BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14809_g2_i1 len=1998 path=[5898:0-588 2959:589-613 2984:614-1997]

Length=1998
                                                                      Score     E

ref|XP_009761198.1|  PREDICTED: exocyst complex component EXO70A1...    751   0.0      
ref|XP_009804352.1|  PREDICTED: exocyst complex component EXO70A1...    747   0.0      
ref|XP_009780374.1|  PREDICTED: exocyst complex component EXO70A1...    741   0.0      
ref|XP_009599080.1|  PREDICTED: exocyst complex component EXO70A1...    733   0.0      
ref|XP_009602592.1|  PREDICTED: exocyst complex component EXO70A1...    732   0.0      
ref|XP_006345719.1|  PREDICTED: exocyst complex protein EXO70-like      718   0.0      
ref|XP_011077417.1|  PREDICTED: exocyst complex component EXO70A1...    712   0.0      
ref|XP_004246928.1|  PREDICTED: exocyst complex component EXO70A1...    711   0.0      
ref|XP_009599079.1|  PREDICTED: exocyst complex component EXO70A1...    709   0.0      
ref|XP_009768765.1|  PREDICTED: exocyst complex component EXO70A1...    709   0.0      
ref|XP_006345672.1|  PREDICTED: exocyst complex protein EXO70-like      700   0.0      
ref|XP_006345673.1|  PREDICTED: exocyst complex protein EXO70-like      696   0.0      
ref|XP_004246739.1|  PREDICTED: exocyst complex component EXO70A1       681   0.0      
gb|EYU38484.1|  hypothetical protein MIMGU_mgv1a022387mg                679   0.0      
ref|XP_011094794.1|  PREDICTED: exocyst complex component EXO70A1...    622   0.0      
gb|KDP35571.1|  hypothetical protein JCGZ_09009                         617   0.0      
emb|CDP06665.1|  unnamed protein product                                616   0.0      
ref|XP_007027133.1|  Exocyst subunit exo70 family protein H4            618   0.0      
emb|CAN80963.1|  hypothetical protein VITISV_005607                     612   0.0      Vitis vinifera
ref|XP_002274342.2|  PREDICTED: exocyst complex component EXO70B1...    615   0.0      Vitis vinifera
ref|XP_011019259.1|  PREDICTED: exocyst complex component EXO70A1...    612   0.0      
emb|CBI32662.3|  unnamed protein product                                612   0.0      
ref|XP_008369835.1|  PREDICTED: exocyst complex component EXO70A1...    606   0.0      
ref|XP_002308485.2|  exocyst subunit EXO70 family protein               603   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009377118.1|  PREDICTED: exocyst complex component EXO70A1...    599   0.0      
ref|XP_007208042.1|  hypothetical protein PRUPE_ppa002738mg             597   0.0      
ref|XP_010558310.1|  PREDICTED: exocyst complex component EXO70A1...    596   0.0      
ref|XP_008241669.1|  PREDICTED: exocyst complex component EXO70A1...    593   0.0      
ref|XP_006480724.1|  PREDICTED: exocyst complex component EXO70A1...    584   0.0      
ref|XP_006428994.1|  hypothetical protein CICLE_v10011115mg             588   0.0      
gb|KDO49819.1|  hypothetical protein CISIN_1g044027mg                   581   0.0      
ref|XP_009341664.1|  PREDICTED: exocyst complex component EXO70A1...    580   0.0      
ref|XP_008387721.1|  PREDICTED: exocyst complex component EXO70B1...    578   0.0      
ref|XP_010253358.1|  PREDICTED: exocyst complex component EXO70B1...    575   0.0      
ref|XP_009368630.1|  PREDICTED: exocyst complex component EXO70B1...    576   0.0      
ref|XP_010473847.1|  PREDICTED: exocyst complex component EXO70B1...    573   0.0      
ref|XP_010260020.1|  PREDICTED: exocyst complex component EXO70B1...    568   0.0      
ref|XP_010486524.1|  PREDICTED: exocyst complex component EXO70B1...    567   0.0      
ref|XP_010464598.1|  PREDICTED: exocyst complex component EXO70B1...    566   0.0      
ref|XP_009123322.1|  PREDICTED: exocyst complex component EXO70B1...    562   0.0      
ref|XP_007208031.1|  hypothetical protein PRUPE_ppa002946mg             557   0.0      
gb|ABE65930.1|  exocyst subunit EXO70 family protein                    553   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_187563.1|  exocyst subunit exo70 family protein H4               553   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882622.1|  ATEXO70H4                                          553   0.0      
ref|XP_006297189.1|  hypothetical protein CARUB_v10013194mg             552   0.0      
ref|XP_006407669.1|  hypothetical protein EUTSA_v10020295mg             551   0.0      
ref|XP_002281519.2|  PREDICTED: exocyst complex component EXO70A1...    551   0.0      Vitis vinifera
emb|CAN66786.1|  hypothetical protein VITISV_037767                     549   0.0      Vitis vinifera
ref|XP_008442595.1|  PREDICTED: exocyst complex component EXO70B1...    548   0.0      
ref|XP_007016546.1|  Exocyst subunit exo70 family protein H7, put...    547   0.0      
ref|XP_004302800.1|  PREDICTED: uncharacterized protein LOC101312264    544   0.0      
ref|XP_004137948.1|  PREDICTED: uncharacterized protein LOC101208543    545   0.0      
ref|XP_004294620.1|  PREDICTED: uncharacterized protein LOC101308554    543   0.0      
ref|XP_009146924.1|  PREDICTED: exocyst complex component EXO70A1       541   0.0      
ref|XP_004305227.1|  PREDICTED: exocyst complex component 7-like        541   0.0      
ref|XP_002534730.1|  protein binding protein, putative                  540   1e-180   Ricinus communis
ref|XP_008222767.1|  PREDICTED: LOW QUALITY PROTEIN: exocyst comp...    536   2e-179   
gb|KFK38344.1|  hypothetical protein AALP_AA3G101900                    535   6e-179   
ref|XP_002276070.1|  PREDICTED: exocyst complex component EXO70B1...    535   7e-179   Vitis vinifera
ref|XP_003554337.1|  PREDICTED: exocyst complex component EXO70B1...    534   1e-178   
ref|XP_009354556.1|  PREDICTED: exocyst complex component EXO70B1...    535   2e-178   
ref|XP_008385184.1|  PREDICTED: exocyst complex component EXO70B1...    532   1e-177   
emb|CDY41604.1|  BnaC05g43410D                                          531   1e-177   
emb|CDY41297.1|  BnaA01g32220D                                          528   2e-176   
ref|XP_002531610.1|  protein binding protein, putative                  529   3e-176   Ricinus communis
ref|XP_003521354.1|  PREDICTED: exocyst complex component EXO70A1...    526   2e-175   
emb|CDY44712.1|  BnaA05g28940D                                          525   3e-175   
ref|XP_007162685.1|  hypothetical protein PHAVU_001G171500g             525   5e-175   
ref|XP_009598246.1|  PREDICTED: exocyst complex component EXO70A1...    522   1e-173   
gb|EPS72115.1|  hypothetical protein M569_02643                         519   7e-173   
ref|XP_006488241.1|  PREDICTED: exocyst complex component EXO70B1...    518   9e-172   
ref|XP_006424734.1|  hypothetical protein CICLE_v10027998mg             516   2e-171   
gb|KHN05687.1|  Exocyst complex component 7                             513   3e-170   
ref|XP_003539758.1|  PREDICTED: exocyst complex component EXO70B1...    513   3e-170   
ref|NP_181470.1|  exocyst subunit exo70 family protein H2               511   4e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010543336.1|  PREDICTED: exocyst complex component EXO70A1...    510   4e-169   
ref|XP_010112927.1|  Exocyst complex component 7                        509   6e-169   
ref|XP_003539098.1|  PREDICTED: exocyst complex component EXO70B1...    509   7e-169   
ref|XP_002315254.2|  exocyst subunit EXO70 family protein               508   1e-168   Populus trichocarpa [western balsam poplar]
ref|XP_011014426.1|  PREDICTED: exocyst complex component EXO70B1...    507   5e-168   
ref|XP_011000313.1|  PREDICTED: exocyst complex component EXO70B1...    507   6e-168   
ref|XP_007009575.1|  Exocyst subunit exo70 family protein H2            507   7e-168   
ref|XP_002298379.2|  hypothetical protein POPTR_0001s24130g             504   2e-167   Populus trichocarpa [western balsam poplar]
ref|XP_011027091.1|  PREDICTED: exocyst complex component EXO70A1...    504   6e-167   
ref|XP_009600986.1|  PREDICTED: exocyst complex component EXO70A1...    503   3e-166   
gb|KFK36832.1|  hypothetical protein AALP_AA4G177100                    501   3e-166   
ref|XP_002881652.1|  ATEXO70H2                                          503   5e-166   
gb|KDP44174.1|  hypothetical protein JCGZ_05641                         500   1e-165   
ref|XP_006411164.1|  hypothetical protein EUTSA_v10017849mg             501   5e-165   
ref|XP_008448357.1|  PREDICTED: exocyst complex component EXO70B1...    498   3e-164   
ref|XP_009764850.1|  PREDICTED: exocyst complex component EXO70A1...    498   4e-164   
ref|XP_004251304.1|  PREDICTED: exocyst complex component EXO70A1       497   6e-164   
ref|XP_010096691.1|  Exocyst complex component 7                        498   6e-164   
ref|XP_009798500.1|  PREDICTED: exocyst complex component EXO70A1...    496   9e-164   
ref|XP_010509024.1|  PREDICTED: exocyst complex component EXO70A1...    496   1e-163   
gb|KHN05940.1|  Exocyst complex component 7                             495   2e-163   
ref|XP_003536965.1|  PREDICTED: exocyst complex component EXO70A1...    494   6e-163   
ref|XP_010505607.1|  PREDICTED: exocyst complex component EXO70A1...    494   1e-162   
ref|XP_007132126.1|  hypothetical protein PHAVU_011G068800g             493   1e-162   
gb|KHN02402.1|  Exocyst complex component 7                             489   2e-162   
ref|XP_002312061.2|  exocyst subunit EXO70 family protein               492   5e-162   Populus trichocarpa [western balsam poplar]
ref|XP_010517282.1|  PREDICTED: exocyst complex component EXO70A1...    492   5e-162   
ref|XP_010037882.1|  PREDICTED: exocyst complex component EXO70A1...    491   7e-162   
ref|XP_011020377.1|  PREDICTED: exocyst complex component EXO70A1...    491   8e-162   
ref|XP_009601489.1|  PREDICTED: exocyst complex component EXO70A1...    491   9e-162   
ref|XP_011041957.1|  PREDICTED: exocyst complex component EXO70B1...    490   3e-161   
ref|XP_010554564.1|  PREDICTED: exocyst complex component EXO70B1...    488   4e-160   
ref|XP_002882623.1|  ATEXO70H3                                          487   6e-160   
emb|CDP19956.1|  unnamed protein product                                487   8e-160   
ref|XP_007144485.1|  hypothetical protein PHAVU_007G160000g             489   1e-159   
ref|XP_006436133.1|  hypothetical protein CICLE_v10030942mg             486   1e-159   
ref|XP_006486008.1|  PREDICTED: exocyst complex component EXO70A1...    486   1e-159   
gb|KEH42330.1|  exocyst subunit exo70 family protein                    484   3e-159   
ref|XP_004148221.1|  PREDICTED: uncharacterized protein LOC101212978    485   3e-159   
ref|XP_002313454.2|  hypothetical protein POPTR_0009s03200g             483   5e-159   Populus trichocarpa [western balsam poplar]
ref|XP_008233543.1|  PREDICTED: exocyst complex component EXO70A1       484   1e-158   
ref|XP_004505905.1|  PREDICTED: uncharacterized protein LOC101512865    483   1e-158   
gb|EYU18924.1|  hypothetical protein MIMGU_mgv1a003114mg                482   2e-158   
ref|XP_004149059.1|  PREDICTED: uncharacterized protein LOC101205924    481   5e-158   
ref|XP_008457545.1|  PREDICTED: exocyst complex component EXO70A1...    482   9e-158   
gb|KFK34771.1|  hypothetical protein AALP_AA5G191600                    481   2e-157   
emb|CDY64629.1|  BnaCnng44430D                                          480   3e-157   
emb|CDX74849.1|  BnaA05g05950D                                          479   3e-157   
ref|XP_010043604.1|  PREDICTED: exocyst complex component EXO70A1...    479   5e-157   
ref|XP_009143321.1|  PREDICTED: exocyst complex component EXO70A1...    479   5e-157   
gb|KEH42331.1|  exocyst subunit exo70 family protein                    478   1e-156   
ref|XP_009143322.1|  PREDICTED: exocyst complex component EXO70A1...    479   2e-156   
ref|XP_009761942.1|  PREDICTED: exocyst complex component EXO70A1...    477   3e-156   
ref|XP_009765156.1|  PREDICTED: exocyst complex component EXO70A1...    476   1e-155   
ref|XP_011089411.1|  PREDICTED: exocyst complex component EXO70A1       476   1e-155   
ref|XP_009357646.1|  PREDICTED: exocyst complex component EXO70B1...    475   2e-155   
ref|XP_009335918.1|  PREDICTED: exocyst complex component EXO70B1...    474   5e-155   
gb|KDO67805.1|  hypothetical protein CISIN_1g007630mg                   472   8e-155   
gb|KFK38345.1|  hypothetical protein AALP_AA3G102000                    474   9e-155   
ref|XP_010520296.1|  PREDICTED: exocyst complex component EXO70B1...    474   9e-155   
ref|XP_006403488.1|  hypothetical protein EUTSA_v10010195mg             473   1e-154   
ref|XP_009139196.1|  PREDICTED: exocyst complex component EXO70A1       473   2e-154   
emb|CDY64627.1|  BnaCnng44410D                                          473   2e-154   
ref|XP_009604963.1|  PREDICTED: exocyst complex component EXO70A1...    472   3e-154   
gb|AES88795.2|  exocyst subunit exo70 family protein                    472   3e-154   
emb|CDP08984.1|  unnamed protein product                                473   4e-154   
emb|CDX74850.1|  BnaA05g05960D                                          473   4e-154   
emb|CDX76117.1|  BnaA04g03810D                                          471   6e-154   
ref|XP_010486525.1|  PREDICTED: exocyst complex component EXO70B1...    471   7e-154   
ref|NP_187564.1|  exocyst subunit exo70 family protein H3               471   1e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116217.1|  PREDICTED: exocyst complex component EXO70B1...    470   2e-153   
emb|CDX73400.1|  BnaC08g26030D                                          470   2e-153   
ref|XP_004240606.1|  PREDICTED: exocyst complex component EXO70A1...    469   2e-153   
ref|XP_002878021.1|  hypothetical protein ARALYDRAFT_485937             469   3e-153   
ref|XP_010464599.1|  PREDICTED: exocyst complex component EXO70B1...    469   3e-153   
ref|XP_004307455.1|  PREDICTED: uncharacterized protein LOC101293927    470   3e-153   
ref|XP_006407668.1|  hypothetical protein EUTSA_v10020272mg             469   4e-153   
ref|XP_003606598.1|  Exocyst complex component                          471   1e-152   
ref|XP_010504360.1|  PREDICTED: exocyst complex component EXO70A1...    468   1e-152   
ref|XP_006366926.1|  PREDICTED: uncharacterized protein LOC102580853    466   1e-152   
emb|CDY02916.1|  BnaC04g25700D                                          467   3e-152   
ref|XP_006400924.1|  hypothetical protein EUTSA_v10016083mg             467   3e-152   
emb|CDY40204.1|  BnaA09g34860D                                          466   5e-152   
gb|KDO72993.1|  hypothetical protein CISIN_1g009180mg                   463   6e-152   
emb|CDY44645.1|  BnaC04g06170D                                          466   9e-152   
ref|XP_006350742.1|  PREDICTED: exocyst complex component 7-like        465   1e-151   
emb|CAB75749.1|  putative protein                                       464   2e-151   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27511.1|  hypothetical protein AALP_AA8G392700                    464   2e-151   
gb|KCW49662.1|  hypothetical protein EUGRSUZ_K03176                     465   2e-151   
ref|NP_191075.2|  exocyst subunit exo70 family protein H1               464   3e-151   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516071.1|  PREDICTED: exocyst complex component EXO70B1...    464   5e-151   
ref|XP_006282043.1|  hypothetical protein CARUB_v10028285mg             463   9e-151   
ref|XP_010516072.1|  PREDICTED: exocyst complex component EXO70A1...    462   1e-150   
ref|XP_010427273.1|  PREDICTED: exocyst complex component EXO70A1...    462   2e-150   
ref|XP_006293038.1|  hypothetical protein CARUB_v10019317mg             462   2e-150   
ref|XP_010418420.1|  PREDICTED: exocyst complex component EXO70B1...    463   2e-150   
ref|XP_010068210.1|  PREDICTED: exocyst complex component EXO70A1...    457   2e-150   
ref|XP_004241253.1|  PREDICTED: exocyst complex component EXO70A1...    461   3e-150   
ref|XP_009135050.1|  PREDICTED: exocyst complex component EXO70B1       459   2e-149   
ref|XP_002866344.1|  ATEXO70H7                                          459   2e-149   
ref|XP_010443748.1|  PREDICTED: exocyst complex component EXO70B1...    458   9e-149   
emb|CDY07931.1|  BnaC03g35920D                                          457   2e-148   
ref|XP_008789001.1|  PREDICTED: exocyst complex component EXO70A1...    457   5e-148   
ref|XP_010483617.1|  PREDICTED: exocyst complex component EXO70A1...    456   6e-148   
gb|KDP46114.1|  hypothetical protein JCGZ_06625                         455   7e-148   
ref|XP_006850618.1|  hypothetical protein AMTR_s00034p00164510          455   7e-148   
emb|CDY44646.1|  BnaC04g06160D                                          457   1e-147   
ref|XP_008461614.1|  PREDICTED: LOW QUALITY PROTEIN: exocyst comp...    454   2e-147   
ref|XP_004171016.1|  PREDICTED: uncharacterized LOC101221801            453   3e-147   
ref|XP_004150962.1|  PREDICTED: uncharacterized protein LOC101221801    453   5e-147   
ref|XP_003597314.1|  Exocyst complex component                          449   5e-146   
ref|XP_009120489.1|  PREDICTED: exocyst complex component EXO70A1...    449   2e-145   
gb|AAN31913.1|  unknown protein                                         449   4e-145   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001032105.1|  exocyst subunit exo70 family protein H7            448   4e-145   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200781.1|  exocyst subunit exo70 family protein H7               447   9e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010032272.1|  PREDICTED: exocyst complex component EXO70A1...    446   1e-144   
emb|CDX80235.1|  BnaC09g35070D                                          446   2e-144   
ref|XP_009141801.1|  PREDICTED: LOW QUALITY PROTEIN: exocyst comp...    446   2e-144   
ref|XP_009419954.1|  PREDICTED: exocyst complex component EXO70A1...    446   4e-144   
emb|CDX74848.1|  BnaA05g05940D                                          441   2e-142   
ref|XP_004240195.1|  PREDICTED: exocyst complex component EXO70A1       441   3e-142   
ref|XP_010937728.1|  PREDICTED: exocyst complex component EXO70A1...    441   5e-142   
ref|XP_007163944.1|  hypothetical protein PHAVU_L003900g                436   6e-141   
ref|XP_011090083.1|  PREDICTED: exocyst complex component EXO70A1       437   1e-140   
ref|XP_009131976.1|  PREDICTED: exocyst complex component EXO70A1...    436   2e-140   
ref|XP_006346010.1|  PREDICTED: uncharacterized protein LOC102597723    435   9e-140   
ref|XP_011091478.1|  PREDICTED: exocyst complex component EXO70A1       434   9e-140   
ref|XP_009126671.1|  PREDICTED: exocyst complex component EXO70A1...    434   2e-139   
ref|XP_003547470.1|  PREDICTED: exocyst complex component EXO70B1...    431   1e-138   
gb|EPS71941.1|  hypothetical protein M569_02816                         431   2e-138   
ref|XP_008783606.1|  PREDICTED: exocyst complex component EXO70A1...    431   2e-138   
ref|XP_006378741.1|  hypothetical protein POPTR_0010s21920g             423   8e-138   
gb|AAN31926.1|  unknown protein                                         427   1e-137   Arabidopsis thaliana [mouse-ear cress]
gb|KCW65316.1|  hypothetical protein EUGRSUZ_G02769                     424   3e-136   
ref|XP_010514945.1|  PREDICTED: exocyst complex component EXO70A1...    424   4e-136   
ref|XP_010068853.1|  PREDICTED: exocyst complex component EXO70A1...    425   5e-136   
ref|XP_010521810.1|  PREDICTED: exocyst complex component EXO70A1       423   1e-135   
gb|KDP46117.1|  hypothetical protein JCGZ_06628                         421   6e-134   
ref|XP_010034603.1|  PREDICTED: exocyst complex component EXO70A1...    419   4e-133   
ref|XP_010426049.1|  PREDICTED: exocyst complex component EXO70A1...    415   1e-132   
gb|EYU33194.1|  hypothetical protein MIMGU_mgv1a002824mg                415   5e-132   
ref|XP_010034604.1|  PREDICTED: exocyst complex component EXO70B1...    406   9e-129   
emb|CDX93267.1|  BnaC04g46290D                                          404   4e-128   
ref|XP_004142214.1|  PREDICTED: uncharacterized protein LOC101209042    401   2e-127   
ref|XP_010922437.1|  PREDICTED: exocyst complex component EXO70A1...    401   8e-127   
ref|XP_010521809.1|  PREDICTED: exocyst complex component EXO70A1...    400   1e-126   
gb|KHN33420.1|  hypothetical protein glysoja_005462                     398   3e-126   
ref|XP_009386540.1|  PREDICTED: exocyst complex component EXO70A1...    400   4e-126   
gb|KHN30212.1|  Exocyst complex component 7                             397   1e-125   
ref|XP_010686180.1|  PREDICTED: exocyst complex component EXO70A1...    395   8e-125   
ref|XP_002534263.1|  Exocyst complex component, putative                387   1e-124   Ricinus communis
emb|CDY49576.1|  BnaA10g12720D                                          390   8e-124   
ref|XP_008447429.1|  PREDICTED: exocyst complex component EXO70A1       391   2e-123   
ref|XP_009140928.1|  PREDICTED: exocyst complex component EXO70B1       391   3e-123   
emb|CDX71078.1|  BnaC03g11620D                                          387   2e-122   
ref|XP_009409718.1|  PREDICTED: exocyst complex component EXO70A1...    390   4e-122   
emb|CDY60562.1|  BnaA02g06880D                                          386   4e-122   
emb|CDX88720.1|  BnaA03g09290D                                          386   5e-122   
ref|XP_010510597.1|  PREDICTED: exocyst complex component EXO70A1       387   7e-122   
emb|CDY68540.1|  BnaCnng59460D                                          385   1e-121   
ref|XP_006409897.1|  hypothetical protein EUTSA_v10017620mg             387   1e-121   
ref|XP_003542014.2|  PREDICTED: exocyst complex component EXO70B1...    384   6e-121   
ref|XP_010034605.1|  PREDICTED: exocyst complex component EXO70A1...    386   6e-121   
gb|KCW52736.1|  hypothetical protein EUGRSUZ_J02094                     386   7e-121   
emb|CDX77195.1|  BnaC04g39900D                                          384   9e-121   
ref|XP_006293428.1|  hypothetical protein CARUB_v10025404mg             384   1e-120   
ref|XP_006409898.1|  hypothetical protein EUTSA_v10017781mg             382   3e-120   
emb|CDY31722.1|  BnaA04g16580D                                          382   3e-120   
ref|XP_004495266.1|  PREDICTED: uncharacterized protein LOC101497388    379   4e-120   
gb|KCW52738.1|  hypothetical protein EUGRSUZ_J02096                     383   8e-120   
ref|XP_010034607.1|  PREDICTED: exocyst complex component EXO70A1...    382   1e-119   
ref|XP_002881000.1|  hypothetical protein ARALYDRAFT_344647             379   8e-119   
gb|EPS59557.1|  hypothetical protein M569_15248                         376   1e-117   
gb|AAD24371.1|  unknown protein                                         376   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|NP_683286.2|  exocyst subunit exo70 family protein H6               375   6e-117   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180432.2|  exocyst subunit exo70 family protein H5               374   9e-117   Arabidopsis thaliana [mouse-ear cress]
gb|KCW52737.1|  hypothetical protein EUGRSUZ_J02095                     373   3e-116   
ref|XP_010475543.1|  PREDICTED: exocyst complex component EXO70B1...    372   6e-116   
ref|XP_010487924.1|  PREDICTED: exocyst complex component EXO70B1...    372   8e-116   
ref|XP_002881002.1|  ATEXO70H8                                          369   3e-115   
ref|XP_002862704.1|  ATEXO70H8                                          369   3e-115   
ref|XP_010034606.1|  PREDICTED: exocyst complex component EXO70A1...    367   1e-114   
ref|XP_006279445.1|  hypothetical protein CARUB_v10007909mg             372   2e-114   
ref|XP_003543496.1|  PREDICTED: exocyst complex component EXO70A1...    363   5e-114   
ref|XP_002892415.1|  ATEXO70H6                                          366   2e-113   
emb|CDX95128.1|  BnaC05g05430D                                          364   2e-113   
ref|XP_010457977.1|  PREDICTED: exocyst complex component EXO70B1...    365   5e-113   
ref|XP_006417770.1|  hypothetical protein EUTSA_v10007118mg             363   9e-113   
ref|XP_009407615.1|  PREDICTED: exocyst complex component EXO70A1...    362   1e-111   
ref|XP_009148021.1|  PREDICTED: exocyst complex component EXO70B1       358   6e-111   
ref|XP_010543894.1|  PREDICTED: exocyst complex component EXO70B1...    350   3e-110   
ref|XP_009103703.1|  PREDICTED: exocyst complex component EXO70A1       355   5e-110   
gb|KHN30211.1|  hypothetical protein glysoja_010589                     350   4e-109   
ref|XP_010937792.1|  PREDICTED: exocyst complex component EXO70A1...    350   9e-109   
gb|KDP44175.1|  hypothetical protein JCGZ_05642                         345   2e-108   
ref|XP_006306202.1|  hypothetical protein CARUB_v10011844mg             350   2e-107   
ref|NP_180433.1|  exocyst subunit exo70 family protein H8               346   2e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510595.1|  PREDICTED: exocyst complex component EXO70B1...    340   4e-104   
ref|XP_010418815.1|  PREDICTED: exocyst complex component EXO70B1...    338   2e-102   
ref|XP_010470058.1|  PREDICTED: exocyst complex component EXO70B1...    332   4e-101   
gb|KHN09445.1|  hypothetical protein glysoja_016544                     325   1e-99    
ref|XP_006293375.1|  hypothetical protein CARUB_v10022905mg             328   2e-99    
ref|XP_009416111.1|  PREDICTED: exocyst complex component EXO70A1...    322   2e-96    
gb|KGN50503.1|  hypothetical protein Csa_5G178700                       307   4e-94    
ref|XP_002976483.1|  hypothetical protein SELMODRAFT_232778             315   5e-94    
emb|CDY04577.1|  BnaA07g14030D                                          311   2e-93    
gb|ABK24268.1|  unknown                                                 310   5e-92    
emb|CDY07003.1|  BnaA04g23120D                                          300   4e-91    
gb|AGW45468.1|  hypothetical protein                                    300   8e-91    
ref|XP_009613007.1|  PREDICTED: exocyst complex component EXO70A1...    304   4e-90    
gb|AGV75881.1|  exocyst 70                                              301   3e-89    
ref|XP_009778564.1|  PREDICTED: exocyst complex component EXO70A1...    301   6e-89    
ref|XP_006357409.1|  PREDICTED: exocyst complex component 7-like ...    300   1e-88    
ref|XP_010322822.1|  PREDICTED: exocyst complex component EXO70A1       300   2e-88    
emb|CDX93621.1|  BnaA06g04270D                                          294   4e-88    
ref|XP_001774512.1|  predicted protein                                  299   5e-88    
ref|XP_009788385.1|  PREDICTED: exocyst complex component EXO70A1...    296   3e-87    
gb|KFK32275.1|  hypothetical protein AALP_AA6G221200                    290   4e-87    
ref|XP_010536245.1|  PREDICTED: exocyst complex component EXO70B1...    290   5e-87    
ref|XP_009622141.1|  PREDICTED: exocyst complex component EXO70A1...    295   1e-86    
ref|XP_001764751.1|  predicted protein                                  293   2e-85    
ref|XP_007135417.1|  hypothetical protein PHAVU_010G127600g             291   2e-85    
ref|XP_011079560.1|  PREDICTED: exocyst complex component EXO70A1       291   4e-85    
gb|EYU21299.1|  hypothetical protein MIMGU_mgv1a003166mg                291   4e-85    
ref|XP_010250741.1|  PREDICTED: exocyst complex component EXO70B1       290   3e-84    
ref|XP_008345484.1|  PREDICTED: exocyst complex component EXO70B1...    278   3e-84    
ref|XP_010248978.1|  PREDICTED: exocyst complex component EXO70B1...    286   5e-83    
emb|CAN62485.1|  hypothetical protein VITISV_010813                     286   1e-82    
ref|XP_002279988.1|  PREDICTED: exocyst complex component EXO70B1       285   2e-82    
ref|XP_006369121.1|  exocyst subunit EXO70 family protein               283   5e-82    
ref|XP_002973424.1|  hypothetical protein SELMODRAFT_98911              283   9e-82    
gb|KDO64960.1|  hypothetical protein CISIN_1g036615mg                   280   5e-81    
ref|XP_007024675.1|  Exocyst subunit exo70 family protein D2            280   6e-81    
ref|XP_006465885.1|  PREDICTED: exocyst complex component EXO70A1...    280   8e-81    
ref|XP_006426703.1|  hypothetical protein CICLE_v10025154mg             279   1e-80    
gb|KHG28684.1|  Exocyst complex component 7                             280   2e-80    
gb|KCW68861.1|  hypothetical protein EUGRSUZ_F02455                     279   2e-80    
ref|XP_008380786.1|  PREDICTED: exocyst complex component EXO70A1...    278   2e-80    
gb|KEH18494.1|  exocyst subunit exo70 family protein                    278   4e-80    
ref|XP_007214942.1|  hypothetical protein PRUPE_ppa002868mg             278   4e-80    
ref|XP_004165282.1|  PREDICTED: uncharacterized LOC101209042            275   7e-80    
ref|XP_004510526.1|  PREDICTED: exocyst complex component 7-like        277   7e-80    
emb|CBI16203.3|  unnamed protein product                                274   1e-79    
gb|KHN01430.1|  Exocyst complex component 7                             275   1e-79    
ref|XP_004235556.1|  PREDICTED: exocyst complex component EXO70A1       276   2e-79    
ref|XP_006342931.1|  PREDICTED: exocyst complex component 7-like ...    276   2e-79    
gb|AAY97869.1|  ACI49                                                   262   2e-79    
gb|AAL07238.2|  unknown protein                                         272   3e-79    
ref|XP_008341817.1|  PREDICTED: exocyst complex component EXO70A1...    275   4e-79    
ref|XP_004144432.1|  PREDICTED: exocyst complex component 7-like        275   6e-79    
ref|XP_001783772.1|  predicted protein                                  275   7e-79    
ref|XP_009359437.1|  PREDICTED: exocyst complex component EXO70B1...    275   9e-79    
ref|XP_010261780.1|  PREDICTED: exocyst complex component EXO70A1...    274   1e-78    
ref|XP_006848373.1|  hypothetical protein AMTR_s00013p00198120          275   1e-78    
gb|KHN39610.1|  Exocyst complex component 7                             272   2e-78    
ref|XP_003529840.2|  PREDICTED: exocyst complex component EXO70A1...    275   2e-78    
ref|XP_003548369.2|  PREDICTED: exocyst complex component EXO70A1...    274   2e-78    
ref|XP_010104033.1|  Exocyst complex component 7                        274   3e-78    
ref|XP_010111987.1|  Exocyst complex component 7                        272   5e-78    
ref|XP_008392777.1|  PREDICTED: exocyst complex component EXO70B1...    273   5e-78    
ref|NP_566477.2|  exocyst subunit exo70 family protein D3               272   5e-78    
ref|NP_001147016.1|  protein binding protein                            272   7e-78    
ref|XP_011072658.1|  PREDICTED: exocyst complex component EXO70B1...    269   1e-77    
emb|CDY52262.1|  BnaC05g52060D                                          272   1e-77    
ref|XP_008460316.1|  PREDICTED: exocyst complex component EXO70A1       271   2e-77    
gb|KDP40675.1|  hypothetical protein JCGZ_24674                         271   2e-77    
ref|XP_010501618.1|  PREDICTED: exocyst complex component EXO70A1...    268   3e-77    
ref|XP_011012017.1|  PREDICTED: exocyst complex component EXO70A1...    270   6e-77    
ref|XP_008374246.1|  PREDICTED: exocyst complex component EXO70B1...    270   7e-77    
ref|XP_011036476.1|  PREDICTED: LOW QUALITY PROTEIN: exocyst comp...    269   9e-77    
ref|XP_006297223.1|  hypothetical protein CARUB_v10013231mg             268   1e-76    
ref|XP_008239462.1|  PREDICTED: exocyst complex component EXO70B1       269   1e-76    
ref|XP_002303234.2|  exocyst subunit EXO70 family protein               268   1e-76    
ref|XP_010474002.1|  PREDICTED: exocyst complex component EXO70A1...    262   3e-76    
ref|XP_004297552.1|  PREDICTED: exocyst complex component 7-like        267   6e-76    
ref|XP_010465291.1|  PREDICTED: exocyst complex component EXO70A1...    266   1e-75    
ref|XP_001771767.1|  predicted protein                                  266   2e-75    
emb|CDX97543.1|  BnaA05g25360D                                          265   3e-75    
ref|XP_009350858.1|  PREDICTED: exocyst complex component EXO70A1       265   3e-75    
ref|XP_002532729.1|  protein binding protein, putative                  265   3e-75    
ref|XP_009368523.1|  PREDICTED: exocyst complex component EXO70B1...    265   4e-75    
ref|XP_009146417.1|  PREDICTED: exocyst complex component EXO70A1       265   4e-75    
ref|XP_007209880.1|  hypothetical protein PRUPE_ppa003933mg             261   9e-75    
gb|KDO52657.1|  hypothetical protein CISIN_1g041189mg                   264   1e-74    
ref|XP_006477028.1|  PREDICTED: exocyst complex component EXO70B1...    263   1e-74    
ref|XP_010487196.1|  PREDICTED: exocyst complex component EXO70A1...    263   1e-74    
emb|CBI35844.3|  unnamed protein product                                262   2e-74    
emb|CDO97829.1|  unnamed protein product                                263   2e-74    
ref|XP_010537632.1|  PREDICTED: exocyst complex component EXO70A1       263   2e-74    
ref|XP_006440106.1|  hypothetical protein CICLE_v10019275mg             263   2e-74    
ref|XP_006836607.1|  hypothetical protein AMTR_s00131p00111490          262   3e-74    
gb|KDP30922.1|  hypothetical protein JCGZ_11298                         262   3e-74    
ref|XP_010932390.1|  PREDICTED: exocyst complex component EXO70B1...    262   4e-74    
ref|XP_004305761.1|  PREDICTED: exocyst complex component 7-like        261   7e-74    
ref|XP_008813458.1|  PREDICTED: exocyst complex component EXO70A1...    261   2e-73    
ref|XP_010471274.1|  PREDICTED: exocyst complex component EXO70A1...    259   5e-73    
ref|XP_006300828.1|  hypothetical protein CARUB_v10019917mg             259   5e-73    
ref|NP_177391.1|  exocyst subunit exo70-D1                              258   9e-73    
ref|XP_010260034.1|  PREDICTED: exocyst complex component EXO70B1...    259   1e-72    
ref|XP_009375245.1|  PREDICTED: exocyst complex component EXO70B1...    257   1e-72    
dbj|BAF00941.1|  hypothetical protein                                   258   1e-72    
ref|XP_004142583.1|  PREDICTED: exocyst complex component 7-like        258   1e-72    
ref|XP_008443783.1|  PREDICTED: exocyst complex component EXO70B1...    258   1e-72    
ref|XP_010917447.1|  PREDICTED: exocyst complex component EXO70A1       258   1e-72    
ref|XP_010428131.1|  PREDICTED: exocyst complex component EXO70A1...    258   1e-72    
dbj|BAK06848.1|  predicted protein                                      254   1e-72    
ref|XP_011044156.1|  PREDICTED: exocyst complex component EXO70B1...    258   2e-72    
gb|EMT00306.1|  Exocyst complex component 7                             251   2e-72    
ref|XP_010258046.1|  PREDICTED: exocyst complex component EXO70B1       258   2e-72    
ref|XP_011073077.1|  PREDICTED: exocyst complex component EXO70B1       257   3e-72    
gb|EMS57716.1|  Exocyst complex component 7                             253   4e-72    
ref|XP_010243483.1|  PREDICTED: exocyst complex component EXO70B1       257   4e-72    
ref|XP_002887435.1|  ATEXO70D1                                          256   6e-72    
ref|XP_010415997.1|  PREDICTED: exocyst complex component EXO70A1...    256   8e-72    
ref|XP_010942405.1|  PREDICTED: exocyst complex component EXO70A1...    256   8e-72    
gb|EPS64676.1|  hypothetical protein M569_10108                         253   9e-72    
gb|EYU23126.1|  hypothetical protein MIMGU_mgv1a027034mg                256   1e-71    
gb|EYU45895.1|  hypothetical protein MIMGU_mgv1a003731mg                253   2e-71    
ref|XP_010542385.1|  PREDICTED: exocyst complex component EXO70A1...    255   2e-71    
ref|XP_009417543.1|  PREDICTED: exocyst complex component EXO70A1...    254   2e-71    
ref|XP_006280115.1|  hypothetical protein CARUB_v10026007mg             256   2e-71    
ref|XP_010660602.1|  PREDICTED: exocyst complex component EXO70B1       255   2e-71    
ref|XP_008228355.1|  PREDICTED: exocyst complex component EXO70A1...    253   4e-71    
ref|XP_009126751.1|  PREDICTED: exocyst complex component EXO70B1       253   5e-71    
ref|XP_009419884.1|  PREDICTED: exocyst complex component EXO70A1...    254   5e-71    
emb|CDP09256.1|  unnamed protein product                                253   7e-71    
ref|XP_003564951.1|  PREDICTED: exocyst complex component EXO70B1...    254   7e-71    
ref|XP_008652770.1|  PREDICTED: exocyst complex component EXO70B1...    253   8e-71    
ref|XP_007017005.1|  Exocyst subunit exo70 family protein B1            253   9e-71    
ref|XP_002272867.1|  PREDICTED: exocyst complex component EXO70B1       253   1e-70    
emb|CBI15871.3|  unnamed protein product                                253   1e-70    
emb|CDX71629.1|  BnaC09g26700D                                          253   1e-70    
ref|XP_010520187.1|  PREDICTED: exocyst complex component EXO70B1       253   1e-70    
gb|KDP36125.1|  hypothetical protein JCGZ_08769                         250   1e-70    
ref|XP_002538716.1|  protein binding protein, putative                  243   1e-70    
ref|XP_002318723.1|  hypothetical protein POPTR_0012s09910g             253   2e-70    
ref|XP_002885012.1|  ATEXO70D3                                          251   2e-70    
ref|XP_009608742.1|  PREDICTED: exocyst complex component EXO70B1       252   3e-70    
emb|CDM85758.1|  unnamed protein product                                252   3e-70    
ref|XP_011024027.1|  PREDICTED: exocyst complex component EXO70B1...    252   3e-70    
ref|XP_009132053.1|  PREDICTED: exocyst complex component EXO70B1       251   3e-70    
emb|CDY05812.1|  BnaA10g06080D                                          252   3e-70    
ref|XP_004956927.1|  PREDICTED: exocyst complex protein exo70-like      251   3e-70    
ref|XP_006402114.1|  hypothetical protein EUTSA_v10012863mg             252   5e-70    
ref|XP_009106941.1|  PREDICTED: exocyst complex component EXO70A1       251   6e-70    
ref|XP_004971086.1|  PREDICTED: exocyst complex component 7-like        251   6e-70    
ref|XP_003608835.1|  Exocyst complex component                          252   7e-70    
ref|XP_008790784.1|  PREDICTED: exocyst complex component EXO70A1...    251   7e-70    
ref|XP_009788652.1|  PREDICTED: exocyst complex component EXO70B1       251   7e-70    
ref|XP_008446222.1|  PREDICTED: exocyst complex component EXO70B1       251   7e-70    
ref|XP_009405488.1|  PREDICTED: exocyst complex component EXO70B1...    251   1e-69    
ref|XP_006854674.1|  hypothetical protein AMTR_s00030p00210320          250   1e-69    
ref|XP_010319057.1|  PREDICTED: exocyst complex component EXO70B1       250   1e-69    
gb|KHN34416.1|  Exocyst complex component 7                             244   1e-69    
ref|XP_002322248.1|  hypothetical protein POPTR_0015s10690g             250   2e-69    
emb|CDY60022.1|  BnaAnng16420D                                          249   2e-69    
dbj|BAB09457.1|  unnamed protein product                                249   2e-69    
ref|XP_007037971.1|  Exocyst subunit exo70 family protein F1 isof...    250   2e-69    
gb|KFK27371.1|  hypothetical protein AALP_AA8G374200                    249   3e-69    
ref|XP_010442524.1|  PREDICTED: exocyst complex component EXO70B1...    250   3e-69    
gb|EPS63454.1|  hypothetical protein M569_11330                         249   4e-69    
ref|XP_007037970.1|  Exocyst subunit exo70 family protein F1 isof...    249   4e-69    
ref|XP_010479990.1|  PREDICTED: exocyst complex component EXO70B1...    248   4e-69    
ref|XP_009107437.1|  PREDICTED: exocyst complex component EXO70B1       250   4e-69    
ref|XP_010442071.1|  PREDICTED: exocyst complex component EXO70B1...    249   4e-69    
ref|NP_175811.1|  exocyst subunit exo70 family protein D2               248   4e-69    
ref|XP_004159234.1|  PREDICTED: exocyst complex component 7-like        248   5e-69    
ref|XP_007142095.1|  hypothetical protein PHAVU_008G252200g             248   5e-69    
ref|XP_010536629.1|  PREDICTED: exocyst complex component EXO70B1       249   5e-69    
emb|CDO99931.1|  unnamed protein product                                249   5e-69    
emb|CDX68265.1|  BnaA07g23050D                                          247   6e-69    
emb|CDY50639.1|  BnaC06g24320D                                          247   6e-69    
ref|XP_002891787.1|  ATEXO70D2                                          248   7e-69    
ref|XP_008798863.1|  PREDICTED: exocyst complex component EXO70A1...    248   7e-69    
ref|XP_008799697.1|  PREDICTED: exocyst complex component EXO70A1...    247   1e-68    
ref|XP_003525708.1|  PREDICTED: exocyst complex component EXO70B1...    248   1e-68    
ref|XP_006306998.1|  hypothetical protein CARUB_v10008575mg             247   1e-68    
ref|XP_003544905.1|  PREDICTED: exocyst complex component EXO70B1...    247   1e-68    
ref|XP_009381616.1|  PREDICTED: exocyst complex component EXO70B1...    245   2e-68    
ref|XP_010462309.1|  PREDICTED: exocyst complex component EXO70A1...    246   2e-68    
ref|XP_004152595.1|  PREDICTED: exocyst complex component 7-like        247   2e-68    
ref|XP_002865797.1|  hypothetical protein ARALYDRAFT_495103             248   2e-68    
gb|KDO67047.1|  hypothetical protein CISIN_1g041244mg                   246   2e-68    
gb|AEW69792.1|  Hop-interacting protein THI029                          246   2e-68    
ref|NP_001045227.1|  Os01g0921400                                       244   2e-68    
ref|XP_006351471.1|  PREDICTED: exocyst complex component 7-like        247   3e-68    
gb|KGN64408.1|  hypothetical protein Csa_1G050470                       247   3e-68    
ref|XP_004166665.1|  PREDICTED: exocyst complex component 7-like        247   3e-68    
ref|XP_010908201.1|  PREDICTED: exocyst complex component EXO70A1...    246   3e-68    
ref|XP_002460270.1|  hypothetical protein SORBIDRAFT_02g025750          246   3e-68    
ref|XP_006390653.1|  hypothetical protein EUTSA_v10019854mg             246   3e-68    
gb|KFK41667.1|  hypothetical protein AALP_AA2G157100                    246   4e-68    
ref|NP_001234392.1|  protein of unknown function                        246   4e-68    
ref|XP_010262979.1|  PREDICTED: exocyst complex component EXO70A1...    247   4e-68    
ref|XP_003519272.1|  PREDICTED: exocyst complex component EXO70B1...    246   4e-68    
ref|XP_011076855.1|  PREDICTED: exocyst complex component EXO70A1...    246   5e-68    
ref|XP_010490839.1|  PREDICTED: exocyst complex component EXO70A1...    243   6e-68    
ref|XP_006425174.1|  hypothetical protein CICLE_v10028037mg             245   6e-68    
gb|ACF86891.1|  unknown                                                 239   6e-68    
ref|XP_009783678.1|  PREDICTED: exocyst complex component EXO70B1       245   6e-68    
dbj|BAF00847.1|  hypothetical protein                                   246   7e-68    
gb|EEC72058.1|  hypothetical protein OsI_04970                          243   7e-68    
ref|XP_010685281.1|  PREDICTED: exocyst complex component EXO70A1...    246   7e-68    
ref|NP_199849.2|  exocyst subunit exo70 family protein F1               246   7e-68    
ref|XP_004978733.1|  PREDICTED: exocyst complex component 7-like ...    245   7e-68    
ref|XP_010677884.1|  PREDICTED: exocyst complex component EXO70B1       245   7e-68    
ref|XP_002456856.1|  hypothetical protein SORBIDRAFT_03g044110          245   8e-68    
gb|KFK35661.1|  hypothetical protein AALP_AA4G020800                    244   8e-68    
ref|XP_006828147.1|  hypothetical protein AMTR_s00023p00070760          245   8e-68    
ref|XP_006488599.1|  PREDICTED: exocyst complex component EXO70B1...    244   1e-67    
ref|XP_006392721.1|  hypothetical protein EUTSA_v10011317mg             244   1e-67    
gb|KHN13248.1|  Exocyst complex component 7                             241   1e-67    
ref|XP_007208043.1|  hypothetical protein PRUPE_ppa002780mg             244   1e-67    
ref|XP_006401083.1|  hypothetical protein EUTSA_v10012970mg             244   1e-67    
gb|EYU19838.1|  hypothetical protein MIMGU_mgv1a002571mg                244   1e-67    
gb|KHN14104.1|  Exocyst complex component 7                             239   2e-67    
ref|XP_011011641.1|  PREDICTED: exocyst complex component EXO70A1...    244   2e-67    
ref|XP_010905198.1|  PREDICTED: exocyst complex component EXO70B1...    244   2e-67    
ref|XP_009104855.1|  PREDICTED: exocyst complex component EXO70B1...    243   3e-67    
ref|XP_008230879.1|  PREDICTED: exocyst complex component EXO70B1       244   3e-67    
dbj|BAB86177.1|  putative leucine zipper protein                        243   3e-67    
ref|NP_001145869.1|  uncharacterized protein LOC100279383               243   4e-67    
ref|XP_006282336.1|  hypothetical protein CARUB_v10028631mg             243   4e-67    
ref|XP_007010469.1|  Exocyst subunit exo70 family protein A1            243   4e-67    
ref|XP_010319288.1|  PREDICTED: exocyst complex component EXO70A1...    243   5e-67    



>ref|XP_009761198.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=633

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/621 (63%), Positives = 483/621 (78%), Gaps = 17/621 (3%)
 Frame = -2

Query  1937  MPRKGMRLIG-FSPNYWsssstvraspsagSD------HFYESVMERALEISGPMIMKWN  1779
             MPRKGMR +  FSP + ++ ST + S  +          F E+V++R LE++ PMIMKWN
Sbjct  1     MPRKGMRTLNWFSPKHSTTDSTSQFSSPSRFGFSPSRPSFSEAVIDRTLEMAEPMIMKWN  60

Query  1778  PEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKR  1599
             P+ +  AKVTSLFYE+R EANDF+KCV NLQKAM F + E  RS+ LVRAQ+LM++AMKR
Sbjct  61    PDTTTFAKVTSLFYENRGEANDFIKCVHNLQKAMHFHSTENSRSDNLVRAQSLMQIAMKR  120

Query  1598  LQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSIT  1419
             LQKEF+QIL++NRAHLDPES S  +  +S  S  + F    D D     +        ++
Sbjct  121   LQKEFYQILSINRAHLDPESISTVSSRTSTVSIISDFDVEDDDDRVIGGES-------VS  173

Query  1418  EVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRK  1239
              VED S+ VMAD+RLI ECMIS GY+KEC  +YK IRK IIDE I RLGVEK+S S++ K
Sbjct  174   VVEDFSNIVMADLRLIAECMISSGYAKECLTIYKVIRKSIIDEGIYRLGVEKLSSSQVHK  233

Query  1238  MDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILF  1059
             MDWEV+++RIK+WL+A+++A+KTLFNGER LCD+VFAS  DAIRES F EISK+ AMILF
Sbjct  234   MDWEVVDMRIKDWLNAVDVAMKTLFNGERILCDHVFASD-DAIRESCFTEISKDGAMILF  292

Query  1058  EFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDA  879
              FPEN+AKY+K  PEKVFRLLDMY AIA H PEIE+IFS DS S+IR+QAVTSL KLG+ 
Sbjct  293   SFPENVAKYSKKLPEKVFRLLDMYTAIAEHLPEIEAIFSFDSESAIRSQAVTSLVKLGEC  352

Query  878   IRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKD  699
             IRT + +FET LQK+SSK+TVAGGGIHPLTIDAMNY+  +AD+SNVLSDI +  PP  K 
Sbjct  353   IRTALVEFETALQKESSKTTVAGGGIHPLTIDAMNYIILLADYSNVLSDILAEAPPPAKA  412

Query  698   WLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVV  519
              LP+S+F++ DSD SP PAISLR+AWLILLLLCKLD  A+HYKD+S+AYLFLANNLQYVV
Sbjct  413   SLPESFFSIVDSDASPAPAISLRFAWLILLLLCKLDGKAKHYKDVSLAYLFLANNLQYVV  472

Query  518   VKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHF  339
             +KVR+S L   LGENW+SKQ  K+KQ+A+NYERLGW  VI SLP  P A M+P+++K+ F
Sbjct  473   LKVRSSNLKYLLGENWISKQEGKIKQFASNYERLGWIHVIESLPREPNATMTPQQVKEIF  532

Query  338   KKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFS  159
             KKFN+SF QAHRK S CVV +R LRD LKVS+ARK+L  YRDFY+T+K  M   +ERH S
Sbjct  533   KKFNSSFEQAHRKQSMCVVPNRKLRDYLKVSIARKILPVYRDFYNTNKHMMA--RERHSS  590

Query  158   SIVKFAPEDVGHHLSDLFFEP  96
              +++F+PEDVGH+LSDLFF P
Sbjct  591   HVIRFSPEDVGHYLSDLFFGP  611



>ref|XP_009804352.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=637

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/625 (63%), Positives = 485/625 (78%), Gaps = 21/625 (3%)
 Frame = -2

Query  1937  MPRKGMRLIG-FSPNYWsssstvraspsagSDH----------FYESVMERALEISGPMI  1791
             MPRKGMR +  FSP + ++ ST  ++    S            F E+V++R LE++ PMI
Sbjct  1     MPRKGMRTLNWFSPKHSTTDSTSPSTSQFSSPSRFGFSPSRPSFSEAVIDRTLEMAEPMI  60

Query  1790  MKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEV  1611
             MKW+P+ +  AKVTSLFYE+RREA DF+KCV NLQKAM F + E  RS+KLVRAQ+LM++
Sbjct  61    MKWDPDTTTFAKVTSLFYENRREAKDFIKCVHNLQKAMHFHSTENSRSDKLVRAQSLMQI  120

Query  1610  AMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvag  1431
             AMKRLQKEF+QIL++NRAHLDPES S  +  +S  S+ + F    D D     +      
Sbjct  121   AMKRLQKEFYQILSINRAHLDPESISTVSSRTSTRSSISDFDVEDDDDRVIGGES-----  175

Query  1430  dSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFS  1251
               ++ VED S+ VMAD+RLI ECMIS GY+KEC  +YK IRK IIDE I RLGVEK+S S
Sbjct  176   --VSVVEDFSNIVMADLRLIAECMISSGYAKECLTIYKVIRKSIIDEGIYRLGVEKLSSS  233

Query  1250  KIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAA  1071
             K+ KMDWEV+++RIK+WL+A+++A+KTLFNGER LCD+VFAS  DAIRES F EISK+ A
Sbjct  234   KVHKMDWEVVDMRIKDWLNAVDVAMKTLFNGERILCDHVFASD-DAIRESCFTEISKDGA  292

Query  1070  MILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAK  891
             MILF FPEN+AKY+K  PEKVFRLLDMY AIA H PEIE+IFS DS S+IR+QAVTSL K
Sbjct  293   MILFSFPENVAKYSKKLPEKVFRLLDMYTAIAEHLPEIEAIFSFDSESAIRSQAVTSLVK  352

Query  890   LGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPP  711
             LG+ IRT + +FET LQK+SSK+TVAGGGIHPLTIDAMNY+  +AD+SNVLSDI +  PP
Sbjct  353   LGECIRTALVEFETALQKESSKTTVAGGGIHPLTIDAMNYIILLADYSNVLSDILAEAPP  412

Query  710   IPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNL  531
               K  LP+S+F++ DSD SP PAISLR+AWLILLLLCKLD  A+HYKD+S+AYLFLANNL
Sbjct  413   PAKASLPESFFSIVDSDASPAPAISLRFAWLILLLLCKLDGKAKHYKDVSLAYLFLANNL  472

Query  530   QYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEI  351
             QYVV+KVR+S L   LGENW+SKQ  K+KQ+A+NYERLGW  VI SLP  P A M+P+++
Sbjct  473   QYVVLKVRSSNLKYLLGENWISKQEGKIKQFASNYERLGWIHVIESLPREPNATMTPQQV  532

Query  350   KQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKE  171
             K+ FKKFN+SF QAHRK S CVV +R LRD LKVS+ARK+L  YRDFY+T+K  M   +E
Sbjct  533   KEIFKKFNSSFEQAHRKQSMCVVPNRKLRDYLKVSIARKILPVYRDFYNTNKHMM--ARE  590

Query  170   RHFSSIVKFAPEDVGHHLSDLFFEP  96
             RH S +++F+PEDVGH+LSDLFF P
Sbjct  591   RHSSHVIRFSPEDVGHYLSDLFFGP  615



>ref|XP_009780374.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=633

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/621 (62%), Positives = 482/621 (78%), Gaps = 17/621 (3%)
 Frame = -2

Query  1937  MPRKGMRLIG-FSPNYWsssstvraspsagSD------HFYESVMERALEISGPMIMKWN  1779
             MPRKGMR +  FSP + ++ ST + S  +          F E+V++R L+++ PMIMKW+
Sbjct  1     MPRKGMRTLNWFSPKHSTTDSTSQFSSPSRFGFSPSRPSFSEAVIDRTLDMAEPMIMKWD  60

Query  1778  PEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKR  1599
             P+ +  AKVTSLFYE+RREA DF+KCV NLQKAM F + E  RS+KLVRAQ+LM++AMKR
Sbjct  61    PDTTTFAKVTSLFYENRREAKDFIKCVHNLQKAMHFHSTENSRSDKLVRAQSLMQIAMKR  120

Query  1598  LQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSIT  1419
             LQKEF+QIL++NRAHLDPES S  +   S  S+ + F    D D     +        I+
Sbjct  121   LQKEFYQILSINRAHLDPESISTVSSRISTRSSISDFDVEDDDDRVIGGES-------IS  173

Query  1418  EVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRK  1239
             EVED S  VM+D+RLI ECMIS GY+KEC K+YK IRK I+DE I RLGVEK+S S++ K
Sbjct  174   EVEDFSVVVMSDLRLIAECMISSGYAKECLKIYKVIRKSIVDEGIYRLGVEKLSSSQVHK  233

Query  1238  MDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILF  1059
             MDWEV++L+IK+WL+A+++A+KTLFNGER LCD+VFA   DAIRES F EISK+ AMILF
Sbjct  234   MDWEVVDLKIKDWLNAVDVAMKTLFNGERILCDHVFAFN-DAIRESCFTEISKDGAMILF  292

Query  1058  EFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDA  879
              FPEN+AK +K SPEKVFRLLD Y AIA H PEIE+IFS DS S IR+QA+TSL KLG++
Sbjct  293   SFPENVAKNSKKSPEKVFRLLDKYTAIAEHWPEIEAIFSFDSESIIRSQALTSLVKLGES  352

Query  878   IRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKD  699
             IRT +A+FET LQK+SSK+TVAGGGIHPLTIDAMNY+  +AD+SNVLSDI +  PP  K 
Sbjct  353   IRTALAEFETALQKESSKTTVAGGGIHPLTIDAMNYIILLADYSNVLSDILAEAPPPAKA  412

Query  698   WLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVV  519
              LP+S+F + DSD SP+PAISLR+AWLILLLLCKLD  A+ YKD+S+AYLFLANNLQYVV
Sbjct  413   SLPESFFGIVDSDASPVPAISLRFAWLILLLLCKLDGKAKQYKDVSLAYLFLANNLQYVV  472

Query  518   VKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHF  339
             VKVR+S L   LGENW+SKQ  K+KQ+A+N ERLGWG VI SLP+ P A M+P+++K+ F
Sbjct  473   VKVRSSNLKYLLGENWISKQEGKIKQFASNNERLGWGHVIESLPQEPNATMTPQQVKEIF  532

Query  338   KKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFS  159
             KKFN+ F QAHRK S CVV +  LRDSLKVS+ARK+L  YR+FY+THK  M    ERH S
Sbjct  533   KKFNSFFEQAHRKQSVCVVPNSKLRDSLKVSIARKILPLYREFYNTHKHMMA--IERHSS  590

Query  158   SIVKFAPEDVGHHLSDLFFEP  96
              ++KF+PED+GH+LSDLFF P
Sbjct  591   HVIKFSPEDIGHYLSDLFFGP  611



>ref|XP_009599080.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
tomentosiformis]
Length=637

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/625 (61%), Positives = 483/625 (77%), Gaps = 21/625 (3%)
 Frame = -2

Query  1937  MPRKGMRLIG-FSPNYWsssstvraspsagSDH----------FYESVMERALEISGPMI  1791
             MPRKGMR +  FS  + ++ ST  ++    S            F E+V++R LE++ PMI
Sbjct  1     MPRKGMRTLNWFSTKHSTTDSTSPSTSQFSSPSRFGFSPSRPSFSEAVIDRTLEMAEPMI  60

Query  1790  MKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEV  1611
             MKW+P+ +  AKVTSLFYE+RREA DF+KCV NLQKAM F + E  RS+KLVRAQ+LM++
Sbjct  61    MKWDPDTTTFAKVTSLFYENRREAKDFIKCVHNLQKAMHFHSTENSRSDKLVRAQSLMQI  120

Query  1610  AMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvag  1431
             AMKRLQKEF+QIL++NRAHLDPES S  +  +S  S+ + F    D D     +      
Sbjct  121   AMKRLQKEFYQILSINRAHLDPESISTVSSRTSTVSSISEFDVEDDDDRVIGGES-----  175

Query  1430  dSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFS  1251
               I+EVED S  VM+D+RLI ECMIS GY+KEC K+YK IRK I+DE I RLGVEK+SFS
Sbjct  176   --ISEVEDFSIVVMSDLRLIAECMISSGYAKECLKIYKVIRKSIVDEGIYRLGVEKLSFS  233

Query  1250  KIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAA  1071
             ++RKMDWEV++L+IK+WL+A+++A+KTLFNGER LCD+VF S  DAIRES F EISK+ A
Sbjct  234   QVRKMDWEVVDLKIKDWLNAVDVAMKTLFNGERILCDHVFTSN-DAIRESCFTEISKDGA  292

Query  1070  MILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAK  891
             M LF FPEN+AK +K SPEKVFRLLDMY AIA H PEIE+IFS DS S IR+QA+TSL K
Sbjct  293   MTLFSFPENVAKNSKKSPEKVFRLLDMYTAIAEHWPEIEAIFSFDSESVIRSQALTSLVK  352

Query  890   LGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPP  711
             LG++I T +A+FET LQK+SSK++ AGGGIHPLTIDAMNY+  +AD+SN+LSDI +  PP
Sbjct  353   LGESISTALAEFETALQKESSKTSAAGGGIHPLTIDAMNYIILLADYSNILSDILAEAPP  412

Query  710   IPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNL  531
               K  LP+S+F ++DSDESP PAISLR+AWLIL+LLCKLD  A+HYKD+S+AYLFLANNL
Sbjct  413   PAKGSLPESFFGIADSDESPAPAISLRFAWLILILLCKLDGKAKHYKDVSLAYLFLANNL  472

Query  530   QYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEI  351
             QYVVVKV +S L   LGENW+SKQ  K+KQ+A+NYERLGW  VI SLP+ P A M+P+++
Sbjct  473   QYVVVKVCSSNLKYLLGENWISKQEGKIKQFASNYERLGWSHVIESLPQEPNASMAPQQV  532

Query  350   KQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKE  171
             K+ FKKFN+SF QAHRK S CVV +  L D+LKVS+ARK+L  YR+FY+THKL M   +E
Sbjct  533   KEIFKKFNSSFEQAHRKQSVCVVPNSKLHDNLKVSIARKILPVYREFYNTHKLMMA--RE  590

Query  170   RHFSSIVKFAPEDVGHHLSDLFFEP  96
             RH + +++F  +DVGH+LSDLFF P
Sbjct  591   RHSNHVIRFFYQDVGHYLSDLFFGP  615



>ref|XP_009602592.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
tomentosiformis]
Length=637

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/640 (60%), Positives = 481/640 (75%), Gaps = 51/640 (8%)
 Frame = -2

Query  1937  MPRKGMRLI--------------------------GFSPNYWsssstvraspsagSDHFY  1836
             MPRKGMR +                          GFSP+                  F 
Sbjct  1     MPRKGMRTLNWFSTKHSTTDSTSPSTSQFSSPSRFGFSPS---------------RPSFS  45

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             E+V++R LE++ PMIMKW+P+ +  AKVTSLFYE+RREA DF+KCV NLQKAM F + E 
Sbjct  46    EAVIDRTLEMAEPMIMKWDPDTTTFAKVTSLFYENRREAKDFIKCVHNLQKAMHFHSTEN  105

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
              RS+KLVRAQ+LM++AMKRLQKEF+QIL++NRAHLDPES S  +  +S  S+ + F    
Sbjct  106   SRSDKLVRAQSLMQIAMKRLQKEFYQILSINRAHLDPESISTVSSRTSTVSSISEFDVED  165

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
             D D     +        I+EVED S  VM+D+RLI ECMIS GY+KEC K+YK IRK I+
Sbjct  166   DDDRVIGGES-------ISEVEDFSIVVMSDLRLIAECMISSGYAKECLKIYKVIRKSIV  218

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DE I RLGVEK+SFS++RKMDWEV++L+IK+WL+A+++A+KTLFNGER LCD+VFAS  D
Sbjct  219   DEGIYRLGVEKLSFSQVRKMDWEVVDLKIKDWLNAVDVAMKTLFNGERILCDHVFASN-D  277

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
             AIRES F EISK+ AM LF FPEN+AK +K SPEK+FRLLDMY AIA H P IE+IFS D
Sbjct  278   AIRESCFTEISKDGAMALFSFPENVAKNSKKSPEKMFRLLDMYTAIAEHWPGIEAIFSFD  337

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             S S IR+QA+TSL KLG++I T +A+FET LQK+SSK++ AGGGIHPLTIDAMNY+  +A
Sbjct  338   SESVIRSQALTSLVKLGESISTALAEFETALQKESSKTSAAGGGIHPLTIDAMNYIILLA  397

Query  755   DHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEH  576
             D+SN+LSDI +  PP  K  LP+S+F ++DSDESP PAISLR+AWLIL+LLCKLD  A+H
Sbjct  398   DYSNILSDILAEAPPPAKGSLPESFFGIADSDESPAPAISLRFAWLILILLCKLDGKAKH  457

Query  575   YKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIA  396
             YKD+S+AYLFLANNLQYVVVKV +S L   LGENW+SK   K+KQ+A+NYERLGW  VI 
Sbjct  458   YKDVSLAYLFLANNLQYVVVKVCSSNLKYLLGENWISKLEGKIKQFASNYERLGWSHVIE  517

Query  395   SLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYR  216
             SLP+ P A M+P+++K+ FKKFN+SF QAHRK S CVV +  LRD+LKVS+ARK+L  YR
Sbjct  518   SLPQEPNASMAPQQVKEIFKKFNSSFEQAHRKQSVCVVPNSKLRDNLKVSIARKILPVYR  577

Query  215   DFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFEP  96
             +FY+T+KLT+   +ER+ + +++F+PEDVGH+LSDLFF P
Sbjct  578   EFYNTYKLTI--TRERYSNHVIRFSPEDVGHYLSDLFFGP  615



>ref|XP_006345719.1| PREDICTED: exocyst complex protein EXO70-like [Solanum tuberosum]
Length=635

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/580 (63%), Positives = 456/580 (79%), Gaps = 8/580 (1%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             +SVM R LE++ PMIMKW+P ++  AKVTSLFYESR EAN+F+KCV NLQKAM F +ME 
Sbjct  49    DSVMNRTLEMAEPMIMKWDPNSTNYAKVTSLFYESRGEANEFIKCVYNLQKAMHFHSMEN  108

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
              +S+KLVRAQ+LM+VA+KRLQKEF+QIL+MNRAHLDPES +  +  +S  S+ + F    
Sbjct  109   SKSDKLVRAQSLMQVAVKRLQKEFYQILSMNRAHLDPESITTVSSRTSARSSLSEFEDEE  168

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
             + D              I+EVEDVS+  MAD+RLI ECMIS GY+KEC K+YK IRK II
Sbjct  169   EDDRIVVVAGES-----ISEVEDVSNVAMADLRLIAECMISSGYAKECVKIYKVIRKSII  223

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DEAI RL VEK+S S++ KMDWEVL+L+IK+WL A ++AVK LFNGER LCD+VF S  D
Sbjct  224   DEAIYRLDVEKLSSSQVHKMDWEVLDLKIKDWLRAADVAVKILFNGERILCDHVFLSN-D  282

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
             +IRES F EISK+ +MILF FPE +AK  K SPEKVFRLLDMY AIA H PEIE+IFS D
Sbjct  283   SIRESCFTEISKDGSMILFSFPEIVAKNCKKSPEKVFRLLDMYTAIAEHWPEIEAIFSSD  342

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             S S IR+QA+TS  KLG++IRT +A+FETVLQK+SSK+ +AGGGIH LT+D M+Y+T +A
Sbjct  343   SESVIRSQALTSHDKLGESIRTALAEFETVLQKESSKTPIAGGGIHHLTVDVMDYVTLLA  402

Query  755   DHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEH  576
             D+SNVLSDI + +PP  K  LP+SYF ++D+DESP PAISLR+AWLIL+LLCKLD  A+H
Sbjct  403   DYSNVLSDILAESPPPAKGSLPESYFGIADTDESPAPAISLRFAWLILILLCKLDGKAKH  462

Query  575   YKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIA  396
             YKD S AYLFLANNL+Y++VKVR+S L   LGENW+SK   KVKQ+A+NYERLGW  VI 
Sbjct  463   YKDASFAYLFLANNLRYIIVKVRSSNLKYLLGENWISKHEEKVKQFASNYERLGWSHVIE  522

Query  395   SLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYR  216
             S+P  P A M+P+++K+ FK+FN+SF QAHRKHS CVVSD  LRD LKVS+A K+L  YR
Sbjct  523   SVPREPNASMAPQQVKEIFKRFNSSFEQAHRKHSMCVVSDSYLRDELKVSIAEKILPAYR  582

Query  215   DFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFEP  96
             +FY+ H+ T+   KERH + +V+F+PEDV H LSDLFF P
Sbjct  583   EFYNKHRNTII--KERHSAHVVRFSPEDVAHQLSDLFFGP  620



>ref|XP_011077417.1| PREDICTED: exocyst complex component EXO70A1-like [Sesamum indicum]
Length=638

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/620 (60%), Positives = 482/620 (78%), Gaps = 19/620 (3%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsa--------gSDHFYESVMERALEISGPMIMKW  1782
             MPRKGMR + FSP   SSSS+  +  ++            F +SVM+R LE++ P+I KW
Sbjct  1     MPRKGMRSLCFSPKISSSSSSPPSHFASPSRFAFSPSRPSFSDSVMDRTLELAEPIIKKW  60

Query  1781  NPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMK  1602
             NPE +  A+VTSLFYE+RREA DF+K V NLQKAM FLA E   S+KLVRAQ+LM++AMK
Sbjct  61    NPETTTFARVTSLFYENRREARDFIKTVNNLQKAMHFLATENSSSDKLVRAQSLMQIAMK  120

Query  1601  RLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSI  1422
             RLQKEF+QIL+MNRA LDPES S  +  +S  S+++ +    D     ++         I
Sbjct  121   RLQKEFYQILSMNRALLDPESVSTRSSRTSTGSSTSDYDDDDDDIRVANES--------I  172

Query  1421  TEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIR  1242
             +EVEDVS+  MAD++LI ECMIS GY+KEC K+YK IRK I+DE I +LGVEK + S+I 
Sbjct  173   SEVEDVSTAAMADLKLIAECMISSGYAKECLKIYKIIRKSIVDEGIYKLGVEKFTSSQIH  232

Query  1241  KMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMIL  1062
             KMDWEV ELRIKNWL+A+  AVKTLFNGER LCD VF+S+ D+IRES F EI++E AMIL
Sbjct  233   KMDWEVAELRIKNWLNAVVTAVKTLFNGERILCDYVFSSS-DSIRESCFTEITREGAMIL  291

Query  1061  FEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGD  882
             F FPEN+AK++K SPEKVFR+LDMY  I+N+ PEI+SIFS +S ++I++QA+TSL KLG+
Sbjct  292   FGFPENVAKHSKKSPEKVFRVLDMYAGISNNWPEIDSIFSFESTTNIKSQALTSLIKLGE  351

Query  881   AIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPK  702
              +R+ +  FE+V+ KDSSKS VAG GIH LTIDAMNYL+ ++D+SN+LSDI +++PP  K
Sbjct  352   FVRSALNDFESVILKDSSKSPVAGAGIHYLTIDAMNYLSILSDYSNILSDILADSPPPAK  411

Query  701   DWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYV  522
             + LP+SYF  SDSDESP PAISL+ AWLIL+LLCKLD  A++YKD+S+AYLFLANNLQYV
Sbjct  412   NLLPESYFGFSDSDESPAPAISLKMAWLILVLLCKLDTKAKYYKDVSLAYLFLANNLQYV  471

Query  521   VVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQH  342
             VVKV+TS L   LG+ WL+K  +KVKQ+A+NYERLGWG VI SLP +P A M+P+++K+ 
Sbjct  472   VVKVQTSNLRYLLGDQWLTKHESKVKQFASNYERLGWGHVIDSLPSDPAAAMTPDKVKEI  531

Query  341   FKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHF  162
             FKKFN SF QAH+K + CVV D  LRD +K+S+ARK+LR YR+FY+ H+ TM  E+ER+ 
Sbjct  532   FKKFNTSFDQAHKKQAICVVPDSKLRDHIKISIARKILRLYREFYNAHRQTM--ERERNS  589

Query  161   SSIVKFAPEDVGHHLSDLFF  102
             +S+V++APEDVGHHLSDLFF
Sbjct  590   ASVVRYAPEDVGHHLSDLFF  609



>ref|XP_004246928.1| PREDICTED: exocyst complex component EXO70A1-like [Solanum lycopersicum]
Length=636

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/580 (62%), Positives = 456/580 (79%), Gaps = 8/580 (1%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             +SVM R LE++ PMIMKW+P+ +  AKVTSLFYESR EANDF+K V NLQKAM F +ME 
Sbjct  50    DSVMNRTLEMAEPMIMKWDPDTTNYAKVTSLFYESRGEANDFIKGVFNLQKAMHFHSMEN  109

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
              +S+KLVRAQ+LM++AMKRLQKEF+QIL+MNRAHLDPES +  +  +S  S+ + F    
Sbjct  110   SKSDKLVRAQSLMQIAMKRLQKEFYQILSMNRAHLDPESITTVSSRTSTRSSLSEFEEEE  169

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
             + D              I+EVEDVS+  MAD+RLI ECMIS GY KEC K+YK IRK II
Sbjct  170   EDDRIVAVAGES-----ISEVEDVSNVAMADLRLIAECMISSGYGKECVKIYKVIRKSII  224

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DEAI RLGVEK+S S++ KMDWEVL+L+IK+WL A ++AVK LFNGER LCD+VF S  D
Sbjct  225   DEAIYRLGVEKLSSSQVHKMDWEVLDLKIKDWLRAADVAVKVLFNGERILCDHVFLSN-D  283

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
             +IRES F EISK+ +MILF FPE +AK  K SPEKVFRLLDMY AIA H PEIE+IFS D
Sbjct  284   SIRESCFTEISKDGSMILFSFPEIVAKNCKKSPEKVFRLLDMYTAIAEHWPEIEAIFSSD  343

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             S S IR+QA+TS  KLG++IRT +A+FETVLQK+SSK+ +AGGGIH LT+D M+Y+T +A
Sbjct  344   SESVIRSQALTSHDKLGESIRTALAEFETVLQKESSKTPIAGGGIHHLTVDVMDYVTLLA  403

Query  755   DHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEH  576
             D+SNVL DI + +PP  K  LP+SYF ++D+++SP PAISLR+AWLIL+LLCKLD  A+H
Sbjct  404   DYSNVLPDILAESPPPAKGSLPESYFGIADTNDSPAPAISLRFAWLILILLCKLDGKAKH  463

Query  575   YKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIA  396
             YKD+S+AYLFLANNL+Y++VKVR+S L   +GENW+SK   KVKQ+A+N+ERLGW  VI 
Sbjct  464   YKDVSLAYLFLANNLRYIIVKVRSSNLKYLVGENWISKHDEKVKQFASNHERLGWSHVIE  523

Query  395   SLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYR  216
             SLP  P   M+P+E+K+ FK+FN+SF QAHRK+S C+VSD NLRD LK+S+  KLL  YR
Sbjct  524   SLPREPNTSMTPQEVKEIFKRFNSSFEQAHRKYSMCMVSDSNLRDELKISITEKLLPTYR  583

Query  215   DFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFEP  96
             +FY+ H+ T+   KERH + +V+F+PE+VGH LSDLFF P
Sbjct  584   EFYNKHRNTIV--KERHSAHVVRFSPEEVGHRLSDLFFGP  621



>ref|XP_009599079.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
tomentosiformis]
Length=642

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/581 (63%), Positives = 456/581 (78%), Gaps = 12/581 (2%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             +SVM+R LE++ PMIMKW+P  +  AKVTSLFYE+RREA DF+KCV NLQKAM F + E 
Sbjct  45    DSVMDRTLEMAEPMIMKWDPNTTTFAKVTSLFYENRREAKDFIKCVYNLQKAMHFHSTEN  104

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
              +S+KLVRAQ+LM++A+KRLQKEF+QIL+MN+AHLDPES S  +  +S  S+++ F+   
Sbjct  105   SKSDKLVRAQSLMQIAVKRLQKEFYQILSMNKAHLDPESISTVSSRTSTVSSTSDFNVAE  164

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
             D D     +        I+EVED SS VMAD+RLI ECMIS GY KEC K+YK IRK II
Sbjct  165   DDDRVIGGES-------ISEVEDFSSVVMADLRLIAECMISSGYGKECVKIYKVIRKSII  217

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DEAI RLGVEK+S +++ KMDWEVL+L+IK+WL+A+ IA+KTLFNGER LCD+VFAS  D
Sbjct  218   DEAIYRLGVEKLSSTQVHKMDWEVLDLKIKDWLNAVNIAMKTLFNGERILCDHVFASN-D  276

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKN--SPEKVFRLLDMYNAIANHRPEIESIFS  942
             AIRES F EISK+ AMILF FPEN++K +KN  SPEKVFRLLDMY  I  H PEIE+IFS
Sbjct  277   AIRESCFTEISKDGAMILFSFPENLSKNSKNIKSPEKVFRLLDMYTTIVEHWPEIEAIFS  336

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              DS   IR+QA+TSL KLG++IRT + +FET LQK+SSK+ VAGGG+H LTID MNY+  
Sbjct  337   SDSEYVIRSQALTSLVKLGESIRTALVEFETALQKESSKTPVAGGGVHHLTIDVMNYIIL  396

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             +AD SNVLSDI +  PP  K  LP+SYF +SDS+ESP PAISLR+AWLIL+LLCKLD  A
Sbjct  397   LADFSNVLSDILAEAPPPAKVSLPESYFGISDSNESPAPAISLRFAWLILILLCKLDSKA  456

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
             +HYKD+ +AYLFLANNLQY+VVKVRTS L   LGENW++K   KVKQ+A+NYERLGW  V
Sbjct  457   KHYKDVFLAYLFLANNLQYIVVKVRTSNLKYLLGENWIAKLEEKVKQFASNYERLGWSHV  516

Query  401   IASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRP  222
             I SLP+ P+  M+P ++K  FK+FN+SFA+AHRKHS CVV D  LRD LK+S+ RK+L  
Sbjct  517   IESLPQEPSTAMAPHQVKGIFKRFNSSFAEAHRKHSICVVPDSKLRDDLKISIGRKILPV  576

Query  221   YRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
             YR+FY+ ++  +   KERH + +++FAPEDV H LSDLFFE
Sbjct  577   YREFYNKYRDALV--KERHSAHVIRFAPEDVAHRLSDLFFE  615



>ref|XP_009768765.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=636

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/579 (63%), Positives = 455/579 (79%), Gaps = 10/579 (2%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             +SVM+R LE++ PMIMKW+P  +  AKVTSLFYE+RREA DF+KCV NLQKAM F + E 
Sbjct  44    DSVMDRTLEMAEPMIMKWDPNTTTFAKVTSLFYENRREAKDFIKCVYNLQKAMHFHSTEN  103

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
              +S+KLVRAQ+LM++A+KRLQKEF+QIL+MNRAHLDPES S  +  +S+ S+S+     +
Sbjct  104   SKSDKLVRAQSLMQIAVKRLQKEFYQILSMNRAHLDPESISTVSSRTSIRSSSSDIDDEN  163

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
             D D     +        ++EVED S+ VMAD+RLI ECMIS GY KEC K+YK IRK II
Sbjct  164   DDDRVIAGES-------VSEVEDFSTVVMADLRLIAECMISSGYGKECVKIYKVIRKSII  216

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
              EAI RLGVEK+S S++ KMDWEVL+L+IK+WL+A+ +AVKTLFNGER LCD+VF S  D
Sbjct  217   AEAIYRLGVEKLSSSQVHKMDWEVLDLKIKDWLNAVNVAVKTLFNGERILCDHVFVSD-D  275

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
             +IRES F EISK+ AMILF FPEN+A+ +K SPEKVFRLLDMY AIA H PEIE+IFS D
Sbjct  276   SIRESCFTEISKDGAMILFSFPENVARNSKKSPEKVFRLLDMYTAIAEHWPEIEAIFSFD  335

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             S S +R+QA+TSL KLG++IRT +A+FE  LQK+SSK+ VAGGGIH LTID MNY+  +A
Sbjct  336   SESVVRSQALTSLIKLGESIRTALAEFEIALQKESSKTPVAGGGIHHLTIDVMNYIILLA  395

Query  755   DHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEH  576
             D SNVLSDI +  PP  K  LP+SYF +SDS+ESP PAISLR+ WLIL+LLCKLD  A++
Sbjct  396   DFSNVLSDILAEAPPPAKVPLPESYFGISDSNESPAPAISLRFGWLILVLLCKLDGKAKY  455

Query  575   YKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIA  396
             YKD+ +AYLFLANNLQYVVVKV TS L   LGENW++K   KVKQ+A+NYERLGW  VI 
Sbjct  456   YKDVFLAYLFLANNLQYVVVKVCTSNLKYLLGENWITKHEEKVKQFASNYERLGWSHVIE  515

Query  395   SLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYR  216
             SLP  P+  M+P ++K+ FK+FN+SFA+AHRKHS CVV D  LRD LK+S+ARK+L  YR
Sbjct  516   SLPREPSTSMAPNQVKEIFKRFNSSFAEAHRKHSICVVPDSKLRDDLKISIARKILPVYR  575

Query  215   DFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
             +FY+ ++  +   KERH + +++FAPEDV H LSDLFFE
Sbjct  576   EFYNKYRGAIV--KERHSAHVIRFAPEDVEHQLSDLFFE  612



>ref|XP_006345672.1| PREDICTED: exocyst complex protein EXO70-like [Solanum tuberosum]
Length=643

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/626 (59%), Positives = 480/626 (77%), Gaps = 17/626 (3%)
 Frame = -2

Query  1937  MPRKGMRLIG-FSPNYWsssstvraspsagSD-----------HFYESVMERALEISGPM  1794
             MPRKGM+ +  FSP + S++     S S  S             F E+V++R +E++  M
Sbjct  1     MPRKGMKTLNWFSPKHSSATDMNSPSTSPFSSPSRFAFSPSRPSFSEAVIDRTIEMAEQM  60

Query  1793  IMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLME  1614
             I KW+P+ +  AKVTSLFYE+R+EA DF+K V NL KAM F A E  RS+KLVRAQ+LM+
Sbjct  61    ITKWDPDTTTFAKVTSLFYENRKEAKDFIKYVNNLHKAMHFHASENSRSDKLVRAQSLMQ  120

Query  1613  VAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrva  1434
             +AMKRLQKEF+QIL++NRA LDPES S  +  +S+++ S+      + D  D+   +   
Sbjct  121   IAMKRLQKEFYQILSINRALLDPESISTVSSRTSISTRSSTSEFNIEDDDIDNRVAIAGE  180

Query  1433  gdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSF  1254
                I+EVED+S+ VMAD+RLI ECMIS GY+KEC ++YK IRK IIDE I RLGVEK+S 
Sbjct  181   S--ISEVEDISNVVMADLRLIAECMISSGYTKECLQIYKVIRKSIIDEGIYRLGVEKLSS  238

Query  1253  SKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEA  1074
             S++ KMDWEV++L+IK+WL+A+++A+KTLF+GER LCD+VFAS+ DAIRES F EISK+ 
Sbjct  239   SQVHKMDWEVMDLKIKDWLNAVDVAMKTLFDGERILCDHVFASS-DAIRESCFTEISKDG  297

Query  1073  AMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLA  894
             AMILF FPE +AK +K SPEKVFR+LDMY +I  H  EIE+ FS DS S+IR+QA+TSL 
Sbjct  298   AMILFSFPEIVAKNSKKSPEKVFRMLDMYTSIVEHWTEIETTFSFDSESAIRSQAMTSLV  357

Query  893   KLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTP  714
             KLG++IR  +A+FET LQK+SSK+TVAGGGIHPLTIDAMNY+  +AD+S VLSDI  ++P
Sbjct  358   KLGESIRMALAEFETALQKESSKTTVAGGGIHPLTIDAMNYIILLADYSYVLSDILGDSP  417

Query  713   PIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANN  534
             P  K  LP+SYF ++DSDESP P ISLR+AWLIL+LLCKLD  A+HYKD+S+AYLFLANN
Sbjct  418   PPAKSSLPESYFGMADSDESPAPVISLRFAWLILILLCKLDGKAKHYKDVSLAYLFLANN  477

Query  533   LQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEE  354
             L+Y+VVKVR+S L   LGENW+SKQ  K+K++A+NYE+LGW  VI SLP  P A +SP++
Sbjct  478   LRYIVVKVRSSNLKYLLGENWISKQEGKIKKFASNYEQLGWSHVIQSLPREPNASISPQQ  537

Query  353   IKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEK  174
             +K+ FK+FN+SF QAHRK S  VV +  LRD LKVS+ARK+L  YR+FY+ H+ T+   K
Sbjct  538   VKEIFKRFNSSFEQAHRKQSLYVVPNSKLRDDLKVSIARKILPVYREFYNIHRDTIA--K  595

Query  173   ERHFSSIVKFAPEDVGHHLSDLFFEP  96
             ERH S ++K++PED+ H+LSDLFF P
Sbjct  596   ERHSSHVIKYSPEDLAHYLSDLFFGP  621



>ref|XP_006345673.1| PREDICTED: exocyst complex protein EXO70-like [Solanum tuberosum]
Length=643

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/626 (58%), Positives = 479/626 (77%), Gaps = 17/626 (3%)
 Frame = -2

Query  1937  MPRKGMRLIG-FSPNYWsssstvraspsagSD-----------HFYESVMERALEISGPM  1794
             MPRKGM+ +  FSP + S++     S S  S             F E+V++R +E++  M
Sbjct  1     MPRKGMKTLNWFSPKHSSATDMNSPSTSPFSSPSRFAFSPSRPSFSEAVIDRTIEMAEQM  60

Query  1793  IMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLME  1614
             I KW+P+ +  AKVTS+FYE+R+EA DF+K V NL KAM F A E  RS+KLVRAQ+LM+
Sbjct  61    ITKWDPDTTTFAKVTSVFYENRKEAKDFIKYVNNLHKAMHFHASENSRSDKLVRAQSLMQ  120

Query  1613  VAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrva  1434
             +AMKRLQKEF+QIL++NRA LDPES S  +  +S+++ S+      + D  D+   +   
Sbjct  121   IAMKRLQKEFYQILSINRALLDPESISTVSSRTSISTRSSTSEFNIEDDDIDNRVAIAGE  180

Query  1433  gdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSF  1254
                I+EVED+S+ VMAD+RLI ECMIS GY+KEC ++YK IRK IIDE I RLGVEK+S 
Sbjct  181   S--ISEVEDISNIVMADLRLIAECMISSGYTKECLQIYKVIRKSIIDEGIYRLGVEKLSS  238

Query  1253  SKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEA  1074
             S++ KMDWEV++L+IK+WL+A+ +A+KTLF+GER LCD+VFAS+ DAIRES F EISK+ 
Sbjct  239   SQVHKMDWEVMDLKIKDWLNAVNVAMKTLFDGERILCDHVFASS-DAIRESCFTEISKDG  297

Query  1073  AMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLA  894
             AMILF FPE +AK +K SPEKVFR+LDMY +I  H  EIE+ FS DS S+IR+QA+TSL 
Sbjct  298   AMILFSFPEIVAKNSKKSPEKVFRMLDMYTSIVEHWTEIETTFSFDSESAIRSQAMTSLV  357

Query  893   KLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTP  714
             KLG++IR  +A+F+T LQK+SSK+TVAGGGIHPLTIDAMNY+  +AD+S VLSDI  ++P
Sbjct  358   KLGESIRMALAEFDTALQKESSKTTVAGGGIHPLTIDAMNYIILLADYSYVLSDILGDSP  417

Query  713   PIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANN  534
             P  K  LP+SYF ++DSDESP P ISLR+AWLIL+LLCKLD  A+HYKD+S+AYLFLANN
Sbjct  418   PPAKSSLPESYFGMADSDESPAPVISLRFAWLILILLCKLDGKAKHYKDVSLAYLFLANN  477

Query  533   LQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEE  354
             L+Y+VVKVR+S L   LGENW+SKQ  K+K++A+NYE+LGW  VI SLP  P + +SP++
Sbjct  478   LRYIVVKVRSSNLKYLLGENWISKQEGKIKKFASNYEQLGWSHVIQSLPREPNSSISPQQ  537

Query  353   IKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEK  174
             +K+ FK+FN+SF QAHRK S  VV +  LRD LKVS+ARK+L  YR+FY+ H+ T+   K
Sbjct  538   VKEIFKRFNSSFEQAHRKQSLYVVPNSKLRDDLKVSIARKILPVYREFYNIHRDTIA--K  595

Query  173   ERHFSSIVKFAPEDVGHHLSDLFFEP  96
             ERH S ++K++PED+ H+LSDLFF P
Sbjct  596   ERHSSHVIKYSPEDLAHYLSDLFFGP  621



>ref|XP_004246739.1| PREDICTED: exocyst complex component EXO70A1 [Solanum lycopersicum]
Length=638

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/626 (58%), Positives = 472/626 (75%), Gaps = 22/626 (4%)
 Frame = -2

Query  1937  MPRKGMRLIG-FSPNYWsssstvraspsagSD-----------HFYESVMERALEISGPM  1794
             MPRKGMR +  FSP + S++     S S  S             F E+V++R +E++  M
Sbjct  1     MPRKGMRTLNWFSPKHNSATDVNSPSTSQFSSPSRFAFSPSRPSFSEAVIDRTIEMAEQM  60

Query  1793  IMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLME  1614
             I KW+P+ +  AKVTSLFYE+R+EA DF+K V NL KAM F A E  RS+KLVRAQ+LM+
Sbjct  61    ITKWDPDTTTFAKVTSLFYENRKEAKDFIKYVNNLHKAMHFHASENSRSDKLVRAQSLMQ  120

Query  1613  VAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrva  1434
             +AMKRLQKEF+QIL++NRA LDPES S  +  +S+++ S+      + D D+       +
Sbjct  121   IAMKRLQKEFYQILSINRALLDPESISTVSSRTSISTRSSTSEFNVEDDDDNRVAIAGES  180

Query  1433  gdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSF  1254
                I EVED+S+ VMAD+RLI ECMIS GY+KEC ++YK IRK IIDE I RLGVEK+S 
Sbjct  181   ---INEVEDISNVVMADLRLIAECMISSGYTKECLQIYKVIRKSIIDEGIYRLGVEKLSS  237

Query  1253  SKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEA  1074
             S++ KMDWEV++++IK+WL+A+++ +KTLF+GE+ LCD+VFAS+ DAIRES F EISK+ 
Sbjct  238   SQVHKMDWEVMDMKIKDWLNAVDVVMKTLFDGEKILCDHVFASS-DAIRESCFTEISKDG  296

Query  1073  AMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLA  894
             AMILF FPE +AK +K SPEKVFR+LDMYN+I  H  EIE+ F     S+IR+QA+TSL 
Sbjct  297   AMILFSFPEIVAKNSKKSPEKVFRILDMYNSIVEHWTEIETTFE----SAIRSQAMTSLV  352

Query  893   KLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTP  714
             KLG+ IR  +A+FET LQK+SSK+TVAGGGIH LTID MNY+  +AD+S VLSDI   +P
Sbjct  353   KLGEFIRMALAEFETALQKESSKTTVAGGGIHALTIDTMNYIILLADYSYVLSDILDESP  412

Query  713   PIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANN  534
             P  K  LP+SYF ++DSDESP PAISLR+AWLIL+LLCKLD  A+HYKD+S+AYLFLANN
Sbjct  413   PPAKSSLPESYFGMADSDESPAPAISLRFAWLILILLCKLDGKAKHYKDVSLAYLFLANN  472

Query  533   LQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEE  354
             L+Y+VVKVR+S L   LGENW+SKQ  K+K++A+NYE+LGW  VI SLP  P A M+P++
Sbjct  473   LRYIVVKVRSSNLKYLLGENWISKQEQKIKKFASNYEQLGWSHVIQSLPREPNASMTPQQ  532

Query  353   IKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEK  174
             +K+ FK+FN+SF Q HRK S  VV +  LRD LKVS+ARK+L  YR+FY+ HK T+   K
Sbjct  533   VKEIFKRFNSSFEQVHRKQSLYVVPNSKLRDDLKVSIARKILPVYREFYNIHKNTIA--K  590

Query  173   ERHFSSIVKFAPEDVGHHLSDLFFEP  96
             ER+ S ++K++PED+ H+LSDLFF P
Sbjct  591   ERYSSHVIKYSPEDLAHYLSDLFFGP  616



>gb|EYU38484.1| hypothetical protein MIMGU_mgv1a022387mg [Erythranthe guttata]
Length=635

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/618 (59%), Positives = 466/618 (75%), Gaps = 15/618 (2%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSD----HFYESVMERALEISGPMIMKWNPEA  1770
             MPRKGMR + FSP   SS  +  +    G         +SVM+R LEI+ P+I+KW+PE 
Sbjct  1     MPRKGMRSVCFSPKISSSFFSPPSPLRIGFSPSHPSISDSVMDRTLEIAEPVIVKWDPET  60

Query  1769  SEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQK  1590
             +  A+VTSLFYE+RREA +F+K V NLQKAM F+  E   SEKLVRAQNLM++AMKRLQK
Sbjct  61    TTFARVTSLFYENRREAREFIKTVNNLQKAMHFIVKEDSGSEKLVRAQNLMQIAMKRLQK  120

Query  1589  EFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVE  1410
             EF+QIL+MNRAHLDPES S  +  +S  S+++      D DV    DD       ITEVE
Sbjct  121   EFYQILSMNRAHLDPESVSTRSSRTSTGSSTSYNEDEDDDDVIRAADDS------ITEVE  174

Query  1409  DVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDW  1230
             D S   MAD++LI ECMIS GY+KEC K+YK IRK I+DE I +LGVEK++ S+I KMDW
Sbjct  175   DASLSAMADLKLIAECMISSGYAKECLKIYKIIRKSIVDEGIYKLGVEKLTSSQIHKMDW  234

Query  1229  EVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFP  1050
             E +ELRIKNWL+A+  AVKTLFNGER L D+VFAS+ D+IRES F EI+K+ A +LF FP
Sbjct  235   ESVELRIKNWLNAVRTAVKTLFNGERILSDHVFASS-DSIRESCFAEITKDGATLLFAFP  293

Query  1049  ENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRT  870
             EN+AK++K  PEKVFR+LDMY  I+N+ PEI+SIFS +S   I++QA+TSL KLG+ +R 
Sbjct  294   ENVAKHSKKWPEKVFRVLDMYAGISNYWPEIDSIFSFESTIPIKSQALTSLVKLGEFVRA  353

Query  869   GIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLP  690
              +  FE+ +QKDS+KS VAG G H LTIDAM YLT++AD+S++LSDI +++PP  K  +P
Sbjct  354   ALHDFESAIQKDSTKSPVAGAGNHNLTIDAMEYLTNLADYSSILSDILADSPPETKKLMP  413

Query  689   DSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKV  510
             +SYF  SD++ESP PAISL+ AWLIL+LLCKLD  A++YKD+S+AYLFLANNLQYVVVKV
Sbjct  414   ESYFGFSDTEESPAPAISLKMAWLILVLLCKLDTKAKYYKDVSLAYLFLANNLQYVVVKV  473

Query  509   RTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPE-NPTAPMS-PEEIKQHFK  336
             +TS L   LG+ WL+   +K+KQ+AANYERLGWG VI SL   NPTA  + PE++K+ FK
Sbjct  474   QTSNLRYILGDEWLTNHKSKIKQFAANYERLGWGHVIDSLSSVNPTAEDTPPEKVKETFK  533

Query  335   KFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSS  156
             KFNASF QA++K   CVV D  LRD +KVS+ARK++R YR+FY+ H+  M    ER+ + 
Sbjct  534   KFNASFEQAYKKQGVCVVPDNKLRDYIKVSIARKIIRLYREFYNAHRQKMV--GERNSAV  591

Query  155   IVKFAPEDVGHHLSDLFF  102
             +V++APEDVGHHLSDLFF
Sbjct  592   VVRYAPEDVGHHLSDLFF  609



>ref|XP_011094794.1| PREDICTED: exocyst complex component EXO70A1-like [Sesamum indicum]
Length=604

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/613 (54%), Positives = 431/613 (70%), Gaps = 14/613 (2%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSD-HFYESVMERALEISGPMIMKWNPEASEA  1761
             MPRKG+    FSP   SS+ ++     + S     E+VM+R L      IMKW+P+ +  
Sbjct  1     MPRKGVTSFCFSPKPSSSTHSLPRFAFSPSQPSLSETVMDRTLATVESTIMKWDPQTTTV  60

Query  1760  AKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFF  1581
              ++TSLF+ +RREA DF++ V  LQKAM  L  +   S KL RA++LM++AMKRL+KEF+
Sbjct  61    GRITSLFHHNRREARDFIQAVNRLQKAMHLLLTDNSTSCKLARAKSLMQIAMKRLEKEFY  120

Query  1580  QILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVS  1401
             QIL+MNRA LDPES S  +  +S  S             ++           I+E+ED S
Sbjct  121   QILSMNRAQLDPESVSTRSLRTSSTSDFEEEDDDCVRVGNEM----------ISEIEDAS  170

Query  1400  SFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVL  1221
             +  M D+RLI ECM+S G++KEC +VYK IRK I+DE I RLGVEK + S+I KMDW+ L
Sbjct  171   TLAMEDLRLIAECMVSSGHAKECTQVYKIIRKSIVDEGIYRLGVEKYTSSQIHKMDWQAL  230

Query  1220  ELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENI  1041
             ELRI++W +A+ IAVKTLFNGER LCD+VFAS+ D+ RES F EI+KE AMILF FPEN+
Sbjct  231   ELRIQSWRNAVRIAVKTLFNGERILCDHVFASS-DSNRESCFTEITKEGAMILFGFPENV  289

Query  1040  AKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIA  861
             AK +K S +KVFRLLDMY  I++H  EI+SIFS  S  +I++QA+TSL KLG  ++  + 
Sbjct  290   AKNSKRSADKVFRLLDMYTGISDHWLEIDSIFSFQSTITIKSQALTSLIKLGAFVKAALN  349

Query  860   QFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSY  681
              FE+ + KDS+KS V GGGIH LT + M YL+ +AD+SN+LSDI +++PP  K   P SY
Sbjct  350   DFESAVLKDSTKSPVLGGGIHHLTTEVMTYLSILADYSNILSDILADSPPPAKHSFPYSY  409

Query  680   FAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTS  501
             F   DSDESP P +SL+ AWLIL LLCKLD  A+ Y D+S++YLFLANNLQYVV KVR S
Sbjct  410   FGFPDSDESPAPPVSLKMAWLILALLCKLDAKAKCYNDVSLSYLFLANNLQYVVAKVRAS  469

Query  500   RLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNAS  321
              L   LG+ WL+K  + VKQ+AANYER GWGDVI S+P N TA  +PE+IK+ FKKFN S
Sbjct  470   NLEYLLGDEWLTKHESTVKQFAANYERHGWGDVIDSIPSNLTAADTPEKIKETFKKFNTS  529

Query  320   FAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFA  141
             F QA++K S CVV  R LRD +K S+ARK+   YR+FY +H+L M  ++ R+  S+V+FA
Sbjct  530   FNQAYKKQSLCVVPHRKLRDDIKASIARKIEPLYREFYSSHRLRM--QRARNSVSVVRFA  587

Query  140   PEDVGHHLSDLFF  102
             PEDVGHH+S +FF
Sbjct  588   PEDVGHHISVMFF  600



>gb|KDP35571.1| hypothetical protein JCGZ_09009 [Jatropha curcas]
Length=638

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/621 (54%), Positives = 446/621 (72%), Gaps = 17/621 (3%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPN-----YWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPE  1773
             MPRKGMR + F+P          SS    SPS       ES +E+ +E +  MIMKWNPE
Sbjct  1     MPRKGMRSLCFNPKTPSFALSPLSSLSTTSPSTPGRRISESTIEQIIETASSMIMKWNPE  60

Query  1772  ASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQ  1593
              S  A+VTSLFYE+++EA  F+KCV +LQK+M  L+ E     ++V+AQ+LM++AMKRLQ
Sbjct  61    GSTYARVTSLFYENKKEAMQFLKCVNDLQKSMHLLSSEGSTDGRIVKAQHLMQIAMKRLQ  120

Query  1592  KEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEV  1413
             KEF+QIL+MNRAHLDPES S  +  +S  S+++ +      + D            I+EV
Sbjct  121   KEFYQILSMNRAHLDPESVSVRSSGASTRSSTSDYEDDGSAEDDVRVAGDS-----ISEV  175

Query  1412  EDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMD  1233
             EDVSS  MAD+R I ECMI+ GY+KEC  VYK IRK IIDE I RLGVEK+S S+I KMD
Sbjct  176   EDVSSIAMADLRSIAECMIAAGYAKECVNVYKIIRKSIIDEGIYRLGVEKLSSSQIHKMD  235

Query  1232  WEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEF  1053
             W  L+LRIK+WL A++++++TLF GER LCD+VFA++ D+IRES F EISKE A +LF F
Sbjct  236   WTALDLRIKSWLEAVKVSMRTLFTGERILCDHVFAAS-DSIRESCFTEISKEGASLLFGF  294

Query  1052  PENIAKYAKN---SP-EKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLG  885
             PE +AK  K+   SP EK+FR+LDMY AI+ +  EIESIFS DS S +R+QA+ SL +L 
Sbjct  295   PELVAKRKKSTSSSPSEKMFRVLDMYTAISENWMEIESIFSFDSLSIVRSQALASLVRLS  354

Query  884   DAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIP  705
             +++   ++ FE+ +QKDSSK+ V GGG+HPLTI +MNYL+ + D+S VL+DI S+ PP  
Sbjct  355   ESVLVMLSDFESSIQKDSSKTPVQGGGLHPLTIYSMNYLSLLGDYSYVLTDIISDWPPPA  414

Query  704   KDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQY  525
             K  LP SYF   DSD+SP P IS+R+AWLIL+LLCKLD  A+HYKD+S++YLFLANNLQ+
Sbjct  415   KSSLPKSYFDSPDSDDSPAPPISVRFAWLILVLLCKLDGKAKHYKDVSLSYLFLANNLQH  474

Query  524   VVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQ  345
             ++ KV+TS L   LGE+W++K  AKVKQ+AANYE+L WG V  SL   PTA +SPE+ ++
Sbjct  475   IISKVQTSNLQYLLGEDWIAKHEAKVKQFAANYEKLAWGQVFESLRAKPTADISPEQARE  534

Query  344   HFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERH  165
              FK+FN+SF Q++RK S+C++SD  LRD +K S+A K+   YR+FYD  +  +P    R+
Sbjct  535   SFKRFNSSFEQSYRKQSSCIISDPKLRDEVKGSVAGKISPIYREFYDKQRNAVP--GRRN  592

Query  164   FSSIVKFAPEDVGHHLSDLFF  102
                +V++ PEDV ++LSDLFF
Sbjct  593   LKLLVRYTPEDVENYLSDLFF  613



>emb|CDP06665.1| unnamed protein product [Coffea canephora]
Length=652

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/584 (57%), Positives = 429/584 (73%), Gaps = 18/584 (3%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPE----ASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFL  1668
             ESVM+R LE++GP+I KW+P+    AS    VTSLF ++R EA   +KCV NLQ+AM+ L
Sbjct  33    ESVMDRTLELAGPVIAKWSPDTAPFASARVVVTSLFPDNRGEAKRLIKCVNNLQQAMRLL  92

Query  1667  AMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgf  1488
               E P S KL  AQNLM+ AMK LQ+EF+Q+L+MNRA+LDPES S+ +  +S+ STS   
Sbjct  93    LPENPTSPKLASAQNLMQTAMKTLQREFYQLLSMNRAYLDPESVSSCSTRTSIHSTSDSD  152

Query  1487  sstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIR  1308
             S   D +  D           I +VED SS V AD+RLI ECMIS GY+KEC K+Y  IR
Sbjct  153   SDDDDDEAADS----------IVQVEDASSLVTADLRLIAECMISSGYAKECVKIYNIIR  202

Query  1307  KWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFA  1128
             K IIDE + RLGVEK S S I  MDWEVL+ RIK WL A++++VKTLFNGER L D+VFA
Sbjct  203   KSIIDEGVYRLGVEKFSSSSIHNMDWEVLDDRIKKWLDAVKVSVKTLFNGERILSDHVFA  262

Query  1127  STPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESI  948
             ++ ++IRES F EIS+E AMILF FPE++ + +K SPEK  R+LDMY AIA H P+I+SI
Sbjct  263   AS-ESIRESCFTEISREGAMILFGFPESVVRNSKKSPEKAIRVLDMYTAIATHWPDIKSI  321

Query  947   FSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYL  768
             FS +S+S++R+QA+TSLAK+G  +R+ +A+FE+ + K+ SKSTVAGG +H LTID+MNYL
Sbjct  322   FSSESSSTVRSQAITSLAKMGQYVRSDLAEFESAILKERSKSTVAGGAVHHLTIDSMNYL  381

Query  767   TSIADHSNVLSDIFSNTPPIPKDWLP--DSYFAVSDSDESPLPAISLRYAWlillllckL  594
             + +AD+SN LSDI +++PP P       +SY ++SDS ESP P ISLR+AWLILLLL KL
Sbjct  382   SLLADYSNPLSDILADSPPPPASTTSVLESYSSLSDSGESPAPTISLRFAWLILLLLAKL  441

Query  593   DVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLG  414
             D  A+ YKD S++YLFLANN Q+V+ KVRTS L   LG++WL KQ  KV+Q+AANY+RL 
Sbjct  442   DGKAKLYKDASLSYLFLANNFQHVITKVRTSNLKHLLGDDWLPKQEVKVRQFAANYKRLA  501

Query  413   WGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
             WG VI SLPE P   ++PEE ++ FK+FNASF QA  K SACV+ D  LRD +KV L+R+
Sbjct  502   WGHVIESLPEVPAISLTPEEARERFKRFNASFEQARDKQSACVIPDSKLRDDIKVDLSRR  561

Query  233   LLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             +L  YR+FY+ HK  M    ER   SIV+F+PEDVGH LSDLFF
Sbjct  562   ILPVYREFYNKHKAVMVGS-ERDLGSIVRFSPEDVGHCLSDLFF  604



>ref|XP_007027133.1| Exocyst subunit exo70 family protein H4 [Theobroma cacao]
 gb|EOY07635.1| Exocyst subunit exo70 family protein H4 [Theobroma cacao]
Length=729

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/619 (53%), Positives = 449/619 (73%), Gaps = 15/619 (2%)
 Frame = -2

Query  1937  MPRKGMRLIGFS---PNYWsssstvraspsagSD----HFYESVMERALEISGPMIMKWN  1779
             MPRKGMR + FS   P++  S  ++  S ++ S        ES++E+ ++ +  +IMKW+
Sbjct  97    MPRKGMRSLCFSSRTPSFALSRQSMSPSTTSLSSTPRRRISESMIEQTIDDAATIIMKWD  156

Query  1778  PEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKR  1599
              +AS  AKVTSLFYES++EA  F++ V  LQK M  L  E   SEKLV AQNLM+++MKR
Sbjct  157   ADASAYAKVTSLFYESKKEAMQFIRSVNELQKIMHLLVSEDSGSEKLVLAQNLMQISMKR  216

Query  1598  LQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSIT  1419
             LQKEF+QIL+MNRAHLDPES S  +  +S  S+ + +      + +            I+
Sbjct  217   LQKEFYQILSMNRAHLDPESVSTRSSRTSARSSLSDYDDEGSTEDEIRAAGDS-----IS  271

Query  1418  EVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRK  1239
             EVE+VSS  M+D++ I +CMI+ GY+KEC  +YK IRK IIDE I +LG+EKMS S+I K
Sbjct  272   EVEEVSSMAMSDLKSIADCMIASGYAKECIHIYKIIRKSIIDEGIYKLGIEKMSSSQINK  331

Query  1238  MDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILF  1059
             MDW+VL+L+I+NWL A++++++TLF GER LCD+VFA + D+IRES F EISK+ AM+LF
Sbjct  332   MDWDVLDLKIQNWLEAVKVSIRTLFTGERILCDHVFAMS-DSIRESCFTEISKDGAMLLF  390

Query  1058  EFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDA  879
              FPE  AK  ++  EK+FR+LDMY A++ +  EIE+IFS +S S++R+QA+ SL +L ++
Sbjct  391   GFPELAAKTKRSPQEKMFRVLDMYTAMSENWQEIETIFSFESTSAVRSQALNSLVRLSES  450

Query  878   IRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKD  699
             +R+ +  FE+ +QKDSSK  + GGG+H LTI +MNYLT +AD+SNVL+DI S+ PP  K 
Sbjct  451   VRSLLTDFESTIQKDSSKVMIPGGGLHSLTIYSMNYLTLLADYSNVLTDIISDWPPPAKS  510

Query  698   WLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVV  519
              LP SYF    SD++P+PAIS+  AWLIL+LLCKLD  A+HYKD+S++YLFLANNLQ+V+
Sbjct  511   SLPKSYFDSPYSDDTPVPAISVHIAWLILVLLCKLDGKAKHYKDVSLSYLFLANNLQHVI  570

Query  518   VKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHF  339
              +VRTS L   LGE W++K  AKV+Q+AANYERL WG V ASLPENPT+ MSP E K+ F
Sbjct  571   SRVRTSNLQYLLGEEWITKHEAKVRQFAANYERLAWGHVFASLPENPTSSMSPGEAKECF  630

Query  338   KKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFS  159
             +KFN+SF   + K S+C+V D  LRD +K+S+ARKL+  YR+FYDT K T   E+     
Sbjct  631   RKFNSSFDDVYWKQSSCLVPDSKLRDEIKLSIARKLVPVYREFYDTQKSTFGDERTARL-  689

Query  158   SIVKFAPEDVGHHLSDLFF  102
               V+F+PED+G+HLSDLFF
Sbjct  690   -FVRFSPEDLGNHLSDLFF  707



>emb|CAN80963.1| hypothetical protein VITISV_005607 [Vitis vinifera]
Length=591

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/575 (54%), Positives = 426/575 (74%), Gaps = 8/575 (1%)
 Frame = -2

Query  1826  MERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRS  1647
             M + +E +  MIMKW+ + S  AKVTS+FYES++EA+DF+KCV +LQKAM F+  E   S
Sbjct  1     MAKGVEEAEAMIMKWDADTSAYAKVTSIFYESKKEAHDFIKCVNDLQKAMHFMVSENSSS  60

Query  1646  EKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfd  1467
             E +VRAQ LM++AMKRLQKEF+QIL+ NRA+LDPES S  +   S  S+++ +      +
Sbjct  61    EMVVRAQRLMQIAMKRLQKEFYQILSTNRAYLDPESVSTRSSRLSARSSTSDYDDDVGPE  120

Query  1466  vddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEA  1287
              +            I+EVE VSS  M D+R I ECMIS GY KEC ++YK IRK I+DE 
Sbjct  121   DEIRTAGDS-----ISEVEQVSSNAMDDLRSIAECMISSGYGKECVRIYKIIRKSIVDEG  175

Query  1286  ISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIR  1107
             I RLGVEK+S S+I KMDWE++EL+IKNWL  ++I++ TLF GER LCD+VFA++ D++R
Sbjct  176   IYRLGVEKLSSSQIHKMDWEIVELKIKNWLEGIKISITTLFTGERILCDHVFAAS-DSMR  234

Query  1106  ESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSAS  927
             ES F EISKE A +LFEFP  +   +K SP+  FR LD+Y AI+++ P+IESIFS +S S
Sbjct  235   ESCFAEISKEGATLLFEFPRLLVSKSKRSPDMAFRTLDVYTAISDNWPDIESIFSFESTS  294

Query  926   SIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHS  747
             S+R  A+T+L+KLG+++R  +++FE+V+QKDSSKS VAGGG+HPLT   MNYL+ +AD+S
Sbjct  295   SVRLHALTTLSKLGESVRMMLSEFESVIQKDSSKSPVAGGGLHPLTQYVMNYLSHLADYS  354

Query  746   NVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKD  567
             ++L DI  ++PP  +  LP+ YF  SD+D +P PAIS+R AW+IL LLCKLD  A+ YK+
Sbjct  355   SILGDIIGDSPPPVQSPLPEFYFESSDTDNTPAPAISVRLAWIILFLLCKLDGKAKQYKE  414

Query  566   ISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLP  387
             +S++YLFLANNLQ+VV KVRTS L   LG+ W+S   +K++Q+AANYERLGWG VI+S+P
Sbjct  415   VSLSYLFLANNLQHVVSKVRTSNLRYLLGDEWISMHESKLRQFAANYERLGWGHVISSMP  474

Query  386   ENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFY  207
             ENP A +SPEE K+ F+KFN  F QA+RK S+ +V D  LRD +K S+ARKL   Y++FY
Sbjct  475   ENPKAAISPEEAKETFRKFNLEFEQAYRKQSSYIVPDPKLRDEIKASIARKLDSVYQEFY  534

Query  206   DTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             +TH+ T+     R+   +++FAPEDV + LSDLF+
Sbjct  535   ETHRETLA--TIRNAEMLIRFAPEDVRNCLSDLFY  567



>ref|XP_002274342.2| PREDICTED: exocyst complex component EXO70B1-like [Vitis vinifera]
Length=694

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/619 (53%), Positives = 445/619 (72%), Gaps = 15/619 (2%)
 Frame = -2

Query  1937  MPRKGMRLIGFS-------PNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWN  1779
             MPRKGMR   FS        ++  S S   A+PS       ++ M + +E +  MIMKW+
Sbjct  60    MPRKGMRSFFFSHKADSSSASHCPSPSRSTATPSIPRRSISDAAMAKGVEEAEAMIMKWD  119

Query  1778  PEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKR  1599
              + S  AKVTS+FYES++EA+DF+KCV +LQKAM F+  E   SE +VRAQ LM++AMKR
Sbjct  120   ADTSAYAKVTSIFYESKKEAHDFIKCVNDLQKAMHFMVSENSSSEMVVRAQRLMQIAMKR  179

Query  1598  LQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSIT  1419
             LQKEF+QIL+ NRA+LDPES S  +   S  S+++ +      + +            I+
Sbjct  180   LQKEFYQILSTNRAYLDPESVSTRSSRLSARSSTSDYDDDVGPEDEIRTAGDS-----IS  234

Query  1418  EVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRK  1239
             EVE VSS  M D+R I ECMIS GY KEC ++YK IRK I+DE I RLGVEK+S S+I K
Sbjct  235   EVEQVSSNAMDDLRSIAECMISSGYGKECVRIYKIIRKSIVDEGIYRLGVEKLSSSQIHK  294

Query  1238  MDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILF  1059
             MDWE++EL+IKNWL  ++I++ TLF GER LCD+VFA++ D++RES F EISKE A +LF
Sbjct  295   MDWEIVELKIKNWLEGIKISITTLFTGERILCDHVFAAS-DSMRESCFAEISKEGATLLF  353

Query  1058  EFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDA  879
             EFP  +   +K SP+  FR LD+Y AI+++ P+IESIFS +S SS+R  A+T+L+KLG++
Sbjct  354   EFPRLLVSKSKRSPDMAFRTLDVYTAISDNWPDIESIFSFESTSSVRLHALTTLSKLGES  413

Query  878   IRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKD  699
             +R  +++FE+V+QKDSSKS VAGGG+HPLT   MNYL+ +AD+S++L DI  ++PP  + 
Sbjct  414   VRMMLSEFESVIQKDSSKSPVAGGGLHPLTQYVMNYLSHLADYSSILGDIIGDSPPPVQS  473

Query  698   WLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVV  519
              LP+ YF  SD+D +P PAIS+R AW+IL LLCKLD  A+ YK++S++YLFLANNLQ+VV
Sbjct  474   PLPEFYFESSDTDNTPAPAISVRLAWIILFLLCKLDGKAKQYKEVSLSYLFLANNLQHVV  533

Query  518   VKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHF  339
              KVRTS L   LG+ W+S   +K++Q+AANYERLGWG VI+S+PENP A +SPEE K+ F
Sbjct  534   SKVRTSNLRYLLGDEWISMHESKLRQFAANYERLGWGHVISSMPENPKAAISPEEAKETF  593

Query  338   KKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFS  159
             +KFN  F QA+RK S+ +V D  LRD +K S+ARKL   Y++FY+TH+ T+     R+  
Sbjct  594   RKFNLEFEQAYRKQSSYIVPDPKLRDEIKASIARKLDSVYQEFYETHRETL--ATIRNAE  651

Query  158   SIVKFAPEDVGHHLSDLFF  102
              +++FAPEDV + LSDLF+
Sbjct  652   MLIRFAPEDVRNCLSDLFY  670



>ref|XP_011019259.1| PREDICTED: exocyst complex component EXO70A1-like [Populus euphratica]
Length=630

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/617 (56%), Positives = 440/617 (71%), Gaps = 14/617 (2%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFY----ESVMERALEISGPMIMKWNPEA  1770
             MPRKGMR I FSP   S  S+ R+SPS           E + E+ +E +  +IMKWNPE 
Sbjct  1     MPRKGMRSICFSPKTISFLSSPRSSPSRLPLPPTPLRSEWMAEQIIENASSLIMKWNPET  60

Query  1769  SEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQK  1590
             S  A VTSLFYE+RREA  F+KCV NLQK M  +  E     +LV+AQNLM++AMKRLQK
Sbjct  61    SAYANVTSLFYENRREAMQFIKCVNNLQKVMHSIVSEDSTHHRLVQAQNLMQIAMKRLQK  120

Query  1589  EFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVE  1410
             EF+QIL+MNRAHLDPES S  +  +S +S S      S  D      D       I+EVE
Sbjct  121   EFYQILSMNRAHLDPESMSTRSSRTSRSSISDFEDDISPEDDVRAASDS------ISEVE  174

Query  1409  DVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDW  1230
              VSS  MAD++ I ECM + GY+KEC  VYK +RK IIDE I RLGVE++S S+I KMDW
Sbjct  175   QVSSIAMADLKAIAECMTAAGYAKECVNVYKVVRKSIIDEGIYRLGVERISSSRINKMDW  234

Query  1229  EVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFP  1050
               L++RIKNWL A++IA+KTLF GER LCD+VFA + ++IRES F EISKE A++LF FP
Sbjct  235   VALDMRIKNWLEAIKIAMKTLFFGERFLCDHVFAVS-ESIRESCFSEISKEGAILLFGFP  293

Query  1049  ENIAKYAK-NSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIR  873
             E +AK  K +SP+K+FR+LDMY AI+ +  EIESIFS +S S +RTQA++SL KL ++I 
Sbjct  294   ELVAKSKKPSSPDKMFRVLDMYTAISQNWIEIESIFSFESTSPVRTQALSSLVKLSESIY  353

Query  872   TGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWL  693
             + ++ FE+ +QK SSK+ V GGG+H LT +AMNYL+ +AD+SNVL+DI S+ PP  K  L
Sbjct  354   SMLSHFESSVQKHSSKALVPGGGVHSLTSNAMNYLSLLADYSNVLTDIISDWPPPTKSSL  413

Query  692   PDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVK  513
             P+SYF   DSD+ P  AIS R+AWL+L LLCKLD  A++YKD+S++YLFLANNLQ+VV K
Sbjct  414   PESYFDSPDSDDPPAAAISTRFAWLVLYLLCKLDGKAKYYKDVSLSYLFLANNLQHVVFK  473

Query  512   VRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKK  333
             VRTS L   LGE+W+ K   KV Q+AANYERL WG V ASLPENPTA +SPEE K+ FK+
Sbjct  474   VRTSNLQYLLGEDWIVKHETKVGQFAANYERLAWGKVFASLPENPTAEISPEEAKETFKR  533

Query  332   FNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSI  153
             FN SF +A RK SACVV+D  L+D +K S+ RK+   YR+FY+ H+ ++    +R     
Sbjct  534   FNISFDEACRKQSACVVADPKLQDEIKGSIRRKITPVYREFYEKHRSSVG--GQRGVGVF  591

Query  152   VKFAPEDVGHHLSDLFF  102
             VK+APEDV + LS LFF
Sbjct  592   VKYAPEDVENCLSHLFF  608



>emb|CBI32662.3| unnamed protein product [Vitis vinifera]
Length=687

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/619 (53%), Positives = 441/619 (71%), Gaps = 31/619 (5%)
 Frame = -2

Query  1937  MPRKGMRLIGFS-------PNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWN  1779
             MPRKGMR   FS        ++  S S   A+PS       ++ M + +E +  MIMKW+
Sbjct  77    MPRKGMRSFFFSHKADSSSASHCPSPSRSTATPSIPRRSISDAAMAKGVEEAEAMIMKWD  136

Query  1778  PEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKR  1599
              + S  AKVTS+FYES++EA+DF+KCV +LQKAM F+  E   SE +VRAQ LM++AMKR
Sbjct  137   ADTSAYAKVTSIFYESKKEAHDFIKCVNDLQKAMHFMVSENSSSEMVVRAQRLMQIAMKR  196

Query  1598  LQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSIT  1419
             LQKEF+QIL+ NRA+LDPES S  +   S  S+++ +                       
Sbjct  197   LQKEFYQILSTNRAYLDPESVSTRSSRLSARSSTSDYD---------------------D  235

Query  1418  EVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRK  1239
             +VE VSS  M D+R I ECMIS GY KEC ++YK IRK I+DE I RLGVEK+S S+I K
Sbjct  236   DVEQVSSNAMDDLRSIAECMISSGYGKECVRIYKIIRKSIVDEGIYRLGVEKLSSSQIHK  295

Query  1238  MDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILF  1059
             MDWE++EL+IKNWL  ++I++ TLF GER LCD+VFA++ D++RES F EISKE A +LF
Sbjct  296   MDWEIVELKIKNWLEGIKISITTLFTGERILCDHVFAAS-DSMRESCFAEISKEGATLLF  354

Query  1058  EFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDA  879
             EFP  +   +K SP+  FR LD+Y AI+++ P+IESIFS +S SS+R  A+T+L+KLG++
Sbjct  355   EFPRLLVSKSKRSPDMAFRTLDVYTAISDNWPDIESIFSFESTSSVRLHALTTLSKLGES  414

Query  878   IRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKD  699
             +R  +++FE+V+QKDSSKS VAGGG+HPLT   MNYL+ +AD+S++L DI  ++PP  + 
Sbjct  415   VRMMLSEFESVIQKDSSKSPVAGGGLHPLTQYVMNYLSHLADYSSILGDIIGDSPPPVQS  474

Query  698   WLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVV  519
              LP+ YF  SD+D +P PAIS+R AW+IL LLCKLD  A+ YK++S++YLFLANNLQ+VV
Sbjct  475   PLPEFYFESSDTDNTPAPAISVRLAWIILFLLCKLDGKAKQYKEVSLSYLFLANNLQHVV  534

Query  518   VKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHF  339
              KVRTS L   LG+ W+S   +K++Q+AANYERLGWG VI+S+PENP A +SPEE K+ F
Sbjct  535   SKVRTSNLRYLLGDEWISMHESKLRQFAANYERLGWGHVISSMPENPKAAISPEEAKETF  594

Query  338   KKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFS  159
             +KFN  F QA+RK S+ +V D  LRD +K S+ARKL   Y++FY+TH+ T+     R+  
Sbjct  595   RKFNLEFEQAYRKQSSYIVPDPKLRDEIKASIARKLDSVYQEFYETHRETLA--TIRNAE  652

Query  158   SIVKFAPEDVGHHLSDLFF  102
              +++FAPEDV + LSDLF+
Sbjct  653   MLIRFAPEDVRNCLSDLFY  671



>ref|XP_008369835.1| PREDICTED: exocyst complex component EXO70A1-like [Malus domestica]
Length=650

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/587 (55%), Positives = 427/587 (73%), Gaps = 8/587 (1%)
 Frame = -2

Query  1844  HFYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLA  1665
             +F E++++  +E    +IMKWNP+ S  AKVTSLFYES+ EA  F++CV +LQ  M +L 
Sbjct  52    NFTEAMIQEIIENGAVLIMKWNPDTSTYAKVTSLFYESKNEARQFIRCVTDLQSVMHYLV  111

Query  1664  MEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
               +P SEKLV AQ+LM+VAMKRLQKEF+QIL+MNRAHLDPES S  +RSS  ++ S+   
Sbjct  112   QXEPTSEKLVHAQSLMQVAMKRLQKEFYQILSMNRAHLDPESVSTRSRSSLASTRSSTSD  171

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRK  1305
                D     DDD        I+EVE VS+  M D++LI ECMI+ GY+KEC  +YK IRK
Sbjct  172   YDEDSGAITDDDVKFAGDA-ISEVEHVSAIAMNDLKLIAECMITSGYAKECVHIYKTIRK  230

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              IIDE + +L VE+ S S+I KMD EVL+ RI +WLSA++I++ TLF+GER LCD+VFAS
Sbjct  231   SIIDEGMYKLRVERFSSSQIGKMDREVLDFRITSWLSAVKISISTLFDGERILCDHVFAS  290

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIA--KYAKNSPEK--VFRLLDMYNAIANHRPEI  957
             +  +I ES F  IS EAA +LF FP+ +   K  KNSP    +FRLLDMY AI+   PEI
Sbjct  291   SA-SILESCFTHISSEAANLLFGFPQVLVAVKSKKNSPSSLDIFRLLDMYTAISESWPEI  349

Query  956   ESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAM  777
             ESIF  +S  ++R+QA+ SL KLG+++R+ I+ FE+ +QKDSSKS   GGGIH LT+  M
Sbjct  350   ESIFGFESTXAVRSQALNSLIKLGESVRSLISDFESTVQKDSSKSVPTGGGIHDLTVRGM  409

Query  776   NYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllck  597
             NYL+ + D+SN+L+DI ++ P   K  LP+SYF    SD +P PAIS+R AWL+L+LLCK
Sbjct  410   NYLSLLTDYSNILADIITDWPCPAKSTLPESYFDSPVSDNAPAPAISVRMAWLVLVLLCK  469

Query  596   LDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERL  417
             LD  A+HYKDI+++YLFLANNLQYV+ KVR+S L   LGE+W+SK  AKV+Q+AANYE+L
Sbjct  470   LDDKAKHYKDIALSYLFLANNLQYVISKVRSSNLQYLLGEDWISKHEAKVRQFAANYEKL  529

Query  416   GWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLAR  237
              WG+V++SLPENPTAP+SPEE +  F+ FN +F QA+RK    VV D  LRD +KVS+ +
Sbjct  530   AWGNVLSSLPENPTAPISPEEARLIFRNFNFAFEQAYRKQRMSVVPDPKLRDEIKVSVGQ  589

Query  236   KLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFEP  96
             KL+  YR+FYDTH++T+     R+ +  V+  PED+G+HLSDLFF P
Sbjct  590   KLVPVYREFYDTHRMTV--GGGRNAALYVRITPEDIGNHLSDLFFTP  634



>ref|XP_002308485.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
 gb|EEE92008.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
Length=630

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/617 (56%), Positives = 440/617 (71%), Gaps = 14/617 (2%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFY----ESVMERALEISGPMIMKWNPEA  1770
             MPRKGMR I FSP   S  S+ R+SPS  S        E ++E+ +E +  +IMKWNPE 
Sbjct  1     MPRKGMRSICFSPKTISFLSSPRSSPSRLSLPPTPLRSEWMVEQIIENASSLIMKWNPET  60

Query  1769  SEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQK  1590
             S  A VTSLFYE+RREA  F+KCV +LQK M  +  E     +LV+AQNLM++AMKRLQK
Sbjct  61    SAYANVTSLFYENRREAMQFIKCVNDLQKVMHSIVSEDSTHYRLVQAQNLMQIAMKRLQK  120

Query  1589  EFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVE  1410
             EF+QIL+MNRAHLDPES S  +  +S +S S      S  D      D       I+EVE
Sbjct  121   EFYQILSMNRAHLDPESMSTRSSRTSRSSISDFEDDISPDDDVRAASDS------ISEVE  174

Query  1409  DVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDW  1230
              VSS  MAD++ I ECM + GY+KEC  VYK +RK IIDE I RLGVE++S S+I KMDW
Sbjct  175   QVSSIAMADLKAIAECMSAAGYAKECVNVYKVVRKSIIDEGIYRLGVERISSSRINKMDW  234

Query  1229  EVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFP  1050
             E L++RIKNWL A++IA+KTLF GER LCD+VFA + ++IRES F EISKE A +LF FP
Sbjct  235   EALDMRIKNWLEAIKIAMKTLFFGERFLCDHVFAVS-ESIRESCFSEISKEGATLLFGFP  293

Query  1049  ENIAKYAKNSPEK-VFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIR  873
             E +AK  K S    +FR LDMY AI+ +  EIESIFS +S S +RTQA++SL KL ++I 
Sbjct  294   ELVAKSKKPSSSDKMFRALDMYTAISENWIEIESIFSFESTSPVRTQALSSLVKLSESIY  353

Query  872   TGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWL  693
             + ++ FE+ +QK SSK+ V GGG+H LT +AMNYL+ +AD+SNVL+DI S+ PP  K  L
Sbjct  354   SMLSDFESSVQKHSSKALVPGGGVHSLTSNAMNYLSLLADYSNVLTDIISDWPPPTKPSL  413

Query  692   PDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVK  513
             P+SYF   DSD+ P  AIS R+AWL+L LLCKLD  A++YKD+S++YLFLANNLQ+VV K
Sbjct  414   PESYFDSPDSDDPPAAAISTRFAWLVLYLLCKLDGKAKYYKDVSLSYLFLANNLQHVVFK  473

Query  512   VRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKK  333
             VRTS L   LGE+W+ K  AKV Q+AANYERL WG V ASLPENPTA +SPEE+K+ FK+
Sbjct  474   VRTSNLQYLLGEDWIVKHEAKVGQFAANYERLAWGKVFASLPENPTAEISPEEVKETFKR  533

Query  332   FNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSI  153
             FN SF +A RK SACVV+D  L+D +KVS+ RK+   YR+FY+ H+ ++    +R     
Sbjct  534   FNISFDEACRKQSACVVADPKLQDEIKVSIGRKITPVYREFYEKHRSSVG--GQRRVGVF  591

Query  152   VKFAPEDVGHHLSDLFF  102
             VK+APEDV + LS LFF
Sbjct  592   VKYAPEDVENCLSHLFF  608



>ref|XP_009377118.1| PREDICTED: exocyst complex component EXO70A1-like [Pyrus x bretschneideri]
Length=652

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/589 (55%), Positives = 428/589 (73%), Gaps = 10/589 (2%)
 Frame = -2

Query  1844  HFYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLA  1665
             +F E++++  +E    +IMKWNP+ S  AKVTSLFYES+ EA  F++CV +LQ  M +L 
Sbjct  52    NFTEAMIQEIIENGAVLIMKWNPDTSTYAKVTSLFYESKNEARQFIRCVTDLQSVMHYLV  111

Query  1664  MEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
              E+P SEKLV AQ LM+VAMKRLQKEF+QIL+MNRAHLDPES S  +RSS  ++ S+   
Sbjct  112   QEEPTSEKLVHAQGLMQVAMKRLQKEFYQILSMNRAHLDPESVSTRSRSSLASTRSSTSD  171

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKEC--FKVYKDI  1311
                D     DDD        I+EVE VS+  M D++LI ECMI+ GY+KEC    +YK I
Sbjct  172   YDEDSGATTDDDVKFAGDA-ISEVEHVSAIAMNDLKLIAECMITSGYAKECECVHIYKTI  230

Query  1310  RKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVF  1131
             RK IIDE + +LGVE+ S S+I KMD EVL+ RI +WLSA++I++ TLF+GER LCD+VF
Sbjct  231   RKSIIDEGMYKLGVERFSSSQIGKMDREVLDFRITSWLSAVKISISTLFDGERILCDHVF  290

Query  1130  ASTPDAIRESIFKEISKEAAMILFEFPENIA--KYAKNSPEKV--FRLLDMYNAIANHRP  963
             AS+  +IRES F  IS EAA +LF FP+ +   K  KNSP  +  FRLLDMY AI+   P
Sbjct  291   ASSA-SIRESCFAHISSEAANLLFGFPQVLVAVKSKKNSPSSIDIFRLLDMYTAISQSWP  349

Query  962   EIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTID  783
             EIESIF  +S +++R+QA+ SL KLG+++R+ I+ FE+ +QKDSSKS   GGGIH LT+ 
Sbjct  350   EIESIFGFESTAAVRSQALNSLIKLGESVRSLISDFESTVQKDSSKSVPTGGGIHDLTVR  409

Query  782   AMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillll  603
             AMN+L+ + D+SN+L+DI ++ P   K    +SYF    SD SP PAIS+  AWL+L+LL
Sbjct  410   AMNHLSLLTDYSNILADIITDWPRPAKSTPRESYFDSPFSDNSPAPAISVLMAWLVLVLL  469

Query  602   ckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYE  423
             CKLD  A+HYKDI+++YLFLANNLQYV+ KVRTS L   LGE+W+SK  AKV+Q+AANYE
Sbjct  470   CKLDDKAKHYKDIALSYLFLANNLQYVISKVRTSNLQYLLGEDWISKHEAKVRQFAANYE  529

Query  422   RLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSL  243
             +L WG+V++SLPENPTA +SPEE +  F+ FN +F QA+RK    VV D  LRD +KVS+
Sbjct  530   KLAWGNVLSSLPENPTAQISPEEERLIFRNFNFAFDQAYRKQRMSVVPDPKLRDEIKVSV  589

Query  242   ARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFEP  96
              +KL+  YR+FYDTH++T+     R+ +  V+ APED+G+HLSDLFF P
Sbjct  590   EQKLVPVYREFYDTHRMTV--GGGRNAALYVRIAPEDIGNHLSDLFFTP  636



>ref|XP_007208042.1| hypothetical protein PRUPE_ppa002738mg [Prunus persica]
 gb|EMJ09241.1| hypothetical protein PRUPE_ppa002738mg [Prunus persica]
Length=638

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/625 (53%), Positives = 441/625 (71%), Gaps = 18/625 (3%)
 Frame = -2

Query  1937  MPRKGMRLIGF---SPNYWsssstvraspsag--------SDHFYESVMERALEISGPMI  1791
             MP+KGMR + F   SP++ + SS+     S            +F ++++E  +  +  ++
Sbjct  1     MPKKGMRSLCFHSKSPSFAAYSSSPSRPSSVSFPTPRRVPVTNFTDAMIEDIIGNAAVLV  60

Query  1790  MKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEV  1611
             MKWNPE S  AKVTSLFYES+REA  F++CV  LQKAM FL  E P SEK+V AQ+LME+
Sbjct  61    MKWNPETSTYAKVTSLFYESKREAQQFIRCVTELQKAMHFLVSEDPTSEKIVHAQSLMEI  120

Query  1610  AMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvag  1431
             AMKRLQKEF+QIL+MNRAHLDPES S  +RSS  ++ S+           DDD       
Sbjct  121   AMKRLQKEFYQILSMNRAHLDPESVSTRSRSSVTSARSSTSDYDDGGATTDDDVRFAGES  180

Query  1430  dSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFS  1251
               I+EVE VSS  MAD++ I ECMIS GY+KEC  +YK IRK IIDE + +LGVE++S S
Sbjct  181   --ISEVEQVSSVAMADLKSIAECMISSGYAKECVHIYKIIRKSIIDEGMYKLGVERLSSS  238

Query  1250  KIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAA  1071
             +I KMD EVL+LRI++WL+A+++++ TLF GE+ LCD+VFAS+  +IRES F  IS+EAA
Sbjct  239   QIHKMDKEVLDLRIRSWLNAVKMSISTLFKGEQILCDHVFASSA-SIRESCFTHISREAA  297

Query  1070  MILFEFPENIAKYAKNSPEK--VFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSL  897
              +LF FP+ +   +K S     VFRLLDMY +I+   PEI+SIFS +S +++R+QA+ SL
Sbjct  298   TLLFGFPQVLVAKSKKSSSSLDVFRLLDMYTSISEAWPEIDSIFSFESTAAVRSQALNSL  357

Query  896   AKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNT  717
              KL +++R+ ++ FE+ +QKDSSKS   GGG+H LT+  MNYL+ + D+SNVL DI ++ 
Sbjct  358   IKLSESVRSMLSDFESTIQKDSSKSVAHGGGVHDLTLRVMNYLSLLTDYSNVLVDIVTDW  417

Query  716   PPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLAN  537
             PP  K  LP+SYF    S++   P ISLR AWL+L+LLCKLD  A+HYKD+S++YLFLAN
Sbjct  418   PPPAKSSLPESYFDSPHSEDGQAPVISLRMAWLLLVLLCKLDDKAKHYKDVSLSYLFLAN  477

Query  536   NLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPE  357
             NLQY++ KVRTS L   LGE+W+SK   KV+Q+A NYE L WG V ASLPEN TA +SPE
Sbjct  478   NLQYMISKVRTSNLQYLLGEDWISKHETKVRQFAENYEGLAWGKVFASLPENLTAEISPE  537

Query  356   EIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKE  177
             E +  F+ FN SF +AHRK    VV D  LR+ ++VS+A+KL+  YR+FYD H+LT+   
Sbjct  538   EARLIFRNFNFSFEEAHRKQRTSVVLDGKLREEMQVSIAKKLVSAYREFYDAHRLTVG--  595

Query  176   KERHFSSIVKFAPEDVGHHLSDLFF  102
               R+ +  V+FAPEDV +HLSDLFF
Sbjct  596   GGRNVALYVRFAPEDVENHLSDLFF  620



>ref|XP_010558310.1| PREDICTED: exocyst complex component EXO70A1-like [Tarenaya hassleriana]
Length=632

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/586 (54%), Positives = 431/586 (74%), Gaps = 20/586 (3%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             + ++E A EI    I KWN E+S  A+VTSLFYES+REA +F++ V++LQK M  L  + 
Sbjct  29    DDIIESATEI----IQKWNTESSTFARVTSLFYESKREAMEFIERVKDLQKTMILLVSQD  84

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
               SEKLVRAQNLM++AMKRLQKEF+QIL+MNRAHLDPES S  +  +S  S+++ F    
Sbjct  85    SNSEKLVRAQNLMQIAMKRLQKEFYQILSMNRAHLDPESVSTRSSLTSTRSSTSDFPDDD  144

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
             D     +D         I EVE+VS+  MAD++ I ECMI+ GY+KEC  +YK IRK I+
Sbjct  145   DATTAAEDS--------IIEVEEVSTMAMADLKSIAECMIASGYAKECVSIYKSIRKSIV  196

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DE I RLGVEK S SK++K  WEV EL+IK W+ A+ +++KTLFNGER LCD+VF S+ D
Sbjct  197   DEGIYRLGVEKTSLSKMKKSPWEVAELKIKCWVDAVNVSMKTLFNGERILCDHVFESS-D  255

Query  1115  AIRESIFKEISKEAAMILFEFPENIA-KYAKNSP-EKVFRLLDMYNAIANHRPEIESIFS  942
             ++RES F +IS+  A++LF FPE +A K  KNSP EK+FRLLDMY+AIA++  EIESIFS
Sbjct  256   SLRESCFSDISRAGALLLFGFPETVAVKGKKNSPPEKIFRLLDMYSAIADNWKEIESIFS  315

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              +S S +RTQA+ SL +LGD+IR+ +  FE+ +QKDSSK+ V+GGG+HPLTI  MNYL+ 
Sbjct  316   FESISMVRTQALNSLIRLGDSIRSLLEDFESGIQKDSSKTVVSGGGVHPLTISTMNYLSL  375

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             ++D++ VL+DI   +PP  K  LP+SYF  ++SD+SP   +++R AWLIL+LLCK+D  A
Sbjct  376   LSDYNTVLADILIGSPPPEKSLLPESYFDAAESDDSPASQLTVRIAWLILVLLCKVDHKA  435

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
             +HYKD+S+ YLFLANNLQ+ V +VR+S L   LG++W+++  +K +Q+AA+YERL W  V
Sbjct  436   KHYKDLSLQYLFLANNLQHTVSRVRSSNLRHLLGDDWVARHFSKARQFAASYERLAWVPV  495

Query  401   IASLPE-NPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
              +SLPE +  A MSPEE++Q F+ F+ SF  A+RK SAC+V D NLRD LK S+ARKLL 
Sbjct  496   ASSLPEISVAAAMSPEEVQQRFETFSTSFESAYRKQSACIVPDANLRDELKTSIARKLLP  555

Query  224   PYRDFYDTHKLTM----PKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
              YR+FY  H+ T+     + + R+  S+V+F PED+G+ LSDLFFE
Sbjct  556   VYREFYYRHRNTVVLAGGENRTRNTMSVVRFTPEDIGNCLSDLFFE  601



>ref|XP_008241669.1| PREDICTED: exocyst complex component EXO70A1-like [Prunus mume]
Length=642

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/625 (53%), Positives = 440/625 (70%), Gaps = 18/625 (3%)
 Frame = -2

Query  1937  MPRKGMRLIGF---SPNYWsssstvraspsag--------SDHFYESVMERALEISGPMI  1791
             MPRKGMR + F   SP++ + SS+     S            +F ++++E  +  +  ++
Sbjct  1     MPRKGMRSLCFHSKSPSFAAYSSSPSRPSSVSFPTPRRVPVTNFTDAMIEDIIGNAAVLV  60

Query  1790  MKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEV  1611
             MKWNPE S  AKVTSLFYES+ EA  F++CV  LQKAM FL +E P SEK+V AQ+LME+
Sbjct  61    MKWNPETSTYAKVTSLFYESKTEAQQFIRCVTELQKAMHFLVLEDPTSEKIVHAQSLMEI  120

Query  1610  AMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvag  1431
             AMKRLQKEF+QIL+MNRAHLDPES S  +RSS  ++ S+           DDD       
Sbjct  121   AMKRLQKEFYQILSMNRAHLDPESVSTRSRSSVTSTRSSTSDYEDGGATTDDDVRFARES  180

Query  1430  dSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFS  1251
               I+EVE VSS  MAD++ I ECMIS GY+KEC  +YK IRK IIDE + +LGVE++S S
Sbjct  181   --ISEVEHVSSVAMADLKSIAECMISSGYAKECVHIYKIIRKSIIDEGMYKLGVERLSSS  238

Query  1250  KIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAA  1071
             +I KMD EVL+LRI++WL+A+++++ TLFNGER LCD+VFAS+  +IRES F  IS+EAA
Sbjct  239   QIHKMDREVLDLRIRSWLNAVKMSISTLFNGERILCDHVFASSA-SIRESCFTHISREAA  297

Query  1070  MILFEFPENIAKYAKNSPE--KVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSL  897
              +LF FP+ +   +K S     VFRLLDMY +I+   PEI+SIFS +S +++R+QA+ SL
Sbjct  298   TLLFGFPQVLVAKSKKSSSSLDVFRLLDMYTSISERWPEIDSIFSFESTAAVRSQALNSL  357

Query  896   AKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNT  717
              KL +++R+ ++ FE+ +QKDSSKS   GGG+H LT+  MNYL+ + D+SNVL +I S+ 
Sbjct  358   IKLSESVRSMLSDFESTIQKDSSKSVAHGGGVHDLTLRVMNYLSLLTDYSNVLVEIVSDW  417

Query  716   PPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLAN  537
             PP  K  LP+SYF    S++   P ISLR AWL+L+LLCKLD  A+HYKD+S++YLFLAN
Sbjct  418   PPPAKSSLPESYFDGPHSEDGQAPVISLRMAWLLLVLLCKLDDKAKHYKDVSLSYLFLAN  477

Query  536   NLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPE  357
             NLQY++  VRTS L   LGE+W+SK   KV+Q+A NYE L WG V ASLPENPTA +S  
Sbjct  478   NLQYMISNVRTSNLQYLLGEDWISKHERKVRQFAENYEGLAWGKVFASLPENPTAEISTV  537

Query  356   EIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKE  177
             E +  F+ FN SF +AHRK    VV D+ LR+ ++VS+A+KL+  YR+FYD H+LT+   
Sbjct  538   EARLIFRNFNFSFEEAHRKQRTSVVLDQKLREEMQVSIAKKLVSAYREFYDAHRLTVG--  595

Query  176   KERHFSSIVKFAPEDVGHHLSDLFF  102
               R+    V+FAPEDV +HLSDLFF
Sbjct  596   GGRNVELYVRFAPEDVENHLSDLFF  620



>ref|XP_006480724.1| PREDICTED: exocyst complex component EXO70A1-like [Citrus sinensis]
Length=646

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/585 (54%), Positives = 420/585 (72%), Gaps = 11/585 (2%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQP  1653
             S +++ ++ +  MI KW+P +S  A+VTSLFYES+REA  F++CV +LQK M  L  E  
Sbjct  41    SPVDQIIDAASGMITKWDPGSSTFARVTSLFYESKREAMQFLRCVDDLQKTMHLLVSENS  100

Query  1652  RSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsd  1473
              S KL+ AQ LM+VAMKRLQKEF+QIL+MNRAHLDPES S  +  +S  S+ + +     
Sbjct  101   SSAKLIEAQTLMQVAMKRLQKEFYQILSMNRAHLDPESLSTRSSRTSARSSLSDYDDEGS  160

Query  1472  fdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIID  1293
              D DD++         I EVE+ SS  MAD++ I +CMI+ GY+KEC KVYK IRK IID
Sbjct  161   PDQDDNEVRDAGDS--IFEVEEASSTAMADLKSIADCMINAGYTKECIKVYKVIRKSIID  218

Query  1292  EAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA  1113
             E I RLGVE+++ S+I KMDW+V++L+IKNWL A++IA+KTLF GER LCD+VFAS+ ++
Sbjct  219   EGIYRLGVERVTSSQINKMDWQVIDLKIKNWLEAVKIAMKTLFTGERILCDHVFASS-ES  277

Query  1112  IRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDS  933
             IRES F +ISKE A +LF FPE + K  K   EK+FR+LDMY AIA   PEIESIFS +S
Sbjct  278   IRESCFTDISKEGAALLFAFPELVIKVKKAPAEKMFRVLDMYTAIAESWPEIESIFSFES  337

Query  932   ASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIAD  753
              S++R++A+TSL K+G++ R  I  FET +QKDSSK+ V GGG+H LTID MNYLTS+AD
Sbjct  338   TSALRSKALTSLIKIGESARQMILDFETHIQKDSSKTQVPGGGVHHLTIDVMNYLTSLAD  397

Query  752   HSNVLSDIFSNTPPIPKDW--LPDSYFAVSDS---DESPLPAISLRYAWlillllckLDV  588
             +SN+L DI ++  P  K    L  SYF   ++   +ESP PA++L  AWLI+ LLCKLD 
Sbjct  398   YSNILGDILADWAPPAKSTSSLLVSYFESPETTADNESPEPAVTLHVAWLIVSLLCKLDA  457

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              A+HYKD  +AYLFLANNLQ+VV KVRTS L   LGE W++K  AK+KQ+ A+Y R+ WG
Sbjct  458   KAKHYKDAHLAYLFLANNLQHVVAKVRTSNLQFLLGEEWINKNEAKLKQFVASYARVAWG  517

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
              V+ SLPENPTA ++P + K +FK FN+SF   +++ S CVV    LR+ +K ++ARKLL
Sbjct  518   PVLKSLPENPTAVITPGQAKDYFKSFNSSFEHVYKQQSWCVVPYAKLREEIKETIARKLL  577

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFEPS  93
               Y  FY+THK+T+    ER+    V+F PEDV ++LSDLFFE S
Sbjct  578   AAYGRFYETHKVTV---GERNVMLFVRFTPEDVDNYLSDLFFETS  619



>ref|XP_006428994.1| hypothetical protein CICLE_v10011115mg [Citrus clementina]
 gb|ESR42234.1| hypothetical protein CICLE_v10011115mg [Citrus clementina]
Length=778

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/630 (53%), Positives = 438/630 (70%), Gaps = 21/630 (3%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPN--------YWsssstvraspsagSDHFYESV--MERALEISGPMIM  1788
             +P KGMR I FSP         Y + SS  R+ P         SV  +++ ++ +  MI 
Sbjct  128   LPNKGMRSICFSPKTPSFSISRYTTHSSPSRSPPLLTLPRSSISVSPVDQIIDAASGMIT  187

Query  1787  KWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVA  1608
             KW+P +S  A+VTSLFYES+REA  F++CV +LQK M  L  E   S KL+ AQ LM+VA
Sbjct  188   KWDPGSSTFARVTSLFYESKREAMQFLRCVDDLQKTMHLLVSENSSSAKLIEAQTLMQVA  247

Query  1607  MKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagd  1428
             MKRLQKEF+QIL+MNRAHLDPES S  +  +S  S+ + +      D DD++        
Sbjct  248   MKRLQKEFYQILSMNRAHLDPESLSTRSSRTSARSSLSDYDDEGSPDQDDNEVRDAGDS-  306

Query  1427  SITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSK  1248
              I EVE+ SS  MAD++ I +CMI+ GY+KEC KVYK IRK IIDE I RLGVE+++ S+
Sbjct  307   -IFEVEEASSTAMADLKSIADCMINAGYTKECIKVYKVIRKSIIDEGIYRLGVERVTSSQ  365

Query  1247  IRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAM  1068
             I KMDW+V++L+IKNWL A++IA+KTLF GER LCD+VFAS+ ++IRES F +ISKE A 
Sbjct  366   INKMDWQVIDLKIKNWLEAVKIAMKTLFTGERILCDHVFASS-ESIRESCFTDISKEGAA  424

Query  1067  ILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKL  888
             +LF FPE + K  K   EK+FR+LDMY AIA   PEIESIFS +S S++R++A+TSL K+
Sbjct  425   LLFAFPELVIKVKKAPAEKMFRVLDMYTAIAESWPEIESIFSFESTSALRSKALTSLIKI  484

Query  887   GDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPI  708
             G++ R  I  FET +QKDSSK+ V GGG+H LTID MNYLTS+AD+SN+L DI ++  P 
Sbjct  485   GESARQMILDFETHIQKDSSKTQVPGGGVHHLTIDVMNYLTSLADYSNILGDILADWAPP  544

Query  707   PKDW--LPDSYFAVSDS---DESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFL  543
              K    L  SYF   ++   +ESP PA++L  AWLI+ LLCKLD  A+HYKD  +AYLFL
Sbjct  545   AKSTSSLLVSYFESPETTADNESPAPAVTLHVAWLIVSLLCKLDAKAKHYKDAHLAYLFL  604

Query  542   ANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMS  363
             ANNLQ+VV KVRTS L   LGE W++K  AK+KQ+ A+Y R+ WG V+ SLPENPTA ++
Sbjct  605   ANNLQHVVAKVRTSNLQFLLGEEWINKNEAKLKQFVASYARVAWGPVLKSLPENPTAVIT  664

Query  362   PEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMP  183
             P + K +FK FN+SF   +++ S CVV    LR+ +K ++ARKLL  Y  FY+THK+T+ 
Sbjct  665   PGQAKDYFKSFNSSFEHVYKQQSWCVVPYAKLREEIKETIARKLLAAYGRFYETHKVTV-  723

Query  182   KEKERHFSSIVKFAPEDVGHHLSDLFFEPS  93
                ER+    V+F PEDV ++LSDLFFE S
Sbjct  724   --GERNVMLFVRFTPEDVDNYLSDLFFETS  751



>gb|KDO49819.1| hypothetical protein CISIN_1g044027mg [Citrus sinensis]
Length=638

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/585 (54%), Positives = 419/585 (72%), Gaps = 11/585 (2%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQP  1653
             S +++ ++ +  MI KW+P +S  A+VTSLFYES+REA  F++CV +LQK M  L  E  
Sbjct  41    SPVDQIIDAASGMITKWDPGSSTFARVTSLFYESKREAMQFLRCVDDLQKTMHLLVSENS  100

Query  1652  RSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsd  1473
              S KL+ AQ LM+VAMKRLQKEF+QIL+MNRAHLDPES S  +  +S  S+ + +     
Sbjct  101   SSAKLIEAQTLMQVAMKRLQKEFYQILSMNRAHLDPESLSTRSSRTSARSSLSDYDDEGS  160

Query  1472  fdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIID  1293
              D DD++         I EVE+ SS  MAD++ I +CMI+ GY+KEC KVYK IRK IID
Sbjct  161   PDQDDNEVRDAGDS--IFEVEEASSTAMADLKSIADCMINAGYTKECIKVYKVIRKSIID  218

Query  1292  EAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA  1113
             E I RLGVE+++ S+I KMDW+V++L+IKNWL A++IA+KTLF GER LCD+VFAS+ ++
Sbjct  219   EGIYRLGVERVTSSQINKMDWQVIDLKIKNWLEAVKIAMKTLFTGERILCDHVFASS-ES  277

Query  1112  IRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDS  933
             IRES F +ISKE A ILF FPE + K  K   EK+FR+LDMY AIA   P IESIFS +S
Sbjct  278   IRESCFTDISKEGAAILFAFPELVIKVKKAPAEKMFRVLDMYTAIAESWPVIESIFSFES  337

Query  932   ASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIAD  753
              S++R++A+TSL K+G++ R  I  FET +QKDSSK+ V GGG+H LTID MNYLTS+ D
Sbjct  338   TSAVRSKALTSLIKIGESARQMILDFETHIQKDSSKTQVPGGGVHHLTIDVMNYLTSLGD  397

Query  752   HSNVLSDIFSN-TPPIPKDWLP-DSYFAVSDS---DESPLPAISLRYAWlillllckLDV  588
             +SN+L DI ++  PP      P  SYF   ++   ++SP PA++L  AWLI+ LLCKLD 
Sbjct  398   YSNILGDILADWDPPAKSTSSPLVSYFESPETTADNDSPAPAVTLHVAWLIVSLLCKLDA  457

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              A+HYKD  +AYLFLANNLQ+VV KVRTS L   LGE W++K  AK+KQ+ A+Y R+ WG
Sbjct  458   KAKHYKDAHLAYLFLANNLQHVVAKVRTSYLQFLLGEEWINKNEAKLKQFVASYVRVAWG  517

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
              V+ SLPENPTA ++P + K +FK FN++F   +++HS CVV    LR+ +K ++ARKLL
Sbjct  518   PVLKSLPENPTAVITPGQAKDYFKSFNSTFEHVYKQHSRCVVPYAKLREEIKETIARKLL  577

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFEPS  93
               Y  FY+THK+T+    ER+    V+F PEDV ++LSDLFFE S
Sbjct  578   AAYGRFYETHKVTV---GERNVMLFVRFTPEDVDNYLSDLFFERS  619



>ref|XP_009341664.1| PREDICTED: exocyst complex component EXO70A1-like [Pyrus x bretschneideri]
Length=640

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/587 (53%), Positives = 430/587 (73%), Gaps = 7/587 (1%)
 Frame = -2

Query  1847  DHFYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFL  1668
             ++F ++++++ ++ +  ++MKWNP+ S  AKVTSLFYES+ EA  F++CV +LQ AM +L
Sbjct  51    ENFTDAMIQQIIDNAAVLVMKWNPDTSTYAKVTSLFYESKNEARQFIRCVTDLQSAMHYL  110

Query  1667  AMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgf  1488
               E P SEKLV+AQ+LM+VAMKRLQKEF+QIL+MNRAHLDPES S  +RSS  ++ S+  
Sbjct  111   VQEDPTSEKLVQAQSLMQVAMKRLQKEFYQILSMNRAHLDPESVSTRSRSSIASTRSSIS  170

Query  1487  sstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIR  1308
                 D     +DD        I EVE VS+  M D++LI ECMI+ GYSKEC  +YK IR
Sbjct  171   DDDEDRGATTEDDVKFATDA-ILEVEQVSAIAMNDLKLIAECMITSGYSKECVHIYKIIR  229

Query  1307  KWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFA  1128
             K IIDE + +LGVE+   S+I KMD EVL+LR K+WL+ ++I++ TLFNGER LCD+VF+
Sbjct  230   KSIIDEGMYKLGVERFGSSQIGKMDREVLDLRYKSWLNTVKISISTLFNGERILCDHVFS  289

Query  1127  STPDAIRESIFKEISKEAAMILFEFPENIA--KYAKNSPEKVFRLLDMYNAIANHRPEIE  954
             S+  +IRES F +IS+EAA +LF FP+ +   K  KNS + +FRLLDMY AI+ + PEIE
Sbjct  290   SSA-SIRESCFTDISREAATLLFGFPQVLVAVKSKKNSLD-IFRLLDMYTAISENWPEIE  347

Query  953   SIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMN  774
             SIF  +S +++R+QA+ SL KL +++ + ++ FE+++QKDSSKS   GG IH LT+ AMN
Sbjct  348   SIFGFESTAAVRSQALNSLIKLSESVLSLLSDFESMVQKDSSKSVPTGGAIHDLTLRAMN  407

Query  773   YLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckL  594
             YL+ + D+SNVL+DI ++ PP  K   P SYF    SDE+P PAIS R AWL+L+LLCKL
Sbjct  408   YLSLLTDYSNVLADIITDWPPPAKSSHPKSYFDSPVSDEAPAPAISARMAWLVLVLLCKL  467

Query  593   DVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLG  414
             +  A+HYKD++++YLFLANNLQ+++ KVRTS L   LGE+W+SK  AKV+Q+AANYE+L 
Sbjct  468   NDKAKHYKDVALSYLFLANNLQHLISKVRTSNLQYLLGEDWISKHEAKVRQFAANYEKLA  527

Query  413   WGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
             W +V++SLPENPTA + PEE +  F+ FN +F +A+RK    VV D  LRD +KVS+ +K
Sbjct  528   WEEVLSSLPENPTAQICPEEARLIFRNFNFAFDEANRKQRTSVVPDPKLRDDIKVSVGQK  587

Query  233   LLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFEPS  93
             L+  YR+FY+ H++T+     R  +   + APEDVG+HLSDLFF PS
Sbjct  588   LVPVYREFYEAHRMTV--GGGRSGALYARIAPEDVGNHLSDLFFPPS  632



>ref|XP_008387721.1| PREDICTED: exocyst complex component EXO70B1-like [Malus domestica]
Length=649

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/584 (53%), Positives = 425/584 (73%), Gaps = 7/584 (1%)
 Frame = -2

Query  1844  HFYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLA  1665
             +F +++++  ++ +  ++MKWNP+ S  AKVTSLFYES+ EA  F++CV +LQ AM +L 
Sbjct  52    NFTDAMIQEIIDNAAXLVMKWNPDTSTYAKVTSLFYESKNEARQFLRCVTDLQSAMHYLV  111

Query  1664  MEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
              E P SEKLV+AQ+LM+VAMKRLQKEF+QIL+MNR HL+PES S  +RSS  ++ S+   
Sbjct  112   QEDPTSEKLVQAQSLMQVAMKRLQKEFYQILSMNREHLBPESVSTRSRSSIASTRSSISD  171

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRK  1305
                D     DDD        I EVE VS+  M D++LI ECMI+ GYSKEC  +YK IRK
Sbjct  172   DDEDGCATTDDDVKFATDA-ILEVEQVSAIAMNDLKLIAECMITSGYSKECVHIYKIIRK  230

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              IIDE + +LGVE+ S S+I KMD EVL+LR K+WL+A++I++ TLFNGER LCD+VFAS
Sbjct  231   SIIDEGMYKLGVERFSSSQIGKMDREVLDLRNKSWLNAVKISISTLFNGERILCDHVFAS  290

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIA--KYAKNSPE-KVFRLLDMYNAIANHRPEIE  954
             +  +IRES F +I++EAA +LF FP+ +   K  KN P   +FRLLDMY  I+ + PEIE
Sbjct  291   SA-SIRESCFTDITREAATLLFGFPQVLVXVKSKKNLPSLDIFRLLDMYTVISENWPEIE  349

Query  953   SIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMN  774
             SIF  +S +++R+QA+ SL KL  ++ + ++ FE+++QKDSSKS   GGGIH LT++AMN
Sbjct  350   SIFGFESTAAVRSQALNSLIKLSVSVLSLLSDFESMVQKDSSKSVPTGGGIHDLTLNAMN  409

Query  773   YLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckL  594
             YL+ + D+SNVL+DI ++ PP  K   P+SYF    SDE+P PAIS R AWL+L+LLCKL
Sbjct  410   YLSLLTDYSNVLADIITDWPPPAKSSHPESYFDSPVSDEAPAPAISARMAWLVLVLLCKL  469

Query  593   DVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLG  414
             +  A+HYKD++++YLFLANNLQ+V+ KVRTS L   LGE+W+SK  AKV+Q+AANYE+L 
Sbjct  470   NDKAKHYKDVALSYLFLANNLQHVISKVRTSNLQYLLGEDWISKHEAKVRQFAANYEKLA  529

Query  413   WGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
             W  V++SLP+NPTA +SPEE +  F+ FN +F +A+RK    VV D  LRD +KVS+ +K
Sbjct  530   WEKVLSSLPDNPTAQISPEEARLIFRNFNFAFDEAYRKQRTSVVPDPKLRDEIKVSVGQK  589

Query  233   LLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             L   YR+FY  H++T+     R  +   + APEDVG+HLSDLFF
Sbjct  590   LFAVYREFYXAHRMTV--GGGRSGALYXRIAPEDVGNHLSDLFF  631



>ref|XP_010253358.1| PREDICTED: exocyst complex component EXO70B1-like [Nelumbo nucifera]
Length=623

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/613 (51%), Positives = 439/613 (72%), Gaps = 13/613 (2%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDH-FYESVMERALEISGPMIMKWNPEASEA  1761
             MPRKGMR + FS +  SS S   +S  +   H   E+++   L+++  +I KW+P +S  
Sbjct  1     MPRKGMRTVFFSSSKDSSPSPSLSSRPSTPLHSLSETMIAENLQVAESVITKWDPNSSTC  60

Query  1760  AKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFF  1581
             AKVTSLFYESR EA +F+K V++LQ++M  L      S  LVRAQ LM++A+KRL+KEFF
Sbjct  61    AKVTSLFYESRTEAMEFLKSVKDLQRSMYCLLSHHSSSHLLVRAQTLMQIAIKRLEKEFF  120

Query  1580  QILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVS  1401
             QIL+ NR HLDPES S  +  S+ +STS     + D      D         I+EVE  S
Sbjct  121   QILSANRDHLDPESISGRSSLSTASSTSDHDDGSEDDLQLTTDS--------ISEVEQAS  172

Query  1400  SFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVL  1221
             +  M+D+R I ECMIS GY  EC ++YK +RK I+DE + RLG+E++S S+I KMDWEVL
Sbjct  173   TVAMSDLRSIAECMISSGYGSECVRIYKVVRKSIVDEGLYRLGIEQLSSSQIHKMDWEVL  232

Query  1220  ELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENI  1041
             EL+IKNWL+A+ +AVKTLF+GER LCD VF ST  +IRES F EI +E A+ LF F E++
Sbjct  233   ELKIKNWLNAIRVAVKTLFSGERILCDYVF-STSQSIRESCFSEICREGAIHLFGFAESV  291

Query  1040  AKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIA  861
             AK +K S EK+FR LD+Y+AI+N  PEIE+IF  +S +++R+QA++SL +LGDA+R  ++
Sbjct  292   AK-SKRSSEKMFRFLDLYDAISNLWPEIETIFFFESTAAVRSQALSSLIRLGDAVRAMLS  350

Query  860   QFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSY  681
              FE+ +QKD ++S+V GGG+HPLT   MNYL+ +AD+S  LSDI +N P   +  LP+SY
Sbjct  351   DFESAIQKDPARSSVPGGGLHPLTRYVMNYLSLLADYSGSLSDIIANGPAPVQSPLPESY  410

Query  680   FAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTS  501
             ++     ++   AIS+R  W+IL++LCKLD  AE YKD+S++YLFLANNLQYVV KVRTS
Sbjct  411   YSSPSWVDNQSSAISVRLVWIILVVLCKLDGKAELYKDVSLSYLFLANNLQYVVSKVRTS  470

Query  500   RLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNAS  321
              L   LGE+W+S   A VKQYAA+YER+GW +V ++LPENP A  S EE K+HFK+F+++
Sbjct  471   NLRYLLGEDWISNHEAMVKQYAASYERMGWNNVFSALPENPGAVASKEEAKEHFKRFSSA  530

Query  320   FAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFA  141
             F +A+RK S+ VV+D  LRD +K+S+A+KL+  YR+ YD +++ +  EK  H   +V+FA
Sbjct  531   FEEAYRKQSSWVVTDGRLRDEIKLSIAKKLVPAYRELYDRYRIALSDEKNVH--GVVRFA  588

Query  140   PEDVGHHLSDLFF  102
             P+D+G++LSDLF+
Sbjct  589   PDDLGNYLSDLFY  601



>ref|XP_009368630.1| PREDICTED: exocyst complex component EXO70B1-like [Pyrus x bretschneideri]
Length=640

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/587 (53%), Positives = 429/587 (73%), Gaps = 7/587 (1%)
 Frame = -2

Query  1847  DHFYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFL  1668
             ++F ++++++ ++ +  ++MKWNP+ S  AKVTSLFYES+ EA  F++CV +LQ AM +L
Sbjct  51    ENFTDAMIQQIIDNAAVLVMKWNPDTSTYAKVTSLFYESKNEARQFIRCVTDLQSAMHYL  110

Query  1667  AMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgf  1488
               E P SEKLV+AQ+LM+VAMKRLQKEF+QIL+MNRAHLDPES S  +RSS  ++ S+  
Sbjct  111   VQEDPTSEKLVQAQSLMQVAMKRLQKEFYQILSMNRAHLDPESVSTRSRSSIASTRSSIS  170

Query  1487  sstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIR  1308
                 D     DDD        I EVE VS+  M D++LI ECMI+ GYSKEC  +YK IR
Sbjct  171   DDDEDRGATTDDDVKFATDA-ILEVEQVSAIAMNDLKLIAECMITSGYSKECVHIYKIIR  229

Query  1307  KWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFA  1128
             K IIDE + +LGVE++S S+I KMD EVL+LR K+WL+A++I++ TLFNGER LCD+VF+
Sbjct  230   KSIIDEGMYKLGVERVSSSQIGKMDREVLDLRYKSWLNAVKISISTLFNGERILCDHVFS  289

Query  1127  STPDAIRESIFKEISKEAAMILFEFPENIA--KYAKNSPEKVFRLLDMYNAIANHRPEIE  954
             S+  +IRES F +IS+EAA +LF FP+ +   K  KNS + +FRLLDMY AI+ + PEIE
Sbjct  290   SSA-SIRESCFTDISREAATLLFGFPQVLVAVKSKKNSLD-IFRLLDMYTAISENWPEIE  347

Query  953   SIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMN  774
             SIF  +S +++R+QA+ SL KL +++ + ++ FE+++QKDSSKS   GG IH LT+ AMN
Sbjct  348   SIFGFESTAAVRSQALNSLIKLSESVLSLLSDFESMVQKDSSKSVPTGGAIHDLTLRAMN  407

Query  773   YLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckL  594
             YL+ + D+SNVL+DI ++ PP  K   P SYF    SDE+P PAIS R AWL+L+LLCKL
Sbjct  408   YLSLLTDYSNVLADIITDWPPPAKSSHPKSYFDSPVSDEAPAPAISARMAWLVLVLLCKL  467

Query  593   DVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLG  414
             +  A+HYKD+S++YLFLANNLQ+V+ KVRTS L   L E+W+SK   KV+Q+AANYE+L 
Sbjct  468   NDKAKHYKDVSLSYLFLANNLQHVISKVRTSNLQYLLREDWISKHEEKVRQFAANYEKLA  527

Query  413   WGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
             W +V+ SLPENPTA +SPEE +  F+ FN +F +A RK    VV D  LRD +KVS+ +K
Sbjct  528   WEEVLFSLPENPTAQISPEEARLIFRNFNFAFDEACRKQRTSVVPDPKLRDDIKVSVGQK  587

Query  233   LLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFEPS  93
             L+  YR+FY+ H++T+   +     +  + APEDVG+HLSDLF  PS
Sbjct  588   LVPVYREFYEAHRMTVGGGRSGVLYA--RIAPEDVGNHLSDLFLPPS  632



>ref|XP_010473847.1| PREDICTED: exocyst complex component EXO70B1-like [Camelina sativa]
Length=636

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/585 (51%), Positives = 417/585 (71%), Gaps = 21/585 (4%)
 Frame = -2

Query  1817  ALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKL  1638
              +E +  +I +WN E S  AKVTS+FYE + EA  F++ V++LQK M  L  E P SE+L
Sbjct  39    VIESAADIIERWNTETSSFAKVTSMFYEDKSEAMTFIERVKDLQKTMDVLVCEDPNSERL  98

Query  1637  VRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvdd  1458
             +RA  LM++AMKRLQKEF+QIL+MNRA+LDPES S  +  +S  S+ + F    +   + 
Sbjct  99    MRAHKLMQIAMKRLQKEFYQILSMNRAYLDPESVSTRSSLTSARSSYSDFPEDVEDSHNG  158

Query  1457  ddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISR  1278
              +         I E+E+VS  VM D++ I ECMI  GY+KEC  +YK IR+ IIDE I R
Sbjct  159   GEI--------IVELEEVSINVMTDLKSIAECMIGSGYAKECISIYKTIRRSIIDEGIYR  210

Query  1277  LGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESI  1098
             L VEK S  K++KM WEV+EL+I++WL A+ ++++TLF GE+ LCD+VF S+ DAIRES 
Sbjct  211   LEVEKTSTGKVKKMSWEVMELKIRSWLKAVSVSMETLFRGEKILCDHVFESS-DAIRESC  269

Query  1097  FKEISKEAAMILFEFPENIAKYA--KNSP-EKVFRLLDMYNAIANHRPEIESIFSMDSAS  927
             F +IS++ A++LF FPE IA     KNSP EK+FRLLDMY +IA +   IESIFS DS S
Sbjct  270   FSDISRDGALLLFGFPEVIATKTSKKNSPPEKIFRLLDMYTSIAGNWQAIESIFSFDSIS  329

Query  926   SIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHS  747
              +R+QA+ SL  LG+++R+ +A FE+ +QKDSSK  V GGG+HPLTI  M++LT +AD+S
Sbjct  330   VVRSQALKSLISLGESVRSLLADFESGIQKDSSKVVVPGGGVHPLTISVMDHLTLLADYS  389

Query  746   NVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKD  567
             NVL DI + +PP  +  LP++YF VS++D+SP   ++LR+AWLIL+LLCK+D  + HYKD
Sbjct  390   NVLVDILAGSPPPDRSLLPETYFNVSETDDSPSSELALRFAWLILVLLCKIDHKSNHYKD  449

Query  566   ISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLP  387
              S+ YLFL NNLQ+VV + R+S L + LGE+W+++  AK++Q+A +Y+RL WG V+ASLP
Sbjct  450   FSVQYLFLTNNLQHVVSRARSSNLRQLLGEDWITRHFAKMRQFAGSYKRLAWGPVLASLP  509

Query  386   ENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFY  207
             EN T  M+PEE+K  F+KF+ SF  A+ +HS CVV+D  LRD +KVS+ARKL+  YR+FY
Sbjct  510   ENRTVEMTPEEVKDMFEKFSESFKDAYVRHSVCVVADPKLRDEIKVSIARKLVPIYREFY  569

Query  206   DTHKLTM---------PKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
             +T    +          +  +R+ SS+V+F PED+ ++LSDLF E
Sbjct  570   NTRSSVVLAGAAAGGGNENGKRNLSSVVRFTPEDIENYLSDLFLE  614



>ref|XP_010260020.1| PREDICTED: exocyst complex component EXO70B1-like [Nelumbo nucifera]
Length=636

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/616 (51%), Positives = 427/616 (69%), Gaps = 12/616 (2%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFY---ESVMERALEISGPMIMKWNPEAS  1767
             MPRKGMR I FS +    SS+  ++        +   E+ M   +E++  +I KW+P +S
Sbjct  1     MPRKGMRTIFFSFSSKDLSSSSSSTHPPSPLRTFSESETTMAANIEVAESIITKWDPNSS  60

Query  1766  EAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKE  1587
               AKVTSLF+ESR EA +F+KCV +LQK+M +       S+ L+RAQ LM++AMKRL+KE
Sbjct  61    SYAKVTSLFFESRNEAREFIKCVMDLQKSMHYFLSLGSSSDMLIRAQRLMQIAMKRLEKE  120

Query  1586  FFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVED  1407
             F+QIL+ NR HLDPES S  +   S ++ S+       ++ D            I+EVE 
Sbjct  121   FYQILSANRDHLDPESISGRSSLVSASARSSTSDYDDTYEDDVHVVARS-----ISEVEQ  175

Query  1406  VSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWE  1227
              S+  M+D++ I +CMIS GY KEC K+Y  IRK I+DE + RLG+E+++ S+I+KMDW+
Sbjct  176   ASTLAMSDLKSIADCMISSGYGKECVKIYMIIRKSIVDEGLYRLGIEQLTSSRIQKMDWD  235

Query  1226  VLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPE  1047
             VL+++IK WL+A ++AVKTLF GER LCD VF ST   IRES F EISKE A+ LF+FPE
Sbjct  236   VLDVKIKTWLNAAKVAVKTLFKGERVLCDYVF-STSAFIRESCFSEISKEGAINLFKFPE  294

Query  1046  NIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTG  867
             ++AK  K S EK+FR+LD+Y+ I +  PEI+S FS +S +++R QA+ SL KLGDAI+  
Sbjct  295   SVAKSKKYSSEKMFRILDLYDTICDLWPEIKSTFSFESTAAVRIQALNSLVKLGDAIKRM  354

Query  866   IAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPD  687
             +  FE+ +QKD SKS V GGGIHPL+   MN+L  +AD+S +LSDI +++       LP+
Sbjct  355   LLDFESAIQKDWSKSPVPGGGIHPLSRYVMNFLCFLADYSGILSDIIADSALPKHSPLPE  414

Query  686   SYF-AVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKV  510
             SYF +  +S+  P PA+S+R AWLIL+LLCKLD  AE YKD  ++Y+FLANNLQYV+ KV
Sbjct  415   SYFLSHRNSEVDPSPAVSVRLAWLILVLLCKLDGKAELYKDAPLSYIFLANNLQYVISKV  474

Query  509   RTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKF  330
             RTS L   LGE W SK  AKVKQY ANYER+GW  VI++L ENPTA MS EE K+ FKKF
Sbjct  475   RTSNLRYLLGEEWASKHEAKVKQYVANYERMGWSKVISTLSENPTAVMSKEEAKKWFKKF  534

Query  329   NASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIV  150
             N +F +A++K S+ VV+D  LRD +KVS+ +K+   YR FYD ++   P   E    S+V
Sbjct  535   NTAFDEAYKKQSSWVVTDGRLRDEIKVSITKKIAPAYRAFYDRYR--NPLRDENTAESVV  592

Query  149   KFAPEDVGHHLSDLFF  102
             +FAP+D+G++LSDLF+
Sbjct  593   RFAPDDLGNYLSDLFY  608



>ref|XP_010486524.1| PREDICTED: exocyst complex component EXO70B1-like [Camelina sativa]
Length=636

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/585 (51%), Positives = 412/585 (70%), Gaps = 21/585 (4%)
 Frame = -2

Query  1817  ALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKL  1638
              +E +  +I +WN E S  AKVTS+FYE + EA  F++ V++LQK M  L  E P SE+L
Sbjct  39    VIESAADIIERWNTETSSFAKVTSMFYEDKSEAMMFIERVKDLQKTMDVLVCEDPNSERL  98

Query  1637  VRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvdd  1458
             +RA  LM++AMKRLQKEF+QIL+MNRA+LDPES S  +  +S  S+ + F    +   + 
Sbjct  99    MRAHKLMQIAMKRLQKEFYQILSMNRAYLDPESVSTRSSLTSARSSYSDFPDDVEDSHNG  158

Query  1457  ddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISR  1278
              D         I E+E+VS  VM D++ I ECMI  GY+KEC  +YK IR+ IIDE I R
Sbjct  159   GDI--------IVELEEVSINVMTDLKSIAECMIGSGYAKECISIYKTIRRSIIDEGIYR  210

Query  1277  LGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESI  1098
             L VEK S  K++KM WEV+EL+I++WL A+ ++++TLF GE+ LCD+VF  T DAIRES 
Sbjct  211   LEVEKTSTGKVKKMSWEVMELKIRSWLKAVSVSMETLFRGEKILCDHVF-ETSDAIRESC  269

Query  1097  FKEISKEAAMILFEFPENIAKYA--KNSP-EKVFRLLDMYNAIANHRPEIESIFSMDSAS  927
             F +IS++ A++LF FPE IA     KNSP EK+FRLLDMY +IA +   IESIFS DS S
Sbjct  270   FSDISRDGALLLFGFPEIIATKTTKKNSPPEKIFRLLDMYTSIAGNWQAIESIFSFDSIS  329

Query  926   SIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHS  747
              +R QA+ SL  LG+++R+ +A FE+ +QKDSSK  V GGG+HPLTI  M++LT +AD+S
Sbjct  330   VVRAQALKSLISLGESVRSLLADFESGIQKDSSKVVVPGGGVHPLTISVMDHLTLLADYS  389

Query  746   NVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKD  567
             NVL DI + +PP  +  LP++YF VS++D+SP   ++LR+AWLIL+LLCK+D  + HYKD
Sbjct  390   NVLVDILAGSPPPDRSLLPETYFNVSETDDSPSSELALRFAWLILVLLCKIDHKSNHYKD  449

Query  566   ISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLP  387
              S+ YLFL NNLQ+VV + R+S L + LGE+W+++  AK++Q+A +Y+RL WG V+ASLP
Sbjct  450   FSVQYLFLTNNLQHVVSRARSSNLRQLLGEDWITRHFAKMRQFAGSYKRLAWGPVLASLP  509

Query  386   ENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFY  207
             EN T  M+ EE+K  F+KF+ SF  A+ +HS CVV+D  LRD +KVS+ARKL+  YR+FY
Sbjct  510   ENRTVEMTAEEVKDMFEKFSESFKDAYVRHSVCVVADPKLRDEIKVSIARKLVPIYREFY  569

Query  206   DTHK---------LTMPKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
             +T                  +R+ SS+V+F PED+ ++LSDLF E
Sbjct  570   NTRSSLVLAGAAAGGGNDNGKRNLSSVVRFTPEDIENYLSDLFLE  614



>ref|XP_010464598.1| PREDICTED: exocyst complex component EXO70B1-like [Camelina sativa]
Length=632

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/581 (51%), Positives = 413/581 (71%), Gaps = 17/581 (3%)
 Frame = -2

Query  1817  ALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKL  1638
              +E +  +I +WN E S  AKVTS+FYE + EA  F++ V++LQK M  L  E P SE+L
Sbjct  39    VIESAADIIERWNTETSSFAKVTSMFYEDKSEAMTFIERVKDLQKTMNVLVCEDPNSERL  98

Query  1637  VRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvdd  1458
             +RA  LM++AMKRLQKEF+QIL+MNRA+LDPES S  +  +S  S+ + F    +   + 
Sbjct  99    MRAHKLMQIAMKRLQKEFYQILSMNRAYLDPESVSTRSSLTSARSSYSDFPEDVEDSHNG  158

Query  1457  ddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISR  1278
              D         I E+E+VS  VM D++ I ECMI  GY+KEC  +YK IR+ IIDE I R
Sbjct  159   GDI--------IVELEEVSINVMTDLKSIAECMIGSGYAKECISIYKTIRRSIIDEGIYR  210

Query  1277  LGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESI  1098
             L VEK S  K++KM WEV+EL+I++WL A+ ++++TLF GE+ LCD+VF  T DAIRES 
Sbjct  211   LEVEKTSTGKVKKMSWEVMELKIRSWLKAVSVSMETLFRGEKILCDHVF-ETSDAIRESC  269

Query  1097  FKEISKEAAMILFEFPENIAKYA--KNSP-EKVFRLLDMYNAIANHRPEIESIFSMDSAS  927
             F +IS++ A++LF FPE IA     KNSP EK+FRLLDMY +IA +   IESIFS DS S
Sbjct  270   FSDISRDGALLLFGFPELIATKTSKKNSPPEKIFRLLDMYTSIAGNWQAIESIFSFDSIS  329

Query  926   SIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHS  747
              +R+QA+ SL  LG+++R+ +A FE+ +QKDSSK  V GGG+HPLTI  M++L+ +AD+S
Sbjct  330   VVRSQALKSLISLGESVRSLLADFESGIQKDSSKVVVPGGGVHPLTISVMDHLSLLADYS  389

Query  746   NVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKD  567
             NVL DI + +PP  +  LP++YF VS++D+SP   ++LR+AWLIL+LLCK+D  + HYKD
Sbjct  390   NVLVDILAGSPPPDRSLLPETYFNVSETDDSPSSELALRFAWLILVLLCKIDHKSNHYKD  449

Query  566   ISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLP  387
              S+ YLFL NNLQ+VV + R+S L + LGE+W+++  AK++Q+A +Y+RL WG V+ASLP
Sbjct  450   FSVQYLFLTNNLQHVVSRARSSNLRQLLGEDWITRHFAKMRQFAGSYKRLAWGPVVASLP  509

Query  386   ENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFY  207
             E+ T  M+ EE+K  F+KF+ SF  A+ +HS CVV+D  LRD +KVS+ARKL+  YR+FY
Sbjct  510   ESRTVEMTAEEVKDRFEKFSESFENAYVRHSVCVVADPKLRDEIKVSIARKLVPIYREFY  569

Query  206   DTHKLTM-----PKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
             +T    +         +++ SS+V+F PED+ + LSDLF E
Sbjct  570   NTRSSVVLAGAAAGGGKKNLSSVVRFTPEDIENFLSDLFLE  610



>ref|XP_009123322.1| PREDICTED: exocyst complex component EXO70B1-like [Brassica rapa]
Length=629

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/620 (50%), Positives = 426/620 (69%), Gaps = 24/620 (4%)
 Frame = -2

Query  1937  MPRKGMR---LIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEAS  1767
             MPRKGMR    +  +P+      T+    S  S   Y  ++E A +I    I +WN E S
Sbjct  1     MPRKGMRSLCCVAKTPSNLQPPLTLTPRQSLESAAAY-GIIESAADI----IERWNTETS  55

Query  1766  EAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKE  1587
               AKVTS+FYE + EA  F++ V NLQK M  L  E P SE+L+RAQ LME+AMKRLQKE
Sbjct  56    TFAKVTSMFYEDKAEAMVFIERVNNLQKTMDLLVSEDPNSERLMRAQRLMEIAMKRLQKE  115

Query  1586  FFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVED  1407
             F+QIL+MNRA+LDPES S  +  +S  S+ + F    D +   D          I EVE+
Sbjct  116   FYQILSMNRAYLDPESVSTRSSLTSARSSYSDFPEDDDSNTVGDS---------IVEVEE  166

Query  1406  VSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWE  1227
             V+S VM D+R I ECMI+ GY+KEC  +YK IRK IIDE + RL VEK+S +K +KM WE
Sbjct  167   VASKVMTDLRSIAECMIASGYAKECVIIYKTIRKSIIDEGVYRLDVEKISIAKAKKMSWE  226

Query  1226  VLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPE  1047
              +E++I++WL A++++++TLF GER LCD+VF S+ DAIRES F EIS+E A++LF FPE
Sbjct  227   EMEIKIRSWLEAVKVSMETLFKGERILCDHVFQSS-DAIRESCFTEISREGAVLLFGFPE  285

Query  1046  NI-AKYAKNS--PEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAI  876
              + AK +K S  PEK FRLLDMY+AIA +   IESIFS +S S +R+QA+ SL  L ++I
Sbjct  286   IVSAKISKKSSPPEKTFRLLDMYSAIAGNWRAIESIFSFESTSVVRSQALKSLVSLSESI  345

Query  875   RTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDW  696
             R+ +  FE+ ++KDSSK  V GGG+HPLT  AMN+++ +AD+SNVL DI S +PP  +  
Sbjct  346   RSQLRHFESRIEKDSSKVVVHGGGVHPLTTSAMNHISLLADYSNVLVDILSGSPPPDRTL  405

Query  695   LPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVV  516
             LP+SYF VSD D SP   +++R+AWLIL+LLC++D  A HYK  S+ YLFL NNLQ+VV 
Sbjct  406   LPESYFNVSDPDVSPSSELAIRFAWLILVLLCEIDRKANHYKVCSVQYLFLTNNLQHVVS  465

Query  515   KVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFK  336
             + R S L + LG++W+ +   K+KQ++ +Y+RL WG V+A+LPEN    +S EE+K+ F+
Sbjct  466   RARCSNLKQLLGDDWVRRHVGKIKQFSDSYKRLAWGPVLATLPENRAVELSAEEVKERFE  525

Query  335   KFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHK---LTMPKEKERH  165
             KF+ SF +A+ K S C V D  LR+ +K+S+ARKL+  YR+FY+T +   +    +  R+
Sbjct  526   KFSESFERAYGKQSVCAVPDSELREEIKLSIARKLVPIYREFYNTRRSVIVAGAGDGVRN  585

Query  164   FSSIVKFAPEDVGHHLSDLF  105
              SS+V+F PEDV  HLSDLF
Sbjct  586   LSSVVRFTPEDVESHLSDLF  605



>ref|XP_007208031.1| hypothetical protein PRUPE_ppa002946mg [Prunus persica]
 gb|EMJ09230.1| hypothetical protein PRUPE_ppa002946mg [Prunus persica]
Length=619

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/616 (49%), Positives = 438/616 (71%), Gaps = 23/616 (4%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSD---HFYESVMERALEISGPMIMKWNPEAS  1767
             MPRKGMR + F     S S++   S +  S     F +S+ME  +EI+  +I +W+ ++S
Sbjct  1     MPRKGMRTLFFKSPSPSPSNSPSRSATQPSSPRRSFSDSLMEENIEIAQTLITQWDSDSS  60

Query  1766  EAAKVTSLFYESRREANDFVKCVRNLQKAMQ-FLAMEQPRSEKLVRAQNLMEVAMKRLQK  1590
                 ++SLF++ R+EA  ++K V++LQ AMQ FL+ +   +EKL+ AQNLM+ AMKRL+K
Sbjct  61    SYNNISSLFHDDRQEARLYLKSVKDLQSAMQHFLSSQDSSAEKLIIAQNLMQSAMKRLEK  120

Query  1589  EFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVE  1410
             EF+QIL+ NR +LD E+ S+ +  +S  S+ +   S S+ +              ++ V+
Sbjct  121   EFYQILSGNRDYLDAETVSSRSSRASALSSVSDLESESEDES-------------VSAVD  167

Query  1409  DVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDW  1230
              +S+  M+D++ I +CMIS GY KEC ++YK IRK I+DE +  LGVEK+S S+++KMDW
Sbjct  168   QISTIAMSDLKSIADCMISSGYGKECVRIYKIIRKSIVDEGLYLLGVEKLSLSQVQKMDW  227

Query  1229  EVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFP  1050
             +VLE +IKNWLSA+++AVKTLF GER LC++VFA++ D+I ES F EISKEAAM LF FP
Sbjct  228   QVLETKIKNWLSAVKVAVKTLFYGERLLCEHVFAAS-DSIAESCFNEISKEAAMTLFGFP  286

Query  1049  ENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRT  870
             E + K  K SPEK+FR+LD+Y A+++  PE+ESIFS +S S++R+ AV SL KLG+A+RT
Sbjct  287   ELVGKCKKLSPEKMFRILDLYQAVSDLWPEMESIFSFESTSAVRSLAVNSLIKLGEAVRT  346

Query  869   GIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLP  690
              +  FE+ +QKDSSK+ V  GG+HPLT   MNY++ +AD+S +L DI  + P      LP
Sbjct  347   MLMDFESAIQKDSSKTPVPAGGVHPLTRYVMNYISFLADYSEILGDIVVDWPLTISTPLP  406

Query  689   DSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKV  510
             ++YF   D++ESP   IS+R AWL+L+LLCKLD  A+ YKD++++YLFLANNLQYVV KV
Sbjct  407   EAYFGCYDAEESP---ISIRLAWLVLVLLCKLDGKAKLYKDVALSYLFLANNLQYVVGKV  463

Query  509   RTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKF  330
             R S +   LGE W+ K  +KVKQYAANYER+GW  V ASLPE+ TA +S ++ K +FK+F
Sbjct  464   RGSNVKYLLGEYWVQKHESKVKQYAANYERMGWSKVFASLPEDTTAQISSDQAKSYFKRF  523

Query  329   NASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIV  150
             NA+F +A++K ++ VV D  LRD LKVS+A+KL+  YR+FY+ H++ M +E      S+V
Sbjct  524   NAAFEEAYKKQTSWVVPDSKLRDELKVSVAKKLVPVYREFYEKHRVGMRRECGED--SLV  581

Query  149   KFAPEDVGHHLSDLFF  102
             ++APE++ ++LSDL +
Sbjct  582   RYAPENLDNYLSDLLY  597



>gb|ABE65930.1| exocyst subunit EXO70 family protein [Arabidopsis thaliana]
Length=627

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/578 (51%), Positives = 415/578 (72%), Gaps = 18/578 (3%)
 Frame = -2

Query  1817  ALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKL  1638
              +E +  +I +WN E +  AKVT +FYE++ EA  F++ V++LQK M  L  E P SE+L
Sbjct  41    VIESAADIIERWNTETNTFAKVTCMFYENKPEAMMFIERVKDLQKTMDVLVSEDPNSERL  100

Query  1637  VRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvdd  1458
             +R+  LM++AMKRLQKEF+QIL+MNRA+LDPES S  +  +S  S+ + F    +     
Sbjct  101   LRSHKLMQIAMKRLQKEFYQILSMNRAYLDPESVSTRSSLTSARSSYSDFPDYVEDLDT-  159

Query  1457  ddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISR  1278
                        I E+E+VS+ VM D++ I ECMI  GY+KEC  +YK IRK IIDE I R
Sbjct  160   -----------IIELEEVSTNVMTDLKSIAECMIGSGYAKECLSIYKSIRKSIIDEGIYR  208

Query  1277  LGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESI  1098
             L VEK S  K++KM WEV+EL+I++WL A++++++TLF GE+ LCD+VF S+ DAIRES 
Sbjct  209   LEVEKTSTGKVKKMSWEVMELKIRSWLKAVKVSMETLFKGEKILCDHVFESS-DAIRESC  267

Query  1097  FKEISKEAAMILFEFPE--NIAKYAKNSP-EKVFRLLDMYNAIANHRPEIESIFSMDSAS  927
             F +IS++ A++LF FPE  N     K+SP EKVFRLLDMY AIA +   IESIFS DS S
Sbjct  268   FSDISRDGALLLFGFPEIINTKTSKKHSPPEKVFRLLDMYTAIAGNWQAIESIFSFDSIS  327

Query  926   SIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHS  747
              +R+ A+ SL  L ++IR+ + +FE+ +QKDSSK  V GGG+HPLTI  M++L+ +AD+S
Sbjct  328   VVRSLALKSLISLSESIRSLLVEFESGIQKDSSKVVVPGGGVHPLTISVMDHLSLLADYS  387

Query  746   NVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKD  567
             NVL DI + +PP  +  LP+SYF VS+SD+SP   +++R+AW+IL+LLCK+D  + HYKD
Sbjct  388   NVLVDILAGSPPPDRSLLPESYFNVSESDDSPSSELTIRFAWIILVLLCKIDRKSIHYKD  447

Query  566   ISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLP  387
              SI YLFL NNLQ+VV + R+S L   LGE+W+++  AK++Q+A +Y+RL WG V+A+LP
Sbjct  448   FSIQYLFLTNNLQHVVSRARSSNLKNLLGEDWITRHFAKMRQFAGSYKRLAWGPVVATLP  507

Query  386   ENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFY  207
             EN T  M+PEE+K+ F+KF+ SF  A+ KHS CVV+D N+RD +KVS++RKL+  YR+FY
Sbjct  508   ENRTVEMTPEEVKERFEKFSESFENAYSKHSVCVVADPNIRDEIKVSISRKLVPIYREFY  567

Query  206   DTHKLTMPKEKE--RHFSSIVKFAPEDVGHHLSDLFFE  99
             +T    +  E +  R+ +S+V+F PED+ ++LSDLF E
Sbjct  568   NTRGSVILGEGDGARNLNSVVRFTPEDIENYLSDLFRE  605



>ref|NP_187563.1| exocyst subunit exo70 family protein H4 [Arabidopsis thaliana]
 gb|AAF23313.1|AC016661_38 hypothetical protein [Arabidopsis thaliana]
 gb|AEE74776.1| exocyst subunit exo70 family protein H4 [Arabidopsis thaliana]
Length=628

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/578 (51%), Positives = 415/578 (72%), Gaps = 18/578 (3%)
 Frame = -2

Query  1817  ALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKL  1638
              +E +  +I +WN E +  AKVT +FYE++ EA  F++ V++LQK M  L  E P SE+L
Sbjct  42    VIESAADIIERWNTETNTFAKVTCMFYENKPEAMMFIERVKDLQKTMDVLVSEDPNSERL  101

Query  1637  VRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvdd  1458
             +R+  LM++AMKRLQKEF+QIL+MNRA+LDPES S  +  +S  S+ + F    +     
Sbjct  102   LRSHKLMQIAMKRLQKEFYQILSMNRAYLDPESVSTRSSLTSARSSYSDFPDYVEDLDT-  160

Query  1457  ddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISR  1278
                        I E+E+VS+ VM D++ I ECMI  GY+KEC  +YK IRK IIDE I R
Sbjct  161   -----------IIELEEVSTNVMTDLKSIAECMIGSGYAKECLSIYKSIRKSIIDEGIYR  209

Query  1277  LGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESI  1098
             L VEK S  K++KM WEV+EL+I++WL A++++++TLF GE+ LCD+VF S+ DAIRES 
Sbjct  210   LEVEKTSTGKVKKMSWEVMELKIRSWLKAVKVSMETLFKGEKILCDHVFESS-DAIRESC  268

Query  1097  FKEISKEAAMILFEFPE--NIAKYAKNSP-EKVFRLLDMYNAIANHRPEIESIFSMDSAS  927
             F +IS++ A++LF FPE  N     K+SP EKVFRLLDMY AIA +   IESIFS DS S
Sbjct  269   FSDISRDGALLLFGFPEIINTKTSKKHSPPEKVFRLLDMYTAIAGNWQAIESIFSFDSIS  328

Query  926   SIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHS  747
              +R+ A+ SL  L ++IR+ + +FE+ +QKDSSK  V GGG+HPLTI  M++L+ +AD+S
Sbjct  329   VVRSLALKSLISLSESIRSLLVEFESGIQKDSSKVVVPGGGVHPLTISVMDHLSLLADYS  388

Query  746   NVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKD  567
             NVL DI + +PP  +  LP+SYF VS+SD+SP   +++R+AW+IL+LLCK+D  + HYKD
Sbjct  389   NVLVDILAGSPPPDRSLLPESYFNVSESDDSPSSELTIRFAWIILVLLCKIDRKSIHYKD  448

Query  566   ISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLP  387
              SI YLFL NNLQ+VV + R+S L   LGE+W+++  AK++Q+A +Y+RL WG V+A+LP
Sbjct  449   FSIQYLFLTNNLQHVVSRARSSNLKNLLGEDWITRHFAKMRQFAGSYKRLAWGPVVATLP  508

Query  386   ENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFY  207
             EN T  M+PEE+K+ F+KF+ SF  A+ KHS CVV+D N+RD +KVS++RKL+  YR+FY
Sbjct  509   ENRTVEMTPEEVKERFEKFSESFENAYSKHSVCVVADPNIRDEIKVSISRKLVPIYREFY  568

Query  206   DTHKLTMPKEKE--RHFSSIVKFAPEDVGHHLSDLFFE  99
             +T    +  E +  R+ +S+V+F PED+ ++LSDLF E
Sbjct  569   NTRGSVILGEGDGARNLNSVVRFTPEDIENYLSDLFRE  606



>ref|XP_002882622.1| ATEXO70H4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58881.1| ATEXO70H4 [Arabidopsis lyrata subsp. lyrata]
Length=628

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/578 (51%), Positives = 414/578 (72%), Gaps = 18/578 (3%)
 Frame = -2

Query  1817  ALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKL  1638
              +E +  +I +WN E +  AKVTS+FYE+++EA  F++ V++LQK M  L  E P SE+L
Sbjct  42    VIESAADIIERWNTETNTFAKVTSMFYENKQEAMVFIERVKDLQKTMDVLVSEDPNSERL  101

Query  1637  VRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvdd  1458
             +RA  LM++AMKRLQKEF+QIL+MNRA+LDPES S  +  +S  S+ + F    +     
Sbjct  102   LRAHKLMQIAMKRLQKEFYQILSMNRAYLDPESVSTRSSLTSARSSYSDFPEDVEDLDT-  160

Query  1457  ddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISR  1278
                        I E+E+VSS VM D+R I ECMI  GY+KEC  +YK IRK IIDE I R
Sbjct  161   -----------IVELEEVSSNVMTDLRSIAECMIGSGYAKECLSIYKSIRKSIIDEGIYR  209

Query  1277  LGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESI  1098
             L VEK S  K++KM  EV+EL+I++WL A++++++TLF GE+ LCD+VF S+ DAIRES 
Sbjct  210   LEVEKTSTGKVKKMSREVMELKIRSWLKAVKVSMETLFKGEKILCDHVFESS-DAIRESC  268

Query  1097  FKEISKEAAMILFEFPENIA-KYAK--NSPEKVFRLLDMYNAIANHRPEIESIFSMDSAS  927
             F +IS++ A++LF FPE IA K  K  + PEK+FRLLDMY AIA +   IESIFS DS S
Sbjct  269   FSDISRDGALLLFGFPEIIATKTCKKHSPPEKLFRLLDMYTAIAGNWQAIESIFSFDSIS  328

Query  926   SIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHS  747
              +R+ A+ SL  L ++IR+ + +FE+ +Q DSSK  V GGG+HPLTI  M++L+ +AD+S
Sbjct  329   VVRSLALKSLISLSESIRSLLVEFESGIQNDSSKMVVPGGGVHPLTISVMDHLSLLADYS  388

Query  746   NVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKD  567
             NVL DI + +PP  +  LP+SYF VS+SD+SP   +++R+AWLIL+LLCK+D  + HYKD
Sbjct  389   NVLVDILAGSPPPDRSLLPESYFNVSESDDSPSSELTIRFAWLILVLLCKIDRKSIHYKD  448

Query  566   ISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLP  387
              S+ YLFL NNLQ+VV + R+S L   LGE+W+++  AK++Q+A +Y+RL WG V++SLP
Sbjct  449   FSVQYLFLTNNLQHVVSRARSSNLKNLLGEDWITRHFAKMRQFAGSYKRLAWGPVVSSLP  508

Query  386   ENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFY  207
             EN T  M+PEE+K+ F+KF+ SF  A+ KHS CVV+D NLRD +KVS+ARKL+  YR+FY
Sbjct  509   ENRTVEMTPEEVKERFEKFSESFENAYAKHSVCVVADPNLRDEIKVSIARKLVPIYREFY  568

Query  206   DTHK--LTMPKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
             +T    +       R+ SS+V+F PED+ ++LSD+F E
Sbjct  569   NTRGSVILAGAGGARNLSSVVRFTPEDIENYLSDMFTE  606



>ref|XP_006297189.1| hypothetical protein CARUB_v10013194mg [Capsella rubella]
 gb|EOA30087.1| hypothetical protein CARUB_v10013194mg [Capsella rubella]
Length=636

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/584 (51%), Positives = 417/584 (71%), Gaps = 19/584 (3%)
 Frame = -2

Query  1817  ALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKL  1638
              +E +  +I +WN E+S  AKVTS+FYE++ EA  F++ V++LQK M  L  E P SE+L
Sbjct  39    VIESAADIIERWNTESSSYAKVTSMFYENKPEAMMFIERVKDLQKTMDVLVSEDPNSERL  98

Query  1637  VRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvdd  1458
             +RA  LM++AMKRLQKEF+QIL+MNRA+LDPES S  +  +S  S+ + F    +   + 
Sbjct  99    MRAHKLMQIAMKRLQKEFYQILSMNRAYLDPESVSTRSSLTSARSSYSDFPEDVEDSHNG  158

Query  1457  ddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISR  1278
               D        I E+E+VSS VM ++R I ECMI  GY+KEC  +YK IRK IIDE I R
Sbjct  159   SVDI-------IVELEEVSSNVMTELRAIAECMIGSGYAKECLSIYKTIRKSIIDEGIYR  211

Query  1277  LGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESI  1098
             L VEK S  K+++M WEV+EL+I++WL A+ ++++TLF GE+ LCD+VF S+ DA+RES 
Sbjct  212   LEVEKTSTGKVKRMSWEVMELKIRSWLKALSVSMETLFRGEKILCDHVFESS-DALRESC  270

Query  1097  FKEISKEAAMILFEFPENIA-KYAK--NSPEKVFRLLDMYNAIANHRPEIESIFSMDSAS  927
             F ++S++ A++LF FPE+IA K +K  + PEKVFRLLDMY+AIA +   IESIFS DS S
Sbjct  271   FSDVSRDGALLLFGFPESIATKTSKKHSPPEKVFRLLDMYSAIAGNWQAIESIFSFDSVS  330

Query  926   SIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHS  747
              +R+ A+ SL  L ++IR+ +  FE+ +QKDSSK  V GGGIHPLTI  M++L+ +AD+S
Sbjct  331   VVRSLALKSLVSLSESIRSLLVDFESGIQKDSSKVVVPGGGIHPLTISVMDHLSLLADYS  390

Query  746   NVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKD  567
             NVL DI + +PP  +  LP+SYF +S+SD+SP   ++LR+AWLIL+LLCK+D  + HYKD
Sbjct  391   NVLVDILAGSPPPDRSLLPESYFNLSESDDSPSSELALRFAWLILVLLCKIDHKSNHYKD  450

Query  566   ISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLP  387
              S+ YLFLANNLQ+VV + R+S L + LGE+W+ +   K++Q+A +Y+RL WG V++SLP
Sbjct  451   FSVQYLFLANNLQHVVSRARSSNLKQLLGEDWVKRHFVKMRQFAGSYKRLAWGPVVSSLP  510

Query  386   ENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFY  207
             EN T  M+P+E+K  F+KFN SF  A+ +HS CVV+D  LRD +K S+ARKL+  YR+FY
Sbjct  511   ENRTVEMTPDEVKDLFRKFNESFENAYGRHSVCVVADPKLRDEIKESIARKLVPIYREFY  570

Query  206   DTHKLTM--------PKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
             +T    +            +R+ S++V+F PED+ ++LSDLF E
Sbjct  571   NTRSSVVLAGAAAGGGGNGKRNLSTVVRFTPEDIENYLSDLFLE  614



>ref|XP_006407669.1| hypothetical protein EUTSA_v10020295mg [Eutrema salsugineum]
 gb|ESQ49122.1| hypothetical protein EUTSA_v10020295mg [Eutrema salsugineum]
Length=629

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/576 (52%), Positives = 407/576 (71%), Gaps = 16/576 (3%)
 Frame = -2

Query  1814  LEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLV  1635
             +E S  +I +WN E S  AKVTSLFYE++ EA  F+  V++LQ  M  L  E P SE+L 
Sbjct  40    IESSADIIERWNTETSSFAKVTSLFYENKPEAMVFIDRVKDLQNTMDLLVSEDPNSERLA  99

Query  1634  RAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddd  1455
             R+Q LM++AMKRLQKEF+QIL+MNRA+LDPES S  +  +S  S+ +      +     D
Sbjct  100   RSQKLMQIAMKRLQKEFYQILSMNRAYLDPESVSTRSSLTSARSSYSDLPDDDELHTAGD  159

Query  1454  dddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRL  1275
                       I EVE+VSS VM D+R I ECMI+ GY+KEC  +YK IRK +IDE I RL
Sbjct  160   S---------IVEVEEVSSNVMTDLRSIAECMIASGYAKECLSIYKSIRKSVIDEGIYRL  210

Query  1274  GVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIF  1095
              VEK S +K +KM WE ++L+I++WL A++++++TLF GE+ LCD+VF S+ DAIRES F
Sbjct  211   EVEKTSPAKAKKMSWEAIDLKIRSWLEAVKVSMETLFKGEKILCDHVFESS-DAIRESCF  269

Query  1094  KEISKEAAMILFEFPENIA----KYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSAS  927
              EIS+E A++LF FP+ IA        +SPEK+FRLLDMY+AIA +   IESIFS DS S
Sbjct  270   SEISREGALLLFGFPDIIAASKISTKNSSPEKIFRLLDMYSAIAGNWRAIESIFSFDSIS  329

Query  926   SIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHS  747
              +R+QA+ SL  L ++IR+ +  FE+ +QKDSSK  V GGG+HPLTI  M++LT +AD+S
Sbjct  330   VVRSQALKSLISLSESIRSLLVDFESGIQKDSSKVIVPGGGVHPLTISVMSHLTLLADYS  389

Query  746   NVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKD  567
             NVL DI + +PP  +  LP+SYF VSDSDESP   ++LR+AWLIL+LLCK+D  A  YKD
Sbjct  390   NVLVDILAGSPPPERSLLPESYFNVSDSDESPSSELTLRFAWLILVLLCKIDRKANQYKD  449

Query  566   ISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLP  387
              S+ YLFL NNLQ+VV +VR+S L + LG++W+++  AK+KQY+ +Y+RL WG V+ASLP
Sbjct  450   CSVQYLFLTNNLQHVVSRVRSSNLKQLLGDDWVTRHFAKMKQYSDSYKRLAWGPVVASLP  509

Query  386   ENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFY  207
             EN T  MSPEE+K+ F  F+  F +A+ K SAC+V D NL + +K+S+ARKL+  YR+F 
Sbjct  510   ENRTVEMSPEEVKERFDNFSECFERAYGKQSACIVPDPNLGEEIKLSIARKLVPIYREFC  569

Query  206   DTHK--LTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +T            R+ SS+V+F PED+ +HLSDLF
Sbjct  570   NTRSSVFLAGAGGARNLSSVVRFTPEDIENHLSDLF  605



>ref|XP_002281519.2| PREDICTED: exocyst complex component EXO70A1-like [Vitis vinifera]
Length=621

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/612 (48%), Positives = 431/612 (70%), Gaps = 13/612 (2%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEAA  1758
             MPRKGMR I F  +   SSS   +   A S   +ES+M+  ++ +  +I KW  + S  A
Sbjct  1     MPRKGMRTIFFKASS-PSSSHQSSPSRAPSSPLHESMMDENIDNAQSVISKWYSDESSFA  59

Query  1757  KVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQ  1578
               TSLF+ SR EA  F+  V +LQ+AM F       SEKL+R+QNLM++AMKRL+KEF+Q
Sbjct  60    NFTSLFHSSRSEAKQFLSAVADLQRAMHFFVNHDSTSEKLIRSQNLMQLAMKRLEKEFYQ  119

Query  1577  ILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVSS  1398
             IL+ +R +LDPES S+   + S  S      ++ +      +         ++ VE  S 
Sbjct  120   ILSSSREYLDPESVSSHVSARSSISDFEDDRASEEEFGASIES--------VSGVERESE  171

Query  1397  FVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLE  1218
               MAD++ I +CMIS GY KEC K+YK +RK I+DE++  LGVE++S+S+I+KMDWE++E
Sbjct  172   LAMADLKAIADCMISSGYGKECVKIYKLVRKSIVDESLYHLGVERLSYSQIQKMDWELIE  231

Query  1217  LRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIA  1038
              +I++WL+A++ AVKTLF GER LCD VF+++ D+IRES F EI+KE A+ LF FPE++A
Sbjct  232   NKIRHWLNAVKAAVKTLFYGERILCDRVFSAS-DSIRESCFSEITKEGALSLFGFPEHVA  290

Query  1037  KYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQ  858
             +  K +PEK+FR+LD+Y +I++  PEI+SIFS +S S++ +QA ++L +LG+A+RT ++ 
Sbjct  291   R-CKKTPEKMFRILDLYESISDLWPEIDSIFSFESTSAVLSQATSALIRLGEAVRTMLSD  349

Query  857   FETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYF  678
             FE  +QKDSSK+ + GGG+HPLT   MNY++ ++D+S VLS I +  P   +  +P+SYF
Sbjct  350   FEAAIQKDSSKTPIRGGGVHPLTRYVMNYVSFLSDYSGVLSVIVAEWPLTVQSSMPESYF  409

Query  677   AVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSR  498
                 SD+ P  AISLR AWL+L+LLCKLD  A+ YKD+S++Y+FLANNLQYV  KVRTS 
Sbjct  410   ENPKSDDDPTSAISLRLAWLVLVLLCKLDGRAKLYKDVSLSYIFLANNLQYVTTKVRTSN  469

Query  497   LNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASF  318
             +   LG++W++K   KVKQYA+NYER+GW  V +SLPENP+A +SPE+ K+ FKKFN++F
Sbjct  470   IRYLLGDDWIAKHEIKVKQYASNYERMGWSKVFSSLPENPSADISPEKAKECFKKFNSAF  529

Query  317   AQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAP  138
              + +RK ++ VV D  L++ +K+S+A+KL   YR FY+ ++  + +E      S+V+FAP
Sbjct  530   EEVYRKQTSWVVPDNKLQEEIKLSIAKKLEPTYRAFYEKNRARLRREPGSE--SVVRFAP  587

Query  137   EDVGHHLSDLFF  102
             +D+G++LSDLF+
Sbjct  588   DDMGNYLSDLFY  599



>emb|CAN66786.1| hypothetical protein VITISV_037767 [Vitis vinifera]
Length=621

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/612 (48%), Positives = 430/612 (70%), Gaps = 13/612 (2%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEAA  1758
             MPRKGMR I F  +   SSS   +   A S   +ES+M+  ++ +  +I KW  + S   
Sbjct  1     MPRKGMRTIFFKASS-PSSSHQSSPSRAPSSPLHESMMDENIDNAQSVISKWYSDESSFX  59

Query  1757  KVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQ  1578
               TSLF+ SR EA  F+  V +LQ+AM F       SEKL+R+QNLM++AMKRL+KEF+Q
Sbjct  60    NFTSLFHSSRSEAKQFLSAVABLQRAMHFFVNHDSTSEKLIRSQNLMQLAMKRLEKEFYQ  119

Query  1577  ILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVSS  1398
             IL+ +R +LDPES S+   + S  S      ++ +      +         ++ VE  S 
Sbjct  120   ILSSSREYLDPESVSSHVSARSSISDFEDDRASEEEFGASIES--------VSGVERESE  171

Query  1397  FVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLE  1218
               MAD++ I +CMIS GY KEC K+YK +RK I+DE++  LGVE++S+S+I+KMDWE++E
Sbjct  172   XAMADLKAIADCMISSGYGKECVKIYKLVRKSIVDESLYHLGVERLSYSQIQKMDWELIE  231

Query  1217  LRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIA  1038
              +I++WL+A++ AVKTLF GER LCD VF+++ D+IRES F EI+KE A+ LF FPE++A
Sbjct  232   NKIRHWLNAVKAAVKTLFYGERILCDRVFSAS-DSIRESCFSEITKEGALSLFGFPEHVA  290

Query  1037  KYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQ  858
             +  K +PEK+FR+LD+Y +I++  PEI+SIFS +S S++ +QA ++L +LG+A+RT ++ 
Sbjct  291   R-CKKTPEKMFRILDLYESISDLWPEIDSIFSFESTSAVLSQATSALIRLGEAVRTMLSD  349

Query  857   FETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYF  678
             FE  +QKDSSK+ + GGG+HPLT   MNY++ ++D+S VLS I +  P   +  +P+SYF
Sbjct  350   FEAAIQKDSSKTPIRGGGVHPLTRYVMNYVSFLSDYSGVLSVIVAEWPLTVQSSMPESYF  409

Query  677   AVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSR  498
                 SD+ P  AISLR AWL+L+LLCKLD  A+ YKD+S++Y+FLANNLQYV  KVRTS 
Sbjct  410   ENPKSDDDPTSAISLRLAWLVLVLLCKLDGRAKLYKDVSLSYIFLANNLQYVTTKVRTSN  469

Query  497   LNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASF  318
             +   LG++W++K   KVKQYA+NYER+GW  V +SLPENP+A +SPE+ K+ FKKFN++F
Sbjct  470   IRYLLGDDWIAKHEIKVKQYASNYERMGWSKVFSSLPENPSADISPEKAKECFKKFNSAF  529

Query  317   AQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAP  138
              + +RK ++ VV D  L++ +K+S+A+KL   YR FY+ ++  + +E      S+V+FAP
Sbjct  530   EEVYRKQTSWVVPDNKLQEEIKLSIAKKLEPTYRAFYEKNRARLRREPGSE--SVVRFAP  587

Query  137   EDVGHHLSDLFF  102
             +D+G++LSDLF+
Sbjct  588   DDMGNYLSDLFY  599



>ref|XP_008442595.1| PREDICTED: exocyst complex component EXO70B1-like [Cucumis melo]
Length=641

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/627 (51%), Positives = 438/627 (70%), Gaps = 22/627 (4%)
 Frame = -2

Query  1937  MPRKGMRLIGF--------SPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKW  1782
             MPRKGMR + F        S + +S SS  R         F ++++E+A+E +  ++MKW
Sbjct  1     MPRKGMRSLLFQFSSPSNNSISRYSISSPSRTPALTPRRSFNDAMIEQAVESAAAIVMKW  60

Query  1781  NPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSE--KLVRAQNLMEVA  1608
             NP++S  AKVTS+FYE +REA  F+K V +LQKAM  +A +   S   +LV AQ LME+A
Sbjct  61    NPDSSTYAKVTSMFYEDKREAMQFIKRVNDLQKAMHLMASDDSVSSSDRLVYAQGLMEIA  120

Query  1607  MKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagd  1428
             MKRLQKEF+QIL+MNRAHLDPES S  +   S  S+++          D+          
Sbjct  121   MKRLQKEFYQILSMNRAHLDPESVSTRSSRCSTRSSTSVDFDEDGTLDDELQVVEDS---  177

Query  1427  SITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSK  1248
              I+EVE +SS VM D+R I ECMIS GY+KEC  +YK IRK IIDE + RLG+EK+S S+
Sbjct  178   -ISEVEQISSIVMEDLRAIAECMISSGYAKECVNMYKVIRKSIIDEGVYRLGLEKLSASR  236

Query  1247  IRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAM  1068
             I KMDWEVL+L+IKNWL A+++A++TLF GER LCD+VF+S+ ++IRES F +IS+E A+
Sbjct  237   INKMDWEVLDLKIKNWLDAIKLAIRTLFVGERILCDHVFSSS-ESIRESCFADISREGAL  295

Query  1067  ILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKL  888
             +LF FPE +AK +K SPEK+FR+LDMY++IA + P+IESIFS +S+S +R+QA+TSL KL
Sbjct  296   LLFGFPELVAK-SKKSPEKMFRVLDMYSSIAENWPDIESIFSSESSSVVRSQALTSLTKL  354

Query  887   GDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPI  708
             G+ +R  +   E  +QK+SSKS VAGGG+H LT+ +MNYLT +AD+ N L+DIF++  P 
Sbjct  355   GELVRAIVMDLEYSIQKNSSKSPVAGGGVHSLTLLSMNYLTFLADYCNALTDIFADWTPP  414

Query  707   PKDWLPDSYFA-VSDSDES-PLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANN  534
              K  L   +F+  S++D+S     ISLR  WLIL+LLCKLD  A+ YKD+S++YLFLANN
Sbjct  415   EKSSLEHIFFSSTSETDDSQSASGISLRMGWLILVLLCKLDNKAKRYKDVSLSYLFLANN  474

Query  533   LQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEE  354
             LQ++V KVR+S L   LG+ W++KQ  KV+Q+AA YE L WG V  SLPENPT   S EE
Sbjct  475   LQHIVSKVRSSNLQYLLGDEWIAKQEVKVRQFAAKYEALAWGRVFDSLPENPTEKFSQEE  534

Query  353   IKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEK  174
              K+ F+ FN +F + HRK  +C + D  LRD +K+S+ RKL+  Y +FY   K      +
Sbjct  535   AKEIFRNFNMAFQETHRKQKSCFIPDPKLRDEVKLSIGRKLVWFYGEFYRAQKAYGGANE  594

Query  173   ERHFSSIVKFAPEDVGHHLSDLFFEPS  93
             + +    ++F+PED+G++LSDL+FEPS
Sbjct  595   KPY----IRFSPEDIGNYLSDLYFEPS  617



>ref|XP_007016546.1| Exocyst subunit exo70 family protein H7, putative [Theobroma 
cacao]
 gb|EOY34165.1| Exocyst subunit exo70 family protein H7, putative [Theobroma 
cacao]
Length=623

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/617 (49%), Positives = 429/617 (70%), Gaps = 18/617 (3%)
 Frame = -2

Query  1937  MPRKGMRLIGF-SPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEA---  1770
             MPRKGMR + F SP+     + +    S     F ES+ME  +E++  +I KW+  +   
Sbjct  1     MPRKGMRTVFFKSPS----PTRMTPPASPLPHTFSESLMEENIEVAEFVITKWDSLSESN  56

Query  1769  SEAAKVTSLFYE-SRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQ  1593
             S    + SLF + +R EA  ++  V+ LQKAMQ+LA  Q  SEKLV AQ LM+ AMKRL+
Sbjct  57    SSHCNIGSLFSDDNREEAKMYLSSVKGLQKAMQYLASHQASSEKLVPAQTLMQTAMKRLE  116

Query  1592  KEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEV  1413
             +EF+QIL  NR +LDPES S  + +    S S+     ++ + + D+D+       I EV
Sbjct  117   REFYQILKSNRDYLDPESVSTHSSARPSTSRSSFSDFENESENERDEDES------IPEV  170

Query  1412  EDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMD  1233
             E VS   M D++ I + MIS GY++EC K+YK IRK I+DEA+  LGVE ++F +I+KMD
Sbjct  171   ERVSLAAMTDLKAIADAMISAGYTRECLKIYKIIRKSIVDEALYHLGVESLTFQQIQKMD  230

Query  1232  WEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEF  1053
             WEVLEL+IKNWL+A+++AVKTLF GER LCD+VF S  D IRES F EISKE A+ LF F
Sbjct  231   WEVLELKIKNWLNAVKMAVKTLFYGERILCDHVF-SVSDKIRESCFSEISKEGALALFGF  289

Query  1052  PENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIR  873
             PEN+AK  K +PEK+FR+LD+Y A+++  PEIESIFS +  S++R+ +V SL +LG+A+R
Sbjct  290   PENVAK-CKKTPEKMFRILDLYEAVSDLWPEIESIFSFELTSTVRSTSVNSLIRLGEAVR  348

Query  872   TGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWL  693
             T +  FE  +QKDSSKST+AGGGIHPLT   MNY++ + D+S  LSDI ++ P      L
Sbjct  349   TMLTDFEMAIQKDSSKSTLAGGGIHPLTRYVMNYISFLVDYSGSLSDILADWPLTIPSPL  408

Query  692   PDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVK  513
             P+SYF   D++ES    IS+R AWLIL++LCKLD  A  YKD++++YLFLANNLQY+V K
Sbjct  409   PESYFGSPDNEESISSPISVRLAWLILVMLCKLDGKAAMYKDVALSYLFLANNLQYIVGK  468

Query  512   VRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKK  333
             VR S L   LG++W+++   KVKQYAANYER+GW  V+ASLPEN TA +  +++  HF+K
Sbjct  469   VRQSNLKFLLGDDWVTRHELKVKQYAANYERVGWSKVVASLPENSTAEIPVDQVIDHFRK  528

Query  332   FNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSI  153
             FN++F + + K ++ V++D  LRD +K+SLAR+++  Y++F++ +   M   K+    S+
Sbjct  529   FNSAFEETYTKQTSWVIADPKLRDDIKISLARRIVPIYKEFFEKYG-GMQLRKKMWVESL  587

Query  152   VKFAPEDVGHHLSDLFF  102
             V++ P+D+G++ SDLFF
Sbjct  588   VRYTPDDLGNYWSDLFF  604



>ref|XP_004302800.1| PREDICTED: uncharacterized protein LOC101312264 [Fragaria vesca 
subsp. vesca]
Length=610

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/580 (51%), Positives = 410/580 (71%), Gaps = 20/580 (3%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             E+++E  LE +  MIMKWNPE+S   K+TSLFYES+ EA  F+KCV +LQ+ M  L  E 
Sbjct  48    ETMVEEILENAAVMIMKWNPESSAFGKLTSLFYESKPEARQFIKCVNDLQRVMHVLVSED  107

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
             P SEKLV + NLM++AMKRLQKEF+QIL+MNRAHLDPES S+ +RSS  AS+++      
Sbjct  108   PTSEKLVHSHNLMQIAMKRLQKEFYQILSMNRAHLDPESVSSRSRSSRSASSTSDDDIDD  167

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
               D D            I+EVE VSS  MAD++ I ECMIS GY+KEC  +Y  IRK II
Sbjct  168   GEDADLAGYS-------ISEVEHVSSIAMADLKSIAECMISSGYAKECVHIYNMIRKSII  220

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DEA+ +LGVE++S S+I KMD E++EL+IKNWL+A+++++  LFNGER LCD+VFA    
Sbjct  221   DEAMYKLGVERISSSQINKMDREIVELKIKNWLNAVKVSMTILFNGERILCDHVFA-ISK  279

Query  1115  AIRESIFKEISKEAAMILFEFPENI-AKYAKNSPEK-VFRLLDMYNAIANHRPEIESIFS  942
             ++RES F  I++EAA +LF FP+ +  K  K+ PE+ +FRLLDMY AI+ H P IESIF 
Sbjct  280   SVRESCFAHIAREAATLLFGFPQVLLTKTKKSYPEETIFRLLDMYTAISEHWPGIESIFG  339

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              +S +++R++A+ SL +L +++R+ +++FE  +QKDSSKS VAGGG+HPLT+  M+YL+ 
Sbjct  340   FESTATVRSEAINSLVRLSESVRSMLSEFEISIQKDSSKSAVAGGGVHPLTLRVMSYLSL  399

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPL-PAISLRYAWlillllckLDVI  585
             + D+SNVL+DIF        DW P +     +S+++ +  AISLR  WLIL+L+CKLD  
Sbjct  400   LTDYSNVLADIFI-------DWTPPAKLPQPESEDTSVSTAISLRMVWLILVLVCKLDEK  452

Query  584   AEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             A+ YK++S++YLFLANNLQ+V+  VRTS L   L   W SK  AKV+Q+AANYERL WG 
Sbjct  453   AKQYKEVSLSYLFLANNLQHVISAVRTSNLQYLLSGEWTSKHEAKVRQFAANYERLAWGV  512

Query  404   VIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
             V++SLPEN +A MS +E +  F+ FN S  + ++K     V D  LRD +K S+ +KL+ 
Sbjct  513   VLSSLPENISAEMSWQEARLFFRNFNFSLEETYQKQKLNAVPDAKLRDDIKASVTKKLVS  572

Query  224   PYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              Y++FYD HK+++     R+ +  V+F PEDV H+LS+L+
Sbjct  573   VYKEFYDMHKVSVG--GVRNAAMYVRFTPEDVAHYLSNLY  610



>ref|XP_004137948.1| PREDICTED: uncharacterized protein LOC101208543 [Cucumis sativus]
 ref|XP_004165924.1| PREDICTED: uncharacterized LOC101208543 [Cucumis sativus]
 gb|KGN58903.1| hypothetical protein Csa_3G735030 [Cucumis sativus]
Length=641

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/627 (51%), Positives = 438/627 (70%), Gaps = 22/627 (4%)
 Frame = -2

Query  1937  MPRKGMRLIGF--------SPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKW  1782
             MPRKGMR + F        S + +S SS  R         F ++++E+A+E +  ++MKW
Sbjct  1     MPRKGMRSLLFQFSSPSNNSISRYSISSPSRTPALTPRRSFNDAMIEQAVESAAAIVMKW  60

Query  1781  NPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSE--KLVRAQNLMEVA  1608
             NP++S  AKVTS+FYE +REA  F+K V +LQKAM  +A +   S   +LV AQ LME+A
Sbjct  61    NPDSSTYAKVTSMFYEDKREAMQFIKRVNDLQKAMHLMASDDSVSSSDRLVYAQGLMEIA  120

Query  1607  MKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagd  1428
             MKRLQKEF+QIL+MNRAHLDPES S  +   S  S+++          D+          
Sbjct  121   MKRLQKEFYQILSMNRAHLDPESVSTRSSRCSTRSSTSVDFDEDGTLDDEIQVVEDS---  177

Query  1427  SITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSK  1248
              I+EVE VS  VM D+R I ECMIS GY+KEC  +YK IRK IIDE + RLG+EK+S S+
Sbjct  178   -ISEVEQVSFIVMEDLRAIAECMISSGYAKECVNMYKVIRKSIIDEGVYRLGLEKLSASR  236

Query  1247  IRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAM  1068
             I KMDWEVL+L+IKNWL A+++A++TLF GER LCD+VF+S+ ++IRES F +IS+E A+
Sbjct  237   INKMDWEVLDLKIKNWLDAIKLAIRTLFVGERILCDHVFSSS-ESIRESCFADISREGAL  295

Query  1067  ILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKL  888
             +LF FPE +AK +K SPEK+FR+LDMY++IA + P++ESIFS +S+S +R+QA+TSL KL
Sbjct  296   LLFGFPELVAK-SKKSPEKMFRVLDMYSSIAENWPDVESIFSSESSSVVRSQALTSLTKL  354

Query  887   GDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPI  708
             G+ +R  +   E  +QK+SSKS VAGGG+H LT+ +MNYLT +AD+ N L+DIF++  P 
Sbjct  355   GELVRAIVMDLEYSIQKNSSKSPVAGGGVHSLTLLSMNYLTFLADYCNSLTDIFADWSPP  414

Query  707   PKDWLPDSYFA-VSDSDES-PLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANN  534
              K  L   +F+  S++D+S     ISLR  WLIL+LLCKLD  A+ YKD+S++YLFLANN
Sbjct  415   EKSSLEHIFFSSTSETDDSQSSSGISLRMGWLILVLLCKLDNKAKRYKDVSLSYLFLANN  474

Query  533   LQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEE  354
             L+++V KVR+S L   LG+ W++KQ  KV+Q+AA YE L WG V  SLPENPT   S EE
Sbjct  475   LEHIVSKVRSSNLQYLLGDEWMAKQEVKVRQFAAKYEALAWGRVFDSLPENPTEKFSQEE  534

Query  353   IKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEK  174
              K+ F+ FN +F + HRK  +CV+ D  LRD +K+S+ RKL+  Y +FY   K      +
Sbjct  535   AKEIFRNFNMAFQETHRKQKSCVIPDPKLRDEVKLSIGRKLVWFYGEFYRAQKAYGGANE  594

Query  173   ERHFSSIVKFAPEDVGHHLSDLFFEPS  93
             + +    ++F+PED+G++LSDL+FEPS
Sbjct  595   KPY----IRFSPEDIGNYLSDLYFEPS  617



>ref|XP_004294620.1| PREDICTED: uncharacterized protein LOC101308554 [Fragaria vesca 
subsp. vesca]
Length=625

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/586 (51%), Positives = 419/586 (72%), Gaps = 14/586 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNP-EASEAAKVTSLFYESRREANDFVKCVRNLQKAMQ-FL  1668
             F +S+ME  +E++  +I KW+  + S   K+ SLF + RREA  ++KCV++LQ AM  F+
Sbjct  31    FSDSLMEENIEVAQTLITKWDSSDDSSYTKLISLFRDDRREAKLYLKCVKDLQSAMHHFV  90

Query  1667  AMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgf  1488
               ++  +EKL+ AQ LM+ AMKRL+KEF+QIL+ NR +L+ E+ S+S  S S AST    
Sbjct  91    DSQETSAEKLITAQTLMQAAMKRLEKEFYQILSDNRENLEAETVSSSRSSESRASTPRTS  150

Query  1487  sstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIR  1308
             + +S  D++ + +D     +     E VS   M D++ I +CMIS GY KEC K+YK IR
Sbjct  151   TRSSVSDLESESEDESSILEG----EHVSHIPMDDLKSIADCMISAGYGKECVKIYKIIR  206

Query  1307  KWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFA  1128
             K  +DEA+  LGVEKM+ S+++KMDW VLE +IKNWL+A+++AVKTLF GER LCD+VF+
Sbjct  207   KSNMDEALYHLGVEKMTLSQVQKMDWNVLETKIKNWLNAVKVAVKTLFYGERLLCDHVFS  266

Query  1127  STPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESI  948
             ++ D+IRES F EISKEAA  LF FPE +AK  K SPEK+FR LD+Y AI++  PEIESI
Sbjct  267   AS-DSIRESCFTEISKEAATTLFSFPELVAK-CKKSPEKMFRTLDLYQAISDLWPEIESI  324

Query  947   FSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYL  768
             FS +S S++R+  V SL KLG+A+RT +  FE  +QKD SK+ V  GG+HPLT   MNY+
Sbjct  325   FSFESTSAVRSSGVNSLIKLGEAVRTMLEDFEAAIQKDHSKTAVPAGGVHPLTRYVMNYI  384

Query  767   TSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDV  588
             T + D++ +L+DIF++ P   +  LP++YF   D DESP   IS+R AWL+L+LLCKLD 
Sbjct  385   TFLTDYTEILADIFADYPLTLQTPLPEAYFGCYDVDESP---ISVRIAWLVLVLLCKLDG  441

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTS-RLNRFLGENWLSKQSAKVKQYAANYERLGW  411
              AE YKD++++YLFLANNLQYVV K+R S  L   LG+ W+ K  +KVKQYA NYER+GW
Sbjct  442   KAELYKDVALSYLFLANNLQYVVAKIRNSTNLKYLLGDYWVRKHESKVKQYAGNYERMGW  501

Query  410   GDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKL  231
               V ASLPENPTA +S ++ K++FK+FNA+F + ++K S  VV+D  LRD LKV++A+KL
Sbjct  502   SKVYASLPENPTADISSDQAKKYFKQFNAAFEEVYKKQSTWVVTDSKLRDELKVTVAKKL  561

Query  230   LRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFEPS  93
             +  YR+FY+ H++ +   KE    S+V++APE++ ++LSDL +  S
Sbjct  562   VPVYREFYEMHRVGL--RKECGVDSLVRYAPENLDNYLSDLLYGDS  605



>ref|XP_009146924.1| PREDICTED: exocyst complex component EXO70A1 [Brassica rapa]
Length=614

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/573 (49%), Positives = 411/573 (72%), Gaps = 16/573 (3%)
 Frame = -2

Query  1814  LEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLV  1635
             +E +  +I +WN E S  AKVTS+FYE+++EA  F++ V++LQK M+ L  E P SE+LV
Sbjct  35    IESAADIIERWNTETSTYAKVTSMFYENKQEAMVFIERVKDLQKTMELLVSEDPNSERLV  94

Query  1634  RAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddd  1455
             RAQ LM++AMKRLQKEF+QIL+MNRA+LDPES S  +  +S  S+ + F+        D 
Sbjct  95    RAQRLMQIAMKRLQKEFYQILSMNRAYLDPESVSTRSSLTSERSSYSDFNDEDSHTGGDS  154

Query  1454  dddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRL  1275
                       I EVE+ SS VM D+R I ECMI  GY+KEC  +YK IRK IIDE + RL
Sbjct  155   ----------IVEVEEASSKVMTDLRSIAECMIGSGYAKECVSIYKSIRKSIIDEGVYRL  204

Query  1274  GVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIF  1095
              VEK++  K ++M WE +EL+I++WL A++++++TLF GE+ LCD+VF ++ D+IRES F
Sbjct  205   EVEKITAVKAKRMSWEEIELKIRSWLEAVKVSMETLFKGEKILCDHVFEAS-DSIRESCF  263

Query  1094  KEISKEAAMILFEFPENIA-KYAKNSPEK--VFRLLDMYNAIANHRPEIESIFSMDSASS  924
              EIS+E A++LF FPE +A + +K +P K  +FRLLDMYN++A +   IE+IFS +S S 
Sbjct  264   SEISRERAILLFTFPEIVALRTSKKNPPKDIIFRLLDMYNSVAGNWRAIEAIFSFESTSL  323

Query  923   IRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSN  744
             +R+QA+ SL  L ++IR+ +  FE+ + KDSSK  V GGG+HPLT+  M++++ +AD+SN
Sbjct  324   VRSQALKSLVSLSESIRSLLLDFESRIHKDSSKVVVHGGGVHPLTLSVMSHISLLADYSN  383

Query  743   VLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDI  564
             VL DI + +PP  +  +P+SY  VSDSD SP   +++R+AWLIL+LLCK+D  A +YKD 
Sbjct  384   VLVDILAGSPPPDRSLIPESYLNVSDSDNSPSSELAIRFAWLILVLLCKIDRKANYYKDC  443

Query  563   SIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPE  384
             S+ YLFL NNL++VV +VR S+LN+ LG++W+ +  AK+KQ++ +Y+RL WG V+A+LPE
Sbjct  444   SVQYLFLTNNLRHVVSRVRFSKLNQLLGDDWVKRHVAKIKQFSDSYKRLAWGPVLATLPE  503

Query  383   NPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYD  204
             N T  MSPEE+K+ F+KF+  F +A+ K  ACVV D  L++ +K+S+ARKL+  YR+FY+
Sbjct  504   NRTVEMSPEEVKERFEKFSEGFERAYCKQGACVVPDLELKEEIKLSIARKLVPVYREFYN  563

Query  203   THKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             T +  +         ++V+F PED+ +H+S+LF
Sbjct  564   TRRSVILAGA--GGVTVVRFTPEDIENHMSNLF  594



>ref|XP_004305227.1| PREDICTED: exocyst complex component 7-like [Fragaria vesca subsp. 
vesca]
Length=633

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/624 (49%), Positives = 422/624 (68%), Gaps = 20/624 (3%)
 Frame = -2

Query  1937  MPRKGMRLIGF-----------SPNYWsssstvraspsagSDHFYESVMERALEISGPMI  1791
             MP KGMR + F           SP+  S S        +    F ++++E  +  +  + 
Sbjct  1     MPTKGMRSLLFHHKAPSFSVHPSPSRSSISFPTPRRYPSAGLSFSDAMIEEIIGNAAVLA  60

Query  1790  MKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEV  1611
             +KW+PEAS  A VTS+FYES+ EA+ F+K V +LQK M FL  E P SEKLV   +LM++
Sbjct  61    IKWDPEASGYANVTSMFYESKTEAHLFIKSVNDLQKVMHFLVAEDPTSEKLVHGHSLMQI  120

Query  1610  AMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvag  1431
             AMKRLQKEF+QIL+ NRAHLDPES S  +RSS   S ST      D  V D+D       
Sbjct  121   AMKRLQKEFYQILSTNRAHLDPESVSTRSRSSRANSVSTSDDEIDDGAVTDEDLRFAGES  180

Query  1430  dSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFS  1251
               ++E E VSS  MAD++ I ECMIS GY+KEC  +YK IRK IIDE + +LGVE+ + S
Sbjct  181   --VSEAEQVSSVAMADLKSIAECMISSGYAKECVHIYKMIRKSIIDEGMYKLGVERFASS  238

Query  1250  KIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAA  1071
             +I K+D EVL++RIKNWL+A+++A+ +LFNGE+ LCD VFA + ++IRES F  I++EAA
Sbjct  239   RIHKIDKEVLDIRIKNWLNAVKVAMTSLFNGEKILCDTVFAVS-NSIRESCFTHIAREAA  297

Query  1070  MILFEFPENIAKYAKN--SPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSL  897
              +LF FP+ +   +KN  S E +FRLLDMY AI+ + PEI+SIFS DS +++RTQA+ SL
Sbjct  298   TLLFGFPQALVAKSKNFSSEENIFRLLDMYTAISENWPEIDSIFSFDSTATVRTQALNSL  357

Query  896   AKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNT  717
              K+G+ +R+ ++ FE  +QK+SSK+ VAGGG+HPLT   MNYL+ + D+SNVL+DIF + 
Sbjct  358   IKIGETVRSMLSDFEASIQKESSKTPVAGGGVHPLTQRVMNYLSILTDYSNVLADIFVDC  417

Query  716   PPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLAN  537
             PP  K  LP+  F   +S+ES  P I    AW++L+L+CKLD  A++YKD+S++YLFL N
Sbjct  418   PPPAKGLLPE--FDSPNSEESSAPPICHIMAWIVLILICKLDGKAKNYKDVSVSYLFLTN  475

Query  536   NLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPE  357
             NLQYV+ KVR+S L   LGE W++K   KV+Q+A +YE+L WG V ++LPEN TA +SP+
Sbjct  476   NLQYVISKVRSSNLQYLLGEQWITKYEGKVRQFAVSYEQLAWGKVFSTLPENLTAEVSPD  535

Query  356   EIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKE  177
             E +  F+ FN S  +A RK    VV D  LR+ +K  L + L+  Y++F+DTH++++   
Sbjct  536   EARLVFRNFNFSLEEAFRKQKTSVVPDEKLREEIKALLIKTLVSVYKEFHDTHRVSVG--  593

Query  176   KERHFSSIVKFAPEDVGHHLSDLF  105
               R+ +  V+  PEDV  +LSDLF
Sbjct  594   SARNLALNVRLTPEDVEAYLSDLF  617



>ref|XP_002534730.1| protein binding protein, putative [Ricinus communis]
 gb|EEF27653.1| protein binding protein, putative [Ricinus communis]
Length=630

 Score =   540 bits (1390),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 299/614 (49%), Positives = 425/614 (69%), Gaps = 15/614 (2%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPE-ASEA  1761
             MPRKGMR I F P   ++SS+     S     F +++M+  +E +  ++ KW+ + +S  
Sbjct  1     MPRKGMRTIFFKPT--TASSSSSPMRSPQRHTFSDTLMDENIENAYSLVSKWDSDDSSNY  58

Query  1760  AKVTSLFYES-RREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEF  1584
               ++SLF ++ R+EA  ++  +R LQ AMQ+   E   SEKLVRAQNLM++AMKRL+KEF
Sbjct  59    CNLSSLFTQNNRQEATQYLNSIRELQSAMQYYITENSASEKLVRAQNLMQIAMKRLEKEF  118

Query  1583  FQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDV  1404
             ++IL  NR +LD ES S+ +  +S  S  +  S   D + D        +   I+EVE V
Sbjct  119   YRILKSNRDYLDAESVSSHSSRASNVSAVSEDSENDDSEDDSSSRHGGGS---ISEVERV  175

Query  1403  SSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEV  1224
             S   MAD++ I +CMI+ GY KEC ++YK +RK IIDE++  LGVE ++FS+++KMDWEV
Sbjct  176   SLIAMADLKAIADCMIASGYGKECVRIYKLVRKSIIDESLYHLGVESLNFSQVQKMDWEV  235

Query  1223  LELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPEN  1044
             +E++IK WL+A++ AVKTLF GER LCD+VF+++  +I ES F EI++E A+ LF FPEN
Sbjct  236   VEIKIKTWLNAVKFAVKTLFYGERILCDHVFSASA-SITESCFAEITREGALALFAFPEN  294

Query  1043  IAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGI  864
             +AK  K +PEK+F+ LD+Y AIA+   EIESIF+ +S S++RTQAVTSL KLG+ +RT +
Sbjct  295   VAK-CKKTPEKMFKTLDLYEAIADLWQEIESIFNFESTSTVRTQAVTSLIKLGEGVRTML  353

Query  863   AQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDS  684
             + FE  + KD+SK+ V G G+HPLT   MNY+  +AD+S VLSDI ++ P   +  LP+S
Sbjct  354   SDFEAAISKDNSKTPVPGAGVHPLTRYVMNYIAFLADYSGVLSDIVADWPLTSQSPLPES  413

Query  683   YFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRT  504
             YF   + ++    AIS+R AWLIL+LLCKLD  AE YKD++ +YLFLANNLQYVV KVRT
Sbjct  414   YFGSPEHEDGAATAISVRLAWLILVLLCKLDGKAELYKDVAQSYLFLANNLQYVVSKVRT  473

Query  503   SRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNA  324
             S L   +G++W+ K  AKV+QYA NYER+GW  VIASLPE+ TA M+   + + FK+FN 
Sbjct  474   SSLKFLIGDDWIRKHEAKVRQYAQNYERMGWSKVIASLPEDSTAAMTVNSVAERFKRFNL  533

Query  323   SFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKF  144
             +F   ++K S+ VV D  LRD +KVS+ARK++  YR+FY+  ++ +          IV+F
Sbjct  534   AFEDTYKKQSSWVVPDAKLRDEIKVSVARKIVPVYREFYEKFRVVVRS------VGIVRF  587

Query  143   APEDVGHHLSDLFF  102
             AP+D+ ++LSDLFF
Sbjct  588   APDDLENYLSDLFF  601



>ref|XP_008222767.1| PREDICTED: LOW QUALITY PROTEIN: exocyst complex component EXO70A1 
[Prunus mume]
Length=627

 Score =   536 bits (1382),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 296/616 (48%), Positives = 428/616 (69%), Gaps = 20/616 (3%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSD---HFYESVMERALEISGPMIMKWNPEAS  1767
             MPRKGMR + F     S S++   S +  S     F +S+ME  +EI+  +I +W+ ++S
Sbjct  1     MPRKGMRTLFFKSPSPSPSNSPSRSATQPSSPRRSFSDSLMEENIEIAQTLITQWDSDSS  60

Query  1766  EAAKVTSLFYESRREANDFVKCVRNLQKAMQ-FLAMEQPRSEKLVRAQNLMEVAMKRLQK  1590
                 ++SLF++ R+EA  ++K V++LQ AMQ FL+ +   +EKL+ AQNLM+ AMKRL+K
Sbjct  61    SYTNISSLFHDDRQEARLYLKSVKDLQSAMQHFLSSQDSSAEKLIIAQNLMQSAMKRLEK  120

Query  1589  EFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVE  1410
             EF+QIL+ NR +LD E+ S+ +  +S  S+ +   S S+ +     +        ++ V+
Sbjct  121   EFYQILSANRVYLDAETVSSRSSRASARSSVSDLESESEDESRATTES-------VSAVD  173

Query  1409  DVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDW  1230
              +S+  M+D++ I +CMIS GY KEC ++YK IRK I+DE +  LGVEK+S S+++KMDW
Sbjct  174   QISAIAMSDLKSIADCMISSGYGKECVRIYKIIRKSIVDEGLYVLGVEKLSLSQVQKMDW  233

Query  1229  EVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFP  1050
             +VLE +IKNWLSA+++AVKTLF GER  C+ VFA++ D+I ES F EISKEAAM LF FP
Sbjct  234   QVLETKIKNWLSAVKVAVKTLFYGERLFCEQVFAAS-DSIAESCFNEISKEAAMTLFGFP  292

Query  1049  ENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRT  870
             E + K  K SPEK+FR+LD+Y A+++  PEIESIFS +S S++R+ AV SL KLG+A+RT
Sbjct  293   ELVGKCKKLSPEKMFRILDLYQAVSDLWPEIESIFSFESTSAVRSLAVNSLIKLGEAVRT  352

Query  869   GIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLP  690
              +  FE+ +QKDSSK+ V  GG+HPLT   MNY++ +AD+S +L DI  + P      LP
Sbjct  353   MLTDFESAIQKDSSKTPVPSGGVHPLTRYVMNYISFLADYSEILGDIVFDWPLTISTPLP  412

Query  689   DSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKV  510
             ++YF   D++ESP   IS+R AWL+L+LLCKLD  A+ YKD++++YLFLANNLQYVV KV
Sbjct  413   EAYFGCYDAEESP---ISIRLAWLVLVLLCKLDGKAKLYKDVALSYLFLANNLQYVVGKV  469

Query  509   RTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKF  330
             R S +   LGE W+ K  +KVKQYA+NYER+GW  V AS            + K +FK+F
Sbjct  470   RRSNVKYLLGEYWVEKHESKVKQYASNYERMGWSKVFAS---XXXXXXXXXQAKSYFKRF  526

Query  329   NASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIV  150
             NA+F +A++K ++ VV D  LRD LKVS+A+KL+  YR+FY+ H++ M +E      S+V
Sbjct  527   NAAFEEAYKKQTSWVVPDSKLRDELKVSVAKKLVPVYREFYEKHRVGMRRECGED--SLV  584

Query  149   KFAPEDVGHHLSDLFF  102
             ++APE++ ++LSDL +
Sbjct  585   RYAPENLDNYLSDLLY  600



>gb|KFK38344.1| hypothetical protein AALP_AA3G101900 [Arabis alpina]
Length=628

 Score =   535 bits (1379),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 297/581 (51%), Positives = 402/581 (69%), Gaps = 17/581 (3%)
 Frame = -2

Query  1817  ALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKL  1638
              +E +  +I  WN E S  AKVTS+FYE++ EA  F+  V++LQK M  L  E P SE+L
Sbjct  35    VIESAADIIETWNTETSTFAKVTSMFYENKPEAMVFMDRVKDLQKTMDLLLTEDPNSERL  94

Query  1637  VRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvdd  1458
             +R+Q LME+AMKRLQKEF+QIL+MNRA LDPES S  +  +S  S+ + F    +     
Sbjct  95    MRSQKLMEIAMKRLQKEFYQILSMNRAFLDPESVSTRSSLTSARSSYSDFPEDDESQHTV  154

Query  1457  ddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISR  1278
              D         I EVE+VS+ VM D+R I ECMI+ GY+KEC  +YK IRK IIDE I R
Sbjct  155   GDA--------IIEVEEVSTNVMTDLRSIAECMITSGYAKECISIYKSIRKSIIDEGIYR  206

Query  1277  LGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESI  1098
             L +EK+S SK +KM WE  EL+I++WL AM+++++TLF GE+ LCD+VF S+ DAIRES 
Sbjct  207   LDIEKISTSKAKKMSWEETELKIRSWLKAMKVSMETLFKGEKILCDHVFQSS-DAIRESC  265

Query  1097  FKEISKEAAMILFEFPENIAKYA---KNSPEKVFRLLDMYNAIANHRPEIESIFSMDSAS  927
             F +ISK+ A++LF FPE I       K+ PEK+FRLLDMY++IA H   I SIF+ +S+ 
Sbjct  266   FSDISKDGAILLFGFPEIITTKTSKKKSPPEKIFRLLDMYSSIAGHWQAIASIFAFESSL  325

Query  926   SIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHS  747
              +R+QA+ SL  L ++IR+ + +FE+ +QKDSSK  V GGG+HPLTI   N+L+ +AD+S
Sbjct  326   IVRSQALKSLVSLSESIRSLLIEFESGIQKDSSKVVVPGGGLHPLTISVTNHLSLLADYS  385

Query  746   NVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKD  567
             NVL DI + +PP  K  LP+SYF VSDSD+SP   +S+R+AWLIL+LLCK+D  A HYKD
Sbjct  386   NVLVDILAGSPPPDKTLLPESYFNVSDSDDSPSSELSIRFAWLILVLLCKIDHKANHYKD  445

Query  566   ISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLP  387
              S+ YLFL NNL +VV + R S L   LGE+W+ K  AK+KQ++ +Y+RL WG V+ASL 
Sbjct  446   CSVQYLFLTNNLHHVVSRARFSNLKHLLGEDWIKKHVAKIKQFSDSYKRLAWGPVVASLA  505

Query  386   ENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFY  207
             +  T  MSPEE+K+ F+ F+  F +A+ K SACVV D  LR+ +KVS+ARKL+  YR+FY
Sbjct  506   DYRTVEMSPEEVKERFEIFSECFERAYGKQSACVVPDPKLREEIKVSIARKLVPIYREFY  565

Query  206   DTHK-----LTMPKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
             +T +     L       R    +V+F PEDV ++L+DLF E
Sbjct  566   NTRRSSVLLLAGGGGGVRDLGLVVRFTPEDVENYLADLFTE  606



>ref|XP_002276070.1| PREDICTED: exocyst complex component EXO70B1-like [Vitis vinifera]
Length=622

 Score =   535 bits (1378),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 282/580 (49%), Positives = 411/580 (71%), Gaps = 14/580 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F E +ME +++ +  +I KW+ ++      TSLF+E+R+E  +F+KCV++L+ AM F   
Sbjct  31    FSEYMMEESVDHAHAIITKWDTKSP-----TSLFHENRKEGREFLKCVKDLRTAMHFFLS  85

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             ++  S KLV AQ LM++AMKRL+KEF+QIL+ NR  LDP+S  +     S  S    +  
Sbjct  86    QKSASGKLVLAQQLMQIAMKRLEKEFYQILSANRDRLDPDSVRSCVSGRSSNSDDDQYQC  145

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
                 D + +          I+EVE VS+  M D++ I +CMI CGY KEC K+YK IRK 
Sbjct  146   DVGSDEEINVAGES-----ISEVERVSALAMYDLKAIADCMIGCGYGKECVKIYKIIRKS  200

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE + R+G+E+ S S+I KM++E L+ +IK+WLSA+ IAVKTLFNGER LCD+VF+++
Sbjct  201   IVDEGLYRIGIERNSSSQISKMNFEALQHKIKHWLSAVRIAVKTLFNGERVLCDHVFSAS  260

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              D+IRES F EI++E A+ LF+FPE +A+  ++SP K+F  LD+Y AI++  PEIE IFS
Sbjct  261   -DSIRESSFAEITREGAINLFKFPELVARTKRSSPHKIFCFLDLYEAISDLLPEIELIFS  319

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              +S S++R Q  +SL KL +A+R  +++FE+V+QKDSSK+ V GGGIHPLT  AMNY++S
Sbjct  320   FESTSAVRLQVSSSLQKLSEAVRATLSEFESVVQKDSSKTLVTGGGIHPLTESAMNYISS  379

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             +A++S VLS+I ++ P   +   P+SYF    S ++P  A+++R AWLIL+LLC+LD  A
Sbjct  380   LANYSGVLSEILADWPLPVQSPFPESYFDSPKSIDNPPSAMAMRLAWLILVLLCRLDCKA  439

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
             E YKDI ++YLFLANNL +V+ KVRTS L   LGE W+SK   KVKQY+A+YE +GW  V
Sbjct  440   ELYKDIGLSYLFLANNLHFVLEKVRTSNLRYLLGEEWISKHEKKVKQYSASYEVMGWTKV  499

Query  401   IASLPENPT-APMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
              +SLPEN + APMSPE++K+ F +FN +F +A+RK ++ VV D  LRD +KVS+A+KL+ 
Sbjct  500   FSSLPENNSQAPMSPEDVKECFGRFNLAFEEAYRKQTSWVVQDGKLRDDIKVSIAKKLVP  559

Query  224   PYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              Y +FY+ +   +  + ER+   +V+F+P+D+G++LSDL 
Sbjct  560   AYGEFYEKYLGML--DGERNLEVLVRFSPDDLGNYLSDLL  597



>ref|XP_003554337.1| PREDICTED: exocyst complex component EXO70B1-like [Glycine max]
Length=618

 Score =   534 bits (1376),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 292/574 (51%), Positives = 400/574 (70%), Gaps = 24/574 (4%)
 Frame = -2

Query  1796  MIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLM  1617
             +I+KWNP+ S  AKVTSLFYE + EA  ++  V  LQK+M  L  + P SEKL+ A NLM
Sbjct  43    LILKWNPDTSAYAKVTSLFYEDKTEAKHYIDSVNQLQKSMHSLLSQNPSSEKLILAHNLM  102

Query  1616  EVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrv  1437
             ++AMKRL+KEF+QIL+MNRAHLDPES SA +  +S  S+++ +      + DD       
Sbjct  103   QMAMKRLKKEFYQILSMNRAHLDPESVSARSSRTSANSSASDYDDDFAAEDDDIRAAGDS  162

Query  1436  agdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMS  1257
                 I+EVE VSS  MAD++LI +CM+S GY+KEC  VY  IRK IIDE I RLGVEK+S
Sbjct  163   ----ISEVEQVSSGAMADLKLIADCMVSSGYAKECVSVYILIRKSIIDEGIYRLGVEKLS  218

Query  1256  FSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKE  1077
              S+  KMDW VL+L+IK+WL A+ I+V+TLFNGER LCD+VF S  D++RES F EIS++
Sbjct  219   SSRANKMDWNVLDLKIKSWLEAIRISVRTLFNGERILCDHVF-SYSDSVRESCFAEISRD  277

Query  1076  AAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSL  897
              A +LF FPE +AK  K+S EK+FR+LDM+  ++   PEIESIFS D  S  R+Q + SL
Sbjct  278   GASLLFGFPELVAKTKKSSLEKLFRVLDMHAVVSELWPEIESIFSSDYNSGARSQVLVSL  337

Query  896   AKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNT  717
              +L ++ +  +A+FE+ +QKDSSKS V GGG+HPLTI  MNYL+ +AD+ NVLSDIF   
Sbjct  338   QRLTESAQILLAEFESTIQKDSSKSAVNGGGVHPLTIQTMNYLSVLADYINVLSDIF---  394

Query  716   PPIPKDW--------LPDSYFAVSDSDESPL-PAISLRYAWlillllckLDVIAEHYKDI  564
                P+DW        LP+SY    +SD S   PA++ R+AWLIL+LLCKLD  A+H KD+
Sbjct  395   ---PRDWLPPPKSSSLPESYLYSPESDYSASKPALTARFAWLILVLLCKLDGKAKHCKDV  451

Query  563   SIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPE  384
             S++YLFLANNL YVV +VR+S L   LG++W+ K  AK K++ ANYE++ WG+V++SLPE
Sbjct  452   SLSYLFLANNLWYVVARVRSSNLQYVLGDDWILKHEAKAKRFVANYEKVAWGEVVSSLPE  511

Query  383   NPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYD  204
             NP A     E ++ F+ FN  F + +RK ++ VV+DR LRD +K S+AR ++  YR++Y+
Sbjct  512   NPAAA----EAREVFESFNRKFEEGYRKQNSFVVADRELRDEIKGSIARSIVPRYREWYN  567

Query  203   THKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
                 T+   ++   +  V F PED+ ++L +LFF
Sbjct  568   VVLATVGTVRDLTATEYVTFTPEDIENYLVNLFF  601



>ref|XP_009354556.1| PREDICTED: exocyst complex component EXO70B1-like [Pyrus x bretschneideri]
Length=632

 Score =   535 bits (1377),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 292/619 (47%), Positives = 432/619 (70%), Gaps = 23/619 (4%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDH----FYESVMERALEISGPMIMKWNPEA  1770
             MPRKGMR + F     S S++   + +         F +S+ME  +EI+  +I KW+ ++
Sbjct  1     MPRKGMRTLFFKSPSPSPSNSPSRTTAMLPSSPRHSFSDSLMEENIEIAEALITKWDSDS  60

Query  1769  SEAA--KVTSLFYESRREANDFVKCVRNLQKAMQ-FLAMEQPRSEKLVRAQNLMEVAMKR  1599
                +   VTS+FY+ R+EA  ++K V +LQ AMQ FL  +   +EKL+RAQNLM+ AMKR
Sbjct  61    GSTSYTAVTSIFYDDRQEARLYLKSVGDLQSAMQHFLISQTTSAEKLIRAQNLMQSAMKR  120

Query  1598  LQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSIT  1419
             L+KEF+QIL+ NR +LD E+ S+ +  +S  ++ +   S S+ +     +          
Sbjct  121   LEKEFYQILSANREYLDAETVSSRSSRASTRTSVSDQDSESEDESRVATES---------  171

Query  1418  EVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRK  1239
              V+ +S   M+D++ I +CMI+ GY KEC ++Y  IRK I+DE++  LGVEKM+ S+++K
Sbjct  172   -VDHISWVAMSDLKSIADCMIASGYGKECVRIYNIIRKSILDESLYLLGVEKMTLSQVQK  230

Query  1238  MDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILF  1059
             MDW VLE +IKNWL+A++++VKTLF GER LCD+VFA++ D+I ES F EISKEAAM LF
Sbjct  231   MDWSVLEKKIKNWLNAVKVSVKTLFYGERLLCDHVFAAS-DSIAESCFSEISKEAAMTLF  289

Query  1058  EFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDA  879
              FPE++ K  K SPEK+FR+LD+Y A+++  PEIESIFS +S S++R+ AV SL KLG+A
Sbjct  290   GFPESVGKSKKLSPEKMFRVLDLYQAVSDLWPEIESIFSFESTSAVRSLAVNSLVKLGEA  349

Query  878   IRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKD  699
             +R+ + +FE+ +QK++SK+ V  GG HPLT   MNY+T ++D++ VL+DI ++ P     
Sbjct  350   VRSMLEKFESAIQKETSKTPVPAGGAHPLTRYVMNYITFLSDYTEVLTDIVADWPLAIST  409

Query  698   WLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVV  519
              LP++YF   D++ES L   S+R+AWL+L+LLCKLD  A  YKD++++YLFLANNLQYVV
Sbjct  410   PLPEAYFGCYDAEESQL---SIRFAWLVLVLLCKLDGKAALYKDVALSYLFLANNLQYVV  466

Query  518   VKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHF  339
              KVR+S L   LG+ W+ K  +KVKQYAANYER+GW  V  SLPE+PTA +S ++   +F
Sbjct  467   GKVRSSNLKSLLGDYWVEKHDSKVKQYAANYERMGWTKVFESLPEDPTAEISSDQATVYF  526

Query  338   KKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFS  159
             K+F A+F +A++K ++ VV D  LRD +KVS+A+KL+  YR+FY+ H+  + +       
Sbjct  527   KRFKAAFEEAYKKQTSWVVMDPKLRDEIKVSVAKKLVPAYREFYEKHRNGIMRACGE--D  584

Query  158   SIVKFAPEDVGHHLSDLFF  102
             S+V++APE++ ++LSDL +
Sbjct  585   SLVRYAPENLDNYLSDLLY  603



>ref|XP_008385184.1| PREDICTED: exocyst complex component EXO70B1-like [Malus domestica]
Length=632

 Score =   532 bits (1371),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 291/619 (47%), Positives = 432/619 (70%), Gaps = 23/619 (4%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsag----SDHFYESVMERALEISGPMIMKWNPEA  1770
             MPRKGMR + F     S S++   +           F +S+ME  +EI+  +I KW+ ++
Sbjct  1     MPRKGMRTLFFKSPSPSPSNSPSRTTXMLPSSPRHSFSDSLMEENIEIAEALITKWDSDS  60

Query  1769  SEAA--KVTSLFYESRREANDFVKCVRNLQKAMQ-FLAMEQPRSEKLVRAQNLMEVAMKR  1599
                +   VTS+FY+ R+EA  ++K V +LQ AMQ FL  +   +EKL RAQNLM+ AMKR
Sbjct  61    GSTSYTAVTSIFYDDRQEARLYLKSVGDLQSAMQHFLISQTTSAEKLXRAQNLMQSAMKR  120

Query  1598  LQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSIT  1419
             L+KEF+QIL+ NR +LD E+ S+ +  +S  ++ +   S S+ +     +          
Sbjct  121   LEKEFYQILSANREYLDAETVSSRSSRASTRTSVSDQDSESEDESRVATES---------  171

Query  1418  EVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRK  1239
              V+ +S   M+D++ I +CMI+ GY KEC ++Y  IRK I+DE++  LGVEKM+ S+++K
Sbjct  172   -VDHISWVAMSDLKSIADCMIASGYGKECVRIYNIIRKSILDESLYJLGVEKMTLSQVQK  230

Query  1238  MDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILF  1059
             MDW+VLE +IKNWL+A++++VKTLF GER LCD+VFA++ ++I ES F EISKEAAM LF
Sbjct  231   MDWKVLETKIKNWLNAVKVSVKTLFYGERLLCDHVFAAS-NSIAESCFNEISKEAAMTLF  289

Query  1058  EFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDA  879
              FPE++ K  K SPEK+FR+LD+Y A+++  PEIESIFS +S S++R+ AV SL KLG+A
Sbjct  290   GFPESVGKSKKLSPEKMFRVLDLYQAVSDLWPEIESIFSFESTSAVRSLAVNSLVKLGEA  349

Query  878   IRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKD  699
             +R+ + +FE+ +QK++SK+ V  GG+HPLT   MNYLT + D++ VL+DI ++ P     
Sbjct  350   VRSMLEEFESAIQKETSKTPVPAGGVHPLTRYVMNYLTFLTDYTEVLTDIVADWPLAIST  409

Query  698   WLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVV  519
              LP++YF   D++ES L   S+R AWL+L+LLCKLD  A  YKD++++YLFLANNLQYVV
Sbjct  410   PLPEAYFGCYDAEESQL---SIRVAWLVLVLLCKLDGKAALYKDVALSYLFLANNLQYVV  466

Query  518   VKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHF  339
              KVR+S L   LG+ W+ K  +KV+QYAANYER+GW  V  SLP++PTA +S ++ + +F
Sbjct  467   GKVRSSNLKYLLGDYWVEKHDSKVQQYAANYERMGWTKVFDSLPKDPTAEISSDQARIYF  526

Query  338   KKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFS  159
             K+FNA+F +A++K ++ VV D  LRD +KVS+A+KL+  YR+FY+ H+  + +       
Sbjct  527   KRFNAAFEEAYKKQTSWVVMDPKLRDEIKVSVAKKLVPTYREFYENHRNGIMRACGE--D  584

Query  158   SIVKFAPEDVGHHLSDLFF  102
             S+V++APE++ ++LSDL +
Sbjct  585   SLVRYAPENLDNYLSDLLY  603



>emb|CDY41604.1| BnaC05g43410D [Brassica napus]
Length=619

 Score =   531 bits (1369),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 279/573 (49%), Positives = 405/573 (71%), Gaps = 15/573 (3%)
 Frame = -2

Query  1814  LEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLV  1635
             +E +  +I +WN E S  AKVTS+FYE+++EA  F+  V++LQK M  L  E   SE+LV
Sbjct  35    IESAADVIERWNTETSTYAKVTSMFYENKQEAMVFIDRVKDLQKTMDLLVSEDANSERLV  94

Query  1634  RAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddd  1455
             RAQ LME+AMKRLQKEF+QIL+MNRA+LDPES S  +  +S  S+++ F    D     D
Sbjct  95    RAQRLMEIAMKRLQKEFYQILSMNRAYLDPESVSTRSSLTSERSSNSDFIEDEDSHTGGD  154

Query  1454  dddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRL  1275
                       I EVE+ SS VM ++R I ECMI  GY+KEC  +YK IRK IIDE + RL
Sbjct  155   S---------IVEVEEASSNVMTELRSIAECMIGSGYAKECISIYKSIRKSIIDEGVYRL  205

Query  1274  GVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIF  1095
              VEK++ +K ++M WE +EL I++WL A++++++TLF GE+ LCD+VF ++ D+IRES F
Sbjct  206   EVEKITTAKAKRMSWEEIELNIRSWLEAVKVSMETLFKGEKILCDHVFGAS-DSIRESCF  264

Query  1094  KEISKEAAMILFEFPENIA-KYAKNSP--EKVFRLLDMYNAIANHRPEIESIFSMDSASS  924
              EIS+E A++LF FPE IA + +K +P  E +FRLLDMY ++A +   IE+IFS +S S 
Sbjct  265   SEISREGALLLFTFPEIIAFRTSKKNPPPEIIFRLLDMYTSVAGNWRAIEAIFSFESTSV  324

Query  923   IRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSN  744
             +R+QA+ SL  L ++IR+ +  FE+ + KDSSK  V GGG+HPLT+  +++++ +A++SN
Sbjct  325   VRSQALKSLVSLSESIRSLLLDFESRIHKDSSKVVVHGGGVHPLTLSVVSHISLLANYSN  384

Query  743   VLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDI  564
             VL DI + +PP  +  +P+SY  VSDSD+SP   +++R+AWLIL+LLCK+D  A +YKD 
Sbjct  385   VLVDILAGSPPPDRSLIPESYLNVSDSDDSPTSELAIRFAWLILVLLCKIDRKANYYKDC  444

Query  563   SIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPE  384
             S+ YLFL NNL++VV + R+S L R LG++W+ +  AKVKQ++ +Y+RL WG V+A+LPE
Sbjct  445   SVQYLFLTNNLRHVVSRARSSNLKRLLGDDWVKRHLAKVKQFSDSYKRLAWGPVLATLPE  504

Query  383   NPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYD  204
             N    MS EE+K+ F+KF+  F +A+ K  ACVV D  LR+ +K+S+ARKL+  YR+FY+
Sbjct  505   NRAVEMSAEEVKERFEKFSEGFERAYGKQGACVVPDVELREEIKLSIARKLVPVYREFYN  564

Query  203   THKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             T +  +         ++V+F PED+ +HLS+LF
Sbjct  565   TRRSVILAGA--GGVTVVRFTPEDIENHLSNLF  595



>emb|CDY41297.1| BnaA01g32220D [Brassica napus]
Length=608

 Score =   528 bits (1360),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 299/587 (51%), Positives = 410/587 (70%), Gaps = 21/587 (4%)
 Frame = -2

Query  1937  MPRKGMR---LIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEAS  1767
             MPRKGMR    +  +P+      T+    S  S   Y  ++E A +I    I +WN E S
Sbjct  1     MPRKGMRSLCCVAKTPSNLQPPLTLTPRQSLESAAAY-GIIESAADI----IERWNTETS  55

Query  1766  EAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKE  1587
               AKVTS+FYE + EA  F++ V NLQK M  L  E P SE+L+RAQ LME+AMKRLQKE
Sbjct  56    TFAKVTSMFYEDKAEAMVFIERVNNLQKTMDLLVSEDPNSERLMRAQRLMEIAMKRLQKE  115

Query  1586  FFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVED  1407
             F+QIL+MNRA+LDPES S  +  +S  S+ + F    D +   D          I EVE+
Sbjct  116   FYQILSMNRAYLDPESVSTRSSLTSARSSYSDFPEDDDSNTVGDS---------IVEVEE  166

Query  1406  VSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWE  1227
             V+S VM D+R I ECMI+ GY+KEC  +YK IRK IIDE + RL VEK+S +K +KM WE
Sbjct  167   VASKVMTDLRSIAECMIASGYAKECVIIYKTIRKSIIDEGVYRLDVEKISIAKAKKMSWE  226

Query  1226  VLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPE  1047
              +E++I++WL A++++++TLF GER LCD+VF S+ DAIRES F EIS+E A++LF FPE
Sbjct  227   EMEIKIRSWLEAVKVSMETLFKGERILCDHVFQSS-DAIRESCFTEISREGAVLLFGFPE  285

Query  1046  NI-AKYAKNS--PEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAI  876
              + AK +K S  PEK FRLLDMY+AIA +   IESIFS +S S +R+QA+ SL  L ++I
Sbjct  286   IVSAKISKKSSPPEKTFRLLDMYSAIAGNWRAIESIFSFESTSVVRSQALKSLVSLSESI  345

Query  875   RTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDW  696
             R+ +  FE+ ++KDSSK  V GGG+HPLT  AMN+++ +AD+SNVL DI S +PP  +  
Sbjct  346   RSQLRHFESRIEKDSSKVVVHGGGVHPLTTSAMNHISLLADYSNVLVDILSGSPPPDRTL  405

Query  695   LPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVV  516
             LP+SYF VSDSD+SP   +++R+AWLIL+LLCK+D  A HYKD S+ YLFL NNLQ+VV 
Sbjct  406   LPESYFNVSDSDDSPSSELAIRFAWLILVLLCKIDRKANHYKDCSVQYLFLTNNLQHVVS  465

Query  515   KVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFK  336
             + R S L + LG++W+ +  AK+KQ++ +Y+RL WG V+ +LPEN    +S EE+K+ F+
Sbjct  466   RARCSNLKQLLGDDWVRRHVAKIKQFSDSYKRLAWGPVLVTLPENRAVELSAEEVKERFE  525

Query  335   KFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHK  195
             KF+ SF +A+ K S CVV D  LR+ +K+S+ARKL+  YR++Y+T +
Sbjct  526   KFSDSFERAYGKQSTCVVPDSELREEIKLSIARKLVPIYREYYNTRR  572



>ref|XP_002531610.1| protein binding protein, putative [Ricinus communis]
 gb|EEF30766.1| protein binding protein, putative [Ricinus communis]
Length=634

 Score =   529 bits (1362),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 278/579 (48%), Positives = 403/579 (70%), Gaps = 13/579 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+ME  ++ +  +I KW P  S     TSLF++ R+EA +F+KCV++L++AM FL  
Sbjct  45    FTQSMMEENIDNAELIIKKWAPSTSSVTFATSLFHQ-RKEAKEFLKCVKDLRRAMHFLVS  103

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E   S KLV AQ LM++AM RL+KE + IL+ +   LDPES S  +   S          
Sbjct  104   EHRASAKLVLAQKLMQIAMNRLEKELYLILSAHHDQLDPESVSGPSSDGSSNFEDEDEEG  163

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
             + +      +         I  VE  +++ M+D++ I +CMIS GY KEC K+YK IRK 
Sbjct  164   SEEEIKLVGES--------IANVEREATYAMSDLKSIADCMISAGYGKECIKIYKLIRKS  215

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  LGVE++  S I+KM+WE LE  IKNWL+A++IAVKTLFNGE+ LCD+VF+++
Sbjct  216   IVDEGLYLLGVERLRSSHIQKMNWEALEHLIKNWLNAVKIAVKTLFNGEKALCDHVFSAS  275

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              + +RES F EI+KE A+ LF FPE I K +K SPE++F L++++ A++N  PEIE IF+
Sbjct  276   -ETLRESCFSEITKEGAINLFRFPELIVK-SKKSPERIFPLMELHEALSNLWPEIELIFN  333

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              +S S+I+ QA++SL KLG ++   ++ FE+ +QKDSSK+ V GGGIHPLT  AM+Y++S
Sbjct  334   SESTSAIKLQALSSLQKLGASVHAILSDFESTIQKDSSKTPVLGGGIHPLTRTAMSYISS  393

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             +AD+S +LSDI S++P +    LP+SYF    SD++  P +S+R AWLIL LLCKLD  A
Sbjct  394   LADYSGILSDIVSDSPSLRNTPLPESYFESPTSDDNSTPEVSVRLAWLILTLLCKLDSKA  453

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
             E YKD+S++YLFLANNLQ+++ KV T+RL   LGE+W+SK + K+KQYA NYE + W  V
Sbjct  454   EVYKDVSLSYLFLANNLQFIIEKVCTTRLKLVLGEDWISKHTKKLKQYAVNYEIMAWNKV  513

Query  401   IASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRP  222
              +SLPE P   + PE IK+ F++FNA+F +A++K ++ +V D  LRD LKVS+A KL+  
Sbjct  514   FSSLPEKPYQELPPEAIKERFQRFNAAFLEAYKKQTSWIVPDGKLRDELKVSIATKLVAA  573

Query  221   YRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             YR+F DT+ + +  EK  +  ++V+F P+D+G++LSDLF
Sbjct  574   YREFCDTYLVMLSGEK--NLETLVRFGPDDLGNYLSDLF  610



>ref|XP_003521354.1| PREDICTED: exocyst complex component EXO70A1-like [Glycine max]
Length=635

 Score =   526 bits (1356),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 291/589 (49%), Positives = 402/589 (68%), Gaps = 27/589 (5%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F+E +    +E +  +I+KWNP++S  AKVTSLFY+ R EA  ++ CV  LQK M  L  
Sbjct  43    FHEDIF---IEEAEALILKWNPDSSAYAKVTSLFYQDRNEAKQYISCVNQLQKTMHSLLS  99

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +   S+KL+ A NLM++AMKRL KEF+QIL+MNRAHLDPES SA +  +S  S+++ +  
Sbjct  100   QNLSSDKLILAHNLMQIAMKRLTKEFYQILSMNRAHLDPESVSARSSRTSANSSASDYDD  159

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
                 + DD           I+EVE VSS  MAD++LI +CMIS GY+KEC  VY  IRK 
Sbjct  160   DFAAEDDDIRAAGDS----ISEVEQVSSGAMADLKLIADCMISSGYAKECVSVYILIRKS  215

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             IIDE I RLGVEK+S S+  KMDWEVL+L+IK+WL A  I+V+TLFNGER LCD+VF S 
Sbjct  216   IIDEGIYRLGVEKLSSSRANKMDWEVLDLKIKSWLEATRISVRTLFNGERILCDHVF-SY  274

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              D++RES F EIS++ A +LF FPE +AK  K+SPEK+FR+LDM+   +   PEIESIFS
Sbjct  275   SDSVRESCFAEISRDGAALLFGFPELVAKTKKSSPEKLFRVLDMHAVASELLPEIESIFS  334

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              D  S +R+Q + SL +L ++ +  +A+FE+ +QK +SK  V GGG+H LTI  MNYL+ 
Sbjct  335   SDYNSGVRSQFLVSLQRLTESAQILLAEFESTIQKGTSKPAVNGGGVHSLTIQTMNYLSV  394

Query  761   IADHSNVLSDIFSNTPPIPKDW--------LPDSYFAVSDSDESP-LPAISLRYAWlill  609
             +AD+ NVLSDIF      P+DW        LP+SY    +SD S   PA++ R+AWLIL+
Sbjct  395   LADYLNVLSDIF------PRDWLPPQKSSSLPESYLYSPESDYSASTPALTARFAWLILV  448

Query  608   llckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAAN  429
             LLCKLD  A+H KD+S++YLFLANNL YVV +VR+S L   LG++W+ K  AK K++ +N
Sbjct  449   LLCKLDGKAKHCKDVSLSYLFLANNLWYVVARVRSSNLQYVLGDDWILKHEAKAKRFVSN  508

Query  428   YERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKV  249
             YE++ WG+V++SL ENP A     E +  F+ FN  F +A+RK ++ VV+DR LRD +K 
Sbjct  509   YEKVAWGEVVSSLAENPAAA----EARAVFENFNRKFEEAYRKQNSFVVADRELRDEIKG  564

Query  248   SLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             S+AR ++  YR++Y+     +   ++   +  V F PED+ ++L +LFF
Sbjct  565   SIARSIVPRYREWYNVLLAKVGSVRDLTATEYVTFTPEDIENYLVNLFF  613



>emb|CDY44712.1| BnaA05g28940D [Brassica napus]
Length=614

 Score =   525 bits (1353),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 281/573 (49%), Positives = 409/573 (71%), Gaps = 16/573 (3%)
 Frame = -2

Query  1814  LEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLV  1635
             +E +  +I +WN E S  AKVTS+FYE+++EA  F+  V++LQK M+ L  E P SE+LV
Sbjct  35    IESAADIIERWNTETSTYAKVTSMFYENKQEAMVFIHRVKDLQKTMELLVSEDPNSERLV  94

Query  1634  RAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddd  1455
             RAQ LME+AMKRLQKEF+QIL+MNRA+LDPES S  +  +S  S+ + F+        D 
Sbjct  95    RAQRLMEIAMKRLQKEFYQILSMNRAYLDPESVSTRSSLTSERSSYSDFNDEDSHTGGDS  154

Query  1454  dddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRL  1275
                       I EVE+ SS VM ++R I ECMI  GY+KEC  +YK IRK IIDE + RL
Sbjct  155   ----------IVEVEEASSKVMTELRSIAECMIGSGYAKECIGIYKSIRKSIIDEGVYRL  204

Query  1274  GVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIF  1095
              VEK++  K ++M WE +EL+I++WL A++++++TLF GE+ LCD+VF S+ D+IRES F
Sbjct  205   EVEKITAVKAKRMSWEEIELKIRSWLEAVKVSMETLFKGEKILCDHVFESS-DSIRESCF  263

Query  1094  KEISKEAAMILFEFPENIA-KYAKNSPEK--VFRLLDMYNAIANHRPEIESIFSMDSASS  924
              EIS+E A++LF FPE +A + +K +P K  +FRLLDMY ++A +   IE+IFS +S S 
Sbjct  264   GEISREGAILLFTFPEIVAFRTSKKNPPKEIIFRLLDMYTSVAGNWRAIEAIFSFESTSV  323

Query  923   IRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSN  744
             +R+QA+ SL  L ++IR+ +  FE+ + KDSSK  V GGG+HPLT+  M++++ +AD+SN
Sbjct  324   VRSQALKSLVSLSESIRSLLLDFESRIHKDSSKVVVHGGGVHPLTLSVMSHISLLADYSN  383

Query  743   VLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDI  564
             VL DI + +PP  +  +P+SY  VSDSD+SP   + +R+AWLIL+LLCK+D  A +YKD 
Sbjct  384   VLVDILAGSPPPDRSLIPESYLNVSDSDDSPSSELVIRFAWLILVLLCKIDRKANYYKDC  443

Query  563   SIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPE  384
             S+ YLFL NNL++VV +VR S+LN+ LG++W+ +  AK+KQ++ +Y+RL WG V+A+LPE
Sbjct  444   SVQYLFLTNNLRHVVSRVRFSKLNQLLGDDWVKRHVAKIKQFSDSYKRLAWGPVLATLPE  503

Query  383   NPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYD  204
             N T  MSPEE+K+ F+KF+  F +A+ K  ACVV D  L++ +K+S+ARKL+  YR+FY+
Sbjct  504   NRTVEMSPEEVKERFEKFSEGFERAYCKQGACVVPDLELKEEIKLSIARKLVPVYREFYN  563

Query  203   THKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             T +  +         ++V+F PED+ +H+S+LF
Sbjct  564   TRRSVILAGA--GGVTVVRFTPEDIENHMSNLF  594



>ref|XP_007162685.1| hypothetical protein PHAVU_001G171500g [Phaseolus vulgaris]
 gb|ESW34679.1| hypothetical protein PHAVU_001G171500g [Phaseolus vulgaris]
Length=635

 Score =   525 bits (1353),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 293/580 (51%), Positives = 401/580 (69%), Gaps = 24/580 (4%)
 Frame = -2

Query  1814  LEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLV  1635
             +E +  +I+KWNP++S  AKVTSLFY+ + EA  ++ CV  L + M  L    P S KL+
Sbjct  49    MEEAEALILKWNPDSSAYAKVTSLFYQDKTEAKHYINCVNQLHQTMHSLLSHSPSSHKLI  108

Query  1634  RAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddd  1455
              A NLM++AMKRL+KEF+QIL+MNRAHLDPES SA +  +S  S+S+ +      + DD 
Sbjct  109   LAHNLMQIAMKRLRKEFYQILSMNRAHLDPESVSARSSRTSANSSSSDYDDDFAAEDDDI  168

Query  1454  dddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRL  1275
                       I+EVE VSS  MAD++LI +CM+S GY+KEC  VY  IRK IIDE I RL
Sbjct  169   RAAGDS----ISEVEQVSSGAMADLKLIADCMVSSGYAKECVSVYIIIRKSIIDEGIYRL  224

Query  1274  GVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIF  1095
             GVEKM+ S+  KMDWEVL+L+IKNWL A+ I+V+TLFNGER LCD+VF S  D++RES F
Sbjct  225   GVEKMTSSRANKMDWEVLDLKIKNWLEAVRISVRTLFNGERILCDHVF-SYSDSVRESCF  283

Query  1094  KEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRT  915
              EIS++ A +LF FPE +AK  K+SPEK+FR+LDM+   +   PEIESIFS D  S+ RT
Sbjct  284   AEISRDGASLLFGFPELVAKTKKSSPEKLFRVLDMHAVASELWPEIESIFSSDYNSAART  343

Query  914   QAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLS  735
             Q +TSL +L ++ +  +A+FE+ +QKD SKS V  GG+H LTI  MNYLT +AD+ NVLS
Sbjct  344   QFLTSLQRLTESAQFSLAEFESTIQKDYSKSAVNRGGVHSLTIQTMNYLTLLADYVNVLS  403

Query  734   DIFSNTPPIPKDW--------LPDSYFAVSDSDESP-LPAISLRYAWlillllckLDVIA  582
             DIF      P+DW        LP+SY    +SD S   PA+++R+AWLIL+LLCKLD  A
Sbjct  404   DIF------PRDWLPLPKSSSLPESYLYSPESDYSASTPALTVRFAWLILVLLCKLDGKA  457

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
             +H KD+S++YLFLANNL YVV +VR+S L   LG++W++K  AK K++ ANYE++ WG+V
Sbjct  458   QHCKDVSLSYLFLANNLWYVVARVRSSSLQYVLGDDWITKHEAKAKRFVANYEKVAWGEV  517

Query  401   IASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRP  222
             ++SLP NP       E +  F+ FN  F +A+RK ++ VV+DR LRD +K S+AR ++  
Sbjct  518   VSSLPVNPAVA----EARTVFENFNLKFEEAYRKQNSFVVADRELRDEIKGSIARSVVPK  573

Query  221   YRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             YR++Y+    T+   ++      V F PED+ ++L++LFF
Sbjct  574   YREWYNALLATVGSVRDLMVREYVTFTPEDIENYLANLFF  613



>ref|XP_009598246.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
tomentosiformis]
Length=634

 Score =   522 bits (1345),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 285/585 (49%), Positives = 402/585 (69%), Gaps = 13/585 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAA----KVTSLFYESRREANDFVKCVRNLQKAMQ  1674
             F E++ME  +  +G +I +W+ + S ++    +V +LF + R EA+ F+  V NLQ  M 
Sbjct  25    FSETLMEETINDAGAVIKRWDLDVSSSSSSYNRVANLFRDYREEAHQFIDAVNNLQHGMH  84

Query  1673  FLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvastst  1494
             F+  E  RSE L++AQNLM++AMKRLQKE + IL+ NR  LD E+ S S  S +   +S 
Sbjct  85    FVIKESSRSELLIQAQNLMQIAMKRLQKEMYTILSGNRYFLDSETVSNSRSSRASTRSSV  144

Query  1493  gfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKD  1314
                     ++ + +  V      I+E++ VS  VMAD+R I +CMI  GY  EC K+YK 
Sbjct  145   SDEDDEINEIIEAEVSVSGTR--ISEIDKVSERVMADLRAIADCMIGAGYGAECVKIYKL  202

Query  1313  IRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNV  1134
              RK ++DE +  LGVEK++ S+++KMDW  LEL+ KNWLSA++IAV TLF GE+ LCD+V
Sbjct  203   NRKSVVDETLYYLGVEKLTLSQVQKMDWSSLELKTKNWLSAVKIAVSTLFQGEKILCDHV  262

Query  1133  FASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIE  954
             F+++ DAIRE+ F EI+KE+A+ LF FPE +AKY K S EK+F +LD+YN+I+    EIE
Sbjct  263   FSAS-DAIRETCFCEIAKESALTLFAFPEIVAKYKKLSLEKMFSVLDLYNSISELWDEIE  321

Query  953   SIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMN  774
              IFS +S +++++QAVTSL KLG+A R  +++FE+ +QKDSSK+ VAGGGIHPLT   MN
Sbjct  322   LIFSFNSLTAVKSQAVTSLVKLGEAARFMLSEFESAIQKDSSKA-VAGGGIHPLTRYVMN  380

Query  773   YLTSIADHSNVLSDIFSNTPPIPKDWLPDSYF--AVSDSDESPLPAISLRYAWlillllc  600
             YL  ++D+S   S+I  + P   +  LP+SYF     D D+SP  A+S+R AWL+L+LLC
Sbjct  381   YLVFLSDYSGAFSEIIVDWPLSIQSPLPESYFLSPTPDDDDSPSSAVSVRLAWLVLVLLC  440

Query  599   kLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYER  420
             KLD  A+HYKD+S++YLFLANNL YVV KV+ S L   LG +WL K  AKVKQY +NYER
Sbjct  441   KLDGKAQHYKDVSLSYLFLANNLNYVVSKVKKSNLKLLLGSDWLLKHEAKVKQYISNYER  500

Query  419   LGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLA  240
             +GW  V+ S PEN TA MSP E +  F KFN+ F +A+R  S+ V+ D  LRD +K+SLA
Sbjct  501   MGWSKVLTSFPENSTAEMSPPEARDWFIKFNSGFEEAYRMQSSWVIPDPKLRDGVKISLA  560

Query  239   RKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +K++  YR FY+ ++ T+   +     S+V+FAP+D+ ++ SDLF
Sbjct  561   KKVISGYRTFYEKYRETL---RSGGVKSVVRFAPDDLQNYFSDLF  602



>gb|EPS72115.1| hypothetical protein M569_02643, partial [Genlisea aurea]
Length=617

 Score =   519 bits (1337),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 282/583 (48%), Positives = 397/583 (68%), Gaps = 15/583 (3%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +SV++R+++ + P++MKWNP+ +  A+VTSLF+E+RREA++FV+ V  LQ+A+Q  A 
Sbjct  33    FLDSVLDRSIDAAEPIVMKWNPDTTTIARVTSLFHENRREAHEFVRSVGVLQRALQLAAE  92

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E   S K +RA+NLM +AMKRLQKEF+QIL+MNRAHLD +S SA +  +S  ++S    S
Sbjct  93    ESAASVKTIRAKNLMRIAMKRLQKEFYQILSMNRAHLDSDSVSARSSRTSTTASSLSSDS  152

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               + D ++D           +EVED S   MAD+RLI ECMIS GY++EC K+Y+ +RK 
Sbjct  153   DYEDDEEEDGAGNEAT----SEVEDASKTAMADLRLIAECMISSGYARECSKIYRIMRKS  208

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             ++DE I RLG EK +  +I+KMDWE L+LRI NW++A+ I+++TLF+GER LCD VFA +
Sbjct  209   VVDEGIYRLGFEKFTPHQIQKMDWEALDLRIHNWIAAVRISLQTLFHGERILCDFVFAKS  268

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              D+IRES F EI+K+ A +LF FPE +AK  K    ++FR LDMY  I+N  PEIE  FS
Sbjct  269   -DSIRESCFAEITKDGATMLFGFPEIVAKSRKKIAPEIFRALDMYAVISNQWPEIEITFS  327

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              +S  +IR+Q + SL KL   IR  +  FE+ +QK SSK+TV G GIHPLTID+M+YL +
Sbjct  328   SESTKTIRSQTIDSLIKLRGFIRAAVDNFESSIQKHSSKATVPGAGIHPLTIDSMDYLIN  387

Query  761   IADHSNVLSDIFSNTPPIP--KDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDV  588
             + ++SN+L  I  ++P     K   P+SY     +++SPL A   +  WL   LLCKLD 
Sbjct  388   LIEYSNILPHILIDSPAQAQTKKSFPESYSGA--ANDSPLTA---KITWLTFNLLCKLDD  442

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
                +Y+D  ++YLFLANNLQY+V +VR+S L   LG  W++    K+++YA+ Y+RLGWG
Sbjct  443   KGRYYRDAPLSYLFLANNLQYIVTRVRSSNLASVLGSEWIANHETKIERYASKYQRLGWG  502

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
              V+ S+   P A +   +IK  F+KFNASF QA+ KHSACVV D+ LR  +K  ++  + 
Sbjct  503   HVVDSINAGPAA-IGVGKIKDVFEKFNASFDQAYGKHSACVVPDKILRQRIKSWISNNVF  561

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
             RPYR FY   +  +  EKER+   I ++ P+DV + LSDLFFE
Sbjct  562   RPYRQFYTAKRQLI--EKERYPDPIARYTPDDVANLLSDLFFE  602



>ref|XP_006488241.1| PREDICTED: exocyst complex component EXO70B1-like [Citrus sinensis]
Length=645

 Score =   518 bits (1333),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 288/612 (47%), Positives = 414/612 (68%), Gaps = 10/612 (2%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEAA  1758
             MPRKGMR I F P+   ++ T  +SP   +  F +S+M+  ++I+  +I KW+  +   +
Sbjct  1     MPRKGMRTIFFKPSTSPTAGTPSSSPQRVT--FSDSLMDENIQIARSLITKWDDTSQSCS  58

Query  1757  KVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQ  1578
               +    ++R++A D++K V +LQ AM +       S+KLV AQ LM+ AMKRL++EF+Q
Sbjct  59    ISSLFSSDNRQDAKDYLKAVYDLQTAMHYFITHHSTSDKLVLAQTLMQTAMKRLEREFYQ  118

Query  1577  ILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVSS  1398
             +L +N  +LD ES S S+  +S AS S               DD       I+E+E VS+
Sbjct  119   MLKINGEYLDHESVSVSSSRASRASFSDLEDYEVSETESRISDDA------ISEMERVST  172

Query  1397  FVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLE  1218
               MAD++ I +CMIS GY KEC ++YK IRK ++DEA+  LGVE+++F+ I+KMDW+VLE
Sbjct  173   AAMADLKAIADCMISAGYGKECARIYKIIRKSVVDEALYHLGVERLNFNVIQKMDWDVLE  232

Query  1217  LRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA-IRESIFKEISKEAAMILFEFPENI  1041
             ++IKNWL A+  AVKT+F GER LCD VF+    A IR S F +I KE A+ L  FPEN+
Sbjct  233   IKIKNWLRAVRTAVKTVFAGERILCDTVFSGPSSASIRVSCFSQIVKEGALDLLVFPENV  292

Query  1040  AKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIA  861
             AK  K +PEK+FR LD+Y AI++  P+I SIFS +S S++R+QA  SL +LG+A+RT +A
Sbjct  293   AK-CKKTPEKMFRTLDLYEAISDLSPDIASIFSFESTSAVRSQAANSLIRLGEAVRTMLA  351

Query  860   QFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSY  681
              FE  + KD+SK+ V GGG+HPLT   MNY+  +AD+S  L++I +  P      LP++Y
Sbjct  352   DFEAAIHKDTSKTPVPGGGVHPLTRYVMNYIAFLADYSGSLAEIDAEWPLTSNSPLPEAY  411

Query  680   FAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTS  501
             F   +S +S    I++R AWLIL++LCKLD  AE YK+++ +YLFLANNLQYVVVKVR+S
Sbjct  412   FGSPESSDSISSPIAVRLAWLILVVLCKLDGKAELYKEVAQSYLFLANNLQYVVVKVRSS  471

Query  500   RLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNAS  321
              L   LGE W+ K  AKV+QYAANYER+GW  V ASLPENPTA +   +++  F++FN S
Sbjct  472   NLKFLLGEEWIVKHEAKVRQYAANYERMGWDKVFASLPENPTAEIPIPQVRNCFRRFNLS  531

Query  320   FAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFA  141
             F    ++HS+ +VSD  LRD +K+SLA+++   YRDFY+ +++ + ++       +V+FA
Sbjct  532   FEDTCKRHSSWIVSDPKLRDEIKISLAKRIAPVYRDFYEKYRVRVLRDPSTGNEPLVRFA  591

Query  140   PEDVGHHLSDLF  105
             P+D+G+HLSDLF
Sbjct  592   PDDLGNHLSDLF  603



>ref|XP_006424734.1| hypothetical protein CICLE_v10027998mg [Citrus clementina]
 gb|ESR37974.1| hypothetical protein CICLE_v10027998mg [Citrus clementina]
Length=645

 Score =   516 bits (1330),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 288/612 (47%), Positives = 413/612 (67%), Gaps = 10/612 (2%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEAA  1758
             MPRKGMR I F P+   ++ T  +SP   +  F +S+M+  ++I+  +I KW+  +   +
Sbjct  1     MPRKGMRTIFFKPSSSPTAGTPSSSPQRVT--FSDSLMDENIQIARSLITKWDDTSQSCS  58

Query  1757  KVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQ  1578
               +    ++R++A D++K V +LQ AM +       S+KLV AQ LM+ AMKRL++EF+Q
Sbjct  59    ISSLFSSDNRQDAKDYLKAVYDLQTAMHYFITHHSTSDKLVLAQTLMQTAMKRLEREFYQ  118

Query  1577  ILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVSS  1398
             +L +N  +LD ES S S+  +S AS S               DD       I+E+E VS+
Sbjct  119   MLKINGEYLDHESVSVSSSRASRASFSDLEDYEVSETESRISDDA------ISEMERVST  172

Query  1397  FVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLE  1218
               MAD++ I +CMIS GY KEC ++YK IRK ++DEA+  LGVE+++F+ I KMDW+VLE
Sbjct  173   AAMADLKAIADCMISAGYGKECARIYKIIRKSVVDEALYHLGVERLNFNVIHKMDWDVLE  232

Query  1217  LRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA-IRESIFKEISKEAAMILFEFPENI  1041
             ++IKNWL A+  AVKT+F GER LCD VF+    A IR S F +I KE A+ L  FPEN+
Sbjct  233   IKIKNWLRAVRTAVKTVFAGERILCDTVFSGPSSASIRVSCFSQIVKEGALDLLVFPENV  292

Query  1040  AKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIA  861
             AK  K +PEK+FR LD+Y AI++  P+I SIFS +S S++R+QA  SL +LG+A+RT +A
Sbjct  293   AK-CKKTPEKMFRTLDLYEAISDLSPDIASIFSFESTSAVRSQAANSLIRLGEAVRTMLA  351

Query  860   QFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSY  681
              FE  + KD+SK+ V GGG+HPLT   MNY+  +AD+S  L++I +  P      LP++Y
Sbjct  352   DFEAAIHKDTSKTPVPGGGVHPLTRYVMNYIAFLADYSGSLAEIDAEWPLTSNSPLPEAY  411

Query  680   FAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTS  501
             F   +S +S    I++R AWLIL++LCKLD  AE YK+++ +YLFLANNLQYVVVKVR+S
Sbjct  412   FGSPESSDSISSPIAVRLAWLILVVLCKLDGKAELYKEVAQSYLFLANNLQYVVVKVRSS  471

Query  500   RLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNAS  321
              L   LGE W+ K  AKV+QYAANYER+GW  V ASLPENPTA +   +++  F++FN S
Sbjct  472   NLKFLLGEEWIVKHEAKVRQYAANYERMGWDKVFASLPENPTAEIPIPQVRNCFRRFNLS  531

Query  320   FAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFA  141
             F    ++HS+ +VSD  LRD +K+SLA+++   YRDFY+ +++ + ++       +V+FA
Sbjct  532   FEDTCKRHSSWIVSDPKLRDEIKISLAKRIAPVYRDFYEKYRVRVLRDPSTGNEPLVRFA  591

Query  140   PEDVGHHLSDLF  105
             P+D+G+HLSDLF
Sbjct  592   PDDLGNHLSDLF  603



>gb|KHN05687.1| Exocyst complex component 7 [Glycine soja]
Length=614

 Score =   513 bits (1320),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 290/614 (47%), Positives = 409/614 (67%), Gaps = 28/614 (5%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEAA  1758
             MPRKGMR I F P+  +SS     SP      F +S+M+  +E +  +I KW+   S+  
Sbjct  1     MPRKGMRSIFFKPSTSTSSLPPSPSPQRT---FSDSLMDENIETAEKLITKWDD--SKVP  55

Query  1757  KVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQ  1578
               T+LF  +R+EA  ++  V+ LQ AMQ+L  +   S  LVRAQ LM++AMK LQKEF+Q
Sbjct  56    TTTALFSGTRQEAKQYLNAVKGLQSAMQYLVAQDSTSSTLVRAQLLMQLAMKTLQKEFYQ  115

Query  1577  ILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVSS  1398
             IL+ NR HLDPE+ +  +     + +        +  + +D+         ++E E VS 
Sbjct  116   ILSSNREHLDPETVTTRSSVDLRSVSDYVSDYDDEISITEDEFR-------VSETERVSM  168

Query  1397  FVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLE  1218
               M D++ I E MIS GY KEC KVY  +RK I+DEA+  LGVEK+S S+++K+DWEVLE
Sbjct  169   LAMEDLKAIAESMISSGYGKECVKVYIIMRKSIVDEALYHLGVEKLSLSQVQKLDWEVLE  228

Query  1217  LRIKNWLSAMEIAVKTLFNGERTLCDNVFAS-TPDAIRESIFKEISKEAAMILFEFPENI  1041
             L+IK+WL  +++AV TLF+GER LCD+VFAS +   I ES F EI+K+ A+ LF FPE +
Sbjct  229   LKIKSWLQVVKVAVGTLFHGERILCDHVFASDSGKRIAESCFAEITKDGAVSLFGFPEMV  288

Query  1040  AKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIA  861
             AK  K +PEK+FR+LD+Y AI+++ P+IESIFS +S S+IR+QAVTS+ KLGDA+RT + 
Sbjct  289   AK-CKKTPEKMFRILDLYEAISDYLPQIESIFSFESTSNIRSQAVTSMVKLGDAVRTMLT  347

Query  860   QFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSY  681
               ET +QK+SSK  V GGG+HPLT   MNYLT +AD+S VL DI ++ P  P   LP+SY
Sbjct  348   DLETAIQKESSKKPVPGGGVHPLTRYVMNYLTFLADYSGVLVDIIADLPQSP---LPESY  404

Query  680   FAVSDSDESPLPA--ISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVR  507
             +     +E+P PA  +S R AW+IL++LCKLD  AE YKD++ +YLFLANN+QYVVVKVR
Sbjct  405   YRSPMREENP-PASELSERIAWIILVVLCKLDGKAELYKDVAHSYLFLANNMQYVVVKVR  463

Query  506   TSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFN  327
              S L   LGE WL K   KV++YA+ YER+GW  V ++LPENP A ++ E+ +  F +F+
Sbjct  464   KSNLGFLLGEEWLDKHKLKVREYASKYERVGWSAVFSALPENPAAELTAEQARACFVRFD  523

Query  326   ASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVK  147
             A+F +A RK ++  VSD   RD +K S+A KL++ Y +FY+ +++           S+  
Sbjct  524   AAFHEACRKQASWFVSDPKFRDEIKGSIASKLVQKYSEFYEKNRVGS--------ESVRG  575

Query  146   FAPEDVGHHLSDLF  105
             F P+D+G +LS++ 
Sbjct  576   FLPDDIGKYLSNIL  589



>ref|XP_003539758.1| PREDICTED: exocyst complex component EXO70B1-like [Glycine max]
Length=614

 Score =   513 bits (1320),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 290/614 (47%), Positives = 409/614 (67%), Gaps = 28/614 (5%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEAA  1758
             MPRKGMR I F P+  +SS     SP      F +S+M+  +E +  +I KW+   S+  
Sbjct  1     MPRKGMRSIFFKPSTSTSSLPPPPSPQRT---FSDSLMDENIETAEKLITKWDD--SKVP  55

Query  1757  KVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQ  1578
               T+LF  +R+EA  ++  V+ LQ AMQ+L  +   S  LVRAQ LM++AMK LQKEF+Q
Sbjct  56    TTTALFSGTRQEAKQYLNAVKGLQSAMQYLVAQDSTSSTLVRAQLLMQLAMKTLQKEFYQ  115

Query  1577  ILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVSS  1398
             IL+ NR HLDPE+ +  +     + +        +  + +D+         ++E E VS 
Sbjct  116   ILSSNREHLDPETVTTRSSVDLRSVSDYVSDYDDEISITEDEFR-------VSETERVSM  168

Query  1397  FVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLE  1218
               M D++ I E MIS GY KEC KVY  +RK I+DEA+  LGVEK+S S+++K+DWEVLE
Sbjct  169   LAMEDLKAIAESMISSGYGKECVKVYIIMRKSIVDEALYHLGVEKLSLSQVQKLDWEVLE  228

Query  1217  LRIKNWLSAMEIAVKTLFNGERTLCDNVFAS-TPDAIRESIFKEISKEAAMILFEFPENI  1041
             L+IK+WL  +++AV TLF+GER LCD+VFAS +   I ES F EI+K+ A+ LF FPE +
Sbjct  229   LKIKSWLQVVKVAVGTLFHGERILCDHVFASDSGKRIAESCFAEITKDGAVSLFGFPEMV  288

Query  1040  AKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIA  861
             AK  K +PEK+FR+LD+Y AI+++ P+IESIFS +S S+IR+QAVTS+ KLGDA+RT + 
Sbjct  289   AK-CKKTPEKMFRILDLYEAISDYLPQIESIFSFESTSNIRSQAVTSMVKLGDAVRTMLT  347

Query  860   QFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSY  681
               ET +QK+SSK  V GGG+HPLT   MNYLT +AD+S VL DI ++ P  P   LP+SY
Sbjct  348   DLETAIQKESSKKPVPGGGVHPLTRYVMNYLTFLADYSGVLVDIIADLPQSP---LPESY  404

Query  680   FAVSDSDESPLPA--ISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVR  507
             +     +E+P PA  +S R AW+IL++LCKLD  AE YKD++ +YLFLANN+QYVVVKVR
Sbjct  405   YRSPMREENP-PASELSERIAWIILVVLCKLDGKAELYKDVAHSYLFLANNMQYVVVKVR  463

Query  506   TSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFN  327
              S L   LGE WL K   KV++YA+ YER+GW  V ++LPENP A ++ E+ +  F +F+
Sbjct  464   KSNLGFLLGEEWLDKHKLKVREYASKYERVGWSAVFSALPENPAAELTAEQARACFVRFD  523

Query  326   ASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVK  147
             A+F +A RK ++  VSD   RD +K S+A KL++ Y +FY+ +++           S+  
Sbjct  524   AAFHEACRKQASWFVSDPKFRDEIKGSIASKLVQKYSEFYEKNRVGS--------ESVRG  575

Query  146   FAPEDVGHHLSDLF  105
             F P+D+G +LS++ 
Sbjct  576   FLPDDIGKYLSNIL  589



>ref|NP_181470.1| exocyst subunit exo70 family protein H2 [Arabidopsis thaliana]
 gb|AAC27829.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09667.1| exocyst subunit exo70 family protein H2 [Arabidopsis thaliana]
Length=637

 Score =   511 bits (1315),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 273/580 (47%), Positives = 397/580 (68%), Gaps = 9/580 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+ME  +E +  +I KW+P +    K+ SLF  SRREA +F++C+R+L++AM FL  
Sbjct  37    FSQSMMEETVEAAESIIKKWDPNSPSYTKIISLFSHSRREAKEFIRCIRDLRRAMHFLIS  96

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S KLV AQ+LM++AM RL+KEFFQIL+ NR  LDPES S  +  SS +       S
Sbjct  97    QHSKSAKLVLAQHLMQIAMARLEKEFFQILSSNRDQLDPESVSGHSSISSNSEFEDVMQS  156

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
             + D + D+           IT+VE  ++ VM+D+++I E MISCGY KEC K YK IRK 
Sbjct  157   SDDEEEDELKKAGET----ITKVEKAAALVMSDLKVIAETMISCGYGKECIKSYKLIRKS  212

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  LG+EK   S+  +MDW+VLE  IKNW+ A +I V TL  GE+ LCD+VF+++
Sbjct  213   IVDEGLHLLGIEKCKISRFNRMDWDVLEHMIKNWIKAAKIGVITLLRGEKLLCDHVFSAS  272

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
                IRES F EI  EA + LF+FPE +A+  K SPE++FRL+D+Y AI++ RP+IE IF 
Sbjct  273   -STIRESCFYEIVNEAGINLFKFPELVAE-KKPSPERIFRLMDLYAAISDLRPDIELIFH  330

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              DS ++++T  ++SL KL D+I T + +FE+ +QKDSSK+  AGGGIH LT   M++++S
Sbjct  331   FDSVAAVKTLVLSSLKKLKDSIYTSLMEFESTIQKDSSKALTAGGGIHKLTRSTMSFISS  390

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSD-SDESPLPAISLRYAWlillllckLDVI  585
             ++++S VLS+I +  P      + +SYF      DE    A+S+  AWLIL+ LCKLD+ 
Sbjct  391   LSEYSRVLSEILAEHPLKKNTRMLESYFTAPILEDEHNNHAVSVHLAWLILIFLCKLDIK  450

Query  584   AEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             AE YKD+S++YLFL NN+Q+VV  VR++ L   LG++WL+K  AK++ YAANYE   W +
Sbjct  451   AESYKDVSLSYLFLVNNIQFVVDTVRSTHLRNLLGDDWLTKHEAKLRSYAANYEIAAWAN  510

Query  404   VIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
             V  SLPE  ++ +SPEE K HFK+F+A F +A+ K S+CV++D  LR+ LKVS+A+K++ 
Sbjct  511   VYISLPEKTSSRLSPEEAKTHFKRFHAVFEEAYMKQSSCVITDAKLRNELKVSIAKKIVP  570

Query  224   PYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              YR+FY  +  T+   KER+   +V F P+++ ++LSDLF
Sbjct  571   EYREFYGKYLPTL--SKERNIEMLVSFKPDNLENYLSDLF  608



>ref|XP_010543336.1| PREDICTED: exocyst complex component EXO70A1-like [Tarenaya hassleriana]
Length=634

 Score =   510 bits (1314),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 281/582 (48%), Positives = 400/582 (69%), Gaps = 18/582 (3%)
 Frame = -2

Query  1829  VMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPR  1650
             +++  +E +  +I KW+ E S ++   SLF ES+REA +FV+ V++LQKAM  L +E   
Sbjct  30    LIDATIESAAEIIEKWSTEYSTSSNFYSLFNESKREAREFVRRVKDLQKAMDLLILEDAN  89

Query  1649  SEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdf  1470
             +E+  RAQNLM++AMKRL+KEF+QIL+MNRAHLDPE  S+ +      S  +        
Sbjct  90    AEQSQRAQNLMKIAMKRLRKEFYQILSMNRAHLDPEPVSSRSSDEFGTSDHSSDEDGGGA  149

Query  1469  dvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDE  1290
                  D         ITE+E+VS   MAD++ I +CM++ GY+KEC  +YK +RK IIDE
Sbjct  150   RHRASDS--------ITEMEEVSINAMADLKSIADCMLAAGYAKECGSMYKTLRKSIIDE  201

Query  1289  AISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAI  1110
             A+ RLG+EK+S S  +KM WEV+EL+ + WL A+++++ TLFNGER LCD++F S+ DAI
Sbjct  202   AMYRLGIEKISPSTAKKMSWEVVELKTQTWLEALKVSMTTLFNGERVLCDHIFLSS-DAI  260

Query  1109  RESIFKEISKEAAMILFEFPENIAKYAKNSP--EKVFRLLDMYNAIANHRPEIESIFSMD  936
             RES F  IS + A++LF FPE +A   K +P  EK+FRLL+MY  I  +   I SIFS+ 
Sbjct  261   RESCFSNISNDGALLLFGFPEMVAAKDKKNPPPEKIFRLLEMYRGIDENSHAIRSIFSLS  320

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             S+S++ ++A  SL +L + IR+ +A FE  +QKD+SK+ V  GG+HPLT+ AMNYL+ +A
Sbjct  321   SSSAVISRASNSLNQLSEMIRSLMADFENGIQKDTSKTVVRAGGVHPLTVLAMNYLSLLA  380

Query  755   DHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEH  576
             DH +VL+DI   +PP+ K  LP+SYF VS+SD SP   I +R+AWLIL+LLCK+D  +E 
Sbjct  381   DHCDVLADILMRSPPLEKSLLPESYFNVSESDGSPASEIRIRFAWLILVLLCKIDAKSES  440

Query  575   YKDISIAYLFLANNLQYVVVKVRTS-RLNRFLGENWLSKQSAKVKQYAANYERLGWGDVI  399
             YKD S+ YLFLANNLQ+VV  V  S  +   LG++W+++   K +Q+AA+YERL WG V 
Sbjct  441   YKDFSVQYLFLANNLQHVVSCVHGSWSMRNLLGDDWIARHFDKARQFAASYERLAWGSVA  500

Query  398   ASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPY  219
             ++L +NP+   SPE + + F+ F ASF  A++K SACVV D NLRD +K+S+ARKL+  Y
Sbjct  501   SALTKNPS---SPESVMECFETFAASFESAYKKESACVVPDPNLRDEMKMSIARKLVPIY  557

Query  218   RDFYDTHKLTM---PKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             R+FY TH+ T+     E     + +V+F P+DV ++LS LFF
Sbjct  558   REFYYTHRNTVVMAGNEAGMKLALVVRFTPDDVENYLSGLFF  599



>ref|XP_010112927.1| Exocyst complex component 7 [Morus notabilis]
 gb|EXC35076.1| Exocyst complex component 7 [Morus notabilis]
Length=621

 Score =   509 bits (1312),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 280/581 (48%), Positives = 400/581 (69%), Gaps = 15/581 (3%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFY-ESRREANDFVKCVRNLQKAMQFLA  1665
             F E++++  +E +  +I KW+   S+    +SLF+ + R EA  ++  V++LQ  M  + 
Sbjct  28    FCETLLDENIETAQSLIEKWD---SDDVTASSLFHGDDRLEAGQYLNAVKDLQSTMHLII  84

Query  1664  MEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
              +   S KLVRAQ LME AMKRLQKEF+QI++ NR +LDPES S  +  +S  S+ + F 
Sbjct  85    SKSSASVKLVRAQVLMETAMKRLQKEFYQIMSSNRQYLDPESVSTHSSRTSTVSSFSDFE  144

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRK  1305
                + +     +        I+E+E VS+  MAD++ I +CMIS GY KEC K+YK IRK
Sbjct  145   DELENEFRVTTES-------ISEMERVSAAAMADLKAIADCMISVGYGKECVKIYKTIRK  197

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              I+DE +  LGVEK   S+I+KMDW VLE +IKNW++A+++AVKTLF GER LCD+VF S
Sbjct  198   SIVDEGLYHLGVEKTCLSQIQKMDWGVLEYKIKNWVNAVKVAVKTLFYGERILCDHVF-S  256

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
               ++IRES + EI+ E A  LF FPE +AK  K SPEK+FR LD+Y+AI++  P I+SIF
Sbjct  257   ASESIRESCYSEITGEGATWLFSFPEFVAK-CKKSPEKMFRTLDLYDAISDLWPLIDSIF  315

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
             S +S S++R+ A+ SL KLG+A+R   A FE+ +QKD+SK+ V GGG+HPLT   MNY+ 
Sbjct  316   SFESTSAVRSLAMNSLLKLGEAVRIIFADFESAIQKDTSKAAVRGGGVHPLTRYVMNYVA  375

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVI  585
              + D+S +L+DIF++ P   +  LP+SYF   +S +    +IS+R+ WL+L+LLCKLD  
Sbjct  376   FLTDYSEILADIFADWPLSIQSPLPESYFGSLESADVSSSSISVRFVWLVLVLLCKLDGK  435

Query  584   AEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             AE YKD++++YLFLANNLQYVV KVR S L   LG++W++K   KVK YAANYER+GW  
Sbjct  436   AELYKDVALSYLFLANNLQYVVAKVRDSNLRFLLGDDWVAKHEEKVKNYAANYERVGWSK  495

Query  404   VIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
             V +SLP +PTA +S E+ K+ F + NASF +A+RK  + VV D  LRD LK S++R+L+ 
Sbjct  496   VYSSLPADPTADISSEQTKECFLRLNASFEEAYRKQISWVVPDAKLRDELKYSVSRRLVP  555

Query  224   PYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
              YR FY+ H+  + ++      S+V++ PE++ ++LSDLFF
Sbjct  556   AYRAFYEKHRDGLGRKCGSE--SLVRYLPENMDNYLSDLFF  594



>ref|XP_003539098.1| PREDICTED: exocyst complex component EXO70B1-like [Glycine max]
Length=609

 Score =   509 bits (1310),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 288/614 (47%), Positives = 402/614 (65%), Gaps = 33/614 (5%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEAA  1758
             MPRKGMR I F+        T    P +    F +S+M+  +E +  +I KW+   S+  
Sbjct  1     MPRKGMRSIFFTST-----PTASLPPPSRQRTFSDSLMDENIETAEKLITKWDD--SKVT  53

Query  1757  KVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQ  1578
               T LF  +R+EA  ++  V+ LQ AMQ+L  +   S  LVRAQ LM++AMK LQKEF+Q
Sbjct  54    TTTQLFSGTRQEAKQYLNAVKGLQSAMQYLVAQDSTSSTLVRAQFLMQLAMKTLQKEFYQ  113

Query  1577  ILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVSS  1398
             IL+ NR HLDPE+ S  +     +S S      S  + +            ++E E VS 
Sbjct  114   ILSSNREHLDPETVSTRSSVDHRSSVSDYDDEISITEDEFR----------VSETERVSM  163

Query  1397  FVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLE  1218
               M D++ I ECMIS GY KEC KVY  +RK I+DEA+  LGVEK++ S+++K+DWEVLE
Sbjct  164   LAMEDLKAIAECMISSGYGKECVKVYIVMRKSIVDEALYHLGVEKLNLSQVQKLDWEVLE  223

Query  1217  LRIKNWLSAMEIAVKTLFNGERTLCDNVFAS-TPDAIRESIFKEISKEAAMILFEFPENI  1041
             L+IK+WL A+++AV TLFNGER LCD+VFA+ +   I ES F EI+K+ A+ L  FPE +
Sbjct  224   LKIKSWLKAVKVAVGTLFNGERILCDHVFAADSGKRIAESCFAEITKDGAVSLLGFPEMV  283

Query  1040  AKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIA  861
             AK  K SPEK+FR+LD+Y AI+++ P+IE IFS +S  +IRTQ VTS+ KLGDA+RT + 
Sbjct  284   AK-CKKSPEKMFRILDLYEAISDYWPQIEFIFSFESTVNIRTQTVTSMVKLGDAVRTMLT  342

Query  860   QFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSY  681
              FET +QK+SSK  V GGG+HPLT   MNYLT +AD+S VL DI ++ P  P   LP+SY
Sbjct  343   DFETAIQKESSKKPVPGGGVHPLTRYVMNYLTFLADYSGVLVDIIADLPQSP---LPESY  399

Query  680   FAVSDSDESPLPA--ISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVR  507
             +     +E+P PA  +S R AW+IL++LCKLD  AE YKD++ +YLFLANN+QYVVVKVR
Sbjct  400   YRSPMREENP-PASELSERIAWIILVVLCKLDGKAELYKDVAHSYLFLANNMQYVVVKVR  458

Query  506   TSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFN  327
              S L   LGE WL+K   KV++Y + YE +GW  V +SLPENP A ++ E+ +  F +F+
Sbjct  459   KSNLGFLLGEEWLAKHELKVREYTSKYESVGWSAVFSSLPENPAAELTAEQARACFVRFD  518

Query  326   ASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVK  147
             A+F +A +K ++ VVSD   RD +K S+A KL++ Y  F++ +++           S+  
Sbjct  519   AAFHEACKKQASWVVSDPKFRDEIKDSIASKLMQKYSVFFEKNRVGS--------KSVRD  570

Query  146   FAPEDVGHHLSDLF  105
             F P+D+G +LS++ 
Sbjct  571   FLPDDIGKYLSNIL  584



>ref|XP_002315254.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
 gb|EEF01425.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
Length=618

 Score =   508 bits (1309),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 276/582 (47%), Positives = 403/582 (69%), Gaps = 16/582 (3%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F ESVME  ++    +I KW+P +S   +VTSLF+ +R EA DF++ V++L++AM  L  
Sbjct  35    FSESVMEETIKNVESIITKWDPNSSSITRVTSLFHSNREEAEDFLESVKDLRRAMHALVS  94

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAH-LDPEsssasarsssvaststgfs  1485
             E   S+KL+ AQNLM++AM RL+KEF+QIL+  R H +DPES SA +   S         
Sbjct  95    EHSTSDKLLLAQNLMQIAMARLEKEFYQILSAARDHQIDPESISARSSEGSSNLEDENEL  154

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMA-DMRLIVECMISCGYSKECFKVYKDIR  1308
              + +      + +        T VE V++  M+ D++ I +CMIS GYS EC K+YK IR
Sbjct  155   GSEEEFKTAGESN--------TNVERVTALAMSSDLKTIADCMISSGYSIECIKIYKLIR  206

Query  1307  KWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFA  1128
             K I+DE +  LG+E+   S+I KM+WE LE +IKNWL+A++IA KTLF+GE+ LCD+VF+
Sbjct  207   KSIVDEGLYLLGIEEFRPSQILKMNWEALEHQIKNWLNAVKIAAKTLFSGEKALCDHVFS  266

Query  1127  STPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESI  948
             ++   IRES F EI+    + LF FPE +AK  K  PE++F LLD+Y A+++ RP++E I
Sbjct  267   AS-QTIRESCFSEITI-GGLNLFRFPELVAK-CKKLPERIFPLLDLYEALSDIRPDVELI  323

Query  947   FSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYL  768
             F  +S S I+ QAV+SL  LG++IR  +++FE+ +QKDSSK+ + GGGIHPLT    +Y+
Sbjct  324   FDSESTSKIKQQAVSSLHGLGESIRAILSEFESTIQKDSSKTLIVGGGIHPLTQKVTSYI  383

Query  767   TSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDV  588
             +S+AD+S +LSDI +++ P      P++YF   + D S  PA+S+  AWLIL+LLCKLD 
Sbjct  384   SSLADYSRILSDIVADSSPPRNTAFPEAYFESPNYDASSTPAVSVHLAWLILVLLCKLDR  443

Query  587   IAE-HYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGW  411
              A+  YKD+S++YLFLANNLQ+V+ KV T+RL   LGE+W+ K + KV QYA+ YE + W
Sbjct  444   KADLGYKDMSLSYLFLANNLQFVLDKVCTTRLYVLLGEDWVFKHAEKVIQYASTYETMAW  503

Query  410   GDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKL  231
             G+  +SLPE  +  +SPE  K+ F++FNA+F +A++K ++ VV DR LRD LKVS+A++L
Sbjct  504   GNAFSSLPEKNSPLLSPEAAKECFQRFNAAFEEAYKKQASWVVPDRRLRDELKVSIAKEL  563

Query  230   LRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +  YR+FYDTHK+ + + K+  F   V+F P+D+G++LSDLF
Sbjct  564   IPAYREFYDTHKVMLRRVKD--FEVFVRFGPDDLGNYLSDLF  603



>ref|XP_011014426.1| PREDICTED: exocyst complex component EXO70B1-like [Populus euphratica]
Length=620

 Score =   507 bits (1305),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 278/586 (47%), Positives = 403/586 (69%), Gaps = 23/586 (4%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWN--PEASEA-AKVTSLFY-ESRREANDFVKCVRNLQKAMQ  1674
             F +++ME  +EI+  +I KW+  P++S     +T+LF  ++R EA  ++  +++LQ AMQ
Sbjct  21    FSDTLMEEKMEIAQALISKWDVSPDSSSLYCNITNLFAADNRYEAKQYLNSIKDLQAAMQ  80

Query  1673  FLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvastst  1494
             +    +P SE LV AQ LM+ A+KRL++EF+ IL  NR HLDPES S ++RSS       
Sbjct  81    YYISHEPTSENLVLAQGLMQNAIKRLEREFYIILKSNRQHLDPESVSRASRSSFSEFEDE  140

Query  1493  gfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKD  1314
                       +D           I+EVE VS   M D++ I ECMIS GY KEC K+YK+
Sbjct  141   SEDEEESRAGEDS----------ISEVERVSMSAMEDLKAISECMISAGYGKECIKIYKN  190

Query  1313  IRKWIIDEAISRLGVE-KMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDN  1137
             IRK I+DEA+  L V+ ++SF++I+KMDWEVLE++IK WL+A+++AVKTLF GER LCD 
Sbjct  191   IRKSIVDEALYHLNVDSRLSFAQIQKMDWEVLEVKIKTWLNAVKVAVKTLFYGERILCDQ  250

Query  1136  VFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEI  957
             VF+S+P A+RES F +I++E A+ LF FPEN+AK  K +PE++FR LD+Y AIA+  PEI
Sbjct  251   VFSSSP-AMRESCFADITREGALSLFVFPENVAK-CKKAPERMFRTLDLYEAIADLWPEI  308

Query  956   ESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAM  777
             ESIF ++S S+++ QA+ SL KLG+A+R  + +FE+ + K  SK+ V GGG+HPLT   M
Sbjct  309   ESIFDLESTSAVKQQAINSLIKLGEAVRAILTEFESAISKVHSKAAVPGGGVHPLTRYVM  368

Query  776   NYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPL-PAISLRYAWlillllc  600
             NY+T + D+S +L+DI ++ P      LP++YF    SD+ P+  AIS R AWLIL++LC
Sbjct  369   NYVTFLTDYSGILADILADWPLPVLSSLPEAYFGSPFSDDGPINSAISTRLAWLILVMLC  428

Query  599   kLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYER  420
             KLD  A  YKD +++YLFLANNLQYVV KV+ S L    G+ W+ K  A+V+QY +NYER
Sbjct  429   KLDGGAAIYKDAALSYLFLANNLQYVVNKVQKSNLKFLHGDEWIEKHEARVRQYVSNYER  488

Query  419   LGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLA  240
             +GW  V A+LP+     M+ +++ + FK FN+SF +A+ K ++ VVSD  LRD +K+S+A
Sbjct  489   MGWSKVFATLPDINDNQMTTQQVTECFKSFNSSFEEAYNKQASWVVSDSKLRDQIKLSVA  548

Query  239   RKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             RKL+  YR+FY+ ++  + K++      IV+FAP+D+ ++LSDL F
Sbjct  549   RKLVPAYREFYEKYRQVVEKKE-----GIVRFAPDDLENYLSDLLF  589



>ref|XP_011000313.1| PREDICTED: exocyst complex component EXO70B1-like [Populus euphratica]
Length=620

 Score =   507 bits (1305),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 278/586 (47%), Positives = 403/586 (69%), Gaps = 23/586 (4%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWN--PEASEA-AKVTSLFY-ESRREANDFVKCVRNLQKAMQ  1674
             F +++ME  +EI+  +I KW+  P++S     +T+LF  ++R EA  ++  +++LQ AMQ
Sbjct  21    FSDTLMEEKMEIAQALISKWDVSPDSSSLYCNITNLFAADNRYEAKQYLNSIKDLQAAMQ  80

Query  1673  FLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvastst  1494
             +    +P SE LV AQ LM+ A+KRL++EF+ IL  NR HLDPES S ++RSS       
Sbjct  81    YYISHEPTSENLVLAQGLMQNAIKRLEREFYIILKSNRQHLDPESVSRASRSSFSEFEDE  140

Query  1493  gfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKD  1314
                       +D           I+EVE VS   M D++ I ECMIS GY KEC K+YK+
Sbjct  141   SEDEEESRAGEDS----------ISEVERVSMSAMEDLKAISECMISAGYGKECIKIYKN  190

Query  1313  IRKWIIDEAISRLGVE-KMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDN  1137
             IRK I+DEA+  L V+ ++SF++I+KMDWEVLE++IK WL+A+++AVKTLF GER LCD 
Sbjct  191   IRKSIVDEALYHLNVDSRLSFAQIQKMDWEVLEVKIKTWLNAVKVAVKTLFYGERILCDQ  250

Query  1136  VFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEI  957
             VF+S+P A+RES F +I++E A+ LF FPEN+AK  K +PE++FR LD+Y AIA+  PEI
Sbjct  251   VFSSSP-AMRESCFADITREGALSLFVFPENVAK-CKKAPERMFRTLDLYEAIADLWPEI  308

Query  956   ESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAM  777
             ESIF ++S S+++ QA+ SL KLG+A+R  + +FE+ + K  SK+ V GGG+HPLT   M
Sbjct  309   ESIFDLESTSAVKQQAINSLIKLGEAVRAILTEFESAISKVHSKAAVPGGGVHPLTRYVM  368

Query  776   NYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPL-PAISLRYAWlillllc  600
             NY+T + D+S +L+DI ++ P      LP++YF    SD+ P+  AIS R AWLIL++LC
Sbjct  369   NYVTFLTDYSGILADILADWPLPVLSSLPEAYFGSPFSDDGPVNSAISTRLAWLILVMLC  428

Query  599   kLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYER  420
             KLD  A  YKD +++YLFLANNLQYVV KV+ S L    G+ W+ K  A+V+QY +NYER
Sbjct  429   KLDGGAAIYKDAALSYLFLANNLQYVVNKVQKSNLKFLHGDEWIEKHEARVRQYVSNYER  488

Query  419   LGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLA  240
             +GW  V A+LP+     M+ +++ + FK FN+SF +A+ K ++ VVSD  LRD +K+S+A
Sbjct  489   MGWSKVFATLPDINDNQMTTQQVTECFKSFNSSFEEAYNKQASWVVSDSKLRDQIKLSVA  548

Query  239   RKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             RKL+  YR+FY+ ++  + K++      IV+FAP+D+ ++LSDL F
Sbjct  549   RKLVPAYREFYEKYRQVVEKKE-----GIVRFAPDDLENYLSDLLF  589



>ref|XP_007009575.1| Exocyst subunit exo70 family protein H2 [Theobroma cacao]
 gb|EOY18385.1| Exocyst subunit exo70 family protein H2 [Theobroma cacao]
Length=639

 Score =   507 bits (1306),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 274/579 (47%), Positives = 393/579 (68%), Gaps = 10/579 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F E +ME  +E +  +I KW+  +S   +VTSLF+++R+EA +++KCV +L+++M FL  
Sbjct  49    FSEFMMEENIENAESIITKWDVNSSSLTQVTSLFHQNRKEAREYLKCVGDLRRSMHFLVS  108

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             ++  S KLV AQ LM++AMKRL+KEF+QIL+ NR  LDPES S+ +   S +        
Sbjct  109   QKSASYKLVLAQKLMQMAMKRLEKEFYQILSSNREQLDPESVSSLSSDGSGSFYVEHELV  168

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
             + D        +       ITEVE VS+ VM+D++ I ECM SCGY KEC K+YK  RK 
Sbjct  169   SEDEAELKKAGES------ITEVERVSALVMSDLKAIAECMTSCGYGKECIKIYKLFRKS  222

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+D  +  LG+E++  S+I KM WE LE  IKNWL+A++IAV+TLF GE+ LCD+VFA++
Sbjct  223   IVDRGLYLLGIERLKSSQINKMHWEALEHTIKNWLNAVKIAVRTLFTGEKILCDHVFAAS  282

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              + IRE+ F EI+ E A+ LF FPE IAK +K  PE++F LL+ + AI+   PEIE+IF+
Sbjct  283   -ETIREACFAEITMEGAINLFRFPELIAK-SKKEPERIFWLLEFHEAISELWPEIETIFN  340

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
                 S+I+ QA++SL + GD++   ++ F + +QKDSSK+ VAGGGIHPLT  AM+Y++S
Sbjct  341   SALTSAIKLQALSSLHRAGDSVSAILSNFRSSIQKDSSKTLVAGGGIHPLTRSAMSYISS  400

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             +AD+  VLSDI ++ PP       +SYF    S + P  A S+  AWLIL+LLCKLD  A
Sbjct  401   LADYGRVLSDIVADHPPPGNSPSSESYFENPTSIDGPTSAGSVHLAWLILVLLCKLDRKA  460

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
             E YKD+S+ YLFLANNLQ+++ +V T+ L   LG+ W S  + K+KQYA  YE L W  V
Sbjct  461   ELYKDVSLRYLFLANNLQFIIDRVHTTNLKYLLGDKWASMHTKKIKQYALRYESLAWNKV  520

Query  401   IASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRP  222
              +SLPE  ++ +SPE +K  F++FNA+F +A+ K +  +V D  LRD LKVS+ARKL   
Sbjct  521   FSSLPEGTSSVLSPEAVKDCFRRFNAAFDEAYMKQTLWLVPDGKLRDELKVSIARKLTPA  580

Query  221   YRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             YR+FY+T  + +  E+  +   +V+ AP+D+G++LSDLF
Sbjct  581   YREFYETQLVALSGEE--NLEVLVRIAPDDLGNYLSDLF  617



>ref|XP_002298379.2| hypothetical protein POPTR_0001s24130g [Populus trichocarpa]
 gb|EEE83184.2| hypothetical protein POPTR_0001s24130g [Populus trichocarpa]
Length=581

 Score =   504 bits (1298),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 277/581 (48%), Positives = 400/581 (69%), Gaps = 23/581 (4%)
 Frame = -2

Query  1826  MERALEISGPMIMKWN--PEASEA-AKVTSLFY-ESRREANDFVKCVRNLQKAMQFLAME  1659
             M+  +EI+  +I KW+  P +S     +T+LF  ++R EA  ++  +++LQ AMQ+    
Sbjct  1     MDEKIEIAQALISKWDVSPNSSSLYCNITNLFAADNRYEAKQYLNSIKDLQAAMQYYISH  60

Query  1658  QPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsst  1479
             +P SE LV AQ LM++A+KRL++EF+ IL  NR HLDPES S ++RSS            
Sbjct  61    EPTSENLVLAQGLMQIAIKRLEREFYIILKSNRQHLDPESVSRASRSSVSEFEDESEDEE  120

Query  1478  sdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWI  1299
                  +D           I+EVE VS  VM D++ I ECMIS GY KEC K+YK+IRK I
Sbjct  121   ESRAGEDS----------ISEVERVSMSVMEDLKAISECMISAGYGKECIKIYKNIRKSI  170

Query  1298  IDEAISRLGVE-KMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             +DEA+  L V+ ++SF++I+KMDWEVLE++IK WL+A+++AVKTLF GER LCD VF+S+
Sbjct  171   VDEALYHLNVDSRLSFAQIQKMDWEVLEVKIKTWLNAVKVAVKTLFYGERILCDQVFSSS  230

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
             P A+RES F +I++E A+ LF FPEN+AK  K +PE++FR LD+Y AIA+  PEIESIF 
Sbjct  231   P-AMRESCFADITREGALSLFVFPENVAK-CKKAPERMFRTLDLYEAIADLWPEIESIFD  288

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
             ++S S+++ QA+ SL KLG+A+R  + +FE+ + KD SK+ V GGGIHPLT   MNY+T 
Sbjct  289   LESTSTVKQQAINSLIKLGEAVRAILIEFESAISKDHSKAAVPGGGIHPLTRYVMNYVTF  348

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPL-PAISLRYAWlillllckLDVI  585
             +AD+S +L+DI ++ P      LP++YF    SD+  +  AIS R AWLIL++LCKLD  
Sbjct  349   LADYSGILADILADWPLPVLSSLPEAYFGSPFSDDGTINSAISTRLAWLILVMLCKLDGG  408

Query  584   AEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             A  YKD +++YLFLANNLQYVV KV+ S L    G+ W+ K  A+V+QY +NYER+GW  
Sbjct  409   AAIYKDAALSYLFLANNLQYVVNKVQKSNLKFLHGDEWIEKHEARVRQYVSNYERMGWSK  468

Query  404   VIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
             V A+LP+     M+ +++ + F  FN+SF +A+ K ++ VVSD  LRD +K+S+ARKL+ 
Sbjct  469   VFATLPDINDNQMTTQQVTECFNSFNSSFEEAYNKQASWVVSDSKLRDQIKLSVARKLVP  528

Query  224   PYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
              YR+FY+ ++  + +++      IV+FAP+D+ ++LSDL F
Sbjct  529   AYREFYEKYRQVVVRKE-----GIVRFAPDDLENYLSDLLF  564



>ref|XP_011027091.1| PREDICTED: exocyst complex component EXO70A1-like [Populus euphratica]
Length=634

 Score =   504 bits (1299),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 270/580 (47%), Positives = 400/580 (69%), Gaps = 14/580 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F ES+ME  ++    +I KW+P +S   +VTSLF+ +R EA DF++ V++L++AM  L  
Sbjct  53    FSESMMEETIKNVESIITKWDPNSSSITRVTSLFHSNREEAEDFLESVKDLRRAMHALVS  112

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E   S+KL+ AQNLM++AM RL+KEF+QIL+  R  +DPES S  +   S          
Sbjct  113   EHSTSDKLLLAQNLMQIAMARLEKEFYQILSAARDQIDPESISVRSSEGSSNLEDENELG  172

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMA-DMRLIVECMISCGYSKECFKVYKDIRK  1305
             + +      + +        T VE V++  M+ D++ I +CMIS GYS EC K+YK IRK
Sbjct  173   SEEEFKTAGESN--------TNVERVTALAMSSDLKSIADCMISSGYSIECIKIYKLIRK  224

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              I+DE +  LG+E+   S+I KM+WE LE +IKNWL+A++IA KTLF+GE+ LCD+VF++
Sbjct  225   SIVDEGLYLLGIEEFRPSQILKMNWEALEHQIKNWLNAVKIAAKTLFSGEKALCDHVFSA  284

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
             +   IRES F EI+    + LF FPE +AK  K  PE++F LL++Y A+++ +P++E IF
Sbjct  285   S-QTIRESCFSEITI-GGLNLFRFPELVAK-CKKLPERIFPLLELYEALSDIQPDLELIF  341

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
               +S S  + QAV+SL  LG++IR  ++ FE+ +QKDSSK+ + GGGIHPLT    +Y++
Sbjct  342   DSESTSKTKQQAVSSLHGLGESIRAILSDFESTIQKDSSKTLIVGGGIHPLTQKVTSYIS  401

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVI  585
             S+AD+S +LSDI +++ P      P++YF   + D S  PA+S+  AWLIL+LLCKLD  
Sbjct  402   SLADYSRILSDIVADSSPPRNTAFPEAYFESPNYDASSTPAVSVHLAWLILVLLCKLDRK  461

Query  584   AEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             AE YKD+S++YLFLANNLQ+V+ KV T+RL   LGE+W+ K + KV QYA+ YE + WG+
Sbjct  462   AEGYKDMSLSYLFLANNLQFVLDKVCTTRLYVLLGEDWVFKHAEKVIQYASTYETMAWGN  521

Query  404   VIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
             V +SLPE  +  +SPE  K+ F++FNA+F +A++K ++ VV DR L D LKVS+A++L+ 
Sbjct  522   VFSSLPEKNSPLLSPEAAKECFQRFNAAFEEAYKKQASWVVPDRRLGDELKVSIAKELIP  581

Query  224   PYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              YR+FYDTHK+ + + ++  F   V+F+P+D+G++LSDLF
Sbjct  582   AYREFYDTHKVMLRRVQD--FEVFVRFSPDDLGNYLSDLF  619



>ref|XP_009600986.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
tomentosiformis]
Length=646

 Score =   503 bits (1296),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 266/579 (46%), Positives = 404/579 (70%), Gaps = 7/579 (1%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             +S+ME  ++ +  +I +W+P+ S   K  SLF E R+EA +F++CV++L++AM FL ME 
Sbjct  52    QSIMEENIDNAETIIKRWDPKESSFEKFCSLFQEDRKEAKEFIQCVKDLKRAMHFLVMEH  111

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
               S KLV A NLM+ AMKRL+KEF+QIL+ N+ HLDPES S S++SS ++ +    S   
Sbjct  112   STSNKLVLAHNLMQTAMKRLEKEFYQILSTNKEHLDPESVSKSSQSSHLSQSIAVDSQED  171

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
             +   +++   V  +   I+EVE +S   M+D+ LI +CM+  GY+KEC K+YK IRK I+
Sbjct  172   ETGSENEIQAVVES---ISEVERLSVLAMSDLNLIADCMVGSGYAKECVKIYKIIRKSIV  228

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             D  + RLG+E  S + I   + + LE ++K+W++A+E+AVKT F GER LCD+VF+++ +
Sbjct  229   DGGLYRLGIESRSSAYINGKNSDALEHQVKHWINAVEVAVKTFFYGERFLCDHVFSAS-N  287

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
              IRE+ F +I+KE  + LF FPE IAK +K SPE +F L+D++  I+   PEIESIFS +
Sbjct  288   TIRETCFTDIAKEGGINLFRFPEVIAK-SKKSPENIFFLMDLHEKISELLPEIESIFSYE  346

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             S S+++ QA+++L KL  +I+T ++ FE+ +QK+S ++ + GGGIHPLT   ++Y+ S+A
Sbjct  347   SISAVKVQALSTLHKLKASIQTTLSDFESSIQKNSLRTPIPGGGIHPLTNSVLDYVCSLA  406

Query  755   DHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEH  576
             ++S VLSDI  ++ P  +   P+SYF    ++E+P  A+S R AW+IL+LLCKLD  A+ 
Sbjct  407   NYSGVLSDIICDSAPAAQSPFPESYFDSPSANETPTSAVSARLAWIILVLLCKLDSKAKL  466

Query  575   YKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIA  396
             Y D++++YLFLANNLQ+V+ KVRTS L   LG++W+SK   K K YA NYE + W  V  
Sbjct  467   YNDVALSYLFLANNLQFVIEKVRTSVLKCLLGDDWISKLERKEKLYATNYENVAWNKVFL  526

Query  395   SLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYR  216
              LPE+    +SP+ IK+HF+KFN +F ++++K  + VV D  LRD +KVS+ARKL+  YR
Sbjct  527   CLPESLDPSVSPDIIKEHFRKFNTAFDESYQKQKSWVVPDGKLRDEIKVSIARKLVPAYR  586

Query  215   DFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
             DFYD + + +  EK  +   +V+F+P+++G++LSDLF E
Sbjct  587   DFYDYYMIVLSGEK--NLEVLVRFSPDNIGNYLSDLFHE  623



>gb|KFK36832.1| hypothetical protein AALP_AA4G177100 [Arabis alpina]
Length=597

 Score =   501 bits (1291),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 271/577 (47%), Positives = 388/577 (67%), Gaps = 9/577 (2%)
 Frame = -2

Query  1829  VMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPR  1650
             +ME  +E +  +IMKW+P +    K+ SLF  SR+EA +F++C+R+L++AM FL  +  +
Sbjct  1     MMEETVEAAESIIMKWDPNSPSYTKLISLFSHSRKEAKEFIRCIRDLRRAMHFLVSQHTQ  60

Query  1649  SEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdf  1470
             S KLV AQNLM+  M RL+KEFFQIL+ NR  LDPES S  +  SS +       S  + 
Sbjct  61    SAKLVLAQNLMQTGMSRLEKEFFQILSSNRDQLDPESVSNHSSLSSNSEFEDVMQSDEEE  120

Query  1469  dvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDE  1290
             + D            IT+VE  S+ VM+D+++I E MISCGY KEC K YK IRK I+DE
Sbjct  121   EEDVLKKAGES----ITKVEKASALVMSDLKVIAETMISCGYGKECIKSYKLIRKSIVDE  176

Query  1289  AISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAI  1110
              +  LG+EK   S+  +MDW VLE  IKNW+ A +I V TLF GE+ LCD+VF+S+   I
Sbjct  177   GLHLLGIEKCKISRFNRMDWGVLEPLIKNWIKAAKIGVITLFRGEKLLCDHVFSSS-STI  235

Query  1109  RESIFKEISKEAAMILFEFPENIA-KYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDS  933
             RES F EI+ EA + LF+FPE +A K  K+SPE++FRL+D+Y A+++  PEIE IF  DS
Sbjct  236   RESCFYEIANEAGINLFKFPELVANKEKKSSPERIFRLMDLYAAMSDLWPEIELIFHFDS  295

Query  932   ASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIAD  753
              + ++  A++SL KL D+I T + +FE+ +QKDSSK+   GGGIH LT   M++++S+++
Sbjct  296   VAVVKNLALSSLKKLKDSIHTILMEFESTIQKDSSKAVTPGGGIHKLTRTTMSFISSLSE  355

Query  752   HSNVLSDIFSNTPPIPKDWLPDSYFAVSD-SDESPLPAISLRYAWlillllckLDVIAEH  576
             +S VLSDI ++ PP     + +SYF      DE     IS+  AWL L+LLCKLD+ AE 
Sbjct  356   YSRVLSDILADHPPQRNTRMLESYFTAPILEDEHNNHTISVHLAWLTLVLLCKLDMKAES  415

Query  575   YKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIA  396
             YKD+S++YLFL NN Q+VV  VR++ L   LG++WL+K  AK++ Y+ NYE   W +V  
Sbjct  416   YKDVSLSYLFLVNNTQFVVDTVRSTHLKNLLGDDWLTKHDAKLRSYSTNYEIAAWANVFL  475

Query  395   SLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYR  216
             SLPE     + PE+ K HFK+F+ASF +A+ K S+ V+ +  LRD+LKVS+A+KL+  YR
Sbjct  476   SLPEKTCTTLPPEDAKTHFKRFHASFEEAYMKQSSFVIPNAKLRDNLKVSIAKKLVPEYR  535

Query  215   DFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +FY+ +  T+   +ER+   +V+F PE++ ++LSDLF
Sbjct  536   EFYEKYLPTL--RQERNIEILVRFKPENLENYLSDLF  570



>ref|XP_002881652.1| ATEXO70H2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57911.1| ATEXO70H2 [Arabidopsis lyrata subsp. lyrata]
Length=637

 Score =   503 bits (1294),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 268/581 (46%), Positives = 390/581 (67%), Gaps = 10/581 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+ME  +E +  +I KW+  +    ++ SLF  SR+EA +F++C+R+L++AM FL  
Sbjct  37    FSQSMMEETVEAAESIIKKWDLNSPSYTRIISLFSHSRKEAKEFIRCIRDLRRAMHFLIS  96

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S KLV AQ+LM++ M RL+KEFFQIL+ NR  LDPES S  +  SS +       S
Sbjct  97    QHSQSAKLVLAQHLMQIGMARLEKEFFQILSSNRDQLDPESVSGHSSISSNSEFEDVMQS  156

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               D + +            IT+VE  ++ VM+D+++I E MISCGY KEC K YK IRK 
Sbjct  157   DDDEEDELKKAGET-----ITKVEKAAALVMSDLKVIAETMISCGYGKECIKSYKLIRKS  211

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  LG+EK   S+  +MDW VLE  IKNW+ A +I V TL  GE+ LCD+VF S 
Sbjct  212   IVDEGLHLLGIEKCKISRFNRMDWGVLEHMIKNWIKAAKIGVITLLRGEKLLCDHVF-SA  270

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIA-KYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
                IRES F EI  EA + LF FPE +A K  K+SPE++FRL+D+Y AI++ RP+IE IF
Sbjct  271   SSTIRESCFYEIVNEAGINLFRFPELVANKEKKSSPERIFRLMDLYAAISDLRPDIELIF  330

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
               DS ++++T  ++SL KL  AI T + ++E+ +QKDSSK+  AGGGIH LT   M++++
Sbjct  331   HFDSVAAVKTIVISSLKKLKQAIHTSLTEYESTIQKDSSKALTAGGGIHKLTRSTMSFIS  390

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSD-SDESPLPAISLRYAWlillllckLDV  588
             S++++S VLS+I +  P      + +SYF      DE    A+S+  AWLIL+ LCKLD+
Sbjct  391   SLSEYSRVLSEILAEHPLKKNARMLESYFTAPILEDEHNNHAVSVHLAWLILVFLCKLDI  450

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AE YKD+S++YLFL NN+Q+VV  VR++ L   LG++WL+K   K++ YAANYE   W 
Sbjct  451   KAESYKDVSLSYLFLVNNIQFVVDTVRSTHLRNLLGDDWLTKHETKLRSYAANYEIAAWA  510

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
             +V  SLPE  ++ +SPEE K HFK+F+A+F +A+ K S+CV++D  LR+ LKVS+A+K++
Sbjct  511   NVYISLPEKTSSTLSPEEAKAHFKRFHAAFEEAYMKQSSCVITDAKLRNELKVSIAKKIV  570

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               YR+FY  +  T+   KER+   +V+F P+++ ++LSDLF
Sbjct  571   PEYREFYGKYLPTLS--KERNIEMLVRFKPDNLENYLSDLF  609



>gb|KDP44174.1| hypothetical protein JCGZ_05641 [Jatropha curcas]
Length=597

 Score =   500 bits (1287),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 281/582 (48%), Positives = 397/582 (68%), Gaps = 41/582 (7%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAK---VTSLFYESRREANDFVKCVRNLQKAMQFLA  1665
             ++ M+  ++ +  +I KW+P++S ++    +TSLF E R EA  ++  +R LQ AMQ+  
Sbjct  26    DTFMDEKIDNAQILISKWDPDSSSSSNYCNITSLFTEDRLEAKQYLNSIRELQSAMQYYI  85

Query  1664  MEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
              E P SEKL+ AQNLM+VAMKRL++EF+QIL  NR +LDPES S+ +  +S +S S    
Sbjct  86    TENPASEKLITAQNLMQVAMKRLEREFYQILKFNRDYLDPESVSSHSSRASRSSVSDFED  145

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRK  1305
              + D      D         ++EVE VS   MAD++ I +CMIS GY +EC K+YK +RK
Sbjct  146   ESEDESSRFGDS--------VSEVERVSMMAMADLKAIADCMISSGYGRECVKIYKIVRK  197

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              I+DE +  LGVE ++FS+I+KMDWEVLE++IK+WL A+++AVKTLFNGER LCD+VF++
Sbjct  198   SIVDETLYHLGVEGLNFSQIQKMDWEVLEIKIKSWLYAVKVAVKTLFNGERILCDHVFSA  257

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
             +  ++RES F EI+KE A+ LF FPENIAK  K SPEK+FR+LD+Y AIA+  PEIESIF
Sbjct  258   S-GSMRESCFAEITKEGALGLFGFPENIAK-CKKSPEKMFRILDLYEAIADLWPEIESIF  315

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
             + +S S++R+QAV SL KLG+A+RT +  FE+ + KD+SK T  GGG+HPLT   MNY++
Sbjct  316   NDESTSTVRSQAVNSLIKLGEAVRTMLTDFESAISKDNSK-TPPGGGVHPLTRYVMNYIS  374

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESP-LPAISLRYAWlillllckLDV  588
              ++D+S +LSDI ++ P   +  LP+ YF   + D+     AISLR AWLIL+LLCKLD 
Sbjct  375   FLSDYSGILSDIVADWPLTNQSPLPEFYFGSPEPDQDGNSSAISLRLAWLILVLLCKLDG  434

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AE YKD++++YLFLANNLQYVV KVRTS L   +G++W+ K  AK              
Sbjct  435   KAELYKDVALSYLFLANNLQYVVKKVRTSSLKFLIGDDWIVKHEAK--------------  480

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
                        A M+  ++ +HFK+FN++F + ++K S+ VV D  LRD +KVSLARKL+
Sbjct  481   -----------AAMTVHQVAEHFKRFNSAFEELYKKQSSWVVPDSKLRDEIKVSLARKLV  529

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
               YR F+   +  + +E   + S IV+F P+D+G++LSDLFF
Sbjct  530   PAYRGFHQKFRAAVNREFGSN-SRIVRFGPDDLGNYLSDLFF  570



>ref|XP_006411164.1| hypothetical protein EUTSA_v10017849mg [Eutrema salsugineum]
 gb|ESQ52617.1| hypothetical protein EUTSA_v10017849mg [Eutrema salsugineum]
Length=669

 Score =   501 bits (1290),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 274/579 (47%), Positives = 390/579 (67%), Gaps = 8/579 (1%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             +S+ME  +E +  +I KW+P +    K+ SLF  SR+EA +F++CVR+L++AM FL  + 
Sbjct  39    QSMMEETVEAAESIIKKWDPNSPSYTKIISLFSHSRKEAKEFIRCVRDLRRAMHFLVSQH  98

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
              +S KLV AQ LM++ M RL+KEFFQIL+ NR  LDPES S  +  SS +       S  
Sbjct  99    SQSSKLVLAQKLMQIGMSRLEKEFFQILSSNRDQLDPESVSGQSSISSNSEFDDVMQSDD  158

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
             D D DD+      +   IT+VE  S+ VM+D+++I E MISCGY KEC K YK IRK I+
Sbjct  159   DEDEDDELKKAGES---ITQVEKASALVMSDLKVIAETMISCGYGKECIKSYKLIRKSIV  215

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DE +  LG+EK   S+  + DW VLE  IKNW+ A +I V TLF GE+ LCD+VF+++  
Sbjct  216   DEGLHLLGIEKCKISRFNRTDWGVLEPMIKNWIKAAKIGVTTLFRGEKLLCDHVFSAS-S  274

Query  1115  AIRESIFKEISKEAAMILFEFPENIA-KYAKNSPEKVFRLLDMYNAIANHRPEIESIFSM  939
              IRES F EI+ EA + LF  PE +A K  K  PE++F+L+D+Y AI++  PEIE IF  
Sbjct  275   TIRESCFYEIANEAGINLFRLPELVANKERKPPPERIFKLMDLYTAISDLWPEIELIFHF  334

Query  938   DSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSI  759
             DS ++++T A++SL KL  +I T + +FE+ +QKDSSK+ VAGGGIH LT   M++++S+
Sbjct  335   DSVAAVKTLALSSLKKLKGSIHTCLTEFESTIQKDSSKAVVAGGGIHKLTRTTMSFISSL  394

Query  758   ADHSNVLSDIFSNTPPIPKDWLPDSYFAVSD-SDESPLPAISLRYAWlillllckLDVIA  582
             +++S+VLS+I +  P      L +SYF      DE     IS+  AWLIL+ LCKLD+ A
Sbjct  395   SEYSSVLSEILAEHPLKRNTRLLESYFTAPILEDEHNNHVISVHLAWLILVFLCKLDIKA  454

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
             E Y D+S++YLFL NN+Q+VV  VR+S L   LG++WL K  AK++ YAANYE   W +V
Sbjct  455   ESYGDVSLSYLFLVNNIQFVVDTVRSSHLKNLLGDDWLIKHDAKLRSYAANYETAAWANV  514

Query  401   IASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRP  222
               SLPE     +SPEE K  FK+F+A+F +A+ K S+CV++D  LRD LKVS+A+KL+  
Sbjct  515   FLSLPEKTNVTLSPEEAKTRFKRFHAAFEEAYMKQSSCVITDVKLRDELKVSIAKKLVPE  574

Query  221   YRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             YR+FY+ +  T+   +ER+   +V+F P+++ ++LSDLF
Sbjct  575   YREFYEKYLPTL--RQERNIEMLVRFKPDNLENYLSDLF  611



>ref|XP_008448357.1| PREDICTED: exocyst complex component EXO70B1-like [Cucumis melo]
Length=626

 Score =   498 bits (1281),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 276/614 (45%), Positives = 415/614 (68%), Gaps = 19/614 (3%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEAA  1758
             MP+KGMR + F+    SSS     S  +      +S++E  LE++   +M+W P+++   
Sbjct  1     MPQKGMRSVFFNSPI-SSSVPSTPSSHSSRPTLSDSMVEENLEVAESFVMRWRPDST---  56

Query  1757  KVTSLFYES--RREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEF  1584
              V    ++   R EA  ++K V  L K+M  LA     S+KL+RA +LM++AM+RLQKEF
Sbjct  57    -VVGFLFQGDDRDEARKYIKAVMGLYKSMHSLASRDSSSQKLMRAHDLMKIAMERLQKEF  115

Query  1583  FQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDV  1404
             +QIL+ NR +L PES S      ++++ S+      + + +    +       I EVE V
Sbjct  116   YQILSANREYLYPESVSGVQSPMTISTRSSVSDFELESEDEFRFANES-----IAEVERV  170

Query  1403  SSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEV  1224
             S   MAD++ I +CMIS GY KEC KVYK +RK IIDE++  LG+EK+SFSK++KMDWEV
Sbjct  171   SMSAMADLKAIADCMISTGYGKECVKVYKIVRKSIIDESLYNLGIEKLSFSKVQKMDWEV  230

Query  1223  LELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPEN  1044
             LE++IK WL  ++ AVK+LF GE+ LCD+VF+ +  +IRE+ F +ISK+ A ILF FPE 
Sbjct  231   LEVKIKIWLKGVKTAVKSLFEGEKILCDHVFSGSV-SIRETCFAQISKDGAAILFGFPEL  289

Query  1043  IAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGI  864
             +AKY K +PEK+F  LD+Y AIA+  PEI+ IFS  + S +++QAV+SL KLG+ IRT I
Sbjct  290   VAKY-KKTPEKIFITLDLYEAIADLWPEIDYIFSSTATSMVQSQAVSSLIKLGENIRTLI  348

Query  863   AQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDS  684
             ++FE  +QK+SSK+ +  GG+HPLT   MNY++ ++D+S +L+DI ++ P   K  +P+S
Sbjct  349   SEFEMAIQKESSKTPIPRGGVHPLTRYVMNYISFLSDYSGILNDIVADWPLATKLSMPES  408

Query  683   YFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRT  504
             Y+     ++SP   I+LR+AWLIL+LLCKLD  AEHY D++++YLFLANNLQYVV KVRT
Sbjct  409   YYGTPKQEDSP---ITLRFAWLILVLLCKLDGKAEHYNDVALSYLFLANNLQYVVEKVRT  465

Query  503   SRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNA  324
             S L   LG +W+ +  +K+K Y++ Y R+GW  V +SLP + TA +SPEE ++ F+ FN 
Sbjct  466   SNLRFILGSDWVERHESKIKLYSSKYRRIGWSGVFSSLPRDVTAEISPEEARESFRNFNR  525

Query  323   SFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKF  144
             +F + +RK ++ +V D+ LRD +K+SLAR++   Y +FY  +++ + +      +  V+ 
Sbjct  526   AFEETYRKQTSWIVPDQKLRDEIKISLAREIGALYGEFYTRNRVRVRRVSGSDHA--VRL  583

Query  143   APEDVGHHLSDLFF  102
             +P+D+G++LSDLF+
Sbjct  584   SPDDLGNYLSDLFY  597



>ref|XP_009764850.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=646

 Score =   498 bits (1282),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 263/579 (45%), Positives = 401/579 (69%), Gaps = 7/579 (1%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             +S+ME  ++ +  +I KW+P+ S   K  SLF E R+EA +F++CV++L++AM FL ME 
Sbjct  52    QSIMEENIDNAETIIKKWDPKESSFEKFISLFQEDRKEAKEFIQCVKDLKRAMHFLVMEH  111

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
               S KLV A NLM+ AMKRL+KEF+QIL+ N+ HLDPES S S++SS ++ + +  S   
Sbjct  112   STSNKLVLAHNLMQTAMKRLEKEFYQILSTNKEHLDPESVSKSSQSSHLSQSISVDSQED  171

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
             +   +++      +   I+EVE +S   M+D+ LI +CM+  GY+KEC K+YK IRK I+
Sbjct  172   ETGSENEIQAAVES---ISEVERLSVLAMSDLNLIADCMVGSGYAKECVKIYKIIRKSIV  228

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DE + RLG+E  S       + + LE + K+W+++++ AVKT F GER LCD+VF+++ +
Sbjct  229   DEGLYRLGIESHSSVHTNGKNSDALEHQTKHWINSVKAAVKTFFYGERFLCDHVFSAS-N  287

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
              IRE+ F +I+KE  + LF FPE IAK +K SPE +F L+D++  I+   PEIESIFS +
Sbjct  288   TIRETCFTDIAKEGGINLFRFPEVIAK-SKKSPENIFLLMDLHETISELLPEIESIFSYE  346

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             S S+++ QA+++L KL  +I+T ++ FE+ +QK+S +  + GGGIHPLT   ++Y+ S+A
Sbjct  347   SISAVKVQALSTLHKLKASIQTTLSDFESSIQKNSLRKPIPGGGIHPLTNSVLDYVCSLA  406

Query  755   DHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEH  576
             ++S +LSDI  ++ P  +   P+SYF    ++E+P  A+S R AW+IL+LLCKLD  A+ 
Sbjct  407   NYSGILSDIICDSAPAAQSPFPESYFDSPSANETPTSAVSARLAWIILVLLCKLDSKAKL  466

Query  575   YKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIA  396
             Y DI+++YLFLANNLQ+V+ KVRTS L   LG++W+SK   KVK YA NYE + W  V  
Sbjct  467   YNDIALSYLFLANNLQFVIEKVRTSVLKCLLGDDWISKLERKVKLYATNYENVAWNKVFL  526

Query  395   SLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYR  216
              LPE+    +SP+ IK+HF+KFN +F ++++K  + VV D  LRD +KVS+ARKL+  YR
Sbjct  527   CLPESLDPSVSPDIIKEHFRKFNTAFDESYQKQKSWVVPDGKLRDEIKVSIARKLVPAYR  586

Query  215   DFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
             DFY+ + + +  EK  +   +V+++P+++G++LSDLF E
Sbjct  587   DFYNYYMIVLSGEK--NLEVLVRYSPDNIGNYLSDLFHE  623



>ref|XP_004251304.1| PREDICTED: exocyst complex component EXO70A1 [Solanum lycopersicum]
Length=634

 Score =   497 bits (1280),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 272/585 (46%), Positives = 394/585 (67%), Gaps = 16/585 (3%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAA---KVTSLFYESRREANDFVKCVRNLQKAMQF  1671
             F +++ME  +  +G +I KW+ +AS +    +V +LF + R EA  F+  + NLQ  M F
Sbjct  30    FSQTLMEDTINDAGAIIKKWDLDASSSTSYNRVANLFRDYREEAIQFLDAITNLQHGMHF  89

Query  1670  LAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststg  1491
             +  E   SE LV+AQNLM++AMKRLQKE + IL+ NR  LD E+ S  +   S  S+ + 
Sbjct  90    VIKECSSSELLVQAQNLMQIAMKRLQKEMYTILSGNRYFLDSETLSTRSSRQSTRSSVSD  149

Query  1490  fsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDI  1311
                  D   + +           +EVE VS  VMA+++ I +CMI  GY KEC K+Y   
Sbjct  150   DDDHDDEITNTEVSPRA------SEVEIVSELVMANLKAIADCMIGAGYGKECVKIYNLN  203

Query  1310  RKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVF  1131
             RK +IDE +  LGVEK++ S+I+KMDWE+LE + KNWL A++IAV TLF+GE+ LCD+VF
Sbjct  204   RKSVIDETLYYLGVEKLTSSQIQKMDWELLEKKTKNWLGAVKIAVSTLFHGEKILCDHVF  263

Query  1130  ASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIES  951
             +++ DAIRE+ F EI++E+A+ LF FPE +AKY K S EK+F +LD+YN+I+    EIE 
Sbjct  264   SAS-DAIRETCFAEIARESALTLFTFPEMVAKYKKLSLEKMFTVLDLYNSISELWDEIEL  322

Query  950   IFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNY  771
             IFS +S   +++QA+ SL KLG+A R  +++FE+ +QKD+SK+  AGGG+HPLT   MNY
Sbjct  323   IFSFNSFDIVKSQAMASLVKLGEAARLMLSEFESAIQKDTSKAK-AGGGVHPLTRYVMNY  381

Query  770   LTSIADHSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllck  597
             L  + D+S   ++I  + P   +  LP+SYF   + D D+SP  A+S+R AWL+L+LLCK
Sbjct  382   LVFLGDYSGAFAEIIGDFPLSVQSPLPESYFMSPIPDEDDSPSSAVSVRLAWLVLVLLCK  441

Query  596   LDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERL  417
             LD  A+ YKD+S++YLFLANNL YVV KV+ S L   LG +WLSK   K++QY +NYER+
Sbjct  442   LDGKAQLYKDVSLSYLFLANNLNYVVSKVKKSNLKFLLGSDWLSKHEMKIRQYISNYERM  501

Query  416   GWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLAR  237
             GW  V+  LPEN T  MS  E ++ F KFN+ F +A+R  S+ V+ D  LRD +K+SL+R
Sbjct  502   GWNKVLTLLPENATEEMSLPEAREWFFKFNSGFEEAYRVQSSWVIPDPKLRDEVKISLSR  561

Query  236   KLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             K++  YR FY+ ++ ++   +     S+V+FAP+D+ ++LSDLF+
Sbjct  562   KIVSGYRIFYEKYRESL---RSGGVKSVVRFAPDDLQNYLSDLFY  603



>ref|XP_010096691.1| Exocyst complex component 7 [Morus notabilis]
 gb|EXB65359.1| Exocyst complex component 7 [Morus notabilis]
Length=648

 Score =   498 bits (1281),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 266/582 (46%), Positives = 403/582 (69%), Gaps = 12/582 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F  ++ME  ++ +   I KW+  +S   K+T LF +SR++A +F+K V+ L++AM +L  
Sbjct  51    FSVAMMEENIDNAEKTITKWDLTSSSYTKLTFLFQDSRKDATEFIKSVKELRRAMHYLVA  110

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E   S KLV AQ LM+ AMKRL+KEF+QIL+ NR HL+PES S+ +   S +      + 
Sbjct  111   ENSASSKLVLAQKLMQTAMKRLEKEFYQILSKNRDHLNPESISSRSSVGSSSFGEEDDAQ  170

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
             ++D      +         +TEV+ VS   M+D++ I +CMI CGY KEC K+YK IRK 
Sbjct  171   SNDELEILSES--------VTEVKKVSEIAMSDLKSIADCMIVCGYGKECVKIYKVIRKS  222

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             IIDE +  L +E+   S+++K++WE L   IKNW++A++IAVKTLFNGE+ LCD+VF+++
Sbjct  223   IIDEGLYGLRIERFKSSQVQKLNWEALVGTIKNWINAIKIAVKTLFNGEKILCDHVFSAS  282

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
                I++S F EI+K  A+ LF+FPE IA+  K SPE++F+L+++Y A +   P+IESIFS
Sbjct  283   V-TIKDSCFYEITKAGAIDLFKFPELIARSHKKSPERIFQLMELYEAFSELLPDIESIFS  341

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              +S S+IR+QA++S  KL D+I + + +FE+ +QK+SSK+ + GGGIHP+T   ++Y++S
Sbjct  342   SESTSAIRSQALSSSLKLRDSIPSILQEFESKIQKNSSKTLIFGGGIHPVTQSVVDYISS  401

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYF-AVSDSDESPLP-AISLRYAWlillllckLDV  588
             +ADHS VLS I ++ PP     L +S+F +++ S +SP P A S+  AWLIL+LLCKLD 
Sbjct  402   LADHSGVLSGILAHYPPPGNSPLNESFFESLTTSSDSPAPDAASVHLAWLILVLLCKLDC  461

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AE YKD+S++YLFLANNL ++V KVRT+ L   LG+ W+SK + KV QY  +YE + W 
Sbjct  462   KAELYKDVSLSYLFLANNLNFIVEKVRTTNLRFLLGDEWISKHTKKVHQYTLSYETMAWT  521

Query  407   DVIASLPE-NPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKL  231
               ++SLP+ N ++P+S E +K+  +KFNA+F +A++K ++ +V D  LRD LKVS+A KL
Sbjct  522   KALSSLPDNNASSPLSTEMVKESLRKFNAAFEEAYKKQASWIVQDGKLRDELKVSIANKL  581

Query  230   LRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +  YR FYD +   +  E++     +V+F+P+D+G++LSDLF
Sbjct  582   VPKYRQFYDANLDVLCSEEKNSLQLLVRFSPDDLGNYLSDLF  623



>ref|XP_009798500.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=634

 Score =   496 bits (1278),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 274/585 (47%), Positives = 393/585 (67%), Gaps = 13/585 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAA----KVTSLFYESRREANDFVKCVRNLQKAMQ  1674
             F E++ME  +  +G +I +W+ + S ++    +V +LF + R EA+ F+  V  LQ  M 
Sbjct  25    FSETLMEETINDAGAVIKRWDLDVSSSSSSYNRVANLFRDYRDEAHQFLDAVNKLQHGMH  84

Query  1673  FLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvastst  1494
             F+  E  RSE L++AQNLM++AMKRLQKE + IL+ NR  LD E+ S S  S +   +S 
Sbjct  85    FVIKESSRSELLIQAQNLMQIAMKRLQKEMYTILSGNRYFLDSETVSNSRSSRASTRSSV  144

Query  1493  gfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKD  1314
                     ++ D +  V      ++E++ VS  VMAD++ I +CMI  GY  EC K+YK 
Sbjct  145   SDEDDEINEIIDAEVSVSSTR--VSEIDKVSERVMADLKAIADCMIGAGYGAECVKIYKL  202

Query  1313  IRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNV  1134
              RK ++DE +  LGVEK++ S+++KMDW +LE + KNWLSA++I V TLF GE+ LCD+V
Sbjct  203   NRKSVVDETLYYLGVEKLTLSQVQKMDWSLLEQKTKNWLSAVKITVSTLFQGEKILCDHV  262

Query  1133  FASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIE  954
             F+++ D+IRE+ F EI+KE+A+ LF FPE +AKY K S EK+F +LD+YN+I+    EIE
Sbjct  263   FSAS-DSIRETCFSEIAKESALTLFAFPEMVAKYKKLSLEKMFSVLDLYNSISELWDEIE  321

Query  953   SIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMN  774
              IFS +S + +++QAVTSL KLG+A R  +++FE+ +QKDSSK+ VA GG+HPLT   MN
Sbjct  322   LIFSFNSLTVVKSQAVTSLVKLGEAARFMLSEFESAIQKDSSKA-VACGGVHPLTRYVMN  380

Query  773   YLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllc  600
             YL  + D+S   S+I  + P   +  LP+SYF     D  +SP  A+S+R AWL+L+LLC
Sbjct  381   YLVFLGDYSGAFSEIIVDWPLSIQSPLPESYFLSPTPDDYDSPSSAVSVRLAWLVLVLLC  440

Query  599   kLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYER  420
             KLD  A+HYKD+S++YLFLANNL YVV KV+ S L   LG +WL    AKVKQY +NYER
Sbjct  441   KLDGKAQHYKDVSLSYLFLANNLNYVVSKVKKSNLKLLLGSDWLLNHDAKVKQYISNYER  500

Query  419   LGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLA  240
             +GW  V+ S  EN TA MSP E +  F  FN+ F +A+R  S+ V+ D  LRD +K+SLA
Sbjct  501   MGWSKVLTSFLENSTAEMSPPEARDWFVTFNSDFEEAYRTQSSWVIPDPKLRDGVKISLA  560

Query  239   RKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +K++  YR FY+ ++  +   +     S+V+FAP+D+ ++LSDLF
Sbjct  561   KKVISGYRTFYEKYREIL---RSGGVKSVVRFAPDDLQNYLSDLF  602



>ref|XP_010509024.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=639

 Score =   496 bits (1278),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 267/583 (46%), Positives = 397/583 (68%), Gaps = 10/583 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+ME  +E +  +I KW+P +    K+ SLF  SR+EA +F++C+R+L++AM FL  
Sbjct  37    FSQSMMEETVEAAESIIKKWDPNSPSYTKIISLFCHSRKEAKEFIRCIRDLRRAMHFLIS  96

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S KLV+AQ+LM++ M RL++EFFQIL+ NR  L PES S+ +  SS +       S
Sbjct  97    QHSQSAKLVQAQHLMQIGMARLEQEFFQILSSNRDQLHPESVSSQSSVSSNSEFEDVMQS  156

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               D D DD+      +   I++VE  ++ VM+D+++I E MISCGY KEC K YK IRK 
Sbjct  157   DDDDDDDDELKKAGES---ISKVEKAAALVMSDLKIIAETMISCGYGKECIKRYKLIRKS  213

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  LG+EK   S+  +MDW VLE  IKNW+ A +I V TL  GE+ LCD VF+++
Sbjct  214   IVDEGLHLLGIEKYKISRFNRMDWGVLEPMIKNWIKAAKIGVITLLRGEKLLCDYVFSAS  273

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIA-KYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
                IRES F EI+ EA + LF+FPE +A K  K+SPE++FRL+D+Y AI+  RP+IE IF
Sbjct  274   -STIRESCFYEIANEAGINLFKFPELVANKEKKSSPERIFRLMDLYAAISELRPDIELIF  332

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
               DS ++++T  ++SL KL D+I T + +FE+ +QKDSSK+  AGGG+H LT   M++++
Sbjct  333   HFDSVAAVKTLVLSSLKKLKDSIHTSLTEFESTIQKDSSKALTAGGGVHKLTRSTMSFIS  392

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllckLD  591
             S++++S VLS+I    P      + +SYF   + + +++   A+S++ AWLIL+ LCKLD
Sbjct  393   SLSEYSRVLSEILEEYPLKRNTRMLESYFTAPILEDEDNNNHAVSVQLAWLILVFLCKLD  452

Query  590   VIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGW  411
             + AE YKD+S++YLFL NN+Q+VV  VR++ L   LG++WL+K   K++ YAANYE   W
Sbjct  453   IKAESYKDVSLSYLFLVNNIQFVVDTVRSTHLRNLLGDDWLTKHETKLRSYAANYEIAAW  512

Query  410   GDVIASLPENP-TAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
               V  SLPE   T  +SPEE K HFK+F+A F +A+ K S+CV++D  LRD LKVS+A+K
Sbjct  513   SSVYISLPERSNTTVLSPEEAKTHFKRFHAVFEEAYTKQSSCVITDAKLRDELKVSIAKK  572

Query  233   LLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             ++  YR+FY  +  T+   +ER+   +V+  P+++ ++LSDLF
Sbjct  573   IVPEYREFYGKYLPTLS--QERNIEMLVRLKPDNLENYLSDLF  613



>gb|KHN05940.1| Exocyst complex component 7 [Glycine soja]
Length=622

 Score =   495 bits (1275),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 275/575 (48%), Positives = 388/575 (67%), Gaps = 9/575 (2%)
 Frame = -2

Query  1817  ALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKL  1638
             + E +  +I+KWNPE S   +VTSLFY  + EA  ++ CV  LQK M  L  +   S+KL
Sbjct  34    SFEEAETLILKWNPETSAYGRVTSLFYNDKAEAMHYIHCVNMLQKTMHSLISQNASSQKL  93

Query  1637  VRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvdd  1458
             + A NLM++AMK LQKEF+QIL+MNRAHLDPES S  + ++S  ++    S       +D
Sbjct  94    ILAHNLMQMAMKTLQKEFYQILSMNRAHLDPESVSTRSSTTSTRTSFCSDSYDDATAEED  153

Query  1457  ddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISR  1278
                        I+EVE VSS  MAD++ I +CMIS GY+KEC  VY  +RK I+DE I R
Sbjct  154   VRQSGDC----ISEVERVSSEAMADLKSIADCMISNGYAKECISVYTTMRKSIVDEGIYR  209

Query  1277  LGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESI  1098
             L VE+ S SK+ KM W+VLEL+IK+WL A++IAV+TLF GER LCD+VF ++  +I E+ 
Sbjct  210   LNVEEFSSSKVNKMHWDVLELKIKSWLEAVKIAVRTLFAGERILCDHVFGAS-QSISEAC  268

Query  1097  FKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIR  918
             F EIS+  A +LF FPE +AK  K+ PEK+FR++DMY AIA    EIESIFS+DS ++++
Sbjct  269   FAEISRSGANLLFGFPELVAKTKKSPPEKIFRMIDMYAAIAGMWSEIESIFSLDSTTAVK  328

Query  917   TQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVL  738
             +QA   L  L +++RT ++ F T +QKDSSKST    G+H LT+  MN+LT++AD+SNVL
Sbjct  329   SQAYGLLLGLSESVRTSLSDFATAIQKDSSKSTANFAGVHSLTVQVMNHLTTLADYSNVL  388

Query  737   SDIFSNTPPIPKDWLPDSYFAVSDSDESPL--PAISLRYAWlillllckLDVIAEHYKDI  564
             S+IF + PP P+  LP+SY    +SD +       S++ A LIL+LLCK+D  + +YK++
Sbjct  389   SEIFFDVPPPPRSPLPESYLYSPESDNTTTTETEFSVQMARLILILLCKIDGKSRYYKEV  448

Query  563   SIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPE  384
             S++YLFLANNL++++ KVR S L+  LG++W+    AKVK+  ANYER+ WG V++SLPE
Sbjct  449   SLSYLFLANNLRHILAKVRASNLHYVLGDDWVLNHDAKVKRLTANYERVAWGKVLSSLPE  508

Query  383   NPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYD  204
             NPTA MS  E +  F  FN  F +A+R+ +   V ++  R+ +K SL RK+   YR+ Y+
Sbjct  509   NPTAEMSAAEARVMFGNFNFEFEKAYRRENTFTVPEQEFREEMKASLVRKITPIYREAYE  568

Query  203   THKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
             TH++ M   +E      V FAPEDV +++ +LF E
Sbjct  569   THRIVMGTVRE--IREYVTFAPEDVENYMMNLFSE  601



>ref|XP_003536965.1| PREDICTED: exocyst complex component EXO70A1-like [Glycine max]
Length=622

 Score =   494 bits (1272),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 275/575 (48%), Positives = 389/575 (68%), Gaps = 9/575 (2%)
 Frame = -2

Query  1817  ALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKL  1638
             + E +  +I+KWNPE S   +VTSLFY  + EA  ++ CV  LQK M  L  +   S+KL
Sbjct  34    SFEEAETLILKWNPETSAYGRVTSLFYNDKAEAMHYIHCVNMLQKTMHSLISQNASSQKL  93

Query  1637  VRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvdd  1458
             + A NLM++AMK LQKEF+QIL+MNRAHLDPES S  + ++S  ++    S       +D
Sbjct  94    ILAHNLMQMAMKTLQKEFYQILSMNRAHLDPESVSTRSSTTSTRTSFCSDSYDGGTAEED  153

Query  1457  ddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISR  1278
               +        I+EVE VSS  MAD++ I +CMIS GY+KEC  VY  +RK I+DE I R
Sbjct  154   VRESGDC----ISEVERVSSEAMADLKSIADCMISNGYAKECVSVYTTMRKSIVDEGIYR  209

Query  1277  LGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESI  1098
             L VE+ S SK+ KM W+VLEL+IK+WL A++IAV+TLF GER LCD+VF ++  +I E+ 
Sbjct  210   LNVEEFSSSKVNKMHWDVLELKIKSWLEAVKIAVRTLFAGERILCDHVFGAS-QSISEAC  268

Query  1097  FKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIR  918
             F EIS+  A +LF FPE +AK  K+ PEK+FR++DMY AIA    EIESIFS+DS ++++
Sbjct  269   FAEISRSGANLLFGFPELVAKTKKSPPEKIFRMIDMYAAIAGMWSEIESIFSLDSTTAVK  328

Query  917   TQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVL  738
             +QA   L  L +++RT ++ F T +QKDSSKST    G+H LT+  MN+LT++AD+SNVL
Sbjct  329   SQAYGLLLGLSESVRTSLSDFATAIQKDSSKSTANFAGVHSLTVQVMNHLTTLADYSNVL  388

Query  737   SDIFSNTPPIPKDWLPDSYFAVSDSDESPL--PAISLRYAWlillllckLDVIAEHYKDI  564
             S+IF + PP P+  LP+SY    +SD +       S++ A LIL+LLCK+D  + +YK++
Sbjct  389   SEIFFDVPPPPRSPLPESYLYSPESDNTTTTETEFSVQMARLILILLCKIDGKSRYYKEV  448

Query  563   SIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPE  384
             S++YLFLANNL++++ KVR S L+  LG++W+    AKVK+  ANYER+ WG V++SLPE
Sbjct  449   SLSYLFLANNLRHILAKVRASNLHYVLGDDWVLNHDAKVKRLTANYERVAWGKVLSSLPE  508

Query  383   NPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYD  204
             NPTA MS  E +  F  FN  F +A+R+ +   V ++  R+ +K SL RK+   YR+ Y+
Sbjct  509   NPTAEMSAAEARVMFGNFNFEFEKAYRRENTFTVPEQEFREEIKASLVRKITPIYREAYE  568

Query  203   THKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
             TH++ M   +E      V FAPEDV +++ +LF E
Sbjct  569   THRIVMGTVRE--IREYVTFAPEDVENYMMNLFSE  601



>ref|XP_010505607.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=640

 Score =   494 bits (1272),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 265/584 (45%), Positives = 398/584 (68%), Gaps = 9/584 (2%)
 Frame = -2

Query  1844  HFYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLA  1665
             +F +S+ME  +E +  +I KW+P +    K+ SLF  SR+EA +F++C+R+L++AM FL 
Sbjct  36    NFSQSMMEETVEATESIIKKWDPNSPSYTKIISLFCHSRKEAKEFIRCIRDLRRAMHFLI  95

Query  1664  MEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
              +  +S KLV AQ+LM++ M RL++EFFQIL+ NR  LDPES S+ +  SS +       
Sbjct  96    SQHSQSAKLVLAQHLMQIGMARLEQEFFQILSSNRDQLDPESVSSQSSVSSNSEFEDVMQ  155

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRK  1305
             S  D D D+D+         I++VE  ++ VM+D+++I E MISCGY KEC K YK IRK
Sbjct  156   SDDDDDDDEDELKKAGES--ISKVEKAAALVMSDLKIIAETMISCGYGKECIKRYKLIRK  213

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              I+DE +  LG+EK    +  +MDW VLE  IKNW+ A +I V TL  GE+ LCD VF++
Sbjct  214   SIVDEGLHLLGIEKYKILRFNRMDWGVLEPMIKNWIKAAKIGVITLLRGEKLLCDYVFSA  273

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIA-KYAKNSPEKVFRLLDMYNAIANHRPEIESI  948
             +   IRES F EI+ EA + LF+FPE +A K  K+S E++FRL+D+Y AI++ RP+IE I
Sbjct  274   S-STIRESCFYEIANEAGINLFKFPELVANKEKKSSQERIFRLMDLYAAISDLRPDIELI  332

Query  947   FSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYL  768
             F  DS ++++T  ++SL KL D+I T + +FE+ +QKDSSK+  AGGG+H LT   M+++
Sbjct  333   FHFDSVAAVKTLVLSSLKKLKDSIHTSLTEFESTIQKDSSKALTAGGGVHKLTRSTMSFI  392

Query  767   TSIADHSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllckL  594
             +S++++S VLS+I    P      + +SYF   + + +++   A+S++ AWLIL+ LCKL
Sbjct  393   SSLSEYSRVLSEILEEYPLKRNTRMLESYFTAPILEDEDNNNHAVSIQLAWLILVFLCKL  452

Query  593   DVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLG  414
             D+ AE YKD+S++YLFL NN+Q+VV  VR++ L   LG++WL+K   K++ YA NYE   
Sbjct  453   DIKAESYKDVSLSYLFLVNNIQFVVDTVRSTHLRNLLGDDWLTKHETKLRSYAGNYEIAA  512

Query  413   WGDVIASLPENP-TAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLAR  237
             W +V  SLPE   T  +SPEE K HFK+F+A+F +A+ K S+CV++D  LRD LKVS+A+
Sbjct  513   WSNVYISLPEKSNTTVLSPEEAKTHFKRFHAAFEEAYTKQSSCVITDAKLRDELKVSIAK  572

Query  236   KLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             K++  YR+FY  +  T+   +ER+   +V+  P+++ ++LSDLF
Sbjct  573   KIVPEYREFYGKYLPTLS--QERNIEMLVRLKPDNLENYLSDLF  614



>ref|XP_007132126.1| hypothetical protein PHAVU_011G068800g [Phaseolus vulgaris]
 gb|ESW04120.1| hypothetical protein PHAVU_011G068800g [Phaseolus vulgaris]
Length=616

 Score =   493 bits (1269),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 282/614 (46%), Positives = 406/614 (66%), Gaps = 29/614 (5%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDH-FYESVMERALEISGPMIMKWNPEASEA  1761
             MPRKGMR I F P+  S S++  + P     H F +S+ME+ +  +  +I +W+    ++
Sbjct  1     MPRKGMRSIFFKPSSSSPSTSSSSQPPPSPLHTFSDSMMEQNIHTAESLITEWD----DS  56

Query  1760  AKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFF  1581
                T LF  +R+EA +++  V+ LQ AM +   +   S  LVRAQ LM++AMK LQ+EF+
Sbjct  57    KLATPLFSGTRQEAKNYLHAVKGLQSAMHYFVKQDSSSATLVRAQFLMQLAMKTLQREFY  116

Query  1580  QILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVS  1401
             QIL+ NR +LD E+ SA +     +S S      +  + D            I+E E VS
Sbjct  117   QILSSNRDYLDSETVSARSSIDFRSSVSDYDDEITASEDDFR----------ISETERVS  166

Query  1400  SFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVL  1221
                M D++ I +CM S GY KEC KVY  +RK I+DEA+  LGVEK++ ++++K+DWEVL
Sbjct  167   MLAMEDLKAIADCMTSSGYGKECVKVYIIMRKSIVDEALYHLGVEKLTLARVQKLDWEVL  226

Query  1220  ELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTP-DAIRESIFKEISKEAAMILFEFPEN  1044
             EL+IK WL+A+++AV TLF GER LCD+VF+S P   I ES F EI+K+ A+ LF FPE 
Sbjct  227   ELKIKKWLNAVKVAVGTLFPGERILCDHVFSSNPAKRIAESCFAEITKDGAVSLFAFPEF  286

Query  1043  IAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGI  864
             +AK+ K +PEK+FR LD+Y AI++   +IESIFS +S S IR+QA+TSL +LG+A+R  +
Sbjct  287   VAKW-KKTPEKMFRTLDLYEAISDRLSQIESIFSSESTSVIRSQAITSLVRLGEAVRAML  345

Query  863   AQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDS  684
               FE+ +QKDSSK+T+ GGG+HPLT   MNYLT +AD+S VL DI    P +P+  +P+S
Sbjct  346   VDFESAIQKDSSKTTIPGGGVHPLTRYVMNYLTFLADYSGVLIDII---PDLPQSPMPES  402

Query  683   YF-AVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVR  507
             Y+ +    + +P   +S + AWLIL++LCKLD  AE YK+++++YLFLANN+QYVV KVR
Sbjct  403   YYRSPMRGENTPASELSEKIAWLILVVLCKLDGKAEFYKNVALSYLFLANNMQYVVEKVR  462

Query  506   TSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFN  327
              S L   LGE WL+K   KV +YA+NYER+GW  V ASLPENP + ++ E+ K  F KF+
Sbjct  463   RSNLGFLLGEEWLAKHELKVSEYASNYERVGWSKVFASLPENPASQVTAEQAKTCFVKFD  522

Query  326   ASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVK  147
             A+F +  RK S+ VVSD  LRD +K S+  KL + Y +F++ +++ +         SI  
Sbjct  523   AAFHETCRKQSSWVVSDPKLRDEIKGSIVSKLSQKYSEFHEKNRVGL--------KSIRV  574

Query  146   FAPEDVGHHLSDLF  105
              +PED+G +LS++ 
Sbjct  575   ISPEDIGKNLSNIL  588



>gb|KHN02402.1| Exocyst complex component 7 [Glycine soja]
Length=537

 Score =   489 bits (1260),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 271/535 (51%), Positives = 372/535 (70%), Gaps = 24/535 (4%)
 Frame = -2

Query  1679  MQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvast  1500
             M  L  + P SEKL+ A NLM++AMKRL+KEF+QIL+MNRAHLDPES SA +  +S  S+
Sbjct  1     MHSLLSQNPSSEKLILAHNLMQMAMKRLKKEFYQILSMNRAHLDPESVSARSSRTSANSS  60

Query  1499  stgfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVY  1320
             ++ +      + DD           I+EVE VSS  MAD++LI +CM+S GY+KEC  VY
Sbjct  61    ASDYDDDFAAEDDDIRAAGDS----ISEVEQVSSGAMADLKLIADCMVSSGYAKECVSVY  116

Query  1319  KDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCD  1140
               IRK IIDE I RLGVEK+S S+  KMDW VL+L+IK+WL A+ I+V+TLFNGER LCD
Sbjct  117   ILIRKSIIDEGIYRLGVEKLSSSRANKMDWNVLDLKIKSWLEAIRISVRTLFNGERILCD  176

Query  1139  NVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPE  960
             +VF S  D++RES F EIS++ A +LF FPE +AK  K+S EK+FR+LDM+  ++   PE
Sbjct  177   HVF-SYSDSVRESCFAEISRDGASLLFGFPELVAKTKKSSLEKLFRVLDMHAVVSELWPE  235

Query  959   IESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDA  780
             IESIFS D  S  R+Q + SL +L ++ +  +A+FE+ +QKDSSKS V GGG+HPLTI  
Sbjct  236   IESIFSSDYNSGARSQVLVSLQRLTESAQILLAEFESTIQKDSSKSAVNGGGVHPLTIQT  295

Query  779   MNYLTSIADHSNVLSDIFSNTPPIPKDW--------LPDSYFAVSDSDESPL-PAISLRY  627
             MNYL+ +AD+ NVLSDIF      P+DW        LP+SY    +SD S   PA++ R+
Sbjct  296   MNYLSVLADYINVLSDIF------PRDWLPPPKSSSLPESYLYSPESDYSASKPALTARF  349

Query  626   AWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKV  447
             AWLIL+LLCKLD  A+H KD+S++YLFLANNL YVV +VR+S L   LG++W+ K  AK 
Sbjct  350   AWLILVLLCKLDGKAKHCKDVSLSYLFLANNLWYVVARVRSSNLQYVLGDDWILKHEAKA  409

Query  446   KQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNL  267
             K++ ANYE++ WG+V++SLPENP A     E ++ F+ FN  F + +RK ++ VV+DR L
Sbjct  410   KRFVANYEKVAWGEVVSSLPENPAAA----EAREVFESFNRKFEEGYRKQNSFVVADREL  465

Query  266   RDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             RD +K S+AR ++  YR++Y+    T+   ++   +  V F PED+ ++L +LFF
Sbjct  466   RDEIKGSIARSIVPRYREWYNVVLATVGTVRDLTATEYVTFTPEDIENYLVNLFF  520



>ref|XP_002312061.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
 gb|EEE89428.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
Length=622

 Score =   492 bits (1266),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 266/575 (46%), Positives = 387/575 (67%), Gaps = 17/575 (3%)
 Frame = -2

Query  1829  VMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPR  1650
             V E  +E +  +I KW+P +S   +VTSLF+ +R EA DF+  VR+L++AM  L  E   
Sbjct  50    VTEETIENAELIITKWDPNSSSITRVTSLFHGNRDEAEDFLSSVRDLRRAMHTLVSEHST  109

Query  1649  SEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdf  1470
             S  LV +Q LME+AM RLQKEF+QIL   R  LDPES S  +   S+   +   S     
Sbjct  110   SVMLVLSQKLMEMAMARLQKEFYQILAATRDQLDPESISVRSPDGSIEDENELGSEEEFK  169

Query  1469  dvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDE  1290
                +           IT V  V +  M+D++ I +CMIS GYS EC  +YK +RK ++DE
Sbjct  170   TAGES----------ITNVVRVVAVAMSDLKSIADCMISSGYSIECVNIYKLVRKSVVDE  219

Query  1289  AISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAI  1110
              +  LG+EK   S+I KM+WE LE  IKNW++A+ IAVKTL +GE+ LCD+VF+++   I
Sbjct  220   GLYLLGIEKFRSSQIHKMNWEALEHMIKNWMNAV-IAVKTLLSGEKALCDHVFSAS-QTI  277

Query  1109  RESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSA  930
             +ES F EI+K  A+ LF FP ++AK  K  PE++F L+++Y A+++ +PE+E IF+ +S 
Sbjct  278   KESCFSEITK-GAINLFRFPVHVAK-CKKLPERIFPLMELYEALSDLQPEVELIFNSEST  335

Query  929   SSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADH  750
             S I+ Q V+SL  LG++IR  ++ F + +Q DSSK+ + GGGIHPLT    +Y++S+AD+
Sbjct  336   SDIKLQVVSSLHGLGESIRALLSDFVSTIQNDSSKTLIVGGGIHPLTQKVTSYISSLADY  395

Query  749   SNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYK  570
             S +LSDI S++PP     LP++YF    SD    PA+S+  AWLI +LLCKLD  AE YK
Sbjct  396   SRILSDIVSDSPPPRNTALPEAYFESPTSDSGLTPAVSVHLAWLIFVLLCKLDRKAEVYK  455

Query  569   DISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASL  390
             D+S++YLFLANN+Q V+ KV T+ LN  LGE+W+ K + KV QYA+ YE + WG V +SL
Sbjct  456   DMSLSYLFLANNVQNVLDKVCTTHLNVLLGEDWVFKHAKKVIQYASTYETMAWGKVFSSL  515

Query  389   PENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDF  210
             P+  + P+SPEE K+ F++FNA+F +A++K  + VV DR LRD LKVS+A++L+  YR+F
Sbjct  516   PDINSPPLSPEEAKECFQRFNAAFEEAYKKQVSWVVPDRKLRDELKVSIAKELIPAYREF  575

Query  209   YDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             YDTH++ +   +E +F   V+F P+D+G++++ LF
Sbjct  576   YDTHRMML---RENNFEMFVRFTPDDLGNYIARLF  607



>ref|XP_010517282.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=638

 Score =   492 bits (1267),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 265/583 (45%), Positives = 394/583 (68%), Gaps = 11/583 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+ME  +E +  +I KW+P +    K+ SLF  SR+EA +F++C+R+L++AM FL  
Sbjct  37    FSQSMMEETVEAAESIIKKWDPNSPSYTKIISLFCHSRKEAKEFIRCIRDLRRAMHFLIS  96

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S KLV AQ+LM++ M RL++EFFQIL+ NR  LDPES S+ +  SS +       S
Sbjct  97    QHSQSAKLVLAQHLMQIGMARLEQEFFQILSSNRDQLDPESVSSQSSVSSNSEFEDVMQS  156

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               D D D+           I++VE  ++ VM+D+++I E MISCGY KEC K YK IRK 
Sbjct  157   DDDDDEDELKKAGES----ISKVEKAAALVMSDLKIIAETMISCGYGKECIKRYKLIRKS  212

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  LG+EK   S+  +MDW VLE  IKNW+ A +I V TL  GE+ LCD VF+++
Sbjct  213   IVDEGLHLLGIEKYKISRFNRMDWGVLEPMIKNWIKAAKIGVITLLRGEKLLCDYVFSAS  272

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIA-KYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
                IRES F EI+ EA + LF+FPE +A K  K+S E++FRL+D+Y AI++ RP+IE IF
Sbjct  273   -STIRESCFYEIANEAGINLFKFPELVANKEKKSSQERIFRLMDLYAAISDLRPDIELIF  331

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
               DS ++++T  ++SL KL D+I T + +FE+ +QKDSSK+  AGGG+H LT   M++++
Sbjct  332   HFDSVAAVKTLVLSSLKKLKDSIHTSLTEFESTIQKDSSKAVTAGGGVHKLTRTTMSFIS  391

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllckLD  591
             S++++S VLS+I    P      + +SYF   + + +++   A+S++ AWLIL+ LCKLD
Sbjct  392   SLSEYSRVLSEILEEYPLKRNTRMLESYFTAPILEDEDNNNHAVSVQLAWLILVFLCKLD  451

Query  590   VIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGW  411
               AE YKD+S++YLFL NN+Q+VV  VR++ L   LG++WL+K   K++ YAANYE   W
Sbjct  452   TKAESYKDVSLSYLFLVNNIQFVVDTVRSNHLRNLLGDDWLTKHETKLRSYAANYEIAAW  511

Query  410   GDVIASLPENP-TAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
              +V  SLPE   T  +SPEE K HFK+F+A+F +A+ K S+CV++D  LRD LKVS+A+ 
Sbjct  512   SNVYISLPEKSNTTVLSPEEAKTHFKRFHAAFEEAYTKQSSCVITDAKLRDELKVSIAKN  571

Query  233   LLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             ++  YR+FY  +  T+    ER+   +V+  P+++ ++LSDLF
Sbjct  572   IVPEYREFYGKYLPTLS--HERNTEMLVRLKPDNLENYLSDLF  612



>ref|XP_010037882.1| PREDICTED: exocyst complex component EXO70A1-like [Eucalyptus 
grandis]
Length=624

 Score =   491 bits (1265),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 267/579 (46%), Positives = 373/579 (64%), Gaps = 28/579 (5%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEA-SEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             S+ ER  E S   I KW+PE+ S  A+V S+F E R EA  F++CV +L++AM  L  E 
Sbjct  29    SLTERIFESSAAAIAKWDPESPSPRARVASVFLEDRAEALRFLQCVHDLRQAMHSLVSES  88

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
             P SE L+  Q  M+ AMKRLQKE ++ L+ + A  DPES SA    S             
Sbjct  89    PGSEMLLLGQRSMQTAMKRLQKELYRALSADAACSDPESVSARLSGSVRMDDGGSG----  144

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
                                E   +    M D+R IVECMIS GY+KEC  +Y  +RK I+
Sbjct  145   ------------------GEGLPLPPTAMMDLRSIVECMISSGYAKECIAIYTVVRKVIV  186

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             D+AI RLGVEK+S S++  MDWEVLE+++K WL A+++A+ +LF GER LCD+ F ++ D
Sbjct  187   DKAIRRLGVEKLSVSQVNAMDWEVLEVKVKLWLDAVKVAMTSLFTGERILCDHSFFAS-D  245

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
             ++ E  F EI  + A  LF+FPE IA+  K SPEK+F LLDMY AI+ +  EIES F+ D
Sbjct  246   SLGELCFAEICGDGAACLFKFPEIIARRTKKSPEKIFCLLDMYAAISENWLEIESTFAFD  305

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             S + +R+QA+ SL +LG+++R  + +F++ + KDSSKS VAGGG+H LT+  M++L  +A
Sbjct  306   STAGVRSQALASLVRLGESVRAMLTEFKSTIHKDSSKSVVAGGGVHRLTVYTMDHLCRLA  365

Query  755   DHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSD--ESPLPAISLRYAWlillllckLDVIA  582
             D+ + L+DI +      K  LP+ YF  SDSD  E P PAISL+ A LIL+LLCKLD  A
Sbjct  366   DYGDTLADIVTEWTTPAKSSLPEEYFDGSDSDDEEEPAPAISLQVATLILVLLCKLDGKA  425

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
             EHY+D+S++YLFL NNLQ+++ K R S L   LGE W+++   K++Q+A N+ER+ WGDV
Sbjct  426   EHYRDVSVSYLFLGNNLQHIISKARASNLRYLLGEEWVARLVRKLRQFAENHERIAWGDV  485

Query  401   IASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRP  222
              ASLPE+P A +SP E  + F++FNA F +A R+    V +D  LR+ ++ SL RK++R 
Sbjct  486   AASLPEDPRAAISPAEASERFRRFNARFEEACRREGTRVPADPKLREEMRASLERKVVRA  545

Query  221   YRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             Y +FYD H LT+  E     S  +K+ PEDVG++L+ LF
Sbjct  546   YGEFYDAHWLTVGGETGGAMS--IKYTPEDVGYYLASLF  582



>ref|XP_011020377.1| PREDICTED: exocyst complex component EXO70A1-like [Populus euphratica]
Length=622

 Score =   491 bits (1264),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 265/577 (46%), Positives = 388/577 (67%), Gaps = 17/577 (3%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             +S+ E  +E +  +I KW+P +S   +VTSLF+ +R EA +F+  VR+L++AM  L  E 
Sbjct  48    KSLTEETIENAELIITKWDPNSSSITRVTSLFHGNRDEAEEFLSSVRDLRRAMHTLVSEH  107

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
               S  LV +Q LME+AM RLQKEF+Q+L   R  LDP+S S  +   S+   +   S   
Sbjct  108   STSAMLVLSQKLMEMAMARLQKEFYQVLAATRNQLDPDSISVRSPDGSIEDENELGSEEE  167

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
                  +           IT V  V +  M+D++ I +CMIS GYS EC  +YK  RK ++
Sbjct  168   FKTAGES----------ITNVARVVAVAMSDLKSIADCMISSGYSIECVNIYKLFRKSVV  217

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DE +  LG+EK   S+I KM+WE LE  IKNW++A+ IAVKTL +GE+ L D+VF+++  
Sbjct  218   DEGLYLLGIEKFRSSQIHKMNWEALEHMIKNWMNAV-IAVKTLLSGEKALSDHVFSAS-Q  275

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
              I+ES F EI+K  A+ LF FP ++AK  K  PE++F L+++Y A+++ +PE+E IF+ +
Sbjct  276   TIKESCFSEITK-GAINLFRFPVHVAK-CKKLPERIFPLMELYEALSDLQPEVELIFNSE  333

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             S S I+ Q  +SL  LG++IR  ++ FE+ +QKDSSK+ + GGGIHPLT    +Y++S+A
Sbjct  334   STSDIKLQVASSLHGLGESIRAILSDFESTIQKDSSKNLIVGGGIHPLTQKVTSYISSLA  393

Query  755   DHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEH  576
             D+S +LSDI S++PP     LP++YF    SD    PA+S+  AWLI +LLCKLD  AE 
Sbjct  394   DYSRILSDIVSDSPPPRNTALPEAYFESPTSDSGLTPAVSVHLAWLIFVLLCKLDRKAEV  453

Query  575   YKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIA  396
             YKD+S++YLFLANN+Q V+ KV T+ LN  LGE+W+ K + KV QYA+ YE + WG V +
Sbjct  454   YKDMSLSYLFLANNVQIVLDKVCTTHLNVLLGEDWVFKHAKKVIQYASTYETMAWGKVFS  513

Query  395   SLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYR  216
             SLPE  + P+SPEE K+ F++FNA+F +A++K  + VV DR LRD LKVS+A++L+  YR
Sbjct  514   SLPEINSPPLSPEEAKECFQRFNAAFEEAYKKQVSWVVPDRKLRDELKVSIAKELITAYR  573

Query  215   DFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +FYDTHK+ +   +E +F   V+F P+D+G++++ LF
Sbjct  574   EFYDTHKMML---RENNFEMCVRFTPDDLGNYIAHLF  607



>ref|XP_009601489.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
tomentosiformis]
Length=627

 Score =   491 bits (1264),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 270/588 (46%), Positives = 400/588 (68%), Gaps = 21/588 (4%)
 Frame = -2

Query  1847  DHFYESVMERALEISGPMIMKWNPEASEAA-----KVTSLFYESRREANDFVKCVRNLQK  1683
             + F E++ME  +E S  +I KW+ ++S  +     +V +LF ++  EA   +  V +LQ 
Sbjct  22    NTFSETLMEETIEYSELIIKKWDLDSSSVSTTSYNRVANLFRDNPLEAKQLLNAVNDLQH  81

Query  1682  AMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvas  1503
             AMQF+  +   S+ LVRA NLM++A++RLQKEF+ IL+ +R  LD E+ S+ +  SS A+
Sbjct  82    AMQFVIKDSSSSKLLVRAHNLMQIAIRRLQKEFYTILSGSRYFLDAETVSSRSSRSSTAT  141

Query  1502  tstgfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKV  1323
              S+        + +++           +E+E VS  VMAD++ I +CMI  GY +EC K+
Sbjct  142   LSSLSDEDEVSEDNNN-----------SEIEKVSEVVMADLKSIADCMIGAGYGRECVKI  190

Query  1322  YKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLC  1143
             YK  RK +IDE +  LG+EK+S S+I+KMDWE+LE++IKNWLSA++IAV TLF+GER LC
Sbjct  191   YKLNRKSVIDETLYYLGIEKLSSSQIQKMDWELLEIKIKNWLSAVKIAVTTLFHGERILC  250

Query  1142  DNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRP  963
             D VF+++ D IRES F EI+K+ A+ LF FPE +AKY K S EK+FR+LD+Y+AI     
Sbjct  251   DYVFSAS-DNIRESCFSEIAKDGALTLFLFPEMVAKYKKLSLEKMFRVLDVYDAICELWV  309

Query  962   EIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTID  783
             +IE IFS DS   +++QA+  L KLG+A R  +++FE+ +QKD+SK+ V GGG+HPLT  
Sbjct  310   KIELIFSFDSMEVVKSQAMILLVKLGNAARAMLSEFESAVQKDTSKA-VPGGGVHPLTRY  368

Query  782   AMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlill  609
              MNYL  + D+S+ +S+I  + P   +  LP+SY+    ++  +SP  A++LR AWL+L+
Sbjct  369   VMNYLVYLGDYSDAISEIIVDLPISLQTSLPESYYLSLTTEDGDSPPSAVALRLAWLVLV  428

Query  608   llckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAAN  429
             LLCKLD  A+ YKD++++YLFLANNL Y++ KV+ S L   LG +W+ K   KVK+Y + 
Sbjct  429   LLCKLDGKAQLYKDVALSYLFLANNLNYIISKVQESNLKLLLGSDWILKHEMKVKEYMSK  488

Query  428   YERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKV  249
             YER+GW  V+ SLPEN T  +S  E+K+ F KFN+SF + +RK S+ V+ D+ LRD +KV
Sbjct  489   YERMGWNKVLMSLPENLTIEISSMEVKERFSKFNSSFEEVYRKQSSWVILDQKLRDQVKV  548

Query  248   SLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             SLA KL+  Y+ FY+ H+  + +       SI++FAP+D+ ++LSDLF
Sbjct  549   SLANKLVPRYQTFYEQHRRELVRNV-TGMESIIRFAPDDLQNYLSDLF  595



>ref|XP_011041957.1| PREDICTED: exocyst complex component EXO70B1-like [Populus euphratica]
Length=628

 Score =   490 bits (1261),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 282/616 (46%), Positives = 402/616 (65%), Gaps = 27/616 (4%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEA-  1761
             MPRKGMR I F P+     S      +     F +++M+  +E +  +I KW+   S + 
Sbjct  1     MPRKGMRTILFKPS----RSRSPTRSTPHRQTFSDTLMDDNVENARELISKWDASRSSSL  56

Query  1760  -AKVTSLFY-ESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKE  1587
                V +LF  ++  EA  ++  +++LQ AMQ+     P  +KLV AQNLM++AMKRL+KE
Sbjct  57    YCDVANLFASDNHYEAQRYLNSIKDLQTAMQYYISHDPTLDKLVLAQNLMQIAMKRLEKE  116

Query  1586  FFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVED  1407
             F+ IL   R HLDPES S ++RSS                 +D           I+EVE 
Sbjct  117   FYIILRSRRQHLDPESVSRASRSSVSEFEDESEEDEFSRVGEDS----------ISEVEL  166

Query  1406  VSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVE-KMSFSKIRKMDW  1230
             VS   M D++ I ECMI  GY KEC K++K IRK ++DEA+  L VE ++S ++I+KMDW
Sbjct  167   VSMDAMKDLKAIAECMIGAGYGKECVKIFKIIRKSVVDEALYHLNVESRLSSAQIQKMDW  226

Query  1229  EVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFP  1050
             EVLE++IK WL+A+++AVKTLF GER LCD VF+S+P +++ES F +I++E A+ LF FP
Sbjct  227   EVLEVKIKAWLNAVKVAVKTLFYGERVLCDQVFSSSP-SLKESCFADITREGALSLFVFP  285

Query  1049  ENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRT  870
             EN+AK  K +PE++FR LD+Y AIA+   EIE IF ++S S+IR Q + SL KLG+A+  
Sbjct  286   ENVAK-CKKAPERIFRTLDLYEAIADLWTEIEPIFDLESTSTIRQQVINSLNKLGEAVSA  344

Query  869   GIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLP  690
              + +FET + K +SK+ V GGGIHPLT   MNY+T + D+S VL+DI +    +P   LP
Sbjct  345   ILTEFETAISKFNSKAAVPGGGIHPLTRYVMNYITFLTDYSGVLTDILAGPLTVPSP-LP  403

Query  689   DSYFAVSDS-DESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVK  513
             ++YF    S D     +IS+R AWLIL++LCKLD  AE YKD +++YLFLANNLQYVV K
Sbjct  404   EAYFGSPVSADGMGTSSISIRLAWLILVMLCKLDGKAEIYKDAALSYLFLANNLQYVVNK  463

Query  512   VRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKK  333
             V+ S L   LG+ W+ K   KV+QYA+NYER+GW  V A+LP+     M+  +  + FK+
Sbjct  464   VQKSNLKLLLGDEWVEKHEEKVRQYASNYERMGWSKVFAALPDANDNQMTTPQFTECFKR  523

Query  332   FNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSI  153
             FN+SF +A+   ++ VVSD  LRD +KVS+ARKL+  YR+FY  ++  +P+++      I
Sbjct  524   FNSSFEEAYNNQASWVVSDSKLRDQIKVSVARKLVPVYREFYGKYRQLVPRKE-----GI  578

Query  152   VKFAPEDVGHHLSDLF  105
             V+FAP+D+ ++LSDL 
Sbjct  579   VRFAPDDLENYLSDLL  594



>ref|XP_010554564.1| PREDICTED: exocyst complex component EXO70B1-like [Tarenaya hassleriana]
Length=665

 Score =   488 bits (1257),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 266/580 (46%), Positives = 387/580 (67%), Gaps = 9/580 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+ME  +E + P+I +W+PE+S   K+ SLF  SRREA DF++CVR+L++AM FL  
Sbjct  65    FSQSMMEETVESAEPIIRRWDPESSTYTKIVSLFQHSRREARDFIRCVRDLRRAMHFLVS  124

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
                 S KLV AQNLM++AM RL+KEF+QIL++NR  LDP+S S  + + S  S       
Sbjct  125   HHSHSSKLVLAQNLMQIAMARLEKEFYQILSLNRDQLDPDSVSGQSSNGSSNSEVEDDLD  184

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
                 + DD+      +   IT+VE  S+  M D++ I E MISCGY KEC +VYK IRK 
Sbjct  185   DIYEEEDDELKRAGES---ITKVEKASAMAMTDLKAIAETMISCGYGKECIRVYKLIRKS  241

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I++E +  LG+EK   S   + D   LE  I NW+ A +I V TLF GE+ LCD+VF+++
Sbjct  242   IVEEGLYMLGIEKYKISNFHRTDSAALENTINNWIKAAKIGVTTLFRGEKLLCDHVFSAS  301

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
                IRES F EI+ EA   LF FPE +AK  K SP+++FRL+D++ A++    +IE IF 
Sbjct  302   -KTIRESCFYEIANEAGTNLFRFPEVVAK-GKRSPDRIFRLMDLHMAMSELWQDIELIFH  359

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              D+ +S++ QA++S+ KL D+IR+ + +FE+ +QKDSSKS V GGGIH L    M++++S
Sbjct  360   FDAVASVKLQALSSMQKLSDSIRSLLVEFESTVQKDSSKSLVPGGGIHQLARSTMSFVSS  419

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             +A++ +V+++I +  P   K  L +SYF    S++    A+S+  AW+IL+LLCKLD  A
Sbjct  420   LAEYGSVMAEILAEHPLPRKTRLLESYFGSLTSEDEQNRAVSVHLAWVILVLLCKLDTKA  479

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTS-RLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             E YKD+S++YLFLANNLQ+ V  VR+S RL   LG  W+ +   KV+ YAANYE   W +
Sbjct  480   ELYKDVSLSYLFLANNLQFTVDTVRSSHRLRSLLGHEWIVRHENKVRTYAANYEIAAWAN  539

Query  404   VIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
             V  SLPE  TA + PEE + HF++F+A+F +A+ + SA +V +  LRD LKVS+A+KL+ 
Sbjct  540   VFLSLPEK-TATLPPEEARSHFRRFHAAFEEAYMRQSAWIVPEGKLRDELKVSIAKKLVP  598

Query  224   PYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              YR+FY+ H  T+   +ER+   +V+F P+++ ++LSDLF
Sbjct  599   EYREFYEKHLNTLS--QERNLEILVRFKPDNLENYLSDLF  636



>ref|XP_002882623.1| ATEXO70H3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58882.1| ATEXO70H3 [Arabidopsis lyrata subsp. lyrata]
Length=638

 Score =   487 bits (1253),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 278/587 (47%), Positives = 393/587 (67%), Gaps = 24/587 (4%)
 Frame = -2

Query  1838  YESV-MERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             YES  + + ++ +  +I KWN E   + K  SLF ES+REA  FVK V+ LQ AM  L  
Sbjct  29    YESSDINKTIDNAAEIIEKWNTEYVSSNKFYSLFCESKREAKKFVKRVKELQNAMDMLIR  88

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E P SE L+RAQNLM++AMKRLQKEF QIL+MNRAHLDPES S+ + +S V++    +  
Sbjct  89    EDPNSENLLRAQNLMQIAMKRLQKEFLQILSMNRAHLDPESVSSRSPTSVVSNDDDIWHE  148

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
             +                  I EVE+VS     +++ I +CMI+ GY+KEC   YK IRK 
Sbjct  149   SRSASDS------------IIEVEEVSKNSRTELKSIADCMIAAGYAKECASTYKSIRKS  196

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE+I RLGVEK+S SK +KM  EV+EL++  W+ A+++++KTLFNGE++LCD++F S+
Sbjct  197   IVDESIYRLGVEKISSSKAKKMPCEVVELKMNRWIEAVKVSMKTLFNGEKSLCDDIFESS  256

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKN--SPEKVFRLLDMYNAIANHRPEIESI  948
               ++RES F++ISKE A++LF FPE IA   K   +PEK+F LLDMY  I  +   IESI
Sbjct  257   V-SLRESCFRDISKEGALLLFGFPETIALRDKKNPNPEKIFPLLDMYCTITENLLAIESI  315

Query  947   FSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYL  768
             FS  S S +RTQA +SL++L ++I + +  FE+ ++KDSSK+ V GGG+HP+TI AMN++
Sbjct  316   FSFPSISIVRTQAHSSLSRLSESILSHLVDFESEIRKDSSKTVVRGGGVHPMTISAMNHI  375

Query  767   TSIADHSNVLSDIFSN--TPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckL  594
             + +A++S  L+DI     +    K  LP SYF VS+S+ESP   + +R+AW+IL+LLCK+
Sbjct  376   SRLAEYSTALTDILKGSSSSSSAKSLLPKSYFNVSESEESPASELKVRFAWMILVLLCKI  435

Query  593   DVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLG  414
             D  AE YKD S+ YLFLANNLQ+VV + R++ +   LG++W++K S KV+Q+A +YERL 
Sbjct  436   DGKAEMYKDFSMQYLFLANNLQHVVSRARSTNVKDVLGDDWIAKHSEKVRQFARSYERLA  495

Query  413   WGDVIASLPENPTA---PMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSL  243
             WG + +  P   T+    MSPEE    FKKFN +F       S C+V D  L D +++S+
Sbjct  496   WGPLASMCPAISTSEAVEMSPEEAMMQFKKFNETFENTCEAQSECIVLDPKLLDEMRISI  555

Query  242   ARKLLRPYRDFYDTHK-LTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              RKLL  YRDFY+ H+   M    E  ++  V++ PED+G+HLS+LF
Sbjct  556   GRKLLPVYRDFYNAHRNAVMLAGTEGEWN--VRYTPEDIGNHLSELF  600



>emb|CDP19956.1| unnamed protein product [Coffea canephora]
Length=643

 Score =   487 bits (1253),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 285/623 (46%), Positives = 411/623 (66%), Gaps = 25/623 (4%)
 Frame = -2

Query  1946  LSGMPRKGMRLIGFSPNYWsssstvraspsagSDHFY---------ESVMERALEISGPM  1794
             L   PR+ M  I FSP+         +  S+ S+HF          E +M+  +E +  M
Sbjct  14    LPATPRRAMARI-FSPS------NSTSPISSFSNHFTSPKSSNTTSEPMMDENIEKAEAM  66

Query  1793  IMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLME  1614
             I KW+ + S  AK TSLF E+R+EA DFV CV++L++AM FL  E+  + KLVRAQNLM+
Sbjct  67    ITKWDVKGSTFAKFTSLFQENRKEAKDFVNCVKDLRRAMHFLVSERASAGKLVRAQNLMQ  126

Query  1613  VAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrva  1434
             ++M+RL+KEF+QIL+ NR HLDPES S+ + + S + ++T           +        
Sbjct  127   MSMQRLEKEFYQILSANREHLDPESVSSRSSTISRSLSATSDDEDDYSSDHEIQRVGDK-  185

Query  1433  gdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSF  1254
                I+EVE +S   M+D+RLI +CMIS GY KEC  +YK IR+ I+DE + RLG+E+ S 
Sbjct  186   ---ISEVERLSVLAMSDLRLIADCMISTGYGKECLTIYKIIRRSIVDEGLYRLGIERYSS  242

Query  1253  SKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEA  1074
             S+I KM+   LE + K+WL+ ++IAVKTL +GER LCD+VF+S+ +AIRES F +I+KE 
Sbjct  243   SQINKMNPSALEHQTKSWLNGIKIAVKTLLHGERFLCDHVFSSS-EAIRESCFADIAKEG  301

Query  1073  AMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLA  894
             A  LF FPE +AK +K  PEKVF L+D+Y AI++  PE ESIFS +S SS+++QA +SL 
Sbjct  302   ATNLFRFPELVAK-SKRWPEKVFLLMDLYEAISDLWPETESIFSFESISSVKSQACSSLH  360

Query  893   KLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTP  714
             KL D++RT +  FE+ +QK+SSK  V GG IHPLTI  +NY++S+A++S VLSDI + + 
Sbjct  361   KLSDSVRTLLTDFESSIQKNSSKVPVPGGAIHPLTISVLNYVSSLANYSGVLSDIIAGSA  420

Query  713   PIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANN  534
                +  LP+SYF     +E P  A+S+R AW+IL+LLCKLD  A  Y D +++YLFLANN
Sbjct  421   SPTQLPLPESYFESPTVNEMPTSAVSVRLAWIILVLLCKLDSKANFYNDTALSYLFLANN  480

Query  533   LQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEE  354
             LQ+V  KV  + L   LG++W  K   KVK YAANYE + W  V + LPE     MSP+ 
Sbjct  481   LQFVGKKVCATSLKCLLGDDWTVKLDRKVKLYAANYELMAWNKVFSCLPEKSQEDMSPDT  540

Query  353   IKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEK  174
             +K +F++F A+F +A+RK  + VV D   RD +K+S+  KL+  YR+FY+TH   +  ++
Sbjct  541   VKTYFRQFKAAFDEAYRKQKSWVVPDGKFRDDIKLSIKSKLVPVYREFYNTHIEVLKGDR  600

Query  173   ERHFSSIVKFAPEDVGHHLSDLF  105
                   +V+F+P+++G++LSD+ 
Sbjct  601   TLK---LVRFSPDNLGNYLSDIL  620



>ref|XP_007144485.1| hypothetical protein PHAVU_007G160000g [Phaseolus vulgaris]
 gb|ESW16479.1| hypothetical protein PHAVU_007G160000g [Phaseolus vulgaris]
Length=703

 Score =   489 bits (1258),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 269/579 (46%), Positives = 381/579 (66%), Gaps = 10/579 (2%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             ES++  ++E +  +I+KW+PE S    VTSLFY  + EA  ++ CV  LQK M  L    
Sbjct  111   ESMVSTSIEEAEALILKWDPETSTYGSVTSLFYNDKAEAMHYIHCVNQLQKTMHALLEHN  170

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
             P S KLV AQNLM++AMKRLQKEF+QIL+M+RAHLDPES SA + ++S  S  +      
Sbjct  171   PSSRKLVLAQNLMQMAMKRLQKEFYQILSMSRAHLDPESVSARSSTTSRTSFCSDSYDEG  230

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
               + D  D         I+EVE VSS  +A ++ I +CM+S GY KEC  VY  +RK I+
Sbjct  231   TAEDDVRDTGDC-----ISEVERVSSETVAVLKSIADCMVSNGYGKECVTVYTTMRKSIV  285

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DE I RL VE++S S++ KM WEVLEL+IK WL A++I V+TLF GER LCD VF ++  
Sbjct  286   DEGIYRLSVEELSASRVNKMAWEVLELKIKAWLEAVKIGVRTLFAGERILCDQVFGAS-H  344

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
             ++ E+ F EIS+  A +LF FPE +A+  K+ PEK+FR++DMY  IA   PEIESIFS D
Sbjct  345   SVAEACFAEISRSGAALLFRFPELVARTKKSPPEKIFRMIDMYAVIAELWPEIESIFSFD  404

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             S S+ ++QA   L +L ++IRT   +FET +QKDSSKS     G+H LT+  MN+L+++A
Sbjct  405   STSAAKSQAYALLFRLSESIRTSFFEFETTIQKDSSKSGAKFAGVHSLTVQVMNHLSTLA  464

Query  755   DHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPL--PAISLRYAWlillllckLDVIA  582
             D+SNVLS+IF + PP  +  LP+SY     SD S +     S++ A LIL+LLCK+D  +
Sbjct  465   DYSNVLSEIFFDVPPPSRSPLPESYLYSPQSDNSTITETEFSVQMARLILVLLCKIDGKS  524

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
              H K++S++YLFL NNL++VV KVRTS L   LG++W+    A++K+   NYER+ WG V
Sbjct  525   RHCKEVSLSYLFLTNNLRHVVAKVRTSNLIYVLGDDWVLNHEARMKRLMENYERVAWGKV  584

Query  401   IASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRP  222
             ++SLPENPTA M P E +  F  FN  F +A+++ +   + ++  R+ +K SLARK+   
Sbjct  585   LSSLPENPTAEMPPAEARVMFGNFNLEFEKAYQRENVFTIPEQEFREEIKASLARKISPV  644

Query  221   YRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             YR+ ++T + T  +   R     V F PED+ +++ +LF
Sbjct  645   YREMHETRRNT--EGSVREMREYVIFTPEDIENYMLNLF  681



>ref|XP_006436133.1| hypothetical protein CICLE_v10030942mg [Citrus clementina]
 gb|ESR49373.1| hypothetical protein CICLE_v10030942mg [Citrus clementina]
Length=637

 Score =   486 bits (1251),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 259/579 (45%), Positives = 385/579 (66%), Gaps = 8/579 (1%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F E+++E  +  +  MI KW+  +    K+TSLF  +R+EA +F+KCV++L+ AM +   
Sbjct  41    FSEAMVEENIANAATMIKKWDMNSPSITKLTSLFLHNRKEAKEFLKCVKDLRCAMHYSVS  100

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E   S+KLV AQNLM+ AMKRL+ EF+Q L+  R  LD +S S    S   +S       
Sbjct  101   EHSTSDKLVLAQNLMQTAMKRLEHEFYQTLSRYRDELDADSISLGRSSDGSSSYVGDEDE  160

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
                 D D+           +TE+  +S   MAD++ I + MI CGY KEC K+YK  RK 
Sbjct  161   NGSVDDDELRRTGET----LTEMGRISQLAMADLKAIADVMIGCGYGKECIKIYKLARKS  216

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE + +LG+E    S ++KM+WE LE  IKNWL+A++IAVKTLF+GE+  CD+VF+++
Sbjct  217   IVDEGLHQLGIEHFKASHVQKMNWEALEHMIKNWLTAVKIAVKTLFSGEKFFCDHVFSAS  276

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              D IRE+ F +I++E A+ LF+FPE +AK +K S E++F+L++++N +    PEIE IF+
Sbjct  277   -DKIREACFCDITQEEALNLFKFPELVAK-SKKSAERIFQLMELHNMLNVLFPEIELIFN  334

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              ++ S+++ QA++S+ KLGD++R  I+ FE+ L KDSSK+   GGGIH LT   M+Y+TS
Sbjct  335   SEATSAVKLQALSSMHKLGDSVRAIISDFESTLHKDSSKTQAVGGGIHQLTRSVMSYITS  394

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             + +H N+L+DI ++ PP      P+SYF    S  S   A+SL  AWLIL+LLCKLD  A
Sbjct  395   LGEHGNILADIVADHPPPCTSSFPESYFESPSSHNSRGSAVSLHLAWLILVLLCKLDRKA  454

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
               YKD++++YLFLANNLQ+++ KVRTS L   LG++WL   + K+KQYA NYE + W  V
Sbjct  455   ALYKDVALSYLFLANNLQFIIEKVRTSVLKHLLGDDWLCTHAKKLKQYALNYETMAWNKV  514

Query  401   IASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRP  222
              +SLPE  ++P+ PE  K  F++F+A+F +A+ K ++ +V +R LRD LK S+A+KL   
Sbjct  515   FSSLPERSSSPVPPEVAKDCFRRFSAAFEEAYVKQTSWIVPNRKLRDELKASIAKKLAPA  574

Query  221   YRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             YR+FYD +++ +  EK      +V+F P+D+ + LSDLF
Sbjct  575   YREFYDEYRVILSGEK--FLELLVRFGPDDLENQLSDLF  611



>ref|XP_006486008.1| PREDICTED: exocyst complex component EXO70A1-like [Citrus sinensis]
Length=637

 Score =   486 bits (1251),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 259/579 (45%), Positives = 385/579 (66%), Gaps = 8/579 (1%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F E+++E  +  +  MI KW+  +    K+TSLF  +R+EA +F+KCV++L+ AM +   
Sbjct  41    FSEAMVEENIANAATMIKKWDMNSPSITKLTSLFLHNRKEAKEFLKCVKDLRCAMHYSVS  100

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E   S+KLV AQNLM+ AMKRL+ EF+Q L+  R  LD +S S    S   +S       
Sbjct  101   EHSTSDKLVLAQNLMQTAMKRLEHEFYQTLSRYRDELDADSISLGRSSDGSSSYVGDEDE  160

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
                 D D+           +TE+  +S   MAD++ I + MI CGY KEC K+YK  RK 
Sbjct  161   NGSVDDDELRRTGET----LTEMGRISQLAMADLKAIADVMIGCGYGKECIKIYKLARKS  216

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE + +LG+E    S ++KM+WE LE  IKNWL+A++IAVKTLF+GE+  CD+VF+++
Sbjct  217   IVDEGLHQLGIEHFKASHVQKMNWEALEHMIKNWLTAVKIAVKTLFSGEKFFCDHVFSAS  276

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              D IRE+ F +I++E A+ LF+FPE +AK +K S E++F+L++++N +    PEIE IF+
Sbjct  277   -DKIREACFCDITQEEALNLFKFPELVAK-SKKSAERIFQLMELHNMLNVLFPEIELIFN  334

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              ++ S+++ QA++S+ KLGD++R  I+ FE+ L KDSSK+   GGGIH LT   M+Y+TS
Sbjct  335   SEATSAVKLQALSSMHKLGDSVRAIISDFESTLHKDSSKTQAVGGGIHQLTRSVMSYITS  394

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             + +H N+L+DI ++ PP      P+SYF    S  S   A+SL  AWLIL+LLCKLD  A
Sbjct  395   LGEHGNILADIVADHPPPCTSSFPESYFESPSSHNSRGSAVSLHLAWLILVLLCKLDRKA  454

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
               YKD++++YLFLANNLQ+++ KVRTS L   LG++WL   + K+KQYA NYE + W  V
Sbjct  455   ALYKDVALSYLFLANNLQFIIEKVRTSVLKHLLGDDWLCTHAKKLKQYALNYETMAWNKV  514

Query  401   IASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRP  222
              +SLPE  ++P+ PE  K  F++F+A+F +A+ K ++ +V +R LRD LK S+A+KL   
Sbjct  515   FSSLPERSSSPVPPEVAKDCFRRFSAAFEEAYVKQTSWIVPNRKLRDELKASIAKKLAPA  574

Query  221   YRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             YR+FYD +++ +  EK      +V+F P+D+ + LSDLF
Sbjct  575   YREFYDEYRVILSGEK--FLELLVRFGPDDLENQLSDLF  611



>gb|KEH42330.1| exocyst subunit exo70 family protein [Medicago truncatula]
Length=608

 Score =   484 bits (1246),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 272/573 (47%), Positives = 374/573 (65%), Gaps = 16/573 (3%)
 Frame = -2

Query  1814  LEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLV  1635
             +E +  +I KWN E S+ AK+TSLFY ++ EA  ++  V  LQ+AM  L   +P S +L+
Sbjct  40    IEAAEALIQKWNSETSDYAKITSLFYNNKCEAIQYIHHVNQLQRAMHSLLELEPSSPELI  99

Query  1634  RAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddd  1455
              AQNLM++AMKRLQKEF+QIL MN+A+LD ES S  + S+S  S   G     D     D
Sbjct  100   HAQNLMQIAMKRLQKEFYQILTMNQAYLDSESFSIRSFSTSFGSFDGGTLEDDDDHDAQD  159

Query  1454  dddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRL  1275
                       I+EVE VSS V+ D+++I ECM+S GY KEC  VY  +RK I+DE + +L
Sbjct  160   C---------ISEVERVSSDVVDDLKIIAECMVSNGYGKECVNVYTTVRKSIVDEGVYKL  210

Query  1274  GVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIF  1095
              VE+ SFSK  KMDWEVLE++I  WL A++I+V+TLF+GER LC+ +FAS  ++IRE+ F
Sbjct  211   NVEERSFSKGNKMDWEVLEMKINCWLEAVKISVRTLFSGERNLCERIFAS--NSIREACF  268

Query  1094  KEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRT  915
              EIS++ A +L  FPE +AK  K +PEK+FRLLDMY  I    PE+ESIFS +S S +++
Sbjct  269   GEISRDGATLLLRFPEFVAKTKKWTPEKIFRLLDMYATITMLLPEVESIFSFNSTSGVKS  328

Query  914   QAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLS  735
             QA  S  +L +++R   ++FE+ + KDSSKS    GGIH LT   M YLT + D+SNVLS
Sbjct  329   QAYNSQQRLVESVRNIFSEFESAILKDSSKSLANFGGIHSLTTQTMQYLTKLTDYSNVLS  388

Query  734   DIFSNTPPIPKDWLPDSYFAVSDSDESPL---PAISLRYAWlillllckLDVIAEHYKDI  564
             +IF + PP     LP+SY    +S           S+R AWLIL+LLCK+DV ++  K+I
Sbjct  389   EIFFDIPPSLNSPLPESYLYSPESSNYSTEIETEFSIRIAWLILVLLCKIDVKSKQCKNI  448

Query  563   SIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPE  384
             S++YLFLANNLQ+VV KVR S L   LG++WL K   KVK+    YER+ WG V+ SLP+
Sbjct  449   SLSYLFLANNLQHVVEKVRVSNLQYVLGDDWLLKHMEKVKRLIEKYERIAWGAVVTSLPK  508

Query  383   NPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYD  204
             NPT  +S  E +  F KFN  F +A++K ++ V+ +  LR+ +K SL RK++  YR+ YD
Sbjct  509   NPTTAISVAEARAVFMKFNLEFEKAYQKQNSFVMPESELREEIKASLGRKIIPIYRELYD  568

Query  203   THKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             TH++   K  +   +  V F  EDV  +L DLF
Sbjct  569   THRIV--KGSKSEMNEYVVFTHEDVQSYLVDLF  599



>ref|XP_004148221.1| PREDICTED: uncharacterized protein LOC101212978 [Cucumis sativus]
 ref|XP_004166482.1| PREDICTED: uncharacterized LOC101212978 [Cucumis sativus]
 gb|KGN47351.1| hypothetical protein Csa_6G302190 [Cucumis sativus]
Length=631

 Score =   485 bits (1248),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 267/580 (46%), Positives = 396/580 (68%), Gaps = 18/580 (3%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFY-ESRREANDFVKCVRNLQKAMQFLAME  1659
             +S++E  LE++   +M+W P+++    V SLF  + R EA  ++K V+ L  +M  LA  
Sbjct  39    DSMVEENLEVAESFVMRWRPDST---IVGSLFQGDDRDEARKYLKAVKGLHNSMHSLASR  95

Query  1658  QPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsst  1479
                S KL+ A +LM++AM+RLQKEF+QIL+ NR +L PES S      ++++ S+     
Sbjct  96    DSSSRKLMHAHDLMKIAMERLQKEFYQILSANREYLYPESVSGIQSPMTISARSSVSDFE  155

Query  1478  sdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWI  1299
              + + +    +       I EVE VS   MAD++ I +CMIS GY KEC KVYK +RK I
Sbjct  156   LESEDEFRFANES-----IAEVERVSMSAMADLKAIADCMISTGYGKECVKVYKIVRKSI  210

Query  1298  IDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVF-AST  1122
             IDE++  LG+EK+SFSK++KMDWEVLE++IK WL  ++ AVK+LF GE+ LCD+VF  S 
Sbjct  211   IDESLYNLGIEKLSFSKVQKMDWEVLEIKIKIWLKGVKTAVKSLFEGEKILCDHVFSGSV  270

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
             P  IRES F +ISK+ A ILF FPE +AKY K +PEK+F +LD+Y AIA+  PEI+ IFS
Sbjct  271   P--IRESCFAQISKDGAEILFGFPELVAKY-KKTPEKIFIMLDLYEAIADLWPEIDYIFS  327

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
               + S I++QAV+SL KLG+ IRT +++FE  +QK+SSK+ V  GG+HPLT   MNY++ 
Sbjct  328   STATSMIQSQAVSSLIKLGENIRTLLSEFEMAIQKESSKTPVPRGGVHPLTRYVMNYISF  387

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             ++D+S +L+DI ++     K  +P+SY+     ++SP   I+LR+AWLIL+LLCKLD  A
Sbjct  388   LSDYSGILNDIVADWSLATKLSMPESYYGTPKQEDSP---ITLRFAWLILVLLCKLDGKA  444

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
             EHY D++++YLFLANNLQY+V KVRTS L   LG  W+ +  +K+K Y++ Y R+GW  V
Sbjct  445   EHYNDVALSYLFLANNLQYIVEKVRTSNLRFILGSEWVERHESKIKLYSSKYRRIGWSGV  504

Query  401   IASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRP  222
              +SLP + TA +SPEE ++ F  FN +F + +RK ++ +V D+ LRD +K+ LAR++   
Sbjct  505   FSSLPTDVTAEISPEEARESFINFNRAFEETYRKQTSWIVPDQKLRDEIKILLAREMGAL  564

Query  221   YRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             Y +FY  +++ + +      +  V+ +P+D+G++LSDLF+
Sbjct  565   YGEFYKRNRVRVRRVSGSDHA--VRLSPDDLGNYLSDLFY  602



>ref|XP_002313454.2| hypothetical protein POPTR_0009s03200g [Populus trichocarpa]
 gb|EEE87409.2| hypothetical protein POPTR_0009s03200g [Populus trichocarpa]
Length=604

 Score =   483 bits (1244),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 270/584 (46%), Positives = 393/584 (67%), Gaps = 23/584 (4%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVT---SLFY-ESRREANDFVKCVRNLQKAMQFL  1668
             +++M+  +E +  +I KW+   S +       +LF  ++R EA  ++  +++LQ AMQ+ 
Sbjct  5     DTLMDDNVENARELISKWDASRSSSLHCVDDANLFASDNRYEAQQYLNSIKDLQTAMQYY  64

Query  1667  AMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgf  1488
               + P S+KLV AQNLM++AMKRL+KEF+ IL   R HLDPES S ++RSS         
Sbjct  65    ISQDPTSDKLVLAQNLMQIAMKRLEKEFYIILKSRRQHLDPESVSRTSRSSVSEFEDESE  124

Query  1487  sstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIR  1308
                     +D           I+EVE VS   M D++ I ECMI  GY KEC K++K IR
Sbjct  125   DDELSRVGEDS----------ISEVELVSMDAMKDLKAIAECMIGAGYGKECVKIFKIIR  174

Query  1307  KWIIDEAISRLGVE-KMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVF  1131
             K ++DEA+  L VE ++S ++I+KMDWEVLE++IK WL+A+++AVKTLF GER L D+VF
Sbjct  175   KSVVDEALYHLNVESRLSLAQIQKMDWEVLEVKIKAWLNAVKVAVKTLFYGERVLSDHVF  234

Query  1130  ASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIES  951
             +S+P +++ES F +I++E A+ LF FPEN+AK  K +PE++FR LD+Y AIA+   EIE 
Sbjct  235   SSSP-SLKESCFADITREGALSLFVFPENVAK-CKKAPERIFRTLDLYEAIADLWAEIEP  292

Query  950   IFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNY  771
             IF ++S S+IR Q + SL KLG+A+   + +FET + K +SK+ V GGGIHPLT   MNY
Sbjct  293   IFDLESTSTIRQQVINSLNKLGEAVCAILTEFETAISKFNSKAAVPGGGIHPLTRYVMNY  352

Query  770   LTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDS-DESPLPAISLRYAWlillllckL  594
             +T + D+S VL+DI ++ P      LP++YF    S D +   +IS+R AWLIL++LCKL
Sbjct  353   ITFLTDYSGVLTDILADWPLTVPSPLPEAYFGSPVSADGTSTSSISIRLAWLILVMLCKL  412

Query  593   DVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLG  414
             D  AE YKD++++YLFLANNLQYVV KV+ S L   LG+ W+ K   KV+QYA+NYER+G
Sbjct  413   DGKAEMYKDVALSYLFLANNLQYVVNKVQKSNLKLLLGDEWMEKHEEKVRQYASNYERMG  472

Query  413   WGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
             W  V A+LP+     M+  ++ + FK+FN+SF +A+   ++ VVSD  LRD +KVS+ARK
Sbjct  473   WSKVFAALPDANDNQMTAPQVTECFKRFNSSFEEAYNNQASWVVSDSKLRDQIKVSVARK  532

Query  233   LLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             L+  YR+FY  ++  + +++      IV+FAP+D+ ++LSDL F
Sbjct  533   LVPVYREFYGKYRQLVARKE-----GIVRFAPDDLENYLSDLLF  571



>ref|XP_008233543.1| PREDICTED: exocyst complex component EXO70A1 [Prunus mume]
Length=638

 Score =   484 bits (1245),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 272/576 (47%), Positives = 388/576 (67%), Gaps = 18/576 (3%)
 Frame = -2

Query  1829  VMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPR  1650
             +ME  + I+  +I KW+P +S   K+T LF  SR+EA +F+K V  L+ AM  LA     
Sbjct  56    MMEENIAIAESIITKWDPNSSSYTKITFLFQHSRKEAKEFLKSVNYLRSAMHVLA-NGNL  114

Query  1649  SEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdf  1470
             S KLV AQNLM+ AMKRL+KEF+QIL+ NR HLDPES S+ +  S+    +    S  + 
Sbjct  115   SSKLVLAQNLMQTAMKRLEKEFYQILSANRDHLDPESVSSRSSGSAKFYNADEAGSEDEM  174

Query  1469  dvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDE  1290
             ++  +          ITEVE  S+F M+D++ I +CMIS GY  EC K+YK IRK I+D 
Sbjct  175   EIIGES---------ITEVERASAFAMSDLKSIADCMISSGYGIECVKIYKIIRKSIVDG  225

Query  1289  AISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAI  1110
              + RLG+++    ++ KMD E LE  ++NW+ A++IAVK LF GE+ LCD+VF+++ + I
Sbjct  226   GLFRLGIQQFKSPQVHKMDPEGLESILRNWMDAVKIAVKALFRGEKYLCDHVFSASEN-I  284

Query  1109  RESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSA  930
             +ES F EI+KE A  LF FPE I K  K  PE++F  L++Y A+++  PEIESIF  +S 
Sbjct  285   KESCFYEITKEGATTLFRFPELIVK-NKKGPERIFWQLEIYEAVSDLWPEIESIFDSEST  343

Query  929   SSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADH  750
              +I+ QA++S  KL D++RT ++ FE+ +QKDSSK  V GGGIHPLT   MNY++S+AD+
Sbjct  344   QAIKLQALSSWLKLSDSVRTILSDFESTIQKDSSKILVFGGGIHPLTQSVMNYVSSLADY  403

Query  749   SNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYK  570
               VLSDI ++ PP       +  F    SD+   P +S+  AWLIL+LLCKLD+ AE YK
Sbjct  404   YGVLSDILADHPPPGNSSFQE--FKSVVSDDCSTPEVSVHLAWLILVLLCKLDIKAEIYK  461

Query  569   DISIAYLFLANNLQYVVVKV-RTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIAS  393
             D+S++YLFLANNL ++V KV  T  L   LGE+W+S+   KVKQYA+NYE   W  V++S
Sbjct  462   DVSLSYLFLANNLHFIVEKVNNTPNLKLLLGEDWVSEHMKKVKQYASNYETTAWTKVLSS  521

Query  392   LPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRD  213
             LPE  +A +SPE  K+ F+KFN +F +A+RK ++ +V DR LRD+LKVS+++KL+  Y++
Sbjct  522   LPER-SADISPEMAKECFRKFNTAFEEAYRKQTSWIVEDRKLRDNLKVSISQKLVPTYQE  580

Query  212   FYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             FYDT+ + +  EK      +V+ +P D+G++LSDLF
Sbjct  581   FYDTYMVMLSGEKNMEL--LVRISPNDLGNYLSDLF  614



>ref|XP_004505905.1| PREDICTED: uncharacterized protein LOC101512865 [Cicer arietinum]
Length=626

 Score =   483 bits (1244),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 281/618 (45%), Positives = 399/618 (65%), Gaps = 24/618 (4%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWN-PEASEA  1761
             MPRKGMR I F  +  S S++ +  P +    F +S+M+  +E +  +I KW+    +  
Sbjct  1     MPRKGMRSIFFHQSLPSESTSSKFPPPSPVQTFSDSLMQENIETAESLITKWDYSNTNHQ  60

Query  1760  AKVTSLFY--ESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKE  1587
             +K+ S  +  E+R EA  ++  V+ LQ AMQ+L      S  LVRAQ LM++AMK LQKE
Sbjct  61    SKLFSPLFSGETREEAKQYLNAVKGLQSAMQYLVKRDSTSNSLVRAQFLMQLAMKTLQKE  120

Query  1586  FFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVED  1407
             F+QIL+ NR HLDPE+ S S RSS+   +S         D +            I+E E 
Sbjct  121   FYQILSANREHLDPETVSNSNRSSTDRRSSVSDYEDEISDDEFRVAGNT-----ISETER  175

Query  1406  VSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWE  1227
             VS   MAD++ I  CMIS GY KEC KVY  +RK I+DEA+  LGVE++SFS+I+KMDWE
Sbjct  176   VSMLTMADLKAIAVCMISTGYGKECVKVYIVMRKSIVDEALYHLGVERLSFSQIQKMDWE  235

Query  1226  VLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA-IRESIFKEISKEAAMILFEFP  1050
             V+EL+IK WL+A+++AV TLF+GER LCD +FA+     I ES F EI+KE A +LF FP
Sbjct  236   VIELKIKTWLNAVKVAVGTLFHGERILCDEIFAAASGKRIAESCFAEITKEGAAMLFSFP  295

Query  1049  ENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRT  870
             E + K  K +PEK+FR LD+Y A+ NH  +I+SIFS +S +++R QAVTSL KL +A+RT
Sbjct  296   EMVGK-CKKTPEKMFRTLDLYEAMFNHWIQIQSIFSFESTANVRLQAVTSLVKLKEAVRT  354

Query  869   GIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLP  690
              +  FET +QKDSSK  V GGG+HPLT   MNY+T +AD+S VL+DI ++ P  P   LP
Sbjct  355   MLTDFETAIQKDSSKKQVPGGGVHPLTRYVMNYITFLADYSGVLTDIVADLPQSP---LP  411

Query  689   DSYF--AVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVV  516
             +SY+   V   ++  L  IS + AWLIL+LLCKLD  AE  KD+S++YLFLANN+QYVVV
Sbjct  412   ESYYRSPVRGENQKSL-EISEKIAWLILVLLCKLDGKAELCKDVSLSYLFLANNMQYVVV  470

Query  515   KVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFK  336
             KVR S L   LGE+WL+    KV+++ + +  +GW  V ++LPENPT  +  E+++  F 
Sbjct  471   KVRRSNLGFILGEDWLTNHELKVREHVSKFVHVGWNKVFSTLPENPTVEIPLEQVRASFV  530

Query  335   KFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSS  156
              F+ +F +  RK  + +VSD  LRD +KV++  KL+  Y  FY+ +++           S
Sbjct  531   NFHNAFDEECRKQCSWIVSDSKLRDEIKVAIGSKLVGKYGAFYEKNRVGS--------ES  582

Query  155   IVKFAPEDVGHHLSDLFF  102
             ++++ PE + + L ++ +
Sbjct  583   VIRYKPEYIENCLCNILY  600



>gb|EYU18924.1| hypothetical protein MIMGU_mgv1a003114mg [Erythranthe guttata]
Length=607

 Score =   482 bits (1240),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 271/587 (46%), Positives = 383/587 (65%), Gaps = 15/587 (3%)
 Frame = -2

Query  1829  VMERALEISGPMIMKWNPEASEAAKVTSLFYESRR-EANDFVKCVRNLQKAMQFLAMEQP  1653
             +ME  L+++  MI KW+ +A    K + LF +  R EA  F++ +  L++AM +      
Sbjct  1     MMEENLDVAESMIRKWDLDAHRHEKFSPLFVDDNRAEAKRFIEAIDGLRRAMHYYVKLTS  60

Query  1652  RSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvastst------g  1491
               E LVRAQNLM++A+KRL+KEF+  L+ NR +LD ES S  +  +S  ++ +       
Sbjct  61    GHENLVRAQNLMQIAIKRLEKEFYFSLSANRKNLDSESVSGRSSRASARTSVSDFYDDEA  120

Query  1490  fsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDI  1311
                             R     I+E +  S   MAD++ I +CMI+ GY KEC ++YK I
Sbjct  121   SEEEESTTATPPRTPPRSPPREISEADRASEIAMADLKSIADCMIASGYGKECVRIYKLI  180

Query  1310  RKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVF  1131
             RK IIDE +  LGV  ++ S+++KM+W VLE +IK+WL A+++AVKTLF GER LCD VF
Sbjct  181   RKSIIDETLYYLGVGNLNSSQMQKMEWNVLEAKIKSWLHAVKVAVKTLFTGERILCDIVF  240

Query  1130  ASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKN-SPEKVFRLLDMYNAIANHRPEIE  954
             +S+ + I ES F EIS++AA+ LF FPEN  K  K  SPEK+FR LD+Y AI +  PEIE
Sbjct  241   SSS-EKIAESCFAEISRDAAVNLFSFPENFGKSKKILSPEKLFRALDLYEAICDLWPEIE  299

Query  953   SIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMN  774
             ++FS DS S+++++A  +L KLG+A+RT +AQFE  +QKDSSK    GGG+HPLT   MN
Sbjct  300   AVFSHDSLSAVKSEATAALMKLGEAVRTMLAQFEAAIQKDSSK-IPTGGGVHPLTRYVMN  358

Query  773   YLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDS---DESPLPAISLRYAWlillll  603
             +L  + D+S  LSDI +++P   +  LP+SYF    S   D+S   +I+ R AWLIL+LL
Sbjct  359   FLVFLGDYSGALSDIIADSPVGSQTPLPESYFLSPTSGVGDDSSAASITARLAWLILVLL  418

Query  602   ckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYE  423
             CKLD  A  Y D++++YLFLANNL YVV K+R S L   +G +W+ K  +KV QY ANYE
Sbjct  419   CKLDGKAVLYNDVALSYLFLANNLNYVVSKIRNSNLGLLMGPDWIWKNRSKVNQYMANYE  478

Query  422   RLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSL  243
             R+GW  VI+SLPE+PTA ++PEE K+ F +F   F +A+RK  + V+ D  LRD +KVSL
Sbjct  479   RMGWSKVISSLPEDPTAEITPEEAKERFTRFYLGFEEAYRKQVSWVIPDPKLRDEVKVSL  538

Query  242   ARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             A+K++  YR FY  H+      ++    SIV++APED+ ++LSDLFF
Sbjct  539   AKKIVPGYRAFYRMHRGNF--NRDIGVESIVRYAPEDLDNYLSDLFF  583



>ref|XP_004149059.1| PREDICTED: uncharacterized protein LOC101205924 [Cucumis sativus]
 ref|XP_004164151.1| PREDICTED: uncharacterized LOC101205924 [Cucumis sativus]
 gb|KGN65667.1| hypothetical protein Csa_1G481200 [Cucumis sativus]
Length=619

 Score =   481 bits (1239),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 264/577 (46%), Positives = 391/577 (68%), Gaps = 13/577 (2%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             +S+ME  ++++  +I KW+  AS  A +T LF + R EAN ++K V++LQ AMQ+   E+
Sbjct  26    QSLMEENIDVAETLITKWDCTASSYADITPLFQDDRYEANQYLKAVKDLQTAMQYFGSER  85

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
               S  LVRAQNLM+ AMKRLQ+EF +IL  NRAHLDPES S  +   SV + ++     S
Sbjct  86    MNSHHLVRAQNLMQTAMKRLQREFHRILAENRAHLDPESISNRSSRDSVFTGNSDLEDES  145

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
             + D+   +++       ++E E +S   + D++ I E MIS GY KEC K+Y   RK I+
Sbjct  146   EDDLRFANENN------VSEEERISRSAIKDLKSIAEGMISAGYGKECVKIYIVGRKSIV  199

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             +E +  LGV K ++  + +M+WEVLE++IKNWL+A++IAVKT F  E+ L D VF+S+  
Sbjct  200   EEGLYNLGVAKPNYHHVHRMEWEVLEVKIKNWLNAVKIAVKTFFEAEKFLSDQVFSSSA-  258

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
             +IRES+F EI+KE+A+ LF FPE   K +K +PEK+F +LD+Y AI +  PEIES+F  +
Sbjct  259   SIRESVFSEITKESALTLFSFPEMAVK-SKKTPEKIFLILDLYEAIFDLWPEIESMFIYE  317

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             S +SIR+    SL K+ ++IR+ +  FE+ +QKDSSK+ V GGG+HPLT   MNY+  ++
Sbjct  318   STASIRSLIDHSLTKIAESIRSMLIDFESHIQKDSSKTPVPGGGVHPLTRYVMNYIAFLS  377

Query  755   DHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEH  576
             D+S +L  I ++ P +    LP+S+F  +DS+E+PL   ++R AWLIL+LL KLD  AE 
Sbjct  378   DYSGILPGIVADWPLLLHSPLPESFFGGNDSEENPL---TIRMAWLILVLLSKLDSKAEI  434

Query  575   YKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIA  396
             Y D  ++Y+FLANNL+Y+VVKVRTS L   LG+ W+     KV+QYA++Y+R+GW  V  
Sbjct  435   YHDAPLSYIFLANNLEYIVVKVRTSNLRFVLGDEWIESHETKVRQYASSYQRMGWSRVFL  494

Query  395   SLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYR  216
             SLPENP A +SPE  ++HF  FN +F +A+R  ++ +V+D  LR+ +K+SL +KL   Y 
Sbjct  495   SLPENPMAEISPERARKHFHDFNIAFEEAYRHQASWIVTDSKLREHIKISLGKKLGTLYG  554

Query  215   DFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +FY +++  +  E      S V+FAP+D+G++LSDL 
Sbjct  555   EFYISNRSRL--ENLYGSESEVRFAPDDLGNYLSDLL  589



>ref|XP_008457545.1| PREDICTED: exocyst complex component EXO70A1-like [Cucumis melo]
Length=667

 Score =   482 bits (1241),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 265/577 (46%), Positives = 389/577 (67%), Gaps = 13/577 (2%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             +S+ME  ++++  +I KW+  AS  A +T LF + R EAN ++K V++LQ AMQ+   E+
Sbjct  74    QSLMEENIDVAETLITKWDCTASSYADITPLFQDDRYEANQYLKAVKDLQTAMQYFGSER  133

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
               S  LVRAQNLM+ AMKRLQ+EF +IL  NRAHLDPES S  +   SV + ++     S
Sbjct  134   MNSHHLVRAQNLMQTAMKRLQREFHRILAENRAHLDPESISNRSSRDSVLTGNSDLEDES  193

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
             + D+   +++       ++E E +S   + D++ I E MIS GY KEC K+Y   RK I+
Sbjct  194   EDDLRFANENN------VSEQERISRSAIKDLKSIAEGMISAGYGKECVKIYVVGRKSIV  247

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             +E +  LGV K ++  + +M+WEVLE++IKNWL+A++IAVKT F  E+ L D VF+S+  
Sbjct  248   EEGLYNLGVAKTNYHHVHRMEWEVLEVKIKNWLNAVKIAVKTFFEAEKFLSDQVFSSSA-  306

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
             +IRES+F EI+KE+A+ LF FPE   K +K +PEK+F +LD+Y AI +  PEIES+F  +
Sbjct  307   SIRESVFSEITKESALTLFSFPEMAVK-SKKTPEKIFLILDLYEAIFDLWPEIESMFIYE  365

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             S +S+R+    SL K+ ++IR+ +  FE+ +QKDSSK+ V GGG+HPLT   MNY+  ++
Sbjct  366   STASVRSLIDHSLTKIAESIRSMLIDFESHIQKDSSKTPVPGGGVHPLTRYVMNYIAFLS  425

Query  755   DHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEH  576
             D+S +L  I ++ P I    LP+S+F  +DS+E+PL   ++R AWLIL+LL KLD  AE 
Sbjct  426   DYSGILPGIVADWPLILHSPLPESFFGGNDSEENPL---TIRMAWLILVLLSKLDSKAEL  482

Query  575   YKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIA  396
             Y D  ++Y+FLANNL+Y+VVKVRTS L   LG+ W+     KV+QYA++Y+R+GW  V  
Sbjct  483   YHDAPLSYIFLANNLEYIVVKVRTSNLRFVLGDEWIESHETKVRQYASSYQRMGWSRVFL  542

Query  395   SLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYR  216
             SLPENP A +SPE  ++HF  FN +F +A+R   + VV+D  LR+ +K+SL +KL   Y 
Sbjct  543   SLPENPMAEISPERARKHFHDFNIAFEEAYRHQVSWVVTDSKLREHIKISLGKKLGTLYG  602

Query  215   DFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +FY  ++  +  E      S V+FAP+D+G++LSDL 
Sbjct  603   EFYINNRSRL--ENLYGSESEVRFAPDDLGNYLSDLL  637



>gb|KFK34771.1| hypothetical protein AALP_AA5G191600 [Arabis alpina]
Length=636

 Score =   481 bits (1237),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 270/581 (46%), Positives = 388/581 (67%), Gaps = 9/581 (2%)
 Frame = -2

Query  1844  HFYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLA  1665
             +F +S+ME ++E +  +I KW+P      K+ SLF  SR+EA +F++CVR+L++AM FL 
Sbjct  36    NFTQSMMEESVEKAESVIRKWDPNTPSFTKIVSLFNHSRKEAKEFIRCVRDLRRAMHFLV  95

Query  1664  MEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
              +  +S KL  AQ LM++AM RL+KEFFQ+L+ NR  LDPES S  +  SS +       
Sbjct  96    SQDSQSPKLALAQTLMQIAMTRLEKEFFQLLSSNRDKLDPESVSGQSSISSNSEFDDFMQ  155

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRK  1305
             S  + + D++      +   IT+VE  S+ VM+D++ I E MISCGY KEC K+YK IRK
Sbjct  156   SDDEDEDDNEMKKAGES---ITQVEKASTVVMSDLKAIAESMISCGYGKECVKIYKRIRK  212

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              I+DE +S LGVE    S+  + DW  LE  IKNW+ A +I V TLF GE+ LCD+VFA+
Sbjct  213   SIVDEGLSLLGVELYKGSRFHRTDWVTLENMIKNWIKASKIGVATLFRGEKQLCDHVFAA  272

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
             + ++ RES F EI+ EAA  LF+FPE +AK  K S E++F L+D+  AI++   +IE IF
Sbjct  273   S-NSTRESCFYEIANEAATNLFKFPEFVAK-EKKSYERIFPLMDLQGAISDLWQDIEMIF  330

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
               DS + +R+QA+TSL KL  +I + +  FE  +QKDS+K+   GGGIH LT   M++++
Sbjct  331   HFDSVAGVRSQALTSLQKLKVSIHSALTDFEATIQKDSTKALTPGGGIHSLTRSRMSFIS  390

Query  764   SIADHSNVLSDIFSNTP-PIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDV  588
             S++++S VLSDI ++ P P    WL          DE    A+S+ +AWLIL+LLC+LD 
Sbjct  391   SLSEYSCVLSDILADHPLPRNNSWLESYVRTPILEDEQQNHALSVHFAWLILVLLCRLDT  450

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AEHYKD+S++YLFLANNL +++  VR++ L   LG++WL+K   K+  YAANYE   W 
Sbjct  451   KAEHYKDVSLSYLFLANNLHFIIETVRSTPLRDLLGDDWLAKHEDKLGAYAANYEIAAWS  510

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
             +V  SLPE PT  +SPEE K HFK+F+ +F +A+ K S+ VVSD  +RD LKVS+ARKL+
Sbjct  511   NVFMSLPEEPT-DLSPEEAKIHFKRFHTAFEEAYMKQSSRVVSDAKIRDELKVSIARKLV  569

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               YR+FY  + L M  + ER+   +V+F P+++ +++SDLF
Sbjct  570   PEYREFYRKY-LPMLGQ-ERNIEMLVRFKPDNLENYISDLF  608



>emb|CDY64629.1| BnaCnng44430D [Brassica napus]
Length=643

 Score =   480 bits (1236),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 259/583 (44%), Positives = 386/583 (66%), Gaps = 12/583 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+ME ALE +  +I KW+P +    K+ SLF  SR+EA +F++CVR+L+KAM FL  
Sbjct  38    FSKSMMEEALESAESIIRKWDPNSQSYTKIISLFRHSRKEAKEFIRCVRDLRKAMHFLVS  97

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S+KLV AQ+LM++ M  ++KEFFQIL+ NR HLDP+S+S  +  SS +        
Sbjct  98    QDSKSDKLVLAQSLMQIGMSTMEKEFFQILSSNRDHLDPDSASGQSTISSNSEFEVYMEH  157

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               D D +            I++VE  S+ VM D+++I E MISCGY KEC K YK IRK 
Sbjct  158   DDDEDDELKKAGES-----ISQVEKASALVMTDLKVIAETMISCGYGKECIKSYKLIRKS  212

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  LG+EK+  S+  KMDW VLE+ IKNW+ A +I V TLF GE+ LCD+VF+++
Sbjct  213   IVDEGLHLLGIEKVKTSQFHKMDWGVLEVMIKNWIKAAKIGVTTLFKGEKLLCDHVFSAS  272

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAK--NSPEKVFRLLDMYNAIANHRPEIESI  948
                I +S F +I+KEA + LF  PE ++   K  +  E++F+L+D+Y AI++  P+IE I
Sbjct  273   L-TIGQSCFNQIAKEAGLNLFTLPELVSHKEKKQHHHERIFKLMDLYAAISDLWPDIEMI  331

Query  947   FSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYL  768
             FS DS +S++T  +++L KL D+I T + +FET + KDSSK     GG+H LT   M+++
Sbjct  332   FSFDSLASVKTLVLSTLKKLKDSIHTCLKEFETTIHKDSSKELSPEGGVHKLTRTTMSFI  391

Query  767   TSIADHSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllckL  594
             +S++++S VLS+I +  P      L +SYF   + + +       S+  AWLIL+ LCKL
Sbjct  392   SSLSEYSRVLSEILAEHPLKKNSRLLESYFTAPILEDEHVNNQVCSVHIAWLILVFLCKL  451

Query  593   DVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLG  414
             D  AE Y D+S++Y+FL NNLQ+V+  VR+S+L   +G++WL+K  AK+K YA  YE+  
Sbjct  452   DTKAESYNDVSLSYIFLVNNLQFVIDTVRSSQLKNLIGDDWLTKHEAKLKSYAEKYEKAA  511

Query  413   WGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
             W +V  SLP   +A +SPEE    FK+F+A+FA A+ K S+C++ D  LRD LKVS+ARK
Sbjct  512   WTNVFVSLPAKTSAKLSPEEATTCFKRFHAAFAGAYLKQSSCIIVDAKLRDDLKVSIARK  571

Query  233   LLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             L+  YR+FY+ + L M ++ +R+   +V F P+++ ++LSDLF
Sbjct  572   LVPEYREFYEKY-LPMLRQ-DRNIEMLVCFKPDNLENYLSDLF  612



>emb|CDX74849.1| BnaA05g05950D [Brassica napus]
Length=629

 Score =   479 bits (1234),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 261/583 (45%), Positives = 384/583 (66%), Gaps = 26/583 (4%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+ME ALE +  +I KW+P +    K+ SLF  SR+EA +F++CVR+L+KAM FL  
Sbjct  38    FSKSMMEEALESAESIIRKWDPNSQSYTKIISLFRHSRKEAKEFIRCVRDLRKAMHFLVS  97

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S+KLV AQ+LM++ M  L+KEFFQIL+ NR HLDP+S+S  +  SS +       S
Sbjct  98    QDSKSDKLVLAQSLMQIGMSTLEKEFFQILSSNRDHLDPDSASGQSTISSNSEFEKASES  157

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
                                I++VE  S+ VM+D+++I E MISCGY KEC K YK IRK 
Sbjct  158   -------------------ISQVEKASALVMSDLKVIAETMISCGYGKECIKSYKLIRKS  198

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  LG+EK+  S+  KMDW VLE+ IKNW+ A  I V TLF GE+ LCD+VF+++
Sbjct  199   IVDEGLHLLGIEKVKNSQFHKMDWGVLEVMIKNWIKAANIGVTTLFKGEKLLCDHVFSAS  258

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAK--NSPEKVFRLLDMYNAIANHRPEIESI  948
                I +S F +I+KEA + LF  PE +A   K  +  E++F+L+D+Y AI++  P+IE I
Sbjct  259   V-TIGQSCFNQIAKEAGLNLFILPELVAHKEKKQHHHERIFKLMDLYAAISDLWPDIEMI  317

Query  947   FSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYL  768
             FS DS +S++T  +++L KL D+I T + +FET + KDSSK     GG+H LT   M+++
Sbjct  318   FSFDSLASVKTLVLSTLKKLKDSIHTCLKEFETKIHKDSSKELSPEGGVHKLTRTTMSFI  377

Query  767   TSIADHSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllckL  594
             +S++++S VLS+I +  P      L +SYF   + + +     A S+  AWLIL+ LCKL
Sbjct  378   SSLSEYSRVLSEILAEHPLKRNSRLLESYFTAPILEDEHVNNQACSVHIAWLILVFLCKL  437

Query  593   DVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLG  414
             D  AE Y D+S++Y+FL NN+Q+VV  VR+S+L   +G++WL+K  AK+K YA  YE+  
Sbjct  438   DTKAESYNDVSLSYIFLVNNMQFVVDTVRSSQLKNLIGDDWLTKHEAKLKSYAEKYEKAA  497

Query  413   WGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
             W +V  SLP   +A + PEE    FK+F+A+FA A+ K S+CV+ D  LRD LKVS+ARK
Sbjct  498   WTNVFVSLPAKTSAKLLPEEANTCFKRFHAAFAGAYLKQSSCVIVDAKLRDELKVSIARK  557

Query  233   LLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             L+  YR+FY+ + L M ++ +R+   +V F P+++ ++LSDLF
Sbjct  558   LVPEYREFYEKY-LPMLRQ-DRNIEMLVSFKPDNLENYLSDLF  598



>ref|XP_010043604.1| PREDICTED: exocyst complex component EXO70A1-like [Eucalyptus 
grandis]
 gb|KCW85623.1| hypothetical protein EUGRSUZ_B02411 [Eucalyptus grandis]
Length=618

 Score =   479 bits (1232),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 285/587 (49%), Positives = 388/587 (66%), Gaps = 30/587 (5%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWN-PEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAME  1659
             ES+++  ++ +  +I KW+    S ++  +SL+ + R EA  F+K VR+LQ AM F   +
Sbjct  32    ESLVKENIDRAESLIAKWDLSRHSPSSSSSSLYRDCRPEAKQFLKSVRDLQAAMHFFVKQ  91

Query  1658  QPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsst  1479
                S+KLVR Q+LM+ AMKRL+KEF+ IL+ NR +LD ES SA + S S           
Sbjct  92    DSASDKLVRPQSLMQTAMKRLEKEFYLILSTNRQYLDHESVSARSSSVSEGYEDDSEDDL  151

Query  1478  sdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWI  1299
             +      +            E    S+ VMAD++ I +CMIS GY KEC KVYK +RK +
Sbjct  152   NFAGDGSESAG-------TPERTSSSATVMADLKAIADCMISSGYGKECVKVYKIVRKSV  204

Query  1298  IDEAISRLGVEK-MSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             +DEA+  LG+++ ++ S+I+KMD E LE RIK WL +++ AV T+F GER LCD+VFAS+
Sbjct  205   VDEALYLLGLDRTLTHSQIQKMDSEALEKRIKCWLRSVKFAVNTVFYGERILCDHVFASS  264

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
                IRES F EI++E A+ LF F E++ K  K SPEK+FR LD+Y AIAN  PEIESIFS
Sbjct  265   L-PIRESCFGEITRENAVALFGFAESVGK-CKKSPEKMFRSLDLYEAIANLWPEIESIFS  322

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              DS+S++R+QAV +L +L DA R  +A FE  +QKD SK+ V GGG+HPLT   MNYL  
Sbjct  323   YDSSSAVRSQAVNALVRLSDAARLMLADFEVAIQKDGSKAAVPGGGVHPLTRYVMNYLNL  382

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSD--SDESPLPAISLRYAWlillllckLDV  588
             +AD+S +LSDI +       DW  ++  AVSD  SD SP   IS R AWL+L+LLCK++ 
Sbjct  383   LADYSEILSDIVA-------DWPVEA--AVSDLGSDTSP---ISARLAWLVLVLLCKINA  430

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AE YKD++++YLFLANNLQYVVVK R SRL   LGE W++KQ AKVKQYAANYE++GW 
Sbjct  431   KAERYKDVALSYLFLANNLQYVVVKARQSRLRYLLGEEWVAKQEAKVKQYAANYEKMGWS  490

Query  407   DVIASL---PENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLAR  237
              V+ASL        A M  +  K  F++FNA+F + ++K +  VV+D  LRD + VSLA+
Sbjct  491   KVLASLPEARPAAAAEMPVDHAKDTFRRFNAAFEETYKKQTGWVVADPKLRDEMNVSLAK  550

Query  236   KLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFEP  96
             KLL  YR+FY+ H    P  ++     IV+FAP+D+G++LSDLF  P
Sbjct  551   KLLPRYREFYEKH--AAPLRRDTFREGIVRFAPDDLGNYLSDLFHGP  595



>ref|XP_009143321.1| PREDICTED: exocyst complex component EXO70A1-like [Brassica rapa]
Length=648

 Score =   479 bits (1234),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 261/583 (45%), Positives = 387/583 (66%), Gaps = 12/583 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+ME ALE +  +I KW+P +    K+ SLF  SR+EA +F++CVR+L+KAM FL  
Sbjct  43    FSKSMMEEALESAESIIRKWDPNSQSYTKIISLFRHSRKEAKEFIRCVRDLRKAMHFLVS  102

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S+KLV AQ+LM++ M  L+KEFFQIL+ NR HLDP+S+S  +  SS +       +
Sbjct  103   QDSKSDKLVLAQSLMQIGMSTLEKEFFQILSSNRDHLDPDSASGQSTISSNSEFEVYMEN  162

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               D D +            I++VE  S+ VM+D+++I E MISCGY KEC K YK IRK 
Sbjct  163   DDDEDDELKKASES-----ISQVEKASALVMSDLKVIAETMISCGYGKECIKSYKLIRKS  217

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  LG+EK+  S+  KMDW VLE+ IKNW+ A +I V TLF GE+ LCD+VF+++
Sbjct  218   IVDEGLHLLGIEKVKTSQFHKMDWGVLEVMIKNWIKAAKIGVTTLFKGEKLLCDHVFSAS  277

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAK--NSPEKVFRLLDMYNAIANHRPEIESI  948
                I +S F +I+KEA + LF  PE +A   K  +  E++F+L+D+Y AI++  P+IE I
Sbjct  278   L-TIGQSCFNQIAKEAGLNLFTLPELVAHKEKKQHHHERIFKLMDLYAAISDLWPDIEMI  336

Query  947   FSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYL  768
             FS DS +S++T  +++L KL D+I T + +FET + KDSSK     GG+H LT   M+++
Sbjct  337   FSFDSLASVKTLVLSTLKKLKDSIHTCLKEFETTIHKDSSKELSPEGGVHNLTRTTMSFI  396

Query  767   TSIADHSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllckL  594
             +S++++S VLS+I +  P      L +SYF   + + +     A S+  AWLIL+ LCKL
Sbjct  397   SSLSEYSRVLSEILAEHPLKRNSRLLESYFTAPILEDEHVNNQACSVHIAWLILVFLCKL  456

Query  593   DVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLG  414
             D  AE Y D+S++Y+FL NN+Q+VV  VR+S+L   +G++WL+K  AK+K YA  YE+  
Sbjct  457   DTKAESYNDVSLSYIFLVNNMQFVVDTVRSSQLKNLIGDDWLTKHEAKLKSYAEKYEKAA  516

Query  413   WGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
             W +V  SLP   +A + PEE     K+F+A+FA A+ K S+CV+ D  LRD LKVS+ARK
Sbjct  517   WTNVFVSLPAKKSAKLLPEEATTCLKRFHAAFAGAYLKQSSCVIVDAKLRDELKVSIARK  576

Query  233   LLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             L+  YR+FY+ + L M ++ +R+   +V F P+++ ++LSDLF
Sbjct  577   LVPEYREFYEKY-LPMLRQ-DRNIEMLVSFKPDNLENYLSDLF  617



>gb|KEH42331.1| exocyst subunit exo70 family protein [Medicago truncatula]
Length=605

 Score =   478 bits (1229),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 270/578 (47%), Positives = 380/578 (66%), Gaps = 23/578 (4%)
 Frame = -2

Query  1814  LEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLV  1635
             +E +  +I KWN E S+ AKVTS+FY  R EA  ++  V  LQ+AM  L   +P S KL+
Sbjct  42    IEAAEALIQKWNSETSDYAKVTSIFYNDRNEAIQYIHHVNQLQRAMHSLLELEPSSPKLI  101

Query  1634  RAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddd  1455
              AQNLM++AMKRLQKEF+QIL MN+A LD ES S  +  +S  S   G     D    +D
Sbjct  102   HAQNLMQIAMKRLQKEFYQILTMNQACLDAESFSVGSSRTSFCSFDGGTPEEDDIRAAED  161

Query  1454  dddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRL  1275
                       I+EVE +SS  + D+R+I ECM+  GY KEC +VY  +RK I+DE I +L
Sbjct  162   C---------ISEVERISSDAVDDLRIIAECMVKNGYGKECIRVYTTVRKSIVDEGIYKL  212

Query  1274  GVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIF  1095
              VE+ SFSK+ KMDWEVLE++I +WL A++I+V+TLF GER LCD +FAS  ++I+E+ F
Sbjct  213   NVEERSFSKMNKMDWEVLEMKINSWLEAVKISVRTLFAGERNLCDRIFAS--NSIKEACF  270

Query  1094  KEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRT  915
              EISK+ A++L  FPE +AK  K+ PEK+FRLLDMY  I    PEIESIFS +S + +++
Sbjct  271   AEISKDGAILLLRFPEVVAKTKKSKPEKIFRLLDMYATITVLLPEIESIFSFNSTAVVKS  330

Query  914   QAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLS  735
             QA  S  +L + +R  + +FE+ + KDSSKS    GG+H LT + M YL ++AD+SNVLS
Sbjct  331   QAYNSQHRLIECVRNLLLEFESTILKDSSKSAANFGGVHSLTEETMQYLITLADYSNVLS  390

Query  734   DIFSNTPPIPKDWLPDSY-FAVSDSDESP--LPAISLRYAWlillllckLDVIAEHYKDI  564
             +IF + PP+ K  LP+SY ++   S+ +P      S+R AWLIL+LLCK+D  ++  K++
Sbjct  391   EIFFDIPPLSKSPLPESYLYSPESSNNTPEMETGFSVRIAWLILVLLCKIDSKSKQCKNV  450

Query  563   SIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPE  384
             S++YLFLANNL++VV KVR S L   LG++WL     KVK+    YER+ WG+V +SLPE
Sbjct  451   SLSYLFLANNLRHVVEKVRQSNLQYVLGDDWLLNHMEKVKKLIEKYERVAWGEVFSSLPE  510

Query  383   NPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYD  204
             NPTA M+  +  + F K    F +A+R  S+ V+ +   R+ +K SLARK++  YR+ Y 
Sbjct  511   NPTAAMTVAKASKVFMKIKLEFEKAYRNQSSFVLPESEFREEIKASLARKIIPIYRELY-  569

Query  203   THKL---TMPKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
             TH++   T+ + KE        F PEDV  +L +LF++
Sbjct  570   THQIMAGTVSEMKEYFV-----FTPEDVEKYLGNLFYD  602



>ref|XP_009143322.1| PREDICTED: exocyst complex component EXO70A1-like [Brassica rapa]
Length=672

 Score =   479 bits (1233),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 257/584 (44%), Positives = 385/584 (66%), Gaps = 12/584 (2%)
 Frame = -2

Query  1844  HFYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLA  1665
             HF +S+ME ALE +  +I KW+P +    K+ SLF  SR++A +F+ CVR+L++AM FL 
Sbjct  67    HFSQSMMEEALESADSIIKKWDPNSQSYRKIISLFRHSRKQAKEFIGCVRDLRRAMHFLV  126

Query  1664  MEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
              +  +S+KLV AQNLM++ M  L+KEFFQIL+ NR HLDP+S+S  +  SS +       
Sbjct  127   SQDSKSDKLVLAQNLMQIGMSTLEKEFFQILSSNRDHLDPDSASGQSTISSNSEFEVYMD  186

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRK  1305
                D D +            I++VE  S+ VM+D+++I E MISCGY KEC K YK IRK
Sbjct  187   YDEDDDDELKKAGES-----ISQVEKASALVMSDLKIIAETMISCGYGKECIKSYKLIRK  241

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              I+DE +  LG+EK+  S  +KMDW VLE  IKNW+ A +I V TLF GE+ LCD+VF++
Sbjct  242   SIVDEGLHLLGIEKVKTSHFQKMDWGVLEHMIKNWIKAAKIGVTTLFRGEKLLCDHVFSA  301

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIAKYAK--NSPEKVFRLLDMYNAIANHRPEIES  951
             +   I +S F +I+KEA + LF  PE +A   K  +  E++F+++D+Y AI++  P+IE 
Sbjct  302   SV-TIGQSCFNQIAKEAGLNLFMLPELVANKEKKQHHHERIFKMMDLYAAISDLWPDIEM  360

Query  950   IFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNY  771
             +FS DS +S++T  +++L KL D+I   + +F+T++ KDSSK     GG+H LT   MN+
Sbjct  361   VFSFDSLASVKTLVLSTLKKLKDSIHMCLKEFDTMIHKDSSKELSPEGGVHKLTRTTMNF  420

Query  770   LTSIADHSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllck  597
             ++S+++++ VLS+I +  P      L +SYF   + + +     A S+  AWLIL+ LCK
Sbjct  421   ISSLSEYNRVLSEILTEHPLKTNTRLLESYFTAPILEDEHVNNHACSVHLAWLILVFLCK  480

Query  596   LDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERL  417
             LD  AE Y D+S++Y+FL NN+Q+V   VR+S L   LG++WL+K  AK+K YA  YE+ 
Sbjct  481   LDTKAESYNDVSLSYIFLVNNMQFVADTVRSSHLKNLLGDDWLTKHEAKLKSYAEKYEKT  540

Query  416   GWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLAR  237
              W +V+ SLP   +A +SPEE    FK+F+A+FA A+ K S+CV+ D  LRD LKVS+ +
Sbjct  541   AWANVLVSLPAKTSAKLSPEEATTCFKRFHAAFAGAYLKQSSCVIVDTKLRDELKVSIVK  600

Query  236   KLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             KL+  YR+FY+ + L M ++ +R+   +V F P+++ ++LSDLF
Sbjct  601   KLVPEYREFYEKY-LPMLRQ-DRNIEMLVSFKPDNLENYLSDLF  642



>ref|XP_009761942.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=627

 Score =   477 bits (1228),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 266/586 (45%), Positives = 397/586 (68%), Gaps = 20/586 (3%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAA-----KVTSLFYESRREANDFVKCVRNLQKAM  1677
             F E++++  +E +  +I KW+ ++S  +     +V +LF ++  EA   +  V +LQ AM
Sbjct  24    FCETLLDETIENAELIIEKWDLDSSSVSTTSYNRVANLFRDNPLEAKQLLNAVNDLQHAM  83

Query  1676  QFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvasts  1497
             QF+  +   S+ LVRA NLM++A++RLQKEF+ IL+ +R  LD E+ S+ +  SS A+ S
Sbjct  84    QFVIKDSASSKLLVRAHNLMQIAIRRLQKEFYTILSGSRYFLDSETVSSRSSRSSTATLS  143

Query  1496  tgfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYK  1317
             +        + ++++          +E+E VS  VMAD++ I +CMI  GY +EC K+YK
Sbjct  144   SLSDEDEVSEDNNNN----------SEIEKVSEVVMADLKSIADCMIGAGYGRECVKIYK  193

Query  1316  DIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDN  1137
               RK +IDE +  LG+EK   S+I+KMDWE+LE++IKNWLSA++IAV TLF+GER LCD 
Sbjct  194   LNRKSVIDETLYYLGIEKAISSQIQKMDWELLEIKIKNWLSAVKIAVTTLFHGERILCDY  253

Query  1136  VFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEI  957
             VF+++ D IRES F EI+K+ A+ LF FPE +AKY K S EK+FR+LD+Y+AI     +I
Sbjct  254   VFSAS-DNIRESCFSEIAKDGALTLFLFPEMVAKYKKLSLEKMFRVLDVYDAICELWVKI  312

Query  956   ESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAM  777
             E IF  DS   +++QA+ SL KLGDA R  +++FE+ +QKD+SK+ V GGG+HPLT   M
Sbjct  313   ELIFCFDSMEVVKSQAMISLVKLGDAARAMLSEFESAVQKDTSKA-VPGGGVHPLTRYVM  371

Query  776   NYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYF-AVSDSDESPLPAI-SLRYAWlillll  603
             NYL  + D+S+ +S+I  + P   +  LP+SY+ +++  D  P P++ +LR AWL+L+LL
Sbjct  372   NYLVYLGDYSDAISEIIVDLPISLQTSLPESYYLSMTTEDGDPPPSVVALRLAWLVLVLL  431

Query  602   ckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYE  423
             CKLD  A+ YKD +++YLFL+NNL Y++ KV+ S L   LG +W+ K   KVK+Y + YE
Sbjct  432   CKLDGKAQLYKDAALSYLFLSNNLNYIISKVQQSNLKLLLGSDWILKHEMKVKEYMSKYE  491

Query  422   RLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSL  243
             R+GW  V+ SLPEN T  +S  E+K+ F +FN+SF + +RK S+ V+ D+ LRD +KVSL
Sbjct  492   RMGWNKVLMSLPENLTIEISSMEVKERFSEFNSSFEEVYRKQSSWVILDQKLRDQVKVSL  551

Query  242   ARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             A KL+  YR FY+ H+  + +       S V+FAP+D+ ++LSDLF
Sbjct  552   ANKLVPRYRTFYEKHRRELVRNV-IGMESTVRFAPDDLQNYLSDLF  596



>ref|XP_009765156.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=634

 Score =   476 bits (1224),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 272/587 (46%), Positives = 391/587 (67%), Gaps = 12/587 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEA----SEAAKVTSLFYESRREANDFVKCVRNLQKAMQ  1674
             F E++ME +L+ +  +I +W+ +     S    +++LF ++R EA  FV  V +LQ AM+
Sbjct  26    FSETLMEDSLKNAEAIIKRWDLDNGSSNSSYCTISNLFRDNRAEAKQFVDAVIDLQHAMR  85

Query  1673  FLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvastst  1494
             F+  E   S++LVRAQ LM++A+KRL+KEF  IL  NR  LD ES+++   S+  ++ S 
Sbjct  86    FVIKESSSSQQLVRAQKLMQIAIKRLEKEFRTILAGNRYFLDSESTASREYSNRSSTGSD  145

Query  1493  gfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKD  1314
                ++ D +  D    +     +  E E +S  V AD+R I +CMI  GY KEC ++Y+ 
Sbjct  146   EDQASEDDNTVDIQARLSEVSIT-EEGEKIS--VTADLRAIADCMIDAGYGKECAQIYQL  202

Query  1313  IRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNV  1134
              RK +IDE +  LG+E  + S I+KMDW+VLE +IK+WLSA+++AV TL  GER LCD V
Sbjct  203   NRKSVIDETLYCLGIESFNISVIQKMDWDVLEKKIKSWLSAVKVAVCTLLYGERILCDQV  262

Query  1133  FASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIE  954
             FA   D IRES F EI+K++A+ LF FPE +AKY K S EK+FR+LD+Y+ I+    EIE
Sbjct  263   FA-VSDNIRESCFSEIAKDSALALFTFPEMVAKYKKLSIEKMFRILDLYDVISELWSEIE  321

Query  953   SIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMN  774
              IF  DS + +R+QA++S+ KL +A R  +++FE+ ++KDSSK  V+GGGIHPLT   MN
Sbjct  322   LIFGFDSTAVVRSQAMSSMEKLREAARAILSEFESAIKKDSSK-VVSGGGIHPLTRYVMN  380

Query  773   YLTSIADHSNVLSDIFSNTPPIPKDWLPDSYF--AVSDSDESPLPAISLRYAWlillllc  600
             YL  ++D+S  +S+I ++ P   K  LP+SY    ++D + SP  A+S+R AWLIL+LLC
Sbjct  381   YLVFLSDYSGPISEIVADVPVSVKSPLPESYLLSPIADDENSPACAVSVRLAWLILVLLC  440

Query  599   kLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYER  420
             KLD  A  Y D+ ++YLFLANNL YVV KVR S L   LG  WLS   AKV+QY  NY+R
Sbjct  441   KLDGKAGFYGDVPLSYLFLANNLNYVVSKVRESSLKLLLGSIWLSNHEAKVEQYMGNYKR  500

Query  419   LGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLA  240
             +GW  V+ASLPEN T  +SP E+ Q F KFN+ F +A+RK ++ V+ D  LRD +K+SLA
Sbjct  501   MGWSKVLASLPENLTVEISPAEVNQCFCKFNSGFEEAYRKQNSWVIPDPKLRDEVKISLA  560

Query  239   RKLLRPYRDFYDTHKLTMPKEKE-RHFSSIVKFAPEDVGHHLSDLFF  102
             +K++  YR FY+ +  T+ +        SIV+F P+D+ ++LSDLF+
Sbjct  561   KKIVTAYRAFYEKNWETVSRSGSGGEMESIVRFVPDDLQNYLSDLFY  607



>ref|XP_011089411.1| PREDICTED: exocyst complex component EXO70A1 [Sesamum indicum]
Length=643

 Score =   476 bits (1224),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 270/591 (46%), Positives = 391/591 (66%), Gaps = 15/591 (3%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +++ME  ++ +  ++ KW+ +A    K + LF + RREA  F++ V  LQ AM +   
Sbjct  36    FSDTMMEENIDHAESIVRKWDLDAHNHEKFSPLFADDRREAKRFLEAVSGLQSAMHYYVK  95

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
                 S KLVRAQNLM++A+KRL+KEF+ IL+ NR +LD ES S  +  +S  ST + +  
Sbjct  96    LTSSSHKLVRAQNLMQIAIKRLEKEFYVILSANRRNLDSESVSGMSSRASTRSTISDYYE  155

Query  1481  tsdfdvddddddvrvagdSI-------TEVEDVSSFVMADMRLIVECMISCGYSKECFKV  1323
                 + ++     R    +        +E E      MAD++ I ECMI+ GY++EC  +
Sbjct  156   DEISEEEESTTPPRTPPRTPPRGGNSPSEAERALDVAMADLKSIAECMIASGYARECVNI  215

Query  1322  YKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLC  1143
             YK IRK I+DEA+  LGVEK++ S+++KM+W VLE +IKNWL A++IAVKTLF+GER LC
Sbjct  216   YKLIRKSIVDEALYYLGVEKLNHSQMQKMEWNVLEPKIKNWLHAVKIAVKTLFHGERILC  275

Query  1142  DNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKN-SPEKVFRLLDMYNAIANHR  966
             D VF+S+ + I ES F EIS++AA+ LF FPEN  K  K  SPEK+FR LD+Y +I++  
Sbjct  276   DIVFSSS-EKIAESCFTEISRDAALSLFSFPENFGKSKKILSPEKMFRALDLYESISDLW  334

Query  965   PEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTI  786
             PEIE IFS +S S++R++AV +L KLG+A+R  + QFE  +QKDSSK+  AG  +HPLT 
Sbjct  335   PEIELIFSHESLSAVRSEAVAALVKLGEAVRIMLDQFEAAIQKDSSKTPTAGA-VHPLTR  393

Query  785   DAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESP-LPAISLRYAWli  615
               MNYL  + D+S  LSDI ++ P   +  LP+SYF+   S   E P   AI+ R AW+I
Sbjct  394   YVMNYLVFLCDYSGALSDILADWPVTAQTPLPESYFSSPTSGGGEDPSAAAITARLAWVI  453

Query  614   llllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYA  435
             L+LLCKLD  A  Y D++++YLFLANNL YVV KV+ S L   +G +W+ K  +KV +Y 
Sbjct  454   LVLLCKLDGKAVLYNDVALSYLFLANNLNYVVSKVQNSNLGLLMGLDWIWKTRSKVNRYV  513

Query  434   ANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSL  255
             ANYER+GW  V++SLP++PTA +  EE ++ F++FN +F +A++K ++ V+ D  LRD +
Sbjct  514   ANYERMGWSKVVSSLPDDPTAEIPLEEARECFRRFNLAFEEAYKKQTSWVIPDPKLRDEV  573

Query  254   KVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             K+SLA+ ++  YR FY  H+    +E       IV++ PED+ ++LSDLFF
Sbjct  574   KISLAKMIVPGYRAFYQKHRGKYAREP--GMVPIVRYVPEDLDNYLSDLFF  622



>ref|XP_009357646.1| PREDICTED: exocyst complex component EXO70B1-like [Pyrus x bretschneideri]
Length=638

 Score =   475 bits (1222),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 266/577 (46%), Positives = 386/577 (67%), Gaps = 17/577 (3%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQP  1653
             S+ME  +E +  +I KW+P +S   K+TS+F  SR+EA   +K V++L+ AM  L  E  
Sbjct  54    SMMEENIETAESIITKWDPNSSSYTKLTSIFQSSRKEAKQLLKSVKDLRSAMHVLVHESS  113

Query  1652  RSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsd  1473
              S KLV AQNLM+ AMKRL++EF++IL+ NR HLDPES S+   S S          + +
Sbjct  114   PSSKLVLAQNLMQTAMKRLEREFYEILSANRRHLDPESVSSRTSSRSWTFNGEDEGGSEE  173

Query  1472  fdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIID  1293
                   +         ITEVE VS+  M D++ I +CMIS GY  EC K+YK IRK I++
Sbjct  174   ELEIVGES--------ITEVERVSALAMVDLKSIADCMISSGYGHECVKIYKVIRKSIVE  225

Query  1292  EAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA  1113
             E + RLG++++  S+I KMD E LE  I NW+ A +IAVK LF+GE+ LCD+VF+++ + 
Sbjct  226   EGLYRLGIQQLKSSQIHKMDSEGLENIIMNWMDAAKIAVKALFHGEKVLCDHVFSAS-ET  284

Query  1112  IRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDS  933
             I +S F EI+KE A  LF FPE I K  K   E++F  L++Y   ++  PEIESIF+  S
Sbjct  285   IADSCFYEITKEGATTLFRFPELIVK-NKKCWERIFWQLELYEVFSDLWPEIESIFTSAS  343

Query  932   ASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIAD  753
               +I+ QA+ S  KL D++++ ++ FE+ +QKDSSK    GG IHPLT   MN ++S+AD
Sbjct  344   TQAIKLQALASWLKLSDSVQSSLSVFESTIQKDSSKFLAPGGRIHPLTQSVMNLVSSLAD  403

Query  752   HSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHY  573
             H   LSDI ++ PP PK+ +  S+F    +D+   PA+++  AWLIL+L+CKLD+ AE Y
Sbjct  404   HHGALSDILADYPP-PKNQV--SHFKSPMADDGSTPAVTVHLAWLILVLMCKLDMKAEIY  460

Query  572   KDISIAYLFLANNLQYVVVKV-RTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIA  396
             KD S++YLFLANNLQ++V KV +T  L   LGE+W+++   KVK YA+NYE   W  V++
Sbjct  461   KDASLSYLFLANNLQFIVEKVQQTPNLKLLLGEDWVAEHMKKVKLYASNYESTAWTKVLS  520

Query  395   SLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYR  216
             SLPE  ++  SPE  K+ FK+FNA+F +A+RK ++ +V DR LRD +KVS+ +KL+  Y+
Sbjct  521   SLPEK-SSETSPEMAKECFKRFNAAFEEAYRKQTSWIVEDRKLRDDVKVSIEQKLVPRYQ  579

Query  215   DFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +FYDT+ L M +  E++   +V+++P+D+G+HLSDLF
Sbjct  580   EFYDTY-LVM-QSGEKNLELLVRYSPDDLGNHLSDLF  614



>ref|XP_009335918.1| PREDICTED: exocyst complex component EXO70B1-like [Pyrus x bretschneideri]
Length=638

 Score =   474 bits (1221),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 266/577 (46%), Positives = 384/577 (67%), Gaps = 17/577 (3%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQP  1653
             S+ME  +E +  +I KW+P +S   K+TS+F  SR+EA   +K V+ L+ AM  L  E  
Sbjct  54    SMMEENIETAESIITKWDPNSSSYTKLTSIFQSSRKEAKQLLKSVKGLRSAMHVLVHESS  113

Query  1652  RSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsd  1473
              S KLV AQNLM+ AMKRL++EF++IL+ NR HLDPES S+   S S          + +
Sbjct  114   PSSKLVLAQNLMQTAMKRLEREFYEILSANRRHLDPESVSSRTSSRSWTFNGEDEGGSEE  173

Query  1472  fdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIID  1293
                   +         ITEVE VS+  M D++ I +CMIS GY  EC K+YK IRK I+D
Sbjct  174   ELEIVGES--------ITEVERVSALAMVDLKSIADCMISSGYGHECVKIYKVIRKSIVD  225

Query  1292  EAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA  1113
               + RLG+++   S+I KMD E LE  I NW+ A +IAVK LF+GE+ LCD+VF+++ + 
Sbjct  226   AGLYRLGIQQFKSSQIHKMDSEGLENIIMNWMDAAKIAVKALFHGEKVLCDHVFSAS-ET  284

Query  1112  IRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDS  933
             I +S F EI+KE A  LF FPE I K  K   E++F  L++Y   ++  PEIESIF+  S
Sbjct  285   IADSCFYEITKEGATTLFRFPELIVK-NKKCWERIFWQLELYEVFSDLWPEIESIFTSAS  343

Query  932   ASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIAD  753
               +I+ QA+ S  KL D++++ ++ FE+ +QKDSSK   +GG IHPLT   MN ++S+AD
Sbjct  344   TQAIKLQALASWLKLSDSVQSSLSVFESTIQKDSSKFLASGGRIHPLTQSVMNLVSSLAD  403

Query  752   HSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHY  573
             H   LSDI ++ PP PK+ +  S+F    +D+   PA+++  AWLIL+L+CKLD+ AE Y
Sbjct  404   HHGALSDILADYPP-PKNQV--SHFKSPMADDGSTPAVTVHLAWLILVLMCKLDMKAEIY  460

Query  572   KDISIAYLFLANNLQYVVVKV-RTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIA  396
             KD S++YLFLANNLQ++V KV +T  L   LGE+W+++   KVK YA+NYE   W  V++
Sbjct  461   KDASLSYLFLANNLQFIVEKVQQTPNLKLLLGEDWVAEHMKKVKLYASNYESTAWTKVLS  520

Query  395   SLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYR  216
             SLPE  ++  SPE  K+ FK+FNA+F +A+RK ++ +V DR LRD +KVS+ +KL+  Y+
Sbjct  521   SLPEK-SSETSPEMAKECFKRFNAAFEEAYRKQTSWIVEDRKLRDDVKVSIEQKLVPRYQ  579

Query  215   DFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +FYDT+ L M +  E++   +V+++P+D+G+HLSDLF
Sbjct  580   EFYDTY-LVM-QSGEKNLELLVRYSPDDLGNHLSDLF  614



>gb|KDO67805.1| hypothetical protein CISIN_1g007630mg [Citrus sinensis]
Length=595

 Score =   472 bits (1215),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 250/556 (45%), Positives = 371/556 (67%), Gaps = 6/556 (1%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F E+++E  +  +  MI KW+  +    K+TSLF  +R+EA +F+KCV++L+ AM +   
Sbjct  36    FSEAMVEENIANAATMIKKWDMNSPSITKLTSLFLHNRKEAKEFLKCVKDLRCAMHYSVS  95

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E   S+KLV AQNLM+ AMKRL+ EF+Q L+  R  LD +S S    S   +S       
Sbjct  96    EHSTSDKLVLAQNLMQTAMKRLEHEFYQTLSRYRDELDADSISLGRSSDGSSSYVGDEDE  155

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
                 D D+           +TE+  +S   MAD++ I + MI CGY KEC K+YK  RK 
Sbjct  156   NGSVDDDELRRTGET----LTEMGRISQLAMADLKAIADVMIGCGYGKECIKIYKLARKS  211

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE + +LG+E    S ++KM+WE LE  IKNWL+A++IAVKTLF+GE+  CD+VF+++
Sbjct  212   IVDEGLHQLGIEHFKASHVQKMNWEALEHMIKNWLTAVKIAVKTLFSGEKFFCDHVFSAS  271

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              D IRE+ F +I++E A+ LF+FPE +AK +K S E++F+L++++N +    PEIE IF+
Sbjct  272   -DKIREACFCDITQEEALNLFKFPELVAK-SKKSAERIFQLMELHNMLNVLFPEIELIFN  329

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              ++ S+++ QA++S+ KLGD++R  I+ FE+ L KDSSK+   GGGIH LT   M+Y+TS
Sbjct  330   SEATSAVKLQALSSMHKLGDSVRAIISDFESTLHKDSSKTQAVGGGIHQLTRSVMSYITS  389

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             + +H N+L+DI ++ PP      P+SYF    S  S   A+SL  AWLIL+LLCKLD  A
Sbjct  390   LGEHGNILADIVADHPPPCTSSFPESYFESPSSHNSRGSAVSLHLAWLILVLLCKLDRKA  449

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
               YKD++++YLFLANNLQ+++ KVRTS L   LG++WL   + K+KQYA NYE + W  V
Sbjct  450   ALYKDVALSYLFLANNLQFIIEKVRTSVLKHLLGDDWLCTHAKKLKQYALNYETMAWNKV  509

Query  401   IASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRP  222
              +SLPE  ++P+ PE  K  F++F+A+F +A+ K ++ +V +R LRD LK S+A+KL   
Sbjct  510   FSSLPERSSSPVPPEVAKDCFRRFSAAFEEAYVKQTSWIVPNRKLRDELKASIAKKLAPA  569

Query  221   YRDFYDTHKLTMPKEK  174
             YR+FYD +++ +  EK
Sbjct  570   YREFYDEYRVILSGEK  585



>gb|KFK38345.1| hypothetical protein AALP_AA3G102000 [Arabis alpina]
Length=639

 Score =   474 bits (1219),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 266/582 (46%), Positives = 386/582 (66%), Gaps = 23/582 (4%)
 Frame = -2

Query  1826  MERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRS  1647
             ++R ++ +  +I KWN E     K  SLF ES+REA  F+K V++LQ AM  L  E P S
Sbjct  36    IDRTIDQAAEIIEKWNTEYVTTTKFYSLFCESKREAKTFLKRVKDLQNAMDSLIREDPNS  95

Query  1646  EKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfd  1467
             E L+RAQ LM++AMKRL+ EF QIL+M RAHLDPES+S+ + +S V++    +       
Sbjct  96    ENLLRAQKLMQIAMKRLENEFLQILSMIRAHLDPESASSRSPTSVVSNDDDIWHEYRSAG  155

Query  1466  vddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEA  1287
                           I EVE+VS   + +++ I ECMI+ GY+KEC   YK IRK I+DE 
Sbjct  156   DS------------IIEVEEVSKNSITELKSIAECMIAAGYAKECGSAYKSIRKSIVDET  203

Query  1286  ISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIR  1107
             I RLGVEK+S SK +KM  EV+EL++K+W+ A+++++K LF+ E+TLCD VF S+  ++R
Sbjct  204   IYRLGVEKISSSKAKKMPSEVVELKMKSWIEAVKVSMKILFDSEKTLCDEVFESSV-SLR  262

Query  1106  ESIFKEISKEAAMILFEFPENIAKYAKNS--PEKVFRLLDMYNAIANHRPEIESIFSMDS  933
             ES F++ISKE A++LF FPE +A   K +  PEK+F LLDMY +I  + P IESIFS  S
Sbjct  263   ESCFRDISKEGALLLFGFPETVALRDKKNPHPEKIFPLLDMYCSITGNLPAIESIFSFAS  322

Query  932   ASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIAD  753
              S ++TQA+TSL++L ++I + +  FE+ ++KDSSK  V GGG+HP+TI AM++L+ +A+
Sbjct  323   LSIVKTQALTSLSRLRESILSHLMDFESEIRKDSSKMVVHGGGVHPMTISAMDHLSRLAE  382

Query  752   HSNVLSDIF--SNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAE  579
             +SN L DIF  S++    K  LP SYF VS +D S    + +R+AW+IL+LLCK+D  AE
Sbjct  383   YSNALLDIFNGSSSSFSAKTLLPKSYFNVSGTDGSSASEVRMRFAWMILVLLCKIDAKAE  442

Query  578   HYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVI  399
              YK+ S+ YLFLANNLQ+V  + R+++L + LG++W+++   KV+Q+A +YERL WG ++
Sbjct  443   MYKEFSMQYLFLANNLQHVASRARSTKLKQLLGDDWIARHFEKVRQFARSYERLAWGPLL  502

Query  398   ASLPENPTA---PMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
             +  P   T+    MSPEE+K  F+ F  SF       SACVV +  L D +++S+ R LL
Sbjct  503   SLCPAISTSEAVEMSPEEVKMQFEIFEESFVNTLVSQSACVVPNPKLLDEIRISIGRMLL  562

Query  227   RPYRDFYDTHK-LTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               Y DFY+ H+   M    E   +  V++ PED+  +LS+LF
Sbjct  563   PVYLDFYNAHRNAVMLAGTEDRLN--VRYTPEDIEIYLSELF  602



>ref|XP_010520296.1| PREDICTED: exocyst complex component EXO70B1-like [Tarenaya hassleriana]
Length=649

 Score =   474 bits (1220),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 268/549 (49%), Positives = 378/549 (69%), Gaps = 14/549 (3%)
 Frame = -2

Query  1733  SRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAH  1554
             SR+EA +FV  VR+LQ  M  L    P SEKL+RAQ+LM+ AMK L+ EF+++L +NR +
Sbjct  78    SRQEAAEFVGAVRDLQSTMHRLVSVSPASEKLIRAQSLMQSAMKFLESEFYRVLKVNREY  137

Query  1553  LDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRL  1374
             LDPE  S  +  S   STS+   S  D  VD  DD+      +  +     S  M D+R+
Sbjct  138   LDPECVSVRSHKSCRFSTSSVSDSDGDNSVDGTDDEGDEMRFAGGD-----SDAMDDLRM  192

Query  1373  IVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLS  1194
             I +CMIS GY+KEC +VYK +R+ I DE +  LGVE++S ++I+KMDWE LE +IK+WL 
Sbjct  193   IADCMISTGYAKECVRVYKTVRRSIADETLHNLGVERLSLNQIQKMDWETLESKIKSWLR  252

Query  1193  AMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPE  1014
             A++ AV+TLF GER L D+VF+++  AI ES F +IS+E A+ LF FPEN AK+ + SPE
Sbjct  253   AVKFAVRTLFYGERILADHVFSAS-SAIAESSFTDISQEGALTLFGFPENAAKFKRLSPE  311

Query  1013  KVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKD  834
             K+FR+LDMY A+AN  PEIESIF  DS +++R+Q + SLA+LGD++R  ++ FE+ +Q D
Sbjct  312   KMFRILDMYEALANLYPEIESIFYFDSTAAVRSQVINSLARLGDSVRWMMSDFESAIQGD  371

Query  833   SSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSN-----TPPIPKDWLPDSYFAVS  669
             SSK  + GGG+HPLT   MNYL+ +AD+S+ ++ IF N     + P+P+  L  S  A +
Sbjct  372   SSKKPIPGGGVHPLTRYVMNYLSFLADYSDSVAAIFENWQLPASSPMPESLLF-SGDANT  430

Query  668   DSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNR  489
             D D+      S+R AW+ILL LCK+D  A+ YKD++++YLFLANNLQYV++KVR+S L  
Sbjct  431   DQDDIYSSPASVRIAWVILLTLCKVDGKAQPYKDVALSYLFLANNLQYVIIKVRSSNLKL  490

Query  488   FLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQA  309
              LG+ W+ +  AKVKQYA  +E+L WG V+ SLPE+P A +S EE  + F++ N  F  A
Sbjct  491   LLGDEWVLRHEAKVKQYAEKFEKLAWGKVLTSLPEDPMAQISQEEAMEIFRRLNDEFESA  550

Query  308   HRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDV  129
             +RK S+ V+ D  LRD  KVSLARKL+  YR+FY+ ++  + +E   +   IV+F PED+
Sbjct  551   YRKQSSWVIPDPKLRDETKVSLARKLIPSYREFYEGNRAELVRET--YNEGIVRFTPEDL  608

Query  128   GHHLSDLFF  102
             G++LSDL+F
Sbjct  609   GNYLSDLYF  617



>ref|XP_006403488.1| hypothetical protein EUTSA_v10010195mg [Eutrema salsugineum]
 gb|ESQ44941.1| hypothetical protein EUTSA_v10010195mg [Eutrema salsugineum]
Length=636

 Score =   473 bits (1218),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 267/581 (46%), Positives = 386/581 (66%), Gaps = 9/581 (2%)
 Frame = -2

Query  1844  HFYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLA  1665
             +F +S ME A+E +  +I KW+P      K+ SLF  SR+EA +F++CVR+L++AM FL 
Sbjct  36    NFTQSTMEEAVEKAESVIRKWDPNTPSFTKIVSLFNHSRKEAKEFIRCVRDLRRAMHFLV  95

Query  1664  MEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
              + P+S KL  AQ LME+AM RL+KEFFQIL+ NR  LDPES S  +  SS +       
Sbjct  96    SQDPQSPKLALAQTLMEIAMTRLEKEFFQILSSNRDKLDPESVSGQSSISSNSEFEDIMQ  155

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRK  1305
             S  D + D++      +   IT+VE  S+ VM+D++ I E MISCGY KEC K+YK IRK
Sbjct  156   SDDDDEDDNEIKKAGES---ITQVEKASAVVMSDLKAIAESMISCGYGKECVKIYKRIRK  212

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              I+DE +S LG+E    S+  +MDW  LE  IKNW+ A +I V TLF GE+ LCD+VF++
Sbjct  213   SIVDEGLSLLGIEIYKGSRFHRMDWVTLEHMIKNWIKAAKIGVATLFRGEKLLCDHVFSA  272

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
             + ++ RES F EI+ EAA  LF FPE +AK  K S E++F L+D+  AI++   +IE IF
Sbjct  273   S-NSTRESCFYEIANEAATNLFRFPEFVAK-EKKSHERIFSLMDLQAAISDLWQDIEMIF  330

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
               DS + +++QA+TSL KL  +I + +  FE+ +QKDS+K+   GGG+H LT   M++++
Sbjct  331   HFDSVADVKSQALTSLRKLKVSIHSALTDFESTIQKDSTKALTPGGGVHKLTRSTMSFIS  390

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYFAVS-DSDESPLPAISLRYAWlillllckLDV  588
             S++ +S+VL ++ ++ P      L +SY       DE    A+S+  AWLIL+LLCKLD 
Sbjct  391   SLSKYSSVLFEVIADHPLHRNTRLLESYVRTPITEDEEHNHALSVHLAWLILVLLCKLDT  450

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AEHYKD+S++YLFLANNL  +V  VR+++L   LG++WLSK   K+  YAANYE   W 
Sbjct  451   KAEHYKDVSLSYLFLANNLNVIVETVRSTQLRDLLGDDWLSKHDDKLSAYAANYEIAAWS  510

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
             +V  SLPE PT  +SPEE K +F++F+ +F +A+ K S+ VV D  LRD LKVS+A+KL+
Sbjct  511   NVFMSLPEEPT-DLSPEEAKIYFRRFHTAFEEAYMKQSSRVVPDAKLRDELKVSIAKKLV  569

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               YR+FY  +   + +EK  +   +V+F P+++ +++SDLF
Sbjct  570   PEYREFYRKYLPMLGQEK--NIEILVRFKPDNLENYISDLF  608



>ref|XP_009139196.1| PREDICTED: exocyst complex component EXO70A1 [Brassica rapa]
Length=632

 Score =   473 bits (1216),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 266/582 (46%), Positives = 387/582 (66%), Gaps = 15/582 (3%)
 Frame = -2

Query  1844  HFYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLA  1665
             +F +S ME A+E +  +I KW+P      K+ SLF  SR+EA +F+ CVR+L+KAM FL 
Sbjct  36    NFTQSSMEEAVERAEAVIRKWDPNTPSFTKIVSLFNHSRKEAKEFIICVRDLRKAMHFLV  95

Query  1664  MEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
              +  +S KL  AQ LM++AM RL+KEFFQIL+ NR  LDPES S  +  SS +       
Sbjct  96    SQDSQSHKLALAQTLMQIAMTRLEKEFFQILSSNRDKLDPESVSGQSSISSNSEFEDIMQ  155

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRK  1305
             S  + ++    +        IT+VE  S+ VM+D++ I E MISCGY KEC K+YK IRK
Sbjct  156   SDDEDEIKKAGES-------ITQVEKASAVVMSDLKAIAESMISCGYGKECVKIYKRIRK  208

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              I+DE +S LG+E     +  + DW  LE  IKNW+ A +I V TLF GE+ LCD+VF++
Sbjct  209   SIVDEGLSLLGIETYKAPRFHRTDWVTLEHMIKNWIRAAKIGVATLFRGEKLLCDHVFSA  268

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
             + ++ RES F EI+ EAA  LF+FPE +AK  K S E++F L+D+  AI++   ++E IF
Sbjct  269   S-NSTRESCFYEIAYEAATNLFKFPEFVAK-EKKSHERIFSLMDLQAAISDLWQDVEMIF  326

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
                S + +++QA++SL KL  +I + +  FE+ +QKDS+K+   GGG+H LT   M++++
Sbjct  327   HFGSVAGVKSQALSSLEKLKVSIHSAVVDFESTIQKDSTKTLTPGGGVHKLTRSTMSFIS  386

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYF--AVSDSDESPLPAISLRYAWlillllckLD  591
             S++ HS VLS+I ++ P        +SY    VS+++E    A+S+ +AWLIL+LLCKLD
Sbjct  387   SLSKHSRVLSEILADHPLPRNTGSLESYIRTPVSENEERN-HALSVHFAWLILVLLCKLD  445

Query  590   VIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGW  411
               AEHYKD+S++YLFLANNL +++  VR++ L   LG+NWL+K S K+  YAANYE   W
Sbjct  446   TKAEHYKDVSLSYLFLANNLHFIIETVRSTHLRDLLGDNWLTKHSDKLNAYAANYEIAAW  505

Query  410   GDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKL  231
              +V  SLPE PT  +SPEE K +FK+F+ +F +A+ K S+ VVSD  LRD LKVS+A+KL
Sbjct  506   SNVYMSLPEEPT-ELSPEEAKTYFKRFHTAFEEAYMKQSSRVVSDSKLRDGLKVSIAKKL  564

Query  230   LRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +  YR+FY  + L M  + ER+   +V+F P+++ +++SDLF
Sbjct  565   VPEYREFYRKY-LPMLGQ-ERNIEMLVRFKPDNLENYISDLF  604



>emb|CDY64627.1| BnaCnng44410D [Brassica napus]
Length=646

 Score =   473 bits (1217),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 258/582 (44%), Positives = 384/582 (66%), Gaps = 11/582 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+ME ALE +  +I KW+P +    K+ S+F  SR+EA +F++CVR+L++AM FL  
Sbjct  43    FSQSMMEEALEAAETIIKKWDPNSQSYTKIISMFRNSRKEAKEFIRCVRDLRRAMHFLVS  102

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S+KLV AQNLM++ M  L+KEFFQIL+ NR HLDPES+S  +  SS +       +
Sbjct  103   QDSKSDKLVLAQNLMQIGMSTLEKEFFQILSSNRDHLDPESASGHSTISSNSEFEVVMEN  162

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               D   +            I++VE+ S+ VM+D+++I E MI CGY KEC K YK IRK 
Sbjct  163   DDDEYDELKKAGES-----ISQVENASALVMSDLKVIAETMIRCGYGKECIKSYKLIRKS  217

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  LG+EK+  S+ +KMDW +LE  IKNW+ + +I V TL  GE+ LCD+VF+++
Sbjct  218   IVDEGLHLLGIEKVKTSQFQKMDWGMLEHMIKNWIKSAKIGVTTLLRGEKLLCDHVFSAS  277

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIA-KYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
                I +S F +I+KEA + LF FPE +A K  K   E++F+L+D+Y AI++  P+IE IF
Sbjct  278   I-TIGQSCFNQIAKEAGLNLFMFPELVASKEKKPHHERIFKLMDLYAAISDLWPDIEMIF  336

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
             S DS +S++   +++L KL D+I T + +FE  + KDS K     GG+H LT   M++++
Sbjct  337   SFDSLASVKNLVLSTLKKLKDSIHTCLKEFEVTIHKDSYKELTPEGGVHKLTRTRMSFIS  396

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllckLD  591
             S++++S VLS+I +  P      L + YF   + + +     A S+  A LIL+ LCKLD
Sbjct  397   SLSEYSRVLSEILAENPLKRNTRLLEYYFTAPILEDEHVNNHAFSVYLASLILVFLCKLD  456

Query  590   VIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGW  411
               AE YKD+ ++Y F+ NNLQ+VVV VR++RL   LG++WL+K  AKV+ YA  YE+  W
Sbjct  457   TKAESYKDMCLSYFFIVNNLQFVVVTVRSTRLKSLLGDDWLTKHEAKVRSYAEKYEKAAW  516

Query  410   GDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKL  231
              +V ASLP   +A +S EE    FK+F+ASFA A+ K S+CV+ D  LRD LKVS+ARKL
Sbjct  517   TNVFASLPAKTSAKLSAEEATTCFKRFHASFAGAYMKQSSCVIEDAKLRDELKVSIARKL  576

Query  230   LRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +  YR+FY+ + L M ++ +R+  ++V F P+++ ++LSDLF
Sbjct  577   VPEYREFYEKY-LPMLRQ-DRNIETLVSFKPDNLENYLSDLF  616



>ref|XP_009604963.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
tomentosiformis]
Length=630

 Score =   472 bits (1214),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 271/587 (46%), Positives = 389/587 (66%), Gaps = 12/587 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEA----SEAAKVTSLFYESRREANDFVKCVRNLQKAMQ  1674
             F E++ME +L+ +  +I +W+ +     S    +++LF ++R EA  FV  V +LQ AM+
Sbjct  26    FCETLMEDSLKNAEAIIKRWDLDNGSSNSSYCTISNLFRDNRAEAKQFVDAVIDLQHAMR  85

Query  1673  FLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvastst  1494
              +  E   S++LVRAQNLM++A+KRL+KEF  IL  NR  LD ES+++   S+  ++ S 
Sbjct  86    LVIKESSSSQQLVRAQNLMQIAIKRLEKEFRTILAGNRYFLDSESTASREYSNRSSTASD  145

Query  1493  gfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKD  1314
                ++ D +  +    +     +  E E +S  V AD+R I +CMI  GY KEC ++Y+ 
Sbjct  146   EDQASEDDNTVEIQARLSEVSIT-EEGEKIS--VTADLRAIADCMIEAGYGKECAQIYQL  202

Query  1313  IRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNV  1134
              RK +IDE +  LG+E  + S I+KMDW+VLE +IK+WLSA+++AV TL  GER LCD V
Sbjct  203   NRKSVIDETLYCLGIENFNISVIQKMDWDVLEKKIKSWLSAVKVAVSTLLYGERILCDQV  262

Query  1133  FASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIE  954
             FA   D IRES F EI+K++A+ LF FPE +AKY K S EK+FR+LD+Y+AI+    EIE
Sbjct  263   FA-VSDNIRESCFSEIAKDSALALFTFPEMVAKYKKLSIEKMFRILDLYDAISELWSEIE  321

Query  953   SIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMN  774
              IF  DS + +R+QA++S+ KL +A RT +++FE+ ++KDSSK  V GGGIHPLT   MN
Sbjct  322   LIFGFDSTAVVRSQAMSSMEKLREAARTILSEFESAIKKDSSK-VVPGGGIHPLTRYVMN  380

Query  773   YLTSIADHSNVLSDIFSNTPPIPKDWLPDSYF--AVSDSDESPLPAISLRYAWlillllc  600
             YL  ++D+S  +S+I ++ P   K  LP+SY    ++D + S    +S+R AWLIL+LLC
Sbjct  381   YLVFLSDYSGPISEIVADMPVSMKSPLPESYLLSPIADDENSAACVVSVRLAWLILVLLC  440

Query  599   kLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYER  420
             KLD  A  Y D+ ++YLFLANNL YV+ KVR S L   LG  WLS   AKV+QY  NY+R
Sbjct  441   KLDGKAGFYGDVPLSYLFLANNLNYVLSKVRESSLKLLLGSIWLSNHEAKVEQYMENYKR  500

Query  419   LGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLA  240
             +GW  V+ SLPEN TA +SP E+ Q F KFN  F +A+RK S+ V+ D  LRD +K+SLA
Sbjct  501   MGWSKVLTSLPENLTAKISPAEVNQCFCKFNLGFEEAYRKQSSWVIPDPKLRDEVKISLA  560

Query  239   RKLLRPYRDFYDTHKLTMPKEKE-RHFSSIVKFAPEDVGHHLSDLFF  102
             +K++  YR FY+ +  T+ +        SIV+F P+D+ ++LSDLF+
Sbjct  561   KKIVTAYRAFYEKNWETVSRSGSGGEVESIVRFVPDDLQNYLSDLFY  607



>gb|AES88795.2| exocyst subunit exo70 family protein [Medicago truncatula]
Length=630

 Score =   472 bits (1214),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 278/623 (45%), Positives = 395/623 (63%), Gaps = 31/623 (5%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEAA  1758
             MPRKGMR I F P   SSS+    S    +  F +S+ME  +  +  +I KW+   +   
Sbjct  1     MPRKGMRSIFFHPTPPSSSTLPSPSSPHHTFTFSDSLMEENILTAESLITKWDYSNTNQI  60

Query  1757  KVTSLFY-ESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFF  1581
              +  LF   +R EA  ++  V+ LQ AMQ+       S  LVRAQ LM++AMK LQKEF+
Sbjct  61    -INPLFSGNTRFEAKHYLNAVKGLQSAMQYFVTHDSTSNTLVRAQFLMQLAMKTLQKEFY  119

Query  1580  QILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVS  1401
              IL+ NR HLDPES S  + +   +S S         D +      +     I+E E VS
Sbjct  120   NILSTNREHLDPESVSNRSSTDRRSSFSVSDYDDEVSDDEKFVVGNQ-----ISETERVS  174

Query  1400  SFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVL  1221
                MAD++ I +CMI+CGY KEC KVY  +RK I+DEA+  LG+E+++FS+I+KMDWEV+
Sbjct  175   MLAMADLKAIADCMINCGYGKECVKVYIVMRKSIVDEALYHLGIERLTFSQIQKMDWEVI  234

Query  1220  ELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENI  1041
             EL+IK WL A+++AV+TLF+GER LCD+VFA+    I ES F EI+KE A  LF FP+ +
Sbjct  235   ELKIKTWLKAVKVAVRTLFHGERILCDDVFAAAGKRIAESCFAEITKEGATSLFTFPDMV  294

Query  1040  AKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIA  861
             AK  K +PEK+FR LD+Y AI++H  +I+SIFS +S S++R QA+ S+ KL +A++T + 
Sbjct  295   AK-CKKTPEKMFRTLDLYEAISDHFQQIQSIFSFESTSNVRLQAINSMEKLAEAVKTMLK  353

Query  860   QFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSY  681
             +FE+ +QKDSSK  V+GGG+HPLT   MNYLT +AD+  +L+DI  + P  P   LP+SY
Sbjct  354   EFESAIQKDSSKKQVSGGGVHPLTRYVMNYLTFLADYGGILADIVFDMPQSP---LPESY  410

Query  680   F--------AVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQY  525
             +        + S S  S    IS + AWLIL+LLCKLD  AE YKD++++YLFLANN+QY
Sbjct  411   YRSPMRSENSSSSSSSSSSSEISEKIAWLILVLLCKLDTKAEFYKDVALSYLFLANNMQY  470

Query  524   VVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLP--ENPTAPMSPEEI  351
             VVVKVR S L   LGE WL+    KVK+Y   + ++GW  V+++LP  EN TA  + E++
Sbjct  471   VVVKVRRSNLGFLLGEEWLTNHELKVKEYVNKFVQIGWNKVLSTLPENENSTAEKTVEQV  530

Query  350   KQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKE  171
             K  F KFNA+F +  +K ++ +VSD  LRD +K  +  KL+  Y  FY+ +++       
Sbjct  531   KAIFVKFNAAFDEECKKQTSWIVSDPRLRDEIKALIGSKLVAKYGGFYEKNRV-------  583

Query  170   RHFSSIVKFAPEDVGHHLSDLFF  102
                 S V++ PE +  +L ++ +
Sbjct  584   ---GSGVRYEPEYIESYLGNILY  603



>emb|CDP08984.1| unnamed protein product [Coffea canephora]
Length=652

 Score =   473 bits (1216),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 275/596 (46%), Positives = 392/596 (66%), Gaps = 27/596 (5%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEAAKV-----TSLFYESRR-EANDFVKCVRNLQKAMQF  1671
             ++ME  ++ +  +I KW+  A+++A++      SLF +  R +A  F+K V +LQ AM F
Sbjct  33    TIMEENVDCAEVIIRKWDLNATDSARLYSSNTPSLFAQDHRSQAQQFIKSVNDLQSAMHF  92

Query  1670  LAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststg  1491
                E P S  L+RAQNLM++AMKRL+KEF+ +L  N   L PES S  + SS  +ST + 
Sbjct  93    FVSEDPGSPMLIRAQNLMQIAMKRLEKEFYSVLKTNMTALHPESVSLRSSSSRASSTWSA  152

Query  1490  fsstsdfdvddddddvrvagdSITEV-------EDVSSFVMADMRLIVECMISCGYSKEC  1332
             FS   + +  + +DD       I ++       E V   VM+D+R+I  CMIS GY KEC
Sbjct  153   FSDFQNRETSEGEDDDDEITTDIDQIHIKSNKTEKVYEDVMSDLRVIANCMISSGYGKEC  212

Query  1331  FKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGER  1152
               +Y  IRK IIDE +  LGVE++S S+++KM W+ +E++IK WL+A++ AVKTLF+GER
Sbjct  213   THIYNLIRKSIIDETLYYLGVEQLSSSQLQKMAWDDIEVKIKKWLAAVKTAVKTLFHGER  272

Query  1151  TLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAK-NSPEKVFRLLDMYNAIA  975
              LCD+VF ++ + IRE+ F EIS+  A+ LF FPEN+A+  K  SPEK+FR LD+Y A++
Sbjct  273   VLCDHVFCAS-EKIRETCFTEISRGNALTLFSFPENVARCKKIFSPEKMFRFLDIYEAVS  331

Query  974   NHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHP  795
                 +I  IFS DS S +R QA+TSL KLG+A+RT + QFE+ ++KDSSK+ V GGG+HP
Sbjct  332   ELWIDIGMIFSFDSLSGVRAQAMTSLLKLGEAVRTMLLQFESAIEKDSSKTAVPGGGVHP  391

Query  794   LTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDS-----DESPLPAISLR  630
             L    MNYL  + D+S  L+DI ++ P   +  LP+SY +   S     D+SP   IS+R
Sbjct  392   LARYVMNYLVFLTDYSGALADIVADWPTSVQTSLPESYLSSPISANDVDDDSPASTISVR  451

Query  629   YAWlillllckLDVIAEHYKD-ISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSA  453
              AW+IL+LLCKLD  A  Y D ++++YLFLANNL YVV KV+TS L   +G +W+SK  +
Sbjct  452   LAWIILVLLCKLDGKAGCYGDHVALSYLFLANNLNYVVSKVKTSNLMPLMGPDWVSKHES  511

Query  452   KVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDR  273
             K KQY+A YER+GW  V+ SLP++PT  +S  EIK  F+KFN+ F +A+R  S+ V+ D 
Sbjct  512   KGKQYSAKYERMGWAKVLTSLPDDPTVEISLPEIKDSFRKFNSGFEEAYRVQSSWVIPDS  571

Query  272   NLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              LRD +K SL+ K++  YR FY+ H+  +  E      SIV+F P+D+ + LSDLF
Sbjct  572   KLRDQIKFSLSEKMVPGYRVFYENHREEVGDE------SIVRFTPDDLENCLSDLF  621



>emb|CDX74850.1| BnaA05g05960D [Brassica napus]
Length=674

 Score =   473 bits (1217),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 258/583 (44%), Positives = 387/583 (66%), Gaps = 11/583 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+ME ALE +  +I KW+P +    K+ SLF  SR++A +F++CVR+L++AM FL  
Sbjct  68    FSQSMMEEALESAESIIKKWDPNSQSYRKIISLFRHSRKQAKEFIRCVRDLRRAMHFLVS  127

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S+KLV AQNLM++ M  L+KEFFQIL+ NR HLDP+S+S  +  SS +        
Sbjct  128   QDSKSDKLVLAQNLMQIGMSMLEKEFFQILSSNRDHLDPDSASGQSTISSNSEFEVYMEY  187

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               D D D+           I++VE  S+ VM+D+++I E MISCGY KEC K YK IRK 
Sbjct  188   DEDDDDDELKKAGES----ISQVEKASALVMSDLKVIAETMISCGYGKECIKSYKLIRKS  243

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  LG+EK+  S+  KMDW VLE+ IKNW+ A  I V TLF GE+ LCD+VF+++
Sbjct  244   IVDEGLHLLGIEKVKNSQFHKMDWGVLEVMIKNWIKAANIGVTTLFKGEKLLCDHVFSAS  303

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAK--NSPEKVFRLLDMYNAIANHRPEIESI  948
                I +S F +I+KEA + LF  PE +A   K  +  E++F+L+D+Y AI++  P+IE I
Sbjct  304   L-TIGQSCFNQIAKEAGLNLFMLPELVAHKEKKQHHHERIFKLMDLYAAISDLWPDIEMI  362

Query  947   FSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYL  768
             FS DS +S++T+ +++L KL D+I T + +FET + KDSSK     GG++ LT   M+++
Sbjct  363   FSFDSLASVKTRVLSTLKKLKDSIHTCLKEFETTIHKDSSKELSPEGGVYKLTRTTMSFI  422

Query  767   TSIADHSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllckL  594
             +S++++S VLS+I +  P      L +SYF   + + +     A S+  AWLIL+ LCKL
Sbjct  423   SSLSEYSRVLSEILTEHPLKTNTRLLESYFTAPILEDEHVNNHACSVHLAWLILVFLCKL  482

Query  593   DVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLG  414
             D  AE Y D+S++Y+FL NN+Q+VV  VR+S+L   LG++W++K   K+K YA  YE+  
Sbjct  483   DTKAESYNDVSLSYIFLVNNMQFVVDTVRSSQLKNLLGDDWVTKHEVKLKSYAEKYEKAA  542

Query  413   WGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
             W +V+ SLP   +  +SPEE    FK+F+++FA A+ K S+CV++D  LRD LKVS+ARK
Sbjct  543   WTNVLVSLPGKKSTKLSPEEATTCFKRFHSAFAGAYLKQSSCVIADAKLRDELKVSIARK  602

Query  233   LLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             L+  YR FY+ + L M ++ +R+   +V F P+++ ++LS LF
Sbjct  603   LVPEYRVFYEKY-LPMLRQ-DRNIEMLVCFKPDNLENYLSGLF  643



>emb|CDX76117.1| BnaA04g03810D [Brassica napus]
Length=633

 Score =   471 bits (1212),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 265/581 (46%), Positives = 384/581 (66%), Gaps = 13/581 (2%)
 Frame = -2

Query  1844  HFYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLA  1665
             +F +S ME A+E +  +I KW+P      K+ SLF  SR+EA +F+ CVR+L+KAM FL 
Sbjct  36    NFTQSSMEEAVERAEAVIRKWDPNTPSFTKIVSLFNHSRKEAKEFIICVRDLRKAMHFLV  95

Query  1664  MEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
              +  +S KL  AQ LM++AM RL+KEFFQIL+ NR  LDPES S  +  SS +       
Sbjct  96    SQDSQSPKLALAQTLMQIAMTRLEKEFFQILSSNRDKLDPESVSGQSSISSNSEFEDIMQ  155

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRK  1305
             S  + ++    +        IT+VE  S+ VM+D++ I E MISCGY KEC K+YK IRK
Sbjct  156   SDDEDEIKKAGES-------ITQVEKASAVVMSDLKAIAESMISCGYGKECVKIYKRIRK  208

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              I+DE +S LG+E     +  + DW  LE  IKNW+ A +I V TLF GE+ LCD+VF++
Sbjct  209   SIVDEGLSLLGIETYKAPRFHRTDWVTLEHMIKNWIRAAKIGVATLFRGEKLLCDHVFSA  268

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
             + ++ RES F EI+ EAA  LF+FPE +AK  K S E++F L+D+  AI++   ++E IF
Sbjct  269   S-NSTRESCFYEIAYEAATNLFKFPEFVAK-EKKSHERIFSLMDLQAAISDLWQDVEMIF  326

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
                S + +++QA++SL KL  +I + +  FE+ +QKDS+K+   GGG+H LT   M++++
Sbjct  327   HFGSVAGVKSQALSSLEKLKVSIHSAVVDFESTIQKDSTKTLTPGGGVHKLTRSTMSFIS  386

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDS-DESPLPAISLRYAWlillllckLDV  588
             S++ HS VLS+I ++ P      L +SY     S DE    A+S+ +AWLIL+LLCKLD 
Sbjct  387   SLSKHSRVLSEILADHPLPRNTRLLESYIRTPVSEDEERNHALSVHFAWLILVLLCKLDT  446

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AEHYKD+S++YLFLANNL +++  VR++ L   LGE+WL+K S K+  YAANYE + W 
Sbjct  447   KAEHYKDVSLSYLFLANNLHFIIETVRSTHLRDLLGEDWLTKHSDKLSAYAANYEIVAWS  506

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
             +V  SLP  PT  +SPEE K +FK+F+ +F +A+   S+ VVSD  LRD LKVS+A+KL+
Sbjct  507   NVYMSLPVEPT-DLSPEEAKTYFKRFHTAFEEAYMNQSSRVVSDSKLRDGLKVSIAKKLV  565

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               YR+FY  + L M  + ER+   +V+F P+++ +++SDLF
Sbjct  566   PEYREFYRKY-LPMLGQ-ERNIEMLVRFKPDNLENYISDLF  604



>ref|XP_010486525.1| PREDICTED: exocyst complex component EXO70B1-like [Camelina sativa]
Length=642

 Score =   471 bits (1213),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 264/584 (45%), Positives = 384/584 (66%), Gaps = 23/584 (4%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQP  1653
             S +++ ++ +  +I KWN E   +    SLF ES+REA  FV+ V+ LQ AM  L  E P
Sbjct  32    SGIDKTIDNAAEIIEKWNTEYVSSNNFYSLFCESKREAKKFVRRVKELQNAMDLLIREDP  91

Query  1652  RSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsd  1473
              S+ L+RAQ LM++AMKRLQKEF QIL+MNRAHLDPES S  + +S V++    +     
Sbjct  92    SSDHLLRAQRLMQIAMKRLQKEFLQILSMNRAHLDPESVSTRSPTSVVSNDEGAWHDYRS  151

Query  1472  fdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIID  1293
                             I EVE+VS     +++ I ECMIS GY+KEC   YK IRK I+D
Sbjct  152   VGDS------------IIEVEEVSKNSRTELKSIAECMISAGYAKECANTYKSIRKSIVD  199

Query  1292  EAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA  1113
             E+I RLGVEK+S SK +KM +EV+EL+ K W+ A+++++KTLF  E+TLCD VF S+  +
Sbjct  200   ESIYRLGVEKISSSKAKKMPYEVVELKTKRWIEAVKVSMKTLFISEKTLCDEVFESSA-S  258

Query  1112  IRESIFKEISKEAAMILFEFPENIAKYAKNSP--EKVFRLLDMYNAIANHRPEIESIFSM  939
             +RES F++ISKE A++LF FPE +A   K +P  EK+F LLDMY  I  +   IE+IFS 
Sbjct  259   LRESCFRDISKEGALLLFGFPETVAVRDKKNPHMEKIFPLLDMYCMITENLLAIEAIFSF  318

Query  938   DSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSI  759
              S S++RTQA +SL +L ++I + +A+FE+ ++KD+SK+ V GGG+HP+TI  M++++ +
Sbjct  319   PSISAVRTQAHSSLTRLSESILSHLAEFESEIRKDTSKTMVRGGGVHPMTISVMDHISRL  378

Query  758   ADHSNVLSDIFSNTPPIPKD--WLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVI  585
             +++S+ L DI   +P    D   LP SYF V++S+ SP   + +R+AWLIL+LLCK+D  
Sbjct  379   SEYSSSLMDILDGSPSSSPDKSMLPKSYFNVTESEGSPSSELKVRFAWLILVLLCKIDGK  438

Query  584   AEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             AE YK+ S+ YLFL NNLQ+VV + R++ L + LG++W+++   KVKQ+A +YERL W  
Sbjct  439   AEMYKEFSMQYLFLTNNLQHVVSRARSTNLKQLLGDDWITRHFEKVKQFARSYERLAWDP  498

Query  404   VIASLP---ENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
             +++  P      T  MS EE K   +KFN SF +     S CV+ D  L D +++S+ RK
Sbjct  499   LVSMCPTISTCETVGMSNEEAKMQSEKFNESFEKTCEAQSECVIPDLKLLDEMRMSIRRK  558

Query  233   LLRPYRDFYDTHK-LTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             LL  YRDFY+ H+   M   KE  ++  +++ PED+ + LS+LF
Sbjct  559   LLPIYRDFYNAHRNAVMLIGKEGGWN--IRYTPEDIEYRLSELF  600



>ref|NP_187564.1| exocyst subunit exo70 family protein H3 [Arabidopsis thaliana]
 gb|AAF23284.1|AC016661_9 hypothetical protein [Arabidopsis thaliana]
 gb|ABE65931.1| exocyst subunit EXO70 family protein [Arabidopsis thaliana]
 gb|AEE74777.1| exocyst subunit exo70 family protein H3 [Arabidopsis thaliana]
Length=637

 Score =   471 bits (1212),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 271/582 (47%), Positives = 385/582 (66%), Gaps = 23/582 (4%)
 Frame = -2

Query  1826  MERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRS  1647
             + + ++ +  +I KWN E     K  SLF ES+R+A  FVK V+ LQ AM  L  E P S
Sbjct  34    VNKTIDNAAEIIEKWNTEYVSDKKFYSLFCESKRDAKKFVKRVKELQNAMDLLIREDPNS  93

Query  1646  EKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfd  1467
             EKL+RAQNLM++AMKRLQKEF QIL+MNRAHLDPES S+ + +S V++    +  +    
Sbjct  94    EKLLRAQNLMQIAMKRLQKEFLQILSMNRAHLDPESISSRSPTSVVSNDDDVWHESRSAG  153

Query  1466  vddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEA  1287
                           I EVE+VS     +++ I +CMI+ G +KEC   YK IRK I+DE+
Sbjct  154   DS------------IIEVEEVSKNSRTELKSIADCMIAAGCAKECATTYKSIRKSIVDES  201

Query  1286  ISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIR  1107
             I RLGVE +S SK +KM  EV+EL++  W+ A+++++KTLFNGE+TLCD +F S+  ++R
Sbjct  202   IYRLGVENISSSKAKKMPCEVVELKMNRWIEAVKVSMKTLFNGEKTLCDEIFESSV-SLR  260

Query  1106  ESIFKEISKEAAMILFEFPENIAKYAKNS--PEKVFRLLDMYNAIANHRPEIESIFSMDS  933
             E  F++ISKE A++LF FPE I    K +  PEK+F LLDMY  I ++   IE+IFS  S
Sbjct  261   EFCFRDISKEGALLLFGFPETITLRDKKNPHPEKIFPLLDMYCTITDNLLAIEAIFSFPS  320

Query  932   ASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIAD  753
              S++RTQA +SL++L ++I   +  FE+ ++KDSSK+ V GGG+HP+TI AMN+++ +A+
Sbjct  321   ISNVRTQAHSSLSRLSESILAHLMDFESQIRKDSSKTVVRGGGVHPMTISAMNHISRLAE  380

Query  752   HSNVLSDIFSN--TPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAE  579
             +SN L +I     +    K  LP SYF VS+S+ESP+  +  R+AW+IL+LLCK+D  AE
Sbjct  381   YSNALINILKGSSSSSSAKALLPKSYFNVSESEESPVSELKARFAWMILVLLCKIDGKAE  440

Query  578   HYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVI  399
              YKD S+ YLFLANNLQ+VV + R++ +   LG +W++K S KV+Q+A +YERL WG + 
Sbjct  441   MYKDFSMQYLFLANNLQHVVSRARSTNVKHVLGNDWIAKNSEKVRQFARSYERLAWGPLA  500

Query  398   ASLPENPTA---PMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
             +  P   T+    MSPEE    FKKFN +F       S C+V D  L D +++S+ RKLL
Sbjct  501   SMCPAISTSEAVEMSPEEAMMQFKKFNETFESTCEAQSECIVLDPKLLDEMRISIGRKLL  560

Query  227   RPYRDFYDTHK-LTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               YRDFY+ H+   M    E  ++  V++ PED+G+HLS+LF
Sbjct  561   PVYRDFYNAHRNAVMLAGTEGQWN--VRYNPEDIGNHLSELF  600



>ref|XP_009116217.1| PREDICTED: exocyst complex component EXO70B1-like [Brassica rapa]
Length=629

 Score =   470 bits (1209),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 261/580 (45%), Positives = 385/580 (66%), Gaps = 14/580 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S M+ A+E +  +I KW+P      K+ SLF  SR+EA +F+KC R+L+K M FL  
Sbjct  36    FTQSTMDEAIERAEAIIKKWDPNTPSFTKIVSLFNHSRKEAKEFIKCARDLRKTMHFLVS  95

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S KL  AQ LM++AM RL+KEFFQIL+ NR  LDPES S  + +S+ +     +  
Sbjct  96    QDSQSPKLALAQTLMQIAMTRLEKEFFQILSSNRDKLDPESVSGQSSTSTNSEFEDDYDE  155

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               D ++   ++        IT+VE  S+ VM+D++ I ECMISCGY KEC K+YK IRK 
Sbjct  156   DDDDEMKKANES-------ITKVEKASAVVMSDLKAIAECMISCGYGKECVKIYKRIRKS  208

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +S LG+E    S++ + DW  L+  IKNW+ A +I V TLF GE+ LCD+VF+++
Sbjct  209   IVDEGLSLLGIEAYKGSRLHRTDWVTLDHMIKNWIKAAKIGVTTLFRGEKLLCDHVFSAS  268

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              ++ RES F EI+ EAA  LF+FPE +AK  K S E++F L+D+  AI++   +IE IF 
Sbjct  269   -NSTRESCFYEIANEAATNLFKFPEFVAK-EKKSHERIFSLMDLQAAISDLWQDIEMIFH  326

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              DS S +++QA+ SL KL  +I   +  FE+ + KDS+K+   GGGIH LT   M++++S
Sbjct  327   YDSVSGVKSQALMSLQKLKVSIHNALTDFESTVHKDSTKALTPGGGIHKLTRSTMSFISS  386

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             +++HS+VLS+I ++ P      L +SY  + + +E    A+S+ +AWLIL+LLCKLD  A
Sbjct  387   LSEHSSVLSEILADHPLPRNTRLLESYVIMLEEEEHN-HALSVHFAWLILVLLCKLDTKA  445

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTS-RLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             EHYKD+S++YLF+ANNL +++  VR+S  L   LGE+W++K   K+  Y ANYE   W  
Sbjct  446   EHYKDVSLSYLFIANNLHFIIETVRSSDHLRHLLGEDWITKHDDKLSAYVANYEISAWSY  505

Query  404   VIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
             V  SLPE PT  +SPEE K +F++F+++F +A+ K S  VV D  LRD LKVS+A+KL+ 
Sbjct  506   VYMSLPEEPT-ELSPEEAKIYFRRFHSAFEEAYMKQSPRVVPDAKLRDELKVSIAKKLVT  564

Query  224   PYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              YR+FY  + L M  + ER+   +V+F P+++ +++SDLF
Sbjct  565   EYREFYGKY-LPMLGQ-ERNIEMLVRFKPDNLENYISDLF  602



>emb|CDX73400.1| BnaC08g26030D [Brassica napus]
Length=627

 Score =   470 bits (1209),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 262/580 (45%), Positives = 383/580 (66%), Gaps = 17/580 (3%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S M+ A+  +  +I KW+P      K+ SLF  SR+EA +F+KCVR+L+KAM FL  
Sbjct  37    FTQSTMDEAIARAEAIIKKWDPNTPSFTKIVSLFNHSRKEAKEFIKCVRDLRKAMHFLVS  96

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S KL  AQ LM++AM RL+KEFFQIL+ NR  LDPES S  + +S+ +     +  
Sbjct  97    QDSQSPKLALAQTLMQIAMTRLEKEFFQILSSNRDKLDPESVSGQSSTSTNSEFEDDYDD  156

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
                   ++           IT+VE  S+ VM+D++ I ECMISCGY KEC K+YK IRK 
Sbjct  157   DEMKKANES----------ITKVEKASAVVMSDLKAIAECMISCGYGKECIKIYKRIRKS  206

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +S LG+E    S++ + DW  L+  IKNW  A +I V TLF GE+ LCD+VF+++
Sbjct  207   IVDEGLSYLGIEAYKSSRLHRTDWVTLDHMIKNWTKAAKIGVTTLFRGEKLLCDHVFSAS  266

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              ++ RES F EI+ EAA  LF+FPE +AK  K S E++F L+D+  AI+N   +IE IF 
Sbjct  267   -NSTRESCFYEIANEAATNLFKFPEFVAK-EKKSHERIFSLMDLQAAISNLWQDIEMIFH  324

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              DS S +++QA+ SL KL  +I   +  FE+ + KDS+K+   GGGIH LT   M++++S
Sbjct  325   YDSVSGVKSQALMSLEKLKVSIHNALTDFESTVHKDSTKALTPGGGIHKLTRSTMSFISS  384

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             ++++S+VLS+I ++ P      L +SY  + + +E    A+S+ +AWLIL+LLCKLD  A
Sbjct  385   LSENSSVLSEILTDHPLPRNTRLLESYVTMLEEEEHN-HALSVHFAWLILVLLCKLDTKA  443

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTS-RLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             EHYKD+S++YLF+ANNL +++  VR+S  L   LGE+W++K   K+  YAANYE   W  
Sbjct  444   EHYKDVSLSYLFIANNLHFIIETVRSSDHLRHLLGEDWITKHDDKLSAYAANYEISAWSY  503

Query  404   VIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
             V  SLPE PT  +SPEE K +F +F+++F +A+ K S+ VV D  LRD LKVS+A+KL+ 
Sbjct  504   VYMSLPEEPT-ELSPEEAKIYFIRFHSAFEEAYMKQSSRVVPDAKLRDELKVSIAKKLVP  562

Query  224   PYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              YR+FY  + L M  + ER+   +V+F P+++ +++SDLF
Sbjct  563   EYREFYKKY-LPMLGQ-ERNIEMLVRFKPDNLENYISDLF  600



>ref|XP_004240606.1| PREDICTED: exocyst complex component EXO70A1-like [Solanum lycopersicum]
Length=598

 Score =   469 bits (1206),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 262/591 (44%), Positives = 381/591 (64%), Gaps = 44/591 (7%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAA------KVTSLFYESRREANDFVKCVRNLQKA  1680
             F ES+ME  ++ S  +I KW+  AS  +      +V +LF ++  EA   ++ V +LQ A
Sbjct  20    FCESLMEETIQNSQSIINKWDLNASSISTSTSYNRVANLFRDNPLEAKHLLESVNDLQHA  79

Query  1679  MQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvast  1500
             MQF+  ++  S+ LVRA NL+++A+KRLQKEF+ IL+ +   LD E+ S+S  S S    
Sbjct  80    MQFVIKDKSTSKLLVRAHNLIQIAIKRLQKEFYTILSGSSYFLDHETMSSSRTSKSSME-  138

Query  1499  stgfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVY  1320
                                          ++VS  VMAD++ I +CMI+ GY +EC K+Y
Sbjct  139   -----------------------------DEVSESVMADLKAIADCMIAAGYGRECVKLY  169

Query  1319  KDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCD  1140
             K  RK +ID+ +  LG+EK++  +++KMDWE++E +IKNWLS+++IAV  LF GER LC+
Sbjct  170   KVHRKSVIDQTLFYLGIEKLNSYQVQKMDWELMEAKIKNWLSSVKIAVNALFRGERILCN  229

Query  1139  NVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPE  960
              VF+S+ + IR+S F EIS + A+ LF FPE + K+ K SPEK+FR+LDMY  +     E
Sbjct  230   YVFSSSVN-IRDSCFSEISNDGALTLFLFPEMVMKFKKLSPEKMFRVLDMYEILCELWVE  288

Query  959   IESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDA  780
             +ESIF+ DS + ++ QA+ SL+KLGDAIR  +++FE  +QKDSSK  V GGGIHPLT   
Sbjct  289   LESIFTFDSMAVVKAQAMASLSKLGDAIRAMLSEFEIAVQKDSSK-VVVGGGIHPLTRYV  347

Query  779   MNYLTSIADHSNVLSDIFSNTPPIPKDWLPDS-YFAVSDSD-ESPLPAISLRYAWlilll  606
             MNYL  + D+S  +SDI  +  P+    L +S Y + +  D +SP   I +R  WL+L+L
Sbjct  348   MNYLVFLGDYSGAISDIIVDYSPMSIQMLSESCYLSPTSGDGDSPSSPIVVRLTWLVLVL  407

Query  605   lckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANY  426
             LCKLD  A+ YKD+ ++YLFLANNL YVV+KVR S L   LG  W+SK   KVK+Y + Y
Sbjct  408   LCKLDGKAQLYKDVGLSYLFLANNLNYVVLKVRESNLKLLLGSEWISKHEMKVKEYMSKY  467

Query  425   ERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVS  246
             ER GW  V+ S+PEN T  +SP E+K++F KFN+SF + +RK ++ V+ D  LRD +K+S
Sbjct  468   ERTGWSKVVTSIPENLTIEISPSEVKEYFIKFNSSFEEVYRKQTSWVIPDPKLRDHIKIS  527

Query  245   LARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFEPS  93
             LA K++  Y+ FY+ ++  +    E    SIV++AP+D+ ++LSDLF   S
Sbjct  528   LASKIISIYQAFYEMYQGELDIGTE----SIVRYAPDDLQNYLSDLFLGAS  574



>ref|XP_002878021.1| hypothetical protein ARALYDRAFT_485937 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54280.1| hypothetical protein ARALYDRAFT_485937 [Arabidopsis lyrata subsp. 
lyrata]
Length=633

 Score =   469 bits (1208),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 264/581 (45%), Positives = 389/581 (67%), Gaps = 9/581 (2%)
 Frame = -2

Query  1844  HFYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLA  1665
             +F +++ME  +E +  +I KW+P      K+ SLF  SR+EA +F++CVR+L++AM FL 
Sbjct  33    NFTQAMMEETVETAESVIRKWDPNTPSFTKIVSLFNHSRKEAKEFIRCVRDLRRAMHFLV  92

Query  1664  MEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
              +  +S KL  AQNLM++AM RL+KEFFQIL+ NR  LDPES S  +  SS +       
Sbjct  93    SQDSQSPKLALAQNLMQIAMARLEKEFFQILSSNRDKLDPESVSGQSSISSNSEFEDVMG  152

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRK  1305
             S  D + D++      +   IT+VE  S  VM+D++ I E MISCGY KEC K+YK IRK
Sbjct  153   SDDDDESDNEMRKAGES---ITQVEKASVVVMSDLKAIAESMISCGYGKECVKIYKRIRK  209

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              I+D  +S LG+E    S+  ++DW  LE  IKNW+ A +I + TLF GE+ LCD+VF++
Sbjct  210   SIVDGGLSLLGIEIYKGSRFHRIDWVTLEHMIKNWIKAAKIGIATLFRGEKLLCDHVFSA  269

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
             + ++ RES F EI+ EAA+ LF+FPE +AK  K S E++F L+D+  AI++   +IE IF
Sbjct  270   S-NSTRESCFYEIANEAAINLFKFPEFVAK-EKKSHERIFPLMDLQAAISDLWQDIEMIF  327

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
               D+ + +++QA+TSL KL  +I + +  FE+ +QKD++K+   GGGIH LT   MN+++
Sbjct  328   YCDAVAGVKSQALTSLQKLKVSIHSALTDFESTIQKDTTKALTPGGGIHKLTRSTMNFIS  387

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDS-DESPLPAISLRYAWlillllckLDV  588
             S++ +S VLS+IF++ P      L +SY     S DE    A+S+ +AWLIL+LLCKLD 
Sbjct  388   SLSKYSGVLSEIFADHPLPRNTRLLESYVRTPISEDEQHNHALSVHFAWLILVLLCKLDT  447

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AEHYKD+S++YLFLANNLQ ++  VR++ L   LG++WL+K   K+  YA NYE   W 
Sbjct  448   KAEHYKDVSLSYLFLANNLQLIIETVRSTHLRNLLGDDWLNKHEDKLGAYAGNYEIAAWS  507

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
             +V  SLPE PT  +SPEE K +F++F+ +F +A+ K S+ VV +  LRD LKVS+A+KL+
Sbjct  508   NVFMSLPEEPT-DLSPEEAKIYFRRFHTAFEEAYMKQSSRVVPNAKLRDELKVSIAKKLV  566

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               YR+FY  + L M  + ER+   +V+F P+++ +++SDLF
Sbjct  567   PEYREFYRKY-LPMLGQ-ERNIEILVRFKPDNLENYISDLF  605



>ref|XP_010464599.1| PREDICTED: exocyst complex component EXO70B1-like [Camelina sativa]
Length=633

 Score =   469 bits (1208),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 261/584 (45%), Positives = 382/584 (65%), Gaps = 23/584 (4%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQP  1653
             S +++ ++ +  +I KWN E   +    SLF ES+REA  FV+ V+ LQ AM  L  E P
Sbjct  32    SGIDKTIDNAAEIIEKWNTEYVSSNNFYSLFCESKREAKKFVRRVKELQNAMDLLIREDP  91

Query  1652  RSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsd  1473
              S+ L+RAQ LM++AMKRLQKEF QIL+MNRAHLDPES S  + +S V++    +     
Sbjct  92    SSDNLLRAQRLMQIAMKRLQKEFLQILSMNRAHLDPESVSTRSPTSVVSNDEDSWHEYRS  151

Query  1472  fdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIID  1293
                             I EVE+VS     +++ I ECMIS GY+KEC   YK IRK I+D
Sbjct  152   VGDS------------IMEVEEVSKNSRKELKSIAECMISAGYAKECANTYKSIRKSIVD  199

Query  1292  EAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA  1113
             E+I RLGVEK+S SK +KM +EV+EL+ K W+ A+++++KTLF  E+TLCD VF S+  +
Sbjct  200   ESIYRLGVEKISSSKAKKMPYEVVELKTKRWIEAVKVSMKTLFISEKTLCDEVFESSA-S  258

Query  1112  IRESIFKEISKEAAMILFEFPENIAKYAKNSP--EKVFRLLDMYNAIANHRPEIESIFSM  939
             +RES F++ISKE A++LF FPE +    K +P  EK+F LLDMY  I  +   +E+IFS 
Sbjct  259   LRESCFRDISKEGALLLFGFPETVTVRDKKNPQMEKIFPLLDMYCMITENLLAVEAIFSF  318

Query  938   DSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSI  759
              S  ++RTQA  SL +L ++I + +A+FE+ ++KD+SK+ V GGG+HP+TI  M++++ +
Sbjct  319   PSMLAVRTQAHISLTRLSESILSNLAEFESEIRKDTSKTMVPGGGVHPMTISVMDHISRL  378

Query  758   ADHSNVLSDIFSNTPPIPKD--WLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVI  585
             +++S+ L DI + +P    D   LP SYF V++SD SP   + +R+AWLIL+LLCK+D  
Sbjct  379   SEYSSSLMDILNGSPSSSPDKSLLPKSYFNVTESDGSPTSELKVRFAWLILVLLCKIDGK  438

Query  584   AEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             AE YK+ S+ Y+FL NNLQ+VV + R++ L + LG++W++    KVKQ+A +YERL W  
Sbjct  439   AEMYKEFSMQYMFLTNNLQHVVSRARSTNLKQLLGDDWITTHFEKVKQFARSYERLAWDP  498

Query  404   VIASLPENPTAP---MSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
             +++  P   T     MS EE K   +KFN SF +     S CV+ D  L D +++S+ RK
Sbjct  499   LVSMCPTISTCEAVGMSQEEAKMQSEKFNGSFEKTCEAQSECVIPDPKLLDEMRISIRRK  558

Query  233   LLRPYRDFYDTHK-LTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             LL  YRDFY+ H+   M + KE  ++  +++ PED+ + LS+LF
Sbjct  559   LLPIYRDFYNAHRNAVMLRGKEGGWN--IRYTPEDMENRLSELF  600



>ref|XP_004307455.1| PREDICTED: uncharacterized protein LOC101293927 [Fragaria vesca 
subsp. vesca]
Length=642

 Score =   470 bits (1209),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 269/580 (46%), Positives = 391/580 (67%), Gaps = 13/580 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F  S+ME  +E +  +I KW+P +S   KVT +F +SR+EA +++K V+ L+ AM  L  
Sbjct  53    FSLSMMEENIENAEAVITKWDPSSSSYTKVTFIFQQSRKEAKEYLKAVKTLRSAMHVLLG  112

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E+  S K+V AQNLM++AMKRL+KEF+QIL+ +R  LDPES S  + S S          
Sbjct  113   ERFPSSKIVIAQNLMQLAMKRLEKEFYQILSASRDQLDPESVSNRSSSRSSKFYDEEAEG  172

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
              SD ++D   +        ITEVE  S   M+D++ I +CMIS GY KEC K+Y+ IRK 
Sbjct  173   RSDDELDIAGES-------ITEVERASVLAMSDLKSIADCMISSGYGKECAKIYRIIRKS  225

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             IIDE +  LG+++   S I+KMD + L+  IK W+ A +IAVKTLF GE+ LCD+VFA++
Sbjct  226   IIDEGLYHLGIQRFKSSHIQKMDSQALDNEIKKWMKAAKIAVKTLFQGEKILCDHVFAAS  285

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              + I+ES F EI+KE A  LF FPE + K  K S E++F L++++ A+++  PE E++F 
Sbjct  286   -ETIKESCFYEITKEGATTLFSFPELLVKTKKVS-ERIFGLMELHEAVSDLWPETEAVFC  343

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              +S S  + QA++ L KLGD++R+ ++ FE+ +QKDS+K  V GGG+HPLT   MNYLTS
Sbjct  344   SESTSGSKLQALSLLLKLGDSVRSILSDFESTIQKDSTKILVPGGGVHPLTQKVMNYLTS  403

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             +AD+S +L DI ++ PP       ++ F  S  DE   PA+S+  AWLIL+LLCKLD+ A
Sbjct  404   LADYSIILCDILADYPPPANSSFHETSFKSSMPDEGSTPAVSVHLAWLILVLLCKLDIKA  463

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTS-RLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             E YKD+ +AYLFLANNL ++V KV+ S  L   LGE W+++   KVK YA+ YE   W  
Sbjct  464   EIYKDVGLAYLFLANNLHFIVEKVQQSPNLKLLLGEEWVAEHMKKVKLYASTYEITAWTK  523

Query  404   VIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
             V++SLPE  +  MS E  K+ F++FN +F +A+RK ++ +V DR LRD LKVS+A+KL+ 
Sbjct  524   VLSSLPEK-SFEMSTEMAKECFRRFNIAFEEAYRKQTSWIVQDRKLRDDLKVSIAQKLVP  582

Query  224   PYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              Y++FYDT+ + + +EK  +   +V+F+P+D+G++LSDLF
Sbjct  583   TYQEFYDTYMVMLTEEK--NLELLVRFSPDDLGNYLSDLF  620



>ref|XP_006407668.1| hypothetical protein EUTSA_v10020272mg [Eutrema salsugineum]
 gb|ESQ49121.1| hypothetical protein EUTSA_v10020272mg [Eutrema salsugineum]
Length=641

 Score =   469 bits (1208),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 272/583 (47%), Positives = 389/583 (67%), Gaps = 22/583 (4%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQP  1653
             S ++R ++ +  +I KWN E   A K  SLF ES+REA  FV+ V+ LQ AM  L  E P
Sbjct  36    SEIDRTIDNAAEIIEKWNTEYVSATKFYSLFCESKREAKKFVRRVKELQNAMDSLIREDP  95

Query  1652  RSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsd  1473
              SE L+RAQ LM++AMKRLQ EF QIL+MNRAHLDPES S+ + +S V++    +  +  
Sbjct  96    NSENLLRAQKLMQIAMKRLQNEFQQILSMNRAHLDPESVSSRSPTSVVSNEDDVWHESRP  155

Query  1472  fdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIID  1293
                             I EVE+VS     +++ I ECMI+ GY+KEC   +K IRK I+D
Sbjct  156   AGDS------------IVEVEEVSKNSTTELKSIAECMIAAGYAKECATTFKSIRKSIVD  203

Query  1292  EAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA  1113
             E I RLGVEK+S SK +KM  EV+EL++K+W+ A++++ KTLF+GE+TLCD VF S+  +
Sbjct  204   EGIYRLGVEKISSSKAKKMPCEVIELKMKSWVEAVKVSTKTLFDGEKTLCDEVFESSV-S  262

Query  1112  IRESIFKEISKEAAMILFEFPENIAKYAKN--SPEKVFRLLDMYNAIANHRPEIESIFSM  939
             +RES F+EI+KE A++LF FP+ +A   K   +P+K+F LLDMY  I  + P IESIFS 
Sbjct  263   LRESCFREITKEGALLLFGFPDIVAVRDKKNPNPDKIFPLLDMYRTITENLPAIESIFSS  322

Query  938   DSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSI  759
              S SS+R+QA  SL +L ++I + +  FE+ ++KDSSK+ V GGG+HP+TI AM+YL+ +
Sbjct  323   PSLSSVRSQAHNSLNRLSESIISHLLDFESEIRKDSSKTVVTGGGVHPMTISAMDYLSRL  382

Query  758   ADHSNVLSDIF-SNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             AD+S+ L  I   ++    K  LP SYF  S+SD SP   + +R+AW+IL+LLCK+D  +
Sbjct  383   ADYSSSLVTILDGSSSSSAKPLLPKSYFNASESDGSPASEVRVRFAWMILVLLCKIDGKS  442

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
             E YK+ S+ YLFLANNLQ+V  + R++ L + LG++W+++   KV+Q+A +YERL WG +
Sbjct  443   EMYKEFSMQYLFLANNLQHVASRARSTCLKQLLGDDWIARHFEKVRQFAKSYERLAWGPL  502

Query  401   IASLPENPTA---PMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKL  231
              +  P+  T+    +SPEE K  F+KFN SF  A    S CVV D  LR+ ++VS+ +KL
Sbjct  503   SSLCPDISTSEAVEISPEEAKIQFEKFNESFESACESQSVCVVPDPKLREEMRVSIGKKL  562

Query  230   LRPYRDFYDTHK-LTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             L  YRDFY+ H+   M    E  ++  V++ PED+G+ LS+LF
Sbjct  563   LPVYRDFYNAHRNAAMLAGTEGGWN--VRYTPEDIGNQLSELF  603



>ref|XP_003606598.1| Exocyst complex component [Medicago truncatula]
Length=721

 Score =   471 bits (1212),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 278/623 (45%), Positives = 395/623 (63%), Gaps = 31/623 (5%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEAA  1758
             MPRKGMR I F P   SSS+    S    +  F +S+ME  +  +  +I KW+   +   
Sbjct  1     MPRKGMRSIFFHPTPPSSSTLPSPSSPHHTFTFSDSLMEENILTAESLITKWDYSNTNQI  60

Query  1757  KVTSLFY-ESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFF  1581
              +  LF   +R EA  ++  V+ LQ AMQ+       S  LVRAQ LM++AMK LQKEF+
Sbjct  61    -INPLFSGNTRFEAKHYLNAVKGLQSAMQYFVTHDSTSNTLVRAQFLMQLAMKTLQKEFY  119

Query  1580  QILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVS  1401
              IL+ NR HLDPES S  + +   +S S         D +      +     I+E E VS
Sbjct  120   NILSTNREHLDPESVSNRSSTDRRSSFSVSDYDDEVSDDEKFVVGNQ-----ISETERVS  174

Query  1400  SFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVL  1221
                MAD++ I +CMI+CGY KEC KVY  +RK I+DEA+  LG+E+++FS+I+KMDWEV+
Sbjct  175   MLAMADLKAIADCMINCGYGKECVKVYIVMRKSIVDEALYHLGIERLTFSQIQKMDWEVI  234

Query  1220  ELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENI  1041
             EL+IK WL A+++AV+TLF+GER LCD+VFA+    I ES F EI+KE A  LF FP+ +
Sbjct  235   ELKIKTWLKAVKVAVRTLFHGERILCDDVFAAAGKRIAESCFAEITKEGATSLFTFPDMV  294

Query  1040  AKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIA  861
             AK  K +PEK+FR LD+Y AI++H  +I+SIFS +S S++R QA+ S+ KL +A++T + 
Sbjct  295   AK-CKKTPEKMFRTLDLYEAISDHFQQIQSIFSFESTSNVRLQAINSMEKLAEAVKTMLK  353

Query  860   QFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSY  681
             +FE+ +QKDSSK  V+GGG+HPLT   MNYLT +AD+  +L+DI  + P  P   LP+SY
Sbjct  354   EFESAIQKDSSKKQVSGGGVHPLTRYVMNYLTFLADYGGILADIVFDMPQSP---LPESY  410

Query  680   F--------AVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQY  525
             +        + S S  S    IS + AWLIL+LLCKLD  AE YKD++++YLFLANN+QY
Sbjct  411   YRSPMRSENSSSSSSSSSSSEISEKIAWLILVLLCKLDTKAEFYKDVALSYLFLANNMQY  470

Query  524   VVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLP--ENPTAPMSPEEI  351
             VVVKVR S L   LGE WL+    KVK+Y   + ++GW  V+++LP  EN TA  + E++
Sbjct  471   VVVKVRRSNLGFLLGEEWLTNHELKVKEYVNKFVQIGWNKVLSTLPENENSTAEKTVEQV  530

Query  350   KQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKE  171
             K  F KFNA+F +  +K ++ +VSD  LRD +K  +  KL+  Y  FY+ +++       
Sbjct  531   KAIFVKFNAAFDEECKKQTSWIVSDPRLRDEIKALIGSKLVAKYGGFYEKNRV-------  583

Query  170   RHFSSIVKFAPEDVGHHLSDLFF  102
                 S V++ PE +  +L ++ +
Sbjct  584   ---GSGVRYEPEYIESYLGNILY  603



>ref|XP_010504360.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=633

 Score =   468 bits (1204),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 265/580 (46%), Positives = 388/580 (67%), Gaps = 9/580 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S++E  +E +  +I KW+P      K+ SLF  SRREA +F++CVR+L++AM FL  
Sbjct  34    FTQSMVEETMEKAESVIRKWDPHTPSFTKIVSLFNHSRREAKEFIRCVRDLRRAMHFLVS  93

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E  +S KL  AQ LM++AM RL+KEFFQIL+ NR  LDPES S  + +SS +       S
Sbjct  94    EDSQSPKLALAQTLMQIAMARLEKEFFQILSSNRDKLDPESVSGQSSTSSNSEFEDFMGS  153

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               D+D D++      +   IT+VE  ++ VM+D++ I E MISCGY KEC K+YK IRK 
Sbjct  154   DDDYDSDNELRKAGES---ITKVEKAAAVVMSDLKAIAESMISCGYGKECVKIYKRIRKS  210

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +S LG+E    S+  KMDW  LE  IKNW+ A +I + TLF GE+ LCD+VF+++
Sbjct  211   IVDEGLSLLGIEIYKGSRFHKMDWVTLEHMIKNWIKAAKIGIATLFRGEKLLCDHVFSAS  270

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              ++ RES F EI+ EAA  LF+FPE +AK  K S E++F L+D+  AI++   +IE IF 
Sbjct  271   -NSTRESCFYEIANEAATNLFKFPEFVAK-EKKSHERIFPLMDLQAAISDLWQDIEMIFH  328

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              D+ + +++QA+T+L KL  +I   + +FE+ +QKDS+K+   GGG+H LT   M++++S
Sbjct  329   FDAVAGVKSQALTTLQKLKVSIHNALTEFESTIQKDSTKALTTGGGVHKLTRSTMSFISS  388

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDS-DESPLPAISLRYAWlillllckLDVI  585
             ++ +S VLS+I ++ P      L +SY     S DE    A+S+ +AWLIL LLCKLD  
Sbjct  389   LSKYSCVLSEILADHPIQRDTRLLESYVRTPISEDEQQNHALSVHFAWLILALLCKLDTK  448

Query  584   AEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             AEHYKD+S++YLFLANNLQ ++  VR+++L   LG++WL+    K+  YA NYE   W +
Sbjct  449   AEHYKDVSLSYLFLANNLQLIIETVRSTQLRDLLGDDWLTNHDDKLSAYAGNYEIAAWSN  508

Query  404   VIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
             V  SLPE PT  +SPEE K +F++F+ +F +A+ K S+ VV D  LRD LKVS+A+KL+ 
Sbjct  509   VFMSLPEEPT-DLSPEEAKIYFRRFHTAFEEAYMKQSSRVVPDAKLRDELKVSIAKKLVP  567

Query  224   PYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              YR+FY  + L M  + ER+   +V+F P+++ +++SDLF
Sbjct  568   EYREFYRKY-LPMLGQ-ERNTEILVRFKPDNLENYISDLF  605



>ref|XP_006366926.1| PREDICTED: uncharacterized protein LOC102580853 [Solanum tuberosum]
Length=570

 Score =   466 bits (1198),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 258/578 (45%), Positives = 373/578 (65%), Gaps = 40/578 (7%)
 Frame = -2

Query  1826  MERALEISGPMIMKWNPEASEAA--KVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQP  1653
             ME  ++ S  +I KW+ +++  +  +V +LF ++  +A   ++ V +LQ AMQF+  ++ 
Sbjct  1     MEETIQNSQSIIKKWDLDSTSTSYNRVANLFRDNPLDAKRLLESVNDLQHAMQFVIKDKS  60

Query  1652  RSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsd  1473
              S+ LVRA NL+++A+KRLQKEF+ IL+ +   LD E+ S+S  S S             
Sbjct  61    TSKLLVRAHNLIQIAIKRLQKEFYTILSGSSYFLDHETVSSSRASKSSME----------  110

Query  1472  fdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIID  1293
                                 ++VS  VMAD++ I +CMI  GY +EC K+YK  RK +ID
Sbjct  111   --------------------DEVSESVMADLKAIADCMIGAGYGRECVKLYKVNRKSVID  150

Query  1292  EAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA  1113
             E +  LG+EK++  +++KMDWE++E++IKNWLS+++IAV  LF GER LCD VF+S+ + 
Sbjct  151   ETLFYLGIEKLNSYQVQKMDWELMEMKIKNWLSSVKIAVNALFRGERILCDYVFSSSVN-  209

Query  1112  IRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDS  933
             IR+S F EI+ + A+ LF FPE + K+ K SPEK+FR+LD+Y  I     E+ESIF+ DS
Sbjct  210   IRDSCFSEIANDGALTLFVFPEMVMKFKKLSPEKMFRVLDIYEIICELWVELESIFTFDS  269

Query  932   ASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIAD  753
              + ++ QA+ SL KLGDAIR  ++ FET +QKDSSK  V GGGIHPLT   MN+L  + D
Sbjct  270   MAVVKAQAMASLGKLGDAIRAMLSAFETAVQKDSSK-VVLGGGIHPLTRYVMNFLVFLGD  328

Query  752   HSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllckLDVIAE  579
             +S  +SDI  +  P+    L +S +    S   +SP   I +R  WL+L+LLCKLD  A+
Sbjct  329   YSGAISDIVVDCSPMSIQMLSESCYLSPTSGDGDSPSSPIVVRLTWLVLVLLCKLDGKAQ  388

Query  578   HYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVI  399
              YKD+ ++YLFLANNL YVV+KVR S L   LG  W+SK   KVK+Y + YER GW  V+
Sbjct  389   LYKDVGLSYLFLANNLNYVVLKVRESNLKLLLGSEWISKHEMKVKEYMSKYERTGWSKVV  448

Query  398   ASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPY  219
              S+PEN T  MS  E+K+ F KFN+SF + +RK S+ V+ D  LRD +K+SLA K++  Y
Sbjct  449   TSIPENLTTEMSSSEVKECFIKFNSSFEEVYRKQSSWVIPDPKLRDHVKISLASKIISIY  508

Query  218   RDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             + FY+T++  +    E    SIV+FAP+D+ ++LSDLF
Sbjct  509   QAFYETYRGELDIGTE----SIVRFAPDDLQNYLSDLF  542



>emb|CDY02916.1| BnaC04g25700D [Brassica napus]
Length=633

 Score =   467 bits (1201),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 264/581 (45%), Positives = 381/581 (66%), Gaps = 13/581 (2%)
 Frame = -2

Query  1844  HFYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLA  1665
             +F +S ME A+E +  +I KW+P      K+ SLF  SR+EA +F+ CVR+L+KAM FL 
Sbjct  36    NFTQSSMEEAVERAEAVIRKWDPNTPSFTKIVSLFNHSRKEAKEFIICVRDLRKAMHFLV  95

Query  1664  MEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
              +  +S KL  AQ LM++AM RL+KEFFQIL+ NR  LDPES S  +  SS +       
Sbjct  96    SQDSQSPKLALAQTLMQIAMTRLEKEFFQILSSNRDKLDPESVSGQSSISSNSEFEDIMQ  155

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRK  1305
             S  + ++    +        IT+VE  S+ VM+D++ I E MISCGY KEC K+YK IRK
Sbjct  156   SDDEDEIKKAGES-------ITQVEKASAVVMSDLKAIAESMISCGYGKECIKIYKRIRK  208

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              I+DE +S LG+E    S+  + DW  LE  IKNW+ A +I V TLF GE+ LCD+VF++
Sbjct  209   SIVDEGMSLLGIEPYKGSRFHRTDWVTLEHMIKNWIRAAKIGVATLFRGEKLLCDHVFSA  268

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
             + ++ RES F EI+ EAA  LF+FPE +AK  K S E++F L+D+  AI++   EIE  F
Sbjct  269   S-NSTRESCFYEIAYEAATNLFKFPEFVAK-EKKSHERIFSLMDLQAAISDLWQEIEMTF  326

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
                S + +++QA++SL KL  +I + +  FE+ + KDS+K+   GGG+H LT   M++++
Sbjct  327   HFGSVAGVKSQALSSLQKLKVSIHSALVDFESTIHKDSTKALTPGGGVHKLTRSTMSFIS  386

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYFAVS-DSDESPLPAISLRYAWlillllckLDV  588
             S++ HS VLS+I ++ P        +SY       DE    A+S+ +AWLIL+LLCKLD 
Sbjct  387   SLSKHSRVLSEIIADHPLPRNTGSLESYIRTPVTEDEERNHALSVHFAWLILVLLCKLDT  446

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AEHYKD+S++YLFLANNL +++  VR++     LGE+WL+K S K+  YAANYE   W 
Sbjct  447   KAEHYKDVSLSYLFLANNLHFIIETVRSTHPRDLLGEDWLTKHSDKLNAYAANYEIAAWS  506

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
             +V  SLPE PT  +SPEE K +F++F+ +F +A+ K S+ VVSD  LRD LKVS+A+KL+
Sbjct  507   NVYMSLPEEPT-DLSPEEAKTYFRRFHTAFEEAYMKQSSRVVSDAKLRDGLKVSIAKKLV  565

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               YR+FY  + L M  + ER+   +V+F P+++ +++SDLF
Sbjct  566   PEYREFYRKY-LPMLGQ-ERNIEMLVRFKPDNLENYISDLF  604



>ref|XP_006400924.1| hypothetical protein EUTSA_v10016083mg [Eutrema salsugineum]
 gb|ESQ42377.1| hypothetical protein EUTSA_v10016083mg [Eutrema salsugineum]
Length=630

 Score =   467 bits (1201),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 269/604 (45%), Positives = 388/604 (64%), Gaps = 56/604 (9%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             ES ++  +     +I KW   +S ++        SRREA +FV  V++LQ  M  L    
Sbjct  24    ESAVQECMSNINTVISKWTSSSSSSSDEFLFSTNSRREAEEFVLAVKHLQSTMHRLVSVN  83

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
             P SEKLV AQNLM+ AMK L+ EF ++LN NR +LDPES S  +  SS  STST  S   
Sbjct  84    PSSEKLVFAQNLMQSAMKLLESEFHRVLNANREYLDPESVSVRSYRSSRFSTSTATS---  140

Query  1475  dfdvddddddvrvagdSITEVEDVSSF---------------VMADMRLIVECMISCGYS  1341
                              +++ ED S++                M D+++I +CMIS GY+
Sbjct  141   -----------------VSDSEDESTYEENADDHRFSGGDSDAMDDLKMIADCMISTGYA  183

Query  1340  KECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFN  1161
             KEC  VYK +R+ I+DE +  L VE+ +  +I+KMDWEVLE +IK+WL A+++AV++LF 
Sbjct  184   KECVTVYKSVRRSIVDETLHNLAVERFTLHQIQKMDWEVLESKIKSWLRAVKLAVRSLFF  243

Query  1160  GERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNA  981
             GER L D+VF+S+ + I ES F +I++E A+ LF FPEN  K  K +PEK+FR LDMY +
Sbjct  244   GERILADHVFSSSTN-IVESSFTDITQEGALTLFAFPENAGKIKKLTPEKMFRFLDMYES  302

Query  980   IANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGI  801
             +AN   EIESIF  DSA+++R+Q + SLA+LG+A R+ +  FE+ +QK++SK+ + GGG+
Sbjct  303   LANLFVEIESIFYFDSAAAVRSQVINSLARLGEAARSMMTDFESAIQKETSKTPIIGGGV  362

Query  800   HPLTIDAMNYLTSIADHSNVLSDIFSN---TPPIPKDWLPDSYFAVSDSDE--------S  654
             HPLT   MNYL+ +AD+S  ++ IF N   + P P   LPDS F +S  DE        S
Sbjct  363   HPLTRYVMNYLSFLADYSESIAAIFENWKLSVPSP---LPDSLF-ISGGDEAHPQDLYSS  418

Query  653   PLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGEN  474
             P   +S+R AW+ILL LCK+D  A+ YKD++++YLFL NNLQYVVVKVR+S L   LG++
Sbjct  419   P---VSVRIAWVILLTLCKIDGKAQPYKDVALSYLFLTNNLQYVVVKVRSSNLKLLLGDD  475

Query  473   WLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHS  294
             WL++  AKV QYA  +E+L WG V+ SLPENP   +SPEE ++ F +FN  F  ++RK  
Sbjct  476   WLARHEAKVNQYADKFEKLAWGKVLTSLPENPAEEISPEEARELFTRFNDEFEASYRKQI  535

Query  293   ACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLS  114
             + V+ D  LRD +K+SL++KL+    +FY+ +++ +  +    FS  V++ PED+G++LS
Sbjct  536   SWVIPDPKLRDQIKISLSQKLMLVCTEFYEINRVGLVGDTFNGFS--VRYTPEDIGNYLS  593

Query  113   DLFF  102
             DL+F
Sbjct  594   DLYF  597



>emb|CDY40204.1| BnaA09g34860D [Brassica napus]
Length=624

 Score =   466 bits (1199),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 260/580 (45%), Positives = 381/580 (66%), Gaps = 17/580 (3%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S M+ A+  +  +I KW+P      K+ SLF  SR+EA +F+KCVR+L+KAM FL  
Sbjct  37    FTQSTMDEAIARAEAIIKKWDPNTPSFTKIVSLFNHSRKEAKEFIKCVRDLRKAMHFLVS  96

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S KL  AQ LM++AM RL+KEFFQIL+ NR  LDPES S  + +S+ +     +  
Sbjct  97    QDSQSPKLALAQTLMQIAMTRLEKEFFQILSSNRDKLDPESVSGQSSTSTNSEFEDDYDD  156

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
                   ++           IT+VE  S+ VM+D++ I ECMISCGY KEC K+YK IRK 
Sbjct  157   DEMKKANES----------ITKVEKASAVVMSDLKAIAECMISCGYGKECVKIYKRIRKS  206

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +S LG+E    S++ + DW  L+  IKNW  A +I V TLF GE+ LCD+VF+++
Sbjct  207   IVDEGLSLLGIEAYKGSRLHRTDWVTLDHMIKNWTKAAKIGVTTLFRGEKFLCDHVFSAS  266

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              ++ RES F EI+ EAA  LF+FPE +AK  K S E++F L+++  AI++   +IE IF 
Sbjct  267   -NSTRESCFYEIANEAATNLFKFPEFVAK-EKKSHERIFSLMNLQAAISDLWQDIEMIFH  324

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              DS S +++QA+ SL KL  +I   +  FE+ + KDS+K+   GGGIH L    MN+++S
Sbjct  325   YDSVSGVKSQALMSLQKLKVSIHNALTDFESTVHKDSTKALTPGGGIHKLARTTMNFISS  384

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             +++HS+VLS+I ++ P      L +SY  + + +E    A+S+ +AWLIL+LLCKLD  A
Sbjct  385   LSEHSSVLSEILADHPLPRNTRLLESYVIMLEEEEHN-HALSVHFAWLILVLLCKLDTKA  443

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTS-RLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             EHYKD+S++YLF+ANNL +++  VR+S  L   LGE+W++K   K+  Y ANYE   W  
Sbjct  444   EHYKDVSLSYLFIANNLHFIIETVRSSDHLRHLLGEDWITKHDDKLSAYVANYEISAWSY  503

Query  404   VIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
             V  SLPE PT  +SPEE K +F++F+++F +A+ K S  VV D  LRD LKVS+A+KL+ 
Sbjct  504   VYMSLPEEPT-ELSPEEAKIYFRRFHSAFEEAYMKQSPRVVPDAKLRDELKVSIAKKLVP  562

Query  224   PYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              YR+FY  + L M  + ER+   +V+F P+++ +++SDLF
Sbjct  563   EYREFYGKY-LPMLGQ-ERNIEMLVRFKPDNLENYISDLF  600



>gb|KDO72993.1| hypothetical protein CISIN_1g009180mg [Citrus sinensis]
Length=541

 Score =   463 bits (1191),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 252/506 (50%), Positives = 353/506 (70%), Gaps = 8/506 (2%)
 Frame = -2

Query  1619  MEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvr  1440
             M+ AMKRL++EF+Q+L +N  +LD ES S S+  +S AS S               DD  
Sbjct  1     MQTAMKRLEREFYQMLKINGEYLDHESVSVSSSRASRASFSDLEDYEVSETESRISDDA-  59

Query  1439  vagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKM  1260
                  I+E+E VS+  MAD++ I +CMIS GY KEC ++YK IRK ++DEA+  LGVE++
Sbjct  60    -----ISEMERVSTAAMADLKAIADCMISAGYGKECARIYKIIRKSVVDEALYHLGVERL  114

Query  1259  SFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA-IRESIFKEIS  1083
             +F+ I+KMDW+VLE++IKNWL A+  AVKT+F GER LCD VF+    A IR S F +I 
Sbjct  115   NFNVIQKMDWDVLEIKIKNWLRAVRTAVKTVFAGERILCDTVFSGPSSASIRVSCFSQIV  174

Query  1082  KEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVT  903
             KE A+ L  FPEN+AK  K +PEK+FR LD+Y AI++  P+I SIFS +S S++R+QA  
Sbjct  175   KEGALDLLVFPENVAK-CKKTPEKMFRTLDLYEAISDLSPDIASIFSFESTSAVRSQAAN  233

Query  902   SLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFS  723
             SL +LG+A+RT +A FE  + KD+SK+ V GGG+HPLT   MNY+  +AD+S  L++I +
Sbjct  234   SLIRLGEAVRTMLADFEAAIHKDTSKTPVPGGGVHPLTRYVMNYIAFLADYSGSLAEIDA  293

Query  722   NTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFL  543
               P      LP++YF   +S +S    I++R AWLIL++LCKLD  AE YK+++ +YLFL
Sbjct  294   EWPLTSNSPLPEAYFGSPESSDSISSPIAVRLAWLILVVLCKLDGKAELYKEVAQSYLFL  353

Query  542   ANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMS  363
             ANNLQYVVVKVR+S L   LGE W+ K  AKV+QYAANYER+GW  V ASLPENPTA + 
Sbjct  354   ANNLQYVVVKVRSSNLKFLLGEEWIVKHEAKVRQYAANYERMGWDKVFASLPENPTAEIP  413

Query  362   PEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMP  183
               +++  F++FN SF    ++HS+ +VSD  LRD +K+SLA+++   YRDFY+ +++ + 
Sbjct  414   IPQVRNCFRRFNLSFEDTCKRHSSWIVSDPKLRDEIKISLAKRIAPVYRDFYEKYRVRVL  473

Query  182   KEKERHFSSIVKFAPEDVGHHLSDLF  105
             ++       +V+FAP+D+G+HLSDLF
Sbjct  474   RDPSTGNEPLVRFAPDDLGNHLSDLF  499



>emb|CDY44645.1| BnaC04g06170D [Brassica napus]
Length=644

 Score =   466 bits (1199),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 260/585 (44%), Positives = 386/585 (66%), Gaps = 12/585 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+ME ALE +  +I KW+P+A    K+ SLF  SR++A +F++CVR+L++AM FL  
Sbjct  36    FSQSMMEEALESAESIIKKWDPKAQSYTKIISLFRHSRKQAKEFIRCVRDLRRAMHFLVS  95

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S+KLV AQ+LM++ M  L+KEFFQIL+ NR HLDP+S+S  +  SS +        
Sbjct  96    QDSKSDKLVLAQSLMQIGMSTLEKEFFQILSSNRDHLDPDSASGQSTISSNSEFEVYMEY  155

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               D D DD+      +   I++VE  S+ VM+D+++I E MISCGY KEC K YK IRK 
Sbjct  156   DEDEDDDDELKKAGES---ISQVEKASAMVMSDLKVIAETMISCGYGKECIKSYKLIRKS  212

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  LG+EK+  S   KMDW VLE  IKNW+ A +I V TLF GE+ LCD+VF+++
Sbjct  213   IVDEGLHLLGIEKVKTSHFHKMDWGVLEHMIKNWIKAAKIGVTTLFKGEKLLCDHVFSAS  272

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAK--NSPEKVFRLLDMYNAIANHRPEIESI  948
                I +S F +I+KEA + LF  PE +A   K  +  E++F+L+D+Y AI++  P+IE I
Sbjct  273   L-TIGQSCFNQIAKEAGLNLFMLPELVAYKEKKQHHHERIFKLMDLYAAISDLWPDIEMI  331

Query  947   FSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYL  768
             FS DS +S++T  +++L KL D+I T + +FE ++ KDSSK     GG+H LT   M++L
Sbjct  332   FSFDSLASVKTLVLSTLKKLKDSIHTCLKEFEKMIHKDSSKELSPEGGVHKLTRTTMSFL  391

Query  767   TSIADHS--NVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllc  600
             + ++++S  +VLS+I +  P      L +SYF   + + +     A S+  AWLIL+ LC
Sbjct  392   SLLSEYSRVHVLSEILTEHPLKTNTRLLESYFTAPILEDEHVNNHACSVHLAWLILVFLC  451

Query  599   kLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYER  420
             KLD  AE Y D+S++Y+FL NN+Q+V   VR+S L   LG++WL+K  AK+K YA  YE+
Sbjct  452   KLDTKAESYNDVSLSYIFLVNNMQFVADTVRSSHLKNLLGDDWLTKHEAKLKSYAEKYEK  511

Query  419   LGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLA  240
               W +V+ SLP   +A +SP E    FK+F+A+FA A+ K S+CV+ D  LRD LKVS+ 
Sbjct  512   TAWANVLVSLPAKTSAKLSPVEATTCFKRFHAAFAGAYLKQSSCVIVDAKLRDELKVSIV  571

Query  239   RKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +KL+  YR+FY  + L M ++ +R+   +V F P+++ ++LSDLF
Sbjct  572   KKLVPEYREFYVKY-LPMLRQ-DRNIEMLVSFKPDNLENYLSDLF  614



>ref|XP_006350742.1| PREDICTED: exocyst complex component 7-like [Solanum tuberosum]
Length=624

 Score =   465 bits (1196),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 271/582 (47%), Positives = 377/582 (65%), Gaps = 16/582 (3%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +++ME  L+ +  +I +W+ + S     ++LF ++R EA  F+  V +LQ AMQF+  
Sbjct  25    FSDTLMEDTLKNAEEIIKRWDLDESS----SNLFQDNRTEAKQFLDAVIDLQHAMQFVVK  80

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E   S+ LVRAQNLM++AMKRLQKEF+ IL  NR  LD ES S  +   S +    G   
Sbjct  81    ESSTSQLLVRAQNLMKIAMKRLQKEFYTILAGNRYFLDSESGSRESTRYSGSDEDQGSED  140

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
              +        +          E E VS  V  D++ I +CMI  GY KEC K+Y+  RK 
Sbjct  141   DNAEIEARFAEISIT-----DEGEKVS--VAVDLKAIADCMIEAGYGKECSKIYELNRKS  193

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             +I+E +  LGVE +  S ++KMDW+ LE +IK WL+A+++AV TLF GER LCD VF S 
Sbjct  194   VIEETLYYLGVENICPSTVQKMDWKDLEKKIKIWLNAVKVAVSTLFYGERILCDQVF-SI  252

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              D+IRES F  I+K++A+ LF FPE +AKY K S EK+FR+LD+Y++I+    EIE IF 
Sbjct  253   SDSIRESCFTGIAKDSALTLFTFPEMVAKYKKLSLEKMFRILDLYDSISELLSEIEVIFG  312

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              DS  ++++QA+TS+AKL DA R  +A+FE+ ++KDSSK  VAGGGIHPLT   MNYL  
Sbjct  313   FDSTVAVKSQALTSMAKLRDAARAMLAEFESAIKKDSSK-VVAGGGIHPLTRYVMNYLIF  371

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYF--AVSDSDESPLPAISLRYAWlillllckLDV  588
             ++D+S  +SDI ++   + K  LP+SY    ++D  ESP   +S+R  WLIL+LLCKLD 
Sbjct  372   LSDYSGPVSDIIADWKAVVKSPLPESYLLSPIADDGESPSCIVSVRLTWLILVLLCKLDG  431

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              A  Y D+ ++YLFLANNL YVV KVR S L   LG +WLS   +KV+QY AN++R+GW 
Sbjct  432   KAGFYGDVPLSYLFLANNLNYVVSKVRQSSLKLLLGPDWLSNHESKVEQYMANFKRMGWS  491

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
              V+ SLPEN TA +SP E K+ F KF+ SF + + K  + V+ D  LRD +K+SLA+K+L
Sbjct  492   SVMTSLPENSTAEISPAEAKECFCKFSLSFEETYWKQRSWVIPDPKLRDEVKISLAKKIL  551

Query  227   RPYRDFYDTHKLTMP-KEKERHFSSIVKFAPEDVGHHLSDLF  105
               YR FY  +   +   E      SI++FAP++V ++LSDLF
Sbjct  552   SAYRPFYHKYGEKVAWMESGGGVESILRFAPDNVQNYLSDLF  593



>emb|CAB75749.1| putative protein [Arabidopsis thaliana]
Length=633

 Score =   464 bits (1195),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 261/581 (45%), Positives = 387/581 (67%), Gaps = 9/581 (2%)
 Frame = -2

Query  1844  HFYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLA  1665
             +F +++ME  +E +  +I KW+P      K+ SLF  SR+EA +F++CVR+L++AM FL 
Sbjct  33    NFTQAMMEETVETADSVIRKWDPNTPSFTKIVSLFNHSRKEAKEFIRCVRDLRRAMHFLV  92

Query  1664  MEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
              +  +S KL  AQ LM++AM RL+KEFFQIL+ NR  LDPES S  +  SS +       
Sbjct  93    SQDSQSPKLALAQTLMQIAMARLEKEFFQILSSNRDKLDPESVSGQSSISSNSEFEDVMG  152

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRK  1305
             S  D + D++      +   IT+VE  S+ VM+D++ I E MISCGY KEC K+YK +RK
Sbjct  153   SDDDDESDNEMRKAGES---ITQVEKASAMVMSDLKAIAESMISCGYGKECVKIYKRVRK  209

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              I+DE +S LG+E    S+  + DW  LE  IKNW+ A +I + TLF GE+ LCD+VF++
Sbjct  210   SIVDEGLSLLGIEIYKGSRFHRTDWVTLEHMIKNWIKAAKIGIATLFRGEKLLCDHVFSA  269

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
             + ++ RES F EI+ EAA  LF+FPE +AK  K S E++F L+D+  AI++   +IE IF
Sbjct  270   S-NSTRESCFYEIANEAATNLFKFPEFVAK-EKKSHERIFPLMDLQAAISDLWQDIEMIF  327

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
               D+ + +++QA+TSL KL  +I + +  FE+++QKD++K+   GGGIH LT   MN+++
Sbjct  328   HFDAVAGVKSQALTSLQKLKVSIHSALTDFESIIQKDTTKALTPGGGIHKLTRSTMNFIS  387

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYF-AVSDSDESPLPAISLRYAWlillllckLDV  588
             S++ +S VLS+I ++ P      L +SY  A    DE    A+S+ +AWLIL+LLCKLD 
Sbjct  388   SLSKYSGVLSEILADHPLPRNTRLLESYVRAPISEDEQHNHALSVHFAWLILVLLCKLDT  447

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AEHYKD+S++YLFLANNLQ ++  V ++ L   LG++WL+K   K+  YA NYE   W 
Sbjct  448   KAEHYKDVSLSYLFLANNLQIIIETVGSTPLRNLLGDDWLNKHEDKLCAYAGNYEIAAWS  507

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
             +V  SLPE PT  +SPEE K +F++F+ +F +A+ K S+ VV +  LRD LKVS+A+KL+
Sbjct  508   NVFMSLPEEPT-DLSPEEAKIYFRRFHTAFEEAYMKQSSRVVPNAKLRDELKVSIAKKLV  566

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               YR+FY  + L M  + ER+   +V+F P+++ +++SDLF
Sbjct  567   PEYREFYRKY-LPMLGQ-ERNIEILVRFKPDNLENYISDLF  605



>gb|KFK27511.1| hypothetical protein AALP_AA8G392700 [Arabis alpina]
Length=623

 Score =   464 bits (1194),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 262/581 (45%), Positives = 382/581 (66%), Gaps = 12/581 (2%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFY--ESRREANDFVKCVRNLQKAMQFLAM  1662
             ES ++  +     +I KW   +S +       +   SRREA +F   V++LQ  M  L  
Sbjct  22    ESAVDECMNRINTVITKWTSSSSSSTSSDEFLFSTNSRREAEEFALAVKHLQSTMHRLVS  81

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
               P SEKL+ AQNLM+ AMK L+ EF+++L  NR +LDPES S  +  SS  STST  S 
Sbjct  82    VNPSSEKLIFAQNLMQSAMKLLESEFYRVLKANREYLDPESVSVRSYKSSRFSTSTSTSV  141

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
             +   D    +++      S  + +      M D+++I +CMIS GY+KEC +VYK +RK 
Sbjct  142   SDSEDETTYEENSEEHRFSGGDTD-----AMDDLKMIADCMISTGYAKECVRVYKTVRKS  196

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  L VE+ +  +I+KMDWEVLE +IK+WL A++++V++LF GER L D+VF+S 
Sbjct  197   IVDETLHNLSVERFTLHQIQKMDWEVLESKIKSWLRAVKLSVRSLFFGERILADHVFSSN  256

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              + I ES F +I++E A+ LF FPE   K  K +PEK+FR LDMY A+AN   EIESIF 
Sbjct  257   VN-IVESCFTDITQEGALNLFVFPEFAGKIKKLTPEKMFRYLDMYEALANLFVEIESIFY  315

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              DS + +R+Q + SLA+LGDA+R  +  FE+ +QK++SK+ + GGG+HPLT   MNYL+ 
Sbjct  316   FDSGAPVRSQVINSLARLGDAVRLMMNDFESAIQKETSKTPIIGGGVHPLTRYVMNYLSF  375

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             +AD++  ++ IF N   +    LPDS       D    P +S+R AW+ILL LCK+D  A
Sbjct  376   LADYNESIAAIFENWQLVVPSPLPDSLDEAHPQDLYSSP-VSVRIAWVILLTLCKIDGKA  434

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
             + YKD++++YLFLANNLQYVVVKVR++ L   LGE+W+ +  AKVKQYA  +E+L WG V
Sbjct  435   QPYKDVALSYLFLANNLQYVVVKVRSANLKLLLGEDWIVRHEAKVKQYAEKFEKLAWGKV  494

Query  401   IASLPENPTA-PMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
             + SLPENPT   +SPEE+K  F +FN  F  ++RK ++ V+ D  LRD +K+S+++KL+ 
Sbjct  495   MTSLPENPTTEKISPEEVKDLFGRFNDEFETSYRKQTSWVIPDPKLRDQIKISVSQKLMM  554

Query  224   PYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
              Y +FY+ +++ + +E      SIV++ PED+G++LSDL+F
Sbjct  555   VYNEFYEVNRVGLVRETFNE--SIVRYTPEDLGNYLSDLYF  593



>gb|KCW49662.1| hypothetical protein EUGRSUZ_K03176 [Eucalyptus grandis]
Length=655

 Score =   465 bits (1197),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 252/546 (46%), Positives = 353/546 (65%), Gaps = 27/546 (5%)
 Frame = -2

Query  1736  ESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRA  1557
             E R EA  F++CV +L++AM  L  E P SE L+  Q  M+ AMKRLQKE ++ L+ + A
Sbjct  93    EDRAEALRFLQCVHDLRQAMHSLVSESPGSEMLLLGQRSMQTAMKRLQKELYRALSADAA  152

Query  1556  HLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMR  1377
               DPES SA    S                                E   +    M D+R
Sbjct  153   CSDPESVSARLSGSVRMDDGGSG----------------------GEGLPLPPTAMMDLR  190

Query  1376  LIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWL  1197
              IVECMIS GY+KEC  +Y  +RK I+D+AI RLGVEK+S S++  MDWEVLE+++K WL
Sbjct  191   SIVECMISSGYAKECIAIYTVVRKVIVDKAIRRLGVEKLSVSQVNAMDWEVLEVKVKLWL  250

Query  1196  SAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSP  1017
              A+++A+ +LF GER LCD+ F ++ D++ E  F EI  + A  LF+FPE IA+  K SP
Sbjct  251   DAVKVAMTSLFTGERILCDHSFFAS-DSLGELCFAEICGDGAACLFKFPEIIARRTKKSP  309

Query  1016  EKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQK  837
             EK+F LLDMY AI+ +  EIES F+ DS + +R+QA+ SL +LG+++R  + +F++ + K
Sbjct  310   EKIFCLLDMYAAISENWLEIESTFAFDSTAGVRSQALASLVRLGESVRAMLTEFKSTIHK  369

Query  836   DSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSD-  660
             DSSKS VAGGG+H LT+  M++L  +AD+ + L+DI +      K  LP+ YF  SDSD 
Sbjct  370   DSSKSVVAGGGVHRLTVYTMDHLCRLADYGDTLADIVTEWTTPAKSSLPEEYFDGSDSDD  429

Query  659   -ESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFL  483
              E P PAISL+ A LIL+LLCKLD  AEHY+D+S++YLFL NNLQ+++ K R S L   L
Sbjct  430   EEEPAPAISLQVATLILVLLCKLDGKAEHYRDVSVSYLFLGNNLQHIISKARASNLRYLL  489

Query  482   GENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHR  303
             GE W+++   K++Q+A N+ER+ WGDV ASLPE+P A +SP E  + F++FNA F +A R
Sbjct  490   GEEWVARLVRKLRQFAENHERIAWGDVAASLPEDPRAAISPAEASERFRRFNARFEEACR  549

Query  302   KHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGH  123
             +    V +D  LR+ ++ SL RK++R Y +FYD H LT+  E     S  +K+ PEDVG+
Sbjct  550   REGTRVPADPKLREEMRASLERKVVRAYGEFYDAHWLTVGGETGGAMS--IKYTPEDVGY  607

Query  122   HLSDLF  105
             +L+ LF
Sbjct  608   YLASLF  613



>ref|NP_191075.2| exocyst subunit exo70 family protein H1 [Arabidopsis thaliana]
 gb|AAL66959.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20093.1| unknown protein [Arabidopsis thaliana]
 gb|AEE79346.1| exocyst subunit exo70 family protein H1 [Arabidopsis thaliana]
Length=636

 Score =   464 bits (1195),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 261/581 (45%), Positives = 387/581 (67%), Gaps = 9/581 (2%)
 Frame = -2

Query  1844  HFYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLA  1665
             +F +++ME  +E +  +I KW+P      K+ SLF  SR+EA +F++CVR+L++AM FL 
Sbjct  36    NFTQAMMEETVETADSVIRKWDPNTPSFTKIVSLFNHSRKEAKEFIRCVRDLRRAMHFLV  95

Query  1664  MEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
              +  +S KL  AQ LM++AM RL+KEFFQIL+ NR  LDPES S  +  SS +       
Sbjct  96    SQDSQSPKLALAQTLMQIAMARLEKEFFQILSSNRDKLDPESVSGQSSISSNSEFEDVMG  155

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRK  1305
             S  D + D++      +   IT+VE  S+ VM+D++ I E MISCGY KEC K+YK +RK
Sbjct  156   SDDDDESDNEMRKAGES---ITQVEKASAMVMSDLKAIAESMISCGYGKECVKIYKRVRK  212

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              I+DE +S LG+E    S+  + DW  LE  IKNW+ A +I + TLF GE+ LCD+VF++
Sbjct  213   SIVDEGLSLLGIEIYKGSRFHRTDWVTLEHMIKNWIKAAKIGIATLFRGEKLLCDHVFSA  272

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
             + ++ RES F EI+ EAA  LF+FPE +AK  K S E++F L+D+  AI++   +IE IF
Sbjct  273   S-NSTRESCFYEIANEAATNLFKFPEFVAK-EKKSHERIFPLMDLQAAISDLWQDIEMIF  330

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
               D+ + +++QA+TSL KL  +I + +  FE+++QKD++K+   GGGIH LT   MN+++
Sbjct  331   HFDAVAGVKSQALTSLQKLKVSIHSALTDFESIIQKDTTKALTPGGGIHKLTRSTMNFIS  390

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYF-AVSDSDESPLPAISLRYAWlillllckLDV  588
             S++ +S VLS+I ++ P      L +SY  A    DE    A+S+ +AWLIL+LLCKLD 
Sbjct  391   SLSKYSGVLSEILADHPLPRNTRLLESYVRAPISEDEQHNHALSVHFAWLILVLLCKLDT  450

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AEHYKD+S++YLFLANNLQ ++  V ++ L   LG++WL+K   K+  YA NYE   W 
Sbjct  451   KAEHYKDVSLSYLFLANNLQIIIETVGSTPLRNLLGDDWLNKHEDKLCAYAGNYEIAAWS  510

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
             +V  SLPE PT  +SPEE K +F++F+ +F +A+ K S+ VV +  LRD LKVS+A+KL+
Sbjct  511   NVFMSLPEEPT-DLSPEEAKIYFRRFHTAFEEAYMKQSSRVVPNAKLRDELKVSIAKKLV  569

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               YR+FY  + L M  + ER+   +V+F P+++ +++SDLF
Sbjct  570   PEYREFYRKY-LPMLGQ-ERNIEILVRFKPDNLENYISDLF  608



>ref|XP_010516071.1| PREDICTED: exocyst complex component EXO70B1-like isoform X1 
[Camelina sativa]
Length=636

 Score =   464 bits (1193),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 268/581 (46%), Positives = 390/581 (67%), Gaps = 11/581 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S++E  +E +  +I KW+P A    K+ SLF  SRREA +F++CVR+L++AM FL  
Sbjct  37    FTQSMVEETMEKAESVIRKWDPNAPSFTKIVSLFNHSRREAKEFIRCVRDLRRAMHFLVS  96

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E  +S KL  AQ LM++AM RL+KEF QIL+ NR  LDPES S  + +SS +       S
Sbjct  97    EDSQSPKLALAQTLMQIAMARLEKEFSQILSSNRDKLDPESVSGQSSTSSNSEFEDFMGS  156

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               D+D D++      +   IT+VE  ++ VM+D++ I E MISCGY KEC K+YK IRK 
Sbjct  157   DDDYDSDNELRKAGES---ITKVEKAAAVVMSDLKAIAESMISCGYGKECVKIYKRIRKS  213

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +S LG+E    S+  KMDW  LE  IKNW+ A +I + TLF GE+ LCD+VF+++
Sbjct  214   IVDEGLSLLGIEIYKGSRFHKMDWVTLEHMIKNWIKAAKIGIATLFRGEKLLCDHVFSAS  273

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              ++ RES F EI+ EAA  LF+FPE +AK  K S +++F L+D+  AI++   +IE IF 
Sbjct  274   -NSTRESCFYEIANEAATNLFKFPEFVAK-EKKSHDRIFPLMDLQAAISDLWQDIEMIFH  331

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              D  + +++QA+T+L KL  +I   + +FE+ +QKDS+K+   GGGIH LT   M++++S
Sbjct  332   FDGVAGVKSQALTTLQKLKVSIHNALTEFESTIQKDSTKALTPGGGIHKLTRSTMSFISS  391

Query  761   IADHSNVLSDIFSNTPPIPKDW-LPDSYFAVSDS-DESPLPAISLRYAWlillllckLDV  588
             ++ +S V S+I ++  PIP+D  L +SY     S DE    A+S+ +AWLIL+LLCKLD 
Sbjct  392   LSKYSCVFSEILADH-PIPRDTRLLESYVRTPISEDEQHNHALSVHFAWLILVLLCKLDT  450

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AEHYKD+S++YLFLANNLQ +   VR+++L   LG++WL+    K+  YA NYE   W 
Sbjct  451   KAEHYKDVSLSYLFLANNLQLITETVRSTQLRDLLGDDWLTNHEDKLSAYAGNYEIAAWS  510

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
             +V  SLPE PT  +SPEE K +F+KF+ +F +A+ K S+ VV D  LRD LKVS+A+KL+
Sbjct  511   NVFMSLPEEPT-DLSPEEAKIYFRKFHTAFEEAYVKQSSRVVPDAKLRDELKVSIAKKLV  569

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               YR+FY  + L M  + ER+   +V+F P+++ +++SDLF
Sbjct  570   PEYREFYRKY-LPMLGQ-ERNTEILVRFKPDNLENYISDLF  608



>ref|XP_006282043.1| hypothetical protein CARUB_v10028285mg [Capsella rubella]
 gb|EOA14941.1| hypothetical protein CARUB_v10028285mg [Capsella rubella]
Length=637

 Score =   463 bits (1192),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 255/564 (45%), Positives = 363/564 (64%), Gaps = 45/564 (8%)
 Frame = -2

Query  1733  SRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAH  1554
             SRREA +FV+ VR+LQ  M  L    P S+KL+ AQNLM+ AMK L+ EFF++L  NR +
Sbjct  64    SRREAEEFVEAVRHLQSTMHRLVAVNPSSDKLIYAQNLMQSAMKLLESEFFRVLKANREY  123

Query  1553  LDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVSSF-------  1395
             LDPE  S  +  SS  STST  S                    I++ ED S++       
Sbjct  124   LDPECVSVRSYRSSRFSTSTTVS--------------------ISDSEDESTYEENAEEE  163

Query  1394  ---------VMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIR  1242
                       M D+++I +CMIS GY+KEC + YK +R+ I+DE +  LG+E+ +  +I+
Sbjct  164   HRFSGGDTDAMDDLKMIADCMISTGYAKECVRAYKTVRRSIVDETLHNLGMERFTLHQIQ  223

Query  1241  KMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMIL  1062
             KMDWEVLE +IK WL A+++AV++LF GER L D+VF+S+   I ES F EI++E A++L
Sbjct  224   KMDWEVLESKIKTWLKAVKLAVRSLFFGERILADHVFSSS-GPIVESSFTEITQEGALVL  282

Query  1061  FEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGD  882
             F FPEN AK  K SPEK+FR LDMY A+AN   EIESIF  +SA+ +R+Q + SL++LGD
Sbjct  283   FTFPENAAKIKKLSPEKMFRFLDMYEALANLFVEIESIFYFESAAPVRSQVINSLSRLGD  342

Query  881   AIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPK  702
             A+R  +  FE+ +QK++SK+ + GGG+HPLT   MNYL+ +AD++  ++ IF N  P   
Sbjct  343   AVRLMMNDFESAIQKETSKTPIIGGGVHPLTRYVMNYLSFLADYNESIAAIFENWQPTTP  402

Query  701   DWLPDSYFAVSDSDESPL----PAISLRYAWlillllckLDVIAEHYKDISIAYLFLANN  534
               LPDS F     +  P       +SLR AW+ILL LCK+D  A+ YKD++++YLFLANN
Sbjct  403   APLPDSLFLNGGDEAHPADLYSSPVSLRIAWVILLTLCKIDGKAQPYKDVALSYLFLANN  462

Query  533   LQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEE  354
             LQYVVVKVR+S L   LG+ WL K   KVK YA  +E+L WG V+  LPENP    +PEE
Sbjct  463   LQYVVVKVRSSSLKLLLGDEWLVKHEEKVKLYADKFEKLAWGKVMDLLPENPAEEFTPEE  522

Query  353   IKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEK  174
              K+   +FN  F  ++RK ++ V+ D  LRD +K+S+++KL     +F+  ++  +  E 
Sbjct  523   AKEVVTRFNDEFETSYRKQTSWVIPDPKLRDQIKISVSQKLTHGCTEFHQMNRSGLVGEN  582

Query  173   ERHFSSIVKFAPEDVGHHLSDLFF  102
             E    +++++ PED+G++LSDL+F
Sbjct  583   E----AVLRYTPEDIGNYLSDLYF  602



>ref|XP_010516072.1| PREDICTED: exocyst complex component EXO70A1-like isoform X2 
[Camelina sativa]
Length=636

 Score =   462 bits (1190),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 267/581 (46%), Positives = 390/581 (67%), Gaps = 11/581 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S++E  +E +  +I KW+P A    K+ SLF  SRREA +F++CVR+L++AM FL  
Sbjct  37    FTQSMVEETMEKAESVIRKWDPNAPSFTKIVSLFNHSRREAKEFIRCVRDLRRAMHFLVS  96

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E  +S KL  AQ LM++AM RL+KEF QIL+ NR  LDPES S  + +SS +       S
Sbjct  97    EDSQSPKLALAQTLMQIAMARLEKEFSQILSSNRDKLDPESVSGQSSTSSNSEFEDFMGS  156

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               D+D D++      +   IT+VE  ++ VM+D++ I E MISCGY KEC K+YK IRK 
Sbjct  157   DDDYDSDNELRKAGES---ITKVEKAAAVVMSDLKAIAESMISCGYGKECVKIYKRIRKS  213

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +S LG+E    S+  +MDW  LE  IKNW+ A +I + TLF GE+ LCD+VF+++
Sbjct  214   IVDEGLSLLGIEIYKGSRFHRMDWVTLEHMIKNWIKAAKIGIATLFRGEKLLCDHVFSAS  273

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              ++ RES F EI+ EAA  LF+FPE +AK  K S +++F L+D+  AI++   +IE IF 
Sbjct  274   -NSTRESCFYEIANEAATNLFKFPEFVAK-EKKSHDRIFPLMDLQAAISDLWQDIEMIFH  331

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              D  + +++QA+T+L KL  +I   + +FE+ +QKDS+K+   GGGIH LT   M++++S
Sbjct  332   FDGVAGVKSQALTTLQKLKVSIHNALTEFESTIQKDSTKALTPGGGIHKLTRSTMSFISS  391

Query  761   IADHSNVLSDIFSNTPPIPKDW-LPDSYFAVSDS-DESPLPAISLRYAWlillllckLDV  588
             ++ +S V S+I ++  PIP+D  L +SY     S DE    A+S+ +AWLIL+LLCKLD 
Sbjct  392   LSKYSCVFSEILADH-PIPRDTRLLESYVRTPISEDEQHNHALSVHFAWLILVLLCKLDT  450

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AEHYKD+S++YLFLANNLQ +   VR+++L   LG++WL+    K+  YA NYE   W 
Sbjct  451   KAEHYKDVSLSYLFLANNLQLITETVRSTQLRDLLGDDWLTNHEDKLSAYAGNYEIAAWS  510

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
             +V  SLPE PT  +SPEE K +F+KF+ +F +A+ K S+ VV D  LRD LKVS+A+KL+
Sbjct  511   NVFMSLPEEPT-DLSPEEAKIYFRKFHTAFEEAYVKQSSRVVPDAKLRDELKVSIAKKLV  569

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               YR+FY  + L M  + ER+   +V+F P+++ +++SDLF
Sbjct  570   PEYREFYRKY-LPMLGQ-ERNTEILVRFKPDNLENYISDLF  608



>ref|XP_010427273.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=636

 Score =   462 bits (1190),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 266/581 (46%), Positives = 390/581 (67%), Gaps = 11/581 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S++E  +E +  +I KW+P      K+ SLF  SRREA +F++CVR+L++AM FL  
Sbjct  37    FTQSMVEETMEKAESVIRKWDPNTPSFTKIVSLFNHSRREAKEFIRCVRDLRRAMHFLVS  96

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E  +S KL  AQ LM++AM RL+KEFFQIL+ NR  LDPES S  + +SS +       S
Sbjct  97    EDSQSPKLALAQTLMQIAMARLEKEFFQILSSNRDRLDPESVSGQSSTSSNSEFEDFMGS  156

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               D+D D++      +   IT+VE  ++ VM+D++ I E MISCGY KEC K+YK IRK 
Sbjct  157   DDDYDSDNELRKAGES---ITKVEKAAAVVMSDLKAIAESMISCGYGKECVKIYKRIRKS  213

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +S LG+E    S+  + D   LE  IKNW+ A +I + TLF GE+ LCD+VF+++
Sbjct  214   IVDEGLSLLGIEIYKGSRFHRTDSVTLEHMIKNWIKAAKIGIATLFRGEKLLCDHVFSAS  273

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              ++ RES F EI+ EAA  LF+FPE IAK  K S E++F L+D+  AI++   +IE IF 
Sbjct  274   -NSTRESCFYEIANEAATNLFKFPEFIAK-EKKSHERIFPLMDLQAAISDLWQDIEMIFH  331

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              D+ + +++QA+T+L KL  +I   +  FE+ +QKDS+K+   GGG+H LT   M++++S
Sbjct  332   FDAVAGVKSQALTTLQKLKVSIHNALTDFESTIQKDSTKALTTGGGVHKLTRSTMSFISS  391

Query  761   IADHSNVLSDIFSNTPPIPKDW-LPDSYFAVSDS-DESPLPAISLRYAWlillllckLDV  588
             ++ +S VLS+I ++  PIP+D  L +SY     S DE    A+S+ +AWLIL+LLCKLD 
Sbjct  392   LSKYSGVLSEILADH-PIPRDTRLLESYVRTPISEDEQQNHALSVHFAWLILVLLCKLDT  450

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AEHYKD+S++YLFLANNLQ ++  VR+++L   LG++WL+    K+  YA NYE   W 
Sbjct  451   KAEHYKDVSLSYLFLANNLQLIIETVRSTQLRDLLGDDWLTNHEDKLSAYAGNYEIAAWS  510

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
             +V  SLPE PT  +SPEE K +F++F+ +F +A+ K S+ VV D  LRD LKVS+A+KL+
Sbjct  511   NVFMSLPEEPT-DLSPEEAKIYFRRFHTAFEEAYMKQSSRVVPDAKLRDELKVSIAKKLV  569

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               YR+FY  + L M  + ER+   +V+F P+++ +++SDLF
Sbjct  570   PEYREFYRKY-LPMLGQ-ERNTEILVRFKPDNLENYISDLF  608



>ref|XP_006293038.1| hypothetical protein CARUB_v10019317mg [Capsella rubella]
 gb|EOA25936.1| hypothetical protein CARUB_v10019317mg [Capsella rubella]
Length=636

 Score =   462 bits (1190),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 268/580 (46%), Positives = 384/580 (66%), Gaps = 9/580 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F ES++E  LE +  +I KW+P      K+ SLF  SRREA +F+ CVR+L++AM FL  
Sbjct  37    FTESMIEETLEKAESVIRKWDPNTPSFTKIVSLFNHSRREAKEFIICVRDLRRAMHFLVS  96

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S KL  AQ LM+VAM RL+KEFFQIL+ NR  LDPES S  +  SS +      +S
Sbjct  97    QDSQSPKLALAQTLMQVAMARLEKEFFQILSSNRDKLDPESVSGQSSISSNSEFEDFMAS  156

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               D D D++      +   IT+VE  S+ VM+D++ I E MISCGY KEC K+YK IRK 
Sbjct  157   DDDDDSDNEIRIAGES---ITKVEKASAVVMSDLKAIAESMISCGYGKECVKIYKRIRKS  213

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +S LG+E    SK  KMDW  LE  IKNW+ A +I V TLF GE+ LCD+VF+++
Sbjct  214   IVDEGLSLLGIEIYKGSKFHKMDWVTLEHMIKNWIKAAKIGVATLFRGEKLLCDHVFSAS  273

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              ++ RES + EI+ EAA  LF+FPE +AK  K S E++F L+D+  AI++   +IE IF 
Sbjct  274   -NSTRESCYYEIANEAATNLFKFPELVAK-EKKSHERIFPLMDLLAAISDLWQDIEMIFH  331

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              D+ + +++QA+TSL KL  +I + +  FE+ +QKDS+K+   GGGIH LT   M++++S
Sbjct  332   FDAVAGVKSQALTSLQKLKASIHSALTDFESTIQKDSTKALTPGGGIHKLTRSTMSFISS  391

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDS-DESPLPAISLRYAWlillllckLDVI  585
             ++ +S+VLS+I ++ P      L +SY     S DE    A+S+ + WLIL+LLCKLD  
Sbjct  392   LSKYSSVLSEILADHPNSRNTRLLESYARTPISEDEQHNHALSVHFVWLILVLLCKLDTK  451

Query  584   AEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             AEHYKD+S++YLFLANNL  ++  VR++ L   LG++WLS  + K+  YA NYE   W +
Sbjct  452   AEHYKDVSLSYLFLANNLHLIIETVRSTHLRDLLGDDWLSMHADKLSAYAGNYEIASWSN  511

Query  404   VIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
             V  SLPE PT  +SPE+ K +F++F+ +F +A+ K S+ VV D  LRD LKVS+A KL+ 
Sbjct  512   VFMSLPEEPT-DLSPEDAKIYFRRFHTAFEEAYMKQSSRVVPDAKLRDELKVSIANKLVP  570

Query  224   PYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              YR+FY  + L M  + ER+   +V+F P+++ +++S LF
Sbjct  571   EYREFYRKY-LPMLGQ-ERNTEILVRFKPDNLENYISHLF  608



>ref|XP_010418420.1| PREDICTED: exocyst complex component EXO70B1-like [Camelina sativa]
Length=663

 Score =   463 bits (1192),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 259/556 (47%), Positives = 370/556 (67%), Gaps = 23/556 (4%)
 Frame = -2

Query  1748  SLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILN  1569
             SLF ES+REA  FV+ V+ LQ AM  L  E P S+ L+RAQ LM++AMKRLQKEF QIL+
Sbjct  81    SLFCESKREAKKFVRRVKELQNAMDLLIREDPSSDHLLRAQRLMQIAMKRLQKEFLQILS  140

Query  1568  MNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVSSFVM  1389
             MNRAHLDPES S  + +S V++    +                     I EVE+VS    
Sbjct  141   MNRAHLDPESISTRSPTSVVSNDEDAWHEYRSVGDS------------IMEVEEVSKNSR  188

Query  1388  ADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRI  1209
              +++ I ECMIS GY+KEC   YK IRK I+DE+I RLGVEK+S SK +KM +EV+EL+ 
Sbjct  189   TELKSIAECMISTGYAKECANTYKSIRKSIVDESIYRLGVEKLSSSKAKKMPYEVVELKT  248

Query  1208  KNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYA  1029
             K W+ A+++++KTLF  E+TLCD VF S+  ++RES F++ISKE A++LF FPE +A   
Sbjct  249   KRWIEAVKVSMKTLFISEKTLCDEVFESSA-SLRESCFRDISKEGALLLFGFPETVAVRD  307

Query  1028  KNSP--EKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQF  855
             K +P  +K+F LLDMY  I      IE+IFS  S S++RTQA +SL +L ++I + +A+F
Sbjct  308   KKNPHMKKIFPLLDMYCMITEKLLAIEAIFSFPSISAVRTQAHSSLTRLSESILSNLAEF  367

Query  854   ETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKD--WLPDSY  681
             E+ ++KD+SK+ V GGG+HP+TI  M++++ ++++S+ L DI + +P    D   LP SY
Sbjct  368   ESDIRKDTSKTMVRGGGVHPMTISVMDHISRLSEYSSSLMDILNGSPSSSPDKSLLPKSY  427

Query  680   FAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTS  501
             F V +S+ SP   + +R+AWLIL+LLCK+D  AE YK+ S+ YLFL NNLQYVV + R++
Sbjct  428   FNVMESEGSPSSELKVRFAWLILVLLCKIDGKAEMYKEFSMQYLFLTNNLQYVVSRARST  487

Query  500   RLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAP---MSPEEIKQHFKKF  330
              L + LG++W+++   KVKQ+A +YERL W  +++  P   T     MS EE K   +KF
Sbjct  488   NLKQLLGDDWITRHFEKVKQFARSYERLAWDPLVSMCPTISTCEAVGMSQEEAKMQSEKF  547

Query  329   NASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHK-LTMPKEKERHFSSI  153
             N SF +     S CV+ DR L D +++S+ RKLL  YRDFY+ H+   M   KE  ++  
Sbjct  548   NESFEKTCEAQSECVIPDRKLLDEMRMSIRRKLLPIYRDFYNAHRNAVMLIGKEGGWN--  605

Query  152   VKFAPEDVGHHLSDLF  105
             +++ PED+ + LS+LF
Sbjct  606   IRYTPEDMEYRLSELF  621



>ref|XP_010068210.1| PREDICTED: exocyst complex component EXO70A1-like [Eucalyptus 
grandis]
Length=482

 Score =   457 bits (1175),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 260/493 (53%), Positives = 354/493 (72%), Gaps = 17/493 (3%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEAA  1758
             MPRKGMR I F+P   S +   R +    +    + V+E A      +IMKWNP+ S  A
Sbjct  1     MPRKGMRSICFNPRTSSFALPARRALPGPAAAEADKVIESA----ALLIMKWNPDTSSYA  56

Query  1757  KVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRS-EKLVRAQNLMEVAMKRLQKEFF  1581
             +VTSLFYES+REA  F+ CV NLQK+M  LA   P S E+LV AQ LME+AMKRLQKEF+
Sbjct  57    RVTSLFYESKREAAQFIACVSNLQKSMHALASASPVSDERLVHAQFLMEIAMKRLQKEFY  116

Query  1580  QILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVS  1401
             QIL++NRAHLDPES SA +  +S  S+++ +S   + D +    D       ITEVE+ S
Sbjct  117   QILSLNRAHLDPESVSARSSRTSARSSTSDYSDDGNGDEECAARDT------ITEVEEAS  170

Query  1400  SFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVL  1221
             +  M+D+R I ECMI+ GY KEC  +YK IRK I+DE I RLGVE+MS S+  KMDW+VL
Sbjct  171   TAAMSDLRSIAECMIASGYGKECVAIYKIIRKSIVDEGIYRLGVERMSASQAAKMDWDVL  230

Query  1220  ELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENI  1041
             E+++KNWL A++IA++TLF GER LCD+VFA++ D IRES+F EIS++ AM+LF FPE +
Sbjct  231   EMKVKNWLEAVKIAIRTLFTGERILCDHVFAAS-DTIRESVFSEISRDGAMLLFGFPELV  289

Query  1040  AKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIA  861
             A+  ++  EK+FRLLDMY+AI+ + PEIESIF+ +S S++R+QA++SLA++G++ R  ++
Sbjct  290   ARSKRSQEEKMFRLLDMYSAISENWPEIESIFAFESTSAVRSQAISSLARIGESARAMLS  349

Query  860   QFETVLQKDSSKST--VAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPD  687
             + E  +QKDS KS+  VAGGG+H LT+  MNYL  +AD+ +++ DIF+      K  LP+
Sbjct  350   EVEAAIQKDSPKSSPLVAGGGVHTLTVRVMNYLALLADYGSIVVDIFAVWEGPAKPSLPE  409

Query  686   SYFAVS-DSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKV  510
              YF +S +SD++  PA+S+R AWLIL+LLCKLD  A+ YKD++ +YLFLANNLQ+VV KV
Sbjct  410   LYFDMSPESDDA--PAVSIRLAWLILVLLCKLDGKAKRYKDVATSYLFLANNLQHVVSKV  467

Query  509   RTSRLNRFLGENW  471
             R S L   LGE W
Sbjct  468   RASNLQDLLGEEW  480



>ref|XP_004241253.1| PREDICTED: exocyst complex component EXO70A1-like [Solanum lycopersicum]
Length=623

 Score =   461 bits (1187),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 269/582 (46%), Positives = 378/582 (65%), Gaps = 16/582 (3%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +++ME  L+ +  +I +W+ + S     ++LF +SR EA  +++ V +LQ AMQF+  
Sbjct  25    FSDTLMEDTLKNAEEIIKRWDLDDSS----SNLFQDSRTEAKQYLEAVIDLQHAMQFVVK  80

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E   S+ LV AQNLM++A++RLQKEFF IL  NR  LD E  S  +  SS +    G   
Sbjct  81    ESATSQLLVPAQNLMKIAIERLQKEFFNILAGNRYFLDSEGGSRESTRSSGSDEDQGSED  140

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
              +        +          E E VS  V  D++ I +CMI  GY KEC K+Y+  RK 
Sbjct  141   DNAEIESRFPELSID-----DESEKVS--VAVDLKAIADCMIEAGYGKECAKIYELNRKS  193

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             +I+E +  LGVE +S S ++KM+W+ LE +IK WL+A+++AV TLF GER LCD VF S 
Sbjct  194   VIEETLYYLGVENISPSTVQKMNWKDLEKKIKIWLNAVKVAVSTLFYGERILCDQVF-SI  252

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
              D++RES F  I+K++A+ LF FPE +AKY K S EK+FR+LD+Y++I+    EIE IF 
Sbjct  253   SDSVRESCFTGIAKDSALTLFTFPEMVAKYKKLSLEKMFRILDLYDSISELLSEIEVIFG  312

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              DS  ++++QA+TS+AKL DA R  +A+FE+ ++KDSSK  VAGGGIHPLT   MNYL  
Sbjct  313   FDSMVAVKSQALTSMAKLRDAARAMLAEFESAIKKDSSK-VVAGGGIHPLTRYVMNYLIF  371

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYF--AVSDSDESPLPAISLRYAWlillllckLDV  588
             ++D+S  +SDI ++   + K  LP+SY    ++D  +SP   +S+R  WLIL+LLCKLD 
Sbjct  372   LSDYSGPISDIIADWKAVVKSPLPESYLLSPIADDGDSPSCIVSVRLTWLILVLLCKLDG  431

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              A  Y D+ ++YLFLANNL YVV KVR S L   LG +WLS   AKV+QY AN++R+GW 
Sbjct  432   KAGFYGDVPLSYLFLANNLNYVVSKVRQSSLKLLLGPDWLSNHEAKVEQYMANFKRMGWS  491

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
              V+ SLPEN TA +SP E K+ F KF+ SF + + K  + V+ D  LRD +K+SLA K+L
Sbjct  492   SVMTSLPENSTAEISPAEAKECFCKFSLSFEETYWKQRSWVIPDPKLRDEVKISLANKIL  551

Query  227   RPYRDFYDTHKLTMPK-EKERHFSSIVKFAPEDVGHHLSDLF  105
               Y+ FY  H   + + E      SIV+FAP++V ++LSDLF
Sbjct  552   SAYQPFYQKHGEKVARMESGGGVESIVRFAPDNVQNYLSDLF  593



>ref|XP_009135050.1| PREDICTED: exocyst complex component EXO70B1 [Brassica rapa]
 emb|CDX73983.1| BnaA03g30640D [Brassica napus]
Length=620

 Score =   459 bits (1182),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 250/582 (43%), Positives = 366/582 (63%), Gaps = 37/582 (6%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQP  1653
             S ++  ++ +  +I KWN E     K  SLF ES+REA  F+  V++LQK+M  L  E P
Sbjct  32    SEIDHTIDNAAEIIEKWNTEYVSTTKFYSLFCESKREAKKFINGVKDLQKSMDTLIKEDP  91

Query  1652  RSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsd  1473
              SE L+RAQ LM++AMKRLQ EF+QIL+MNRA LDPE+      +               
Sbjct  92    NSENLLRAQKLMQIAMKRLQSEFYQILSMNRARLDPETGEDVRLAGDS------------  139

Query  1472  fdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIID  1293
                             I EVE+VS   M +++ I ECMI+ GY+KEC   YK  RK I+D
Sbjct  140   ----------------IVEVEEVSRNSMKELKSIAECMIAAGYAKECASTYKCFRKSIVD  183

Query  1292  EAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA  1113
             E I RLGVEK+S SK++KM  EV+E+++++W+ A+ +++KTLFNGE+TLCD VF     +
Sbjct  184   EGIHRLGVEKVSSSKVKKMPSEVVEVKMRSWIDAVSVSMKTLFNGEKTLCDEVFEGCSVS  243

Query  1112  IRESIFKEISKEAAMILFEFPENIAKYAKNS--PEKVFRLLDMYNAIANHRPEIESIFSM  939
             +RES F++ISKE A++L  FPE++A   K +  P+K+F LLDMY  I  +   IESIFS 
Sbjct  244   LRESCFRDISKEGALLLLGFPESVAVRDKKTPNPKKIFTLLDMYGTITENLQAIESIFSF  303

Query  938   DSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSI  759
              S S++R+QA++SL +L ++I + + +FE+ ++KDSSK+ V GGG+HP+T  +M++L+ +
Sbjct  304   HSVSAVRSQALSSLNRLSESILSHLVEFESEIRKDSSKTVVPGGGVHPMTTSSMDHLSRL  363

Query  758   ADHSNVLSDIF-SNTPPIPKDWLPDSYFAVSDSDESPLPA-ISLRYAWlillllckLDVI  585
             A++S +L +I    +    K  LP SYF +S+SD     + + +R+AW++L+LLCK+D  
Sbjct  364   AEYSGILVNIIVKGSSSSAKALLPKSYFNLSESDGCHHGSEVRVRFAWMVLVLLCKIDGK  423

Query  584   AEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             AE YKD S+ YLFLANNLQ+V  + R++ L   LG+ W+ +   KV Q+A +YERL W  
Sbjct  424   AEMYKDFSMQYLFLANNLQHVASRARSTGLKHLLGDEWIERHFEKVGQFARSYERLAWEP  483

Query  404   VIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
             + +  P+  T  MSPEE K   +KF+  F    +  SACVV D+ L + ++ S+  KLL 
Sbjct  484   LASMCPK--TEEMSPEEAKMRLEKFSECFESTCQSQSACVVPDQTLLEEMRSSIVEKLLP  541

Query  224   PYRDFYDTH-KLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
              YRDFY+ H    M    E  ++  V++ PEDV  +LS   F
Sbjct  542   VYRDFYNAHSNAAMLAGTEGGWN--VRYTPEDVAKYLSSELF  581



>ref|XP_002866344.1| ATEXO70H7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42603.1| ATEXO70H7 [Arabidopsis lyrata subsp. lyrata]
Length=637

 Score =   459 bits (1182),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 262/585 (45%), Positives = 377/585 (64%), Gaps = 19/585 (3%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             ES ++  +     +I KW   A+ ++        SRREA +FV  VR+LQ  M  L    
Sbjct  23    ESAVQECMSNINAVISKWTSPAASSSDEFLFSTNSRREAEEFVTAVRHLQSTMHRLVSVN  82

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
             P SEKL+ AQNLM+ AM+ L+ EF ++L  NR +LDPES S  +  SS  STST  S + 
Sbjct  83    PSSEKLIYAQNLMQSAMRLLESEFHRVLKANREYLDPESVSVRSCRSSRFSTSTTTSVSD  142

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
               D    +++            D     M D+++I +CMIS GY+KEC +VYK +RK I+
Sbjct  143   SEDEITYEENADEEHRFSGGDSDA----MDDLKMIADCMISTGYAKECVRVYKTVRKSIV  198

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DE +  LG+E+ +  +I+KMDWE+L+ +IK WL A+++AV++LF GER L D+VFAS+  
Sbjct  199   DETLHNLGMERFNLHQIQKMDWEILDSKIKTWLKAVKLAVRSLFFGERILADHVFASS-G  257

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
              I ES F EI++E A+ILF FPE  AK  K +PEK+FR LDMY A+AN   EIESIF  +
Sbjct  258   LIVESSFTEITQEGALILFTFPEYAAKIKKLTPEKMFRFLDMYEALANLYVEIESIFYFE  317

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             SA+++R+Q + SLA+LGDA R  +  FE+ +QK++SK+ + GGG+HPLT   MNYL+ +A
Sbjct  318   SAAAVRSQVINSLARLGDATRLMMTDFESAIQKETSKTPIIGGGVHPLTRYVMNYLSFLA  377

Query  755   DHSNVLSDIFSN---TPPIPKDWLPDSYFAVSDSDESP----LPAISLRYAWlillllck  597
             D+S  ++ IF N   + P P   LPDS +     + +P       +S+R AW+ILL LCK
Sbjct  378   DYSESITAIFENWKLSVPTP---LPDSLYISGGDEANPEDLYSSPVSVRIAWVILLTLCK  434

Query  596   LDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERL  417
             +D  A+ YKD++++YLFLANNLQYVVVKVR+S L   LG++W+ +   KVK YA  +E+L
Sbjct  435   IDGKAQPYKDVALSYLFLANNLQYVVVKVRSSNLKLLLGDDWVFRHEEKVKLYADKFEKL  494

Query  416   GWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLAR  237
              WG V+  LPE PT   SPEE K    +FN  F  ++RK ++ V+ D  LRD +K+SL++
Sbjct  495   AWGRVLDLLPEIPTEENSPEEAKDLVGRFNDEFETSYRKQTSWVIPDPKLRDQIKISLSQ  554

Query  236   KLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             KL+    +FY  ++  +  + E    ++V++ PEDVG++LSDL+F
Sbjct  555   KLILVCTEFYQMNRFGLVGDNE----AVVRYTPEDVGNYLSDLYF  595



>ref|XP_010443748.1| PREDICTED: exocyst complex component EXO70B1-like [Camelina sativa]
Length=638

 Score =   458 bits (1179),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 253/550 (46%), Positives = 369/550 (67%), Gaps = 16/550 (3%)
 Frame = -2

Query  1733  SRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAH  1554
             SRREA +FV+ VR+LQ  M  L    P S+KL+ AQNLM+ AMK L+ EF+++L  NR +
Sbjct  61    SRREAEEFVEAVRHLQSTMHRLVSVSPSSDKLIYAQNLMQSAMKLLESEFYRVLKANREY  120

Query  1553  LDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRL  1374
             LDPE  S  +  SS  +TST  S +   D     ++        +  +   +  M D+++
Sbjct  121   LDPECVSVRSCKSSRFTTSTTVSVSDSEDESTSYEETTEEEHRFSGGD---ADAMDDLKM  177

Query  1373  IVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLS  1194
             I +CMIS GY+KEC +VYK +R+ I+DE +  LG+E+++  +I+KM+WEVLE +I+ WL 
Sbjct  178   IADCMISTGYAKECVRVYKTVRRSIVDETLYNLGMERLTLHQIQKMEWEVLESKIRTWLK  237

Query  1193  AMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPE  1014
             A+++AV++LF GER L D+VF+S+   I ES F EI++E A+ILF FPE  AK  K +PE
Sbjct  238   AVKLAVRSLFFGERILADHVFSSS-GPIVESSFTEITQEGALILFTFPEYAAKIKKLTPE  296

Query  1013  KVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKD  834
             K+FR LDMY A+AN   EIESIF  +S + +R+Q + SLA+LGDA R+ +  FE+ +QK+
Sbjct  297   KMFRFLDMYEALANLFVEIESIFYFESGAPVRSQVINSLARLGDAARSMMNDFESAIQKE  356

Query  833   SSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDES  654
             +SK+TV GGG+HPLT   MNYL+ +AD+   ++ IF N  P     LPDS + +S  DE+
Sbjct  357   TSKTTVVGGGVHPLTRYVMNYLSFLADYDESIAAIFENWQPTVAVPLPDSLY-ISGGDEA  415

Query  653   PLPA------ISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLN  492
               PA      +S+R AW+ILL LCK+D  A+ YKD+++AYLFLANNLQYVVVKVR+S L 
Sbjct  416   H-PADLYSSPVSVRIAWVILLTLCKIDGKAQPYKDVALAYLFLANNLQYVVVKVRSSNLK  474

Query  491   RFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQ  312
               LG++W+ K  AKVK YA  +E+L WG V+  +PENP   MSPEE K+   +FN  F  
Sbjct  475   LLLGDDWVVKHEAKVKLYADKFEKLAWGKVLDLVPENPKEEMSPEEAKELVGRFNDEFET  534

Query  311   AHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPED  132
             ++RK ++ V+ D  LRD +K+S+++KL     +F+  ++  +    E    +++++ PED
Sbjct  535   SYRKQTSWVIPDPKLRDQIKISVSQKLTLGCNEFHRLNRSGLVGANE----ALLRYTPED  590

Query  131   VGHHLSDLFF  102
             +G++LSDL+F
Sbjct  591   IGNYLSDLYF  600



>emb|CDY07931.1| BnaC03g35920D [Brassica napus]
Length=626

 Score =   457 bits (1175),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 253/584 (43%), Positives = 364/584 (62%), Gaps = 29/584 (5%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F  S ++  ++ +  +I KWN E     K  SLF ES+REA  F+  V++LQK+M  L  
Sbjct  29    FDSSEIDLTIDNAAEIIEKWNTEYVSTTKFYSLFCESKREAKKFINGVKDLQKSMDSLIK  88

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E P SE L+RAQ LM++AMKRLQ EF+QIL+MNRAHLDPE+ S   +SS+          
Sbjct  89    EDPNSENLLRAQKLMQIAMKRLQSEFYQILSMNRAHLDPETVSTYGQSSASRLAGDS---  145

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
                                I EVE+VS   M +++ I ECMI+ GY+KEC   YK  RK+
Sbjct  146   -------------------IVEVEEVSRNSMKELKSIAECMIAAGYAKECASTYKCFRKY  186

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE I RLGVEK+S SK++KM  EV E+++++W+ A+ +++KTLFNGE+TLCD VF   
Sbjct  187   IVDEGIHRLGVEKVSSSKVKKMPSEVAEMKMRSWIDAVNVSMKTLFNGEKTLCDEVFEGC  246

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKN--SPEKVFRLLDMYNAIANHRPEIESI  948
                +RES F++ISKE A++L  FPE++A   K   +P+K+F LLDMY  I  + P IESI
Sbjct  247   SVYLRESCFRDISKEGALLLLGFPESVAVRDKKNPNPKKIFTLLDMYVTITENLPAIESI  306

Query  947   FSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYL  768
             FS  S  ++R+QA+ SL +L ++I + + +FE+ ++KDSSK+ V GGG+HP+T  +M++L
Sbjct  307   FSFQSVLAVRSQALNSLNRLSESILSHLVEFESEIRKDSSKTVVPGGGVHPMTTSSMDHL  366

Query  767   TSIADHSNVLSDIF-SNTPPIPKDWLPDSYFAVSDSDE-SPLPAISLRYAWlillllckL  594
             + +A++S +L +I    +    K  LP SYF +S+SD       + +R+AW++L+LLCK+
Sbjct  367   SRLAEYSGILVNIIVKGSSSSAKALLPKSYFNLSESDGWHHGSEVRVRFAWMVLVLLCKI  426

Query  593   DVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLG  414
             D  AE YKD S+ YLFLANNLQ+V  + R++ L   LG+ W+ +   KV Q+A +YERL 
Sbjct  427   DGKAEMYKDFSMQYLFLANNLQHVASRARSTSLKHLLGDEWIERHFEKVGQFARSYERLA  486

Query  413   WGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
             W  + +  P+  T  MSPEE K   +KF+  F       S CVV D+ L + ++ S+A K
Sbjct  487   WEPLASMCPK--TEEMSPEEAKTQLEKFSECFESTCESQSMCVVPDQTLLEEMRSSIAEK  544

Query  233   LLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             LL  YRDFY+ H               V++ PEDV  +LS   F
Sbjct  545   LLPVYRDFYNAHS-NAALLAGMGGGWNVRYTPEDVAKYLSSELF  587



>ref|XP_008789001.1| PREDICTED: exocyst complex component EXO70A1-like [Phoenix dactylifera]
Length=653

 Score =   457 bits (1175),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 266/597 (45%), Positives = 386/597 (65%), Gaps = 39/597 (7%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQP  1653
             ++ME  +     +I KW+P AS  AK+TSLFY+ R EA+ F+  V +LQ+AM   A ++ 
Sbjct  41    TMMEDKVTAVEAIITKWDPNASSFAKITSLFYQDRAEAHRFLLAVSDLQRAMLDFASDKG  100

Query  1652  R----SEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
                  S+ LVRAQ LM+ AM+RL+KEF QIL+ NR  LDPES SA +  SSV+       
Sbjct  101   NLVSGSDALVRAQTLMQAAMRRLEKEFDQILSANRDRLDPESVSARSSRSSVSDAEDDVG  160

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRK  1305
              +S+ D+    +        I EVE  ++  MAD+  I E M+S GY KECF++YK +RK
Sbjct  161   GSSEDDIRAAGES-------IGEVERAAAIAMADLHAIAETMMSAGYGKECFRIYKILRK  213

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              IIDE + RLG EK+S S+I+KMDWE L+ +I+ WL+A  +AVKTLF+GER L D+VFA 
Sbjct  214   SIIDECLYRLGFEKLSPSQIQKMDWESLDSKIRTWLAASRVAVKTLFSGERILLDHVFAG  273

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
             + D+IRE+ F +I+++AA+    FPE +AK +K SPEK+FR+LD+++AIA   PEIE +F
Sbjct  274   S-DSIREACFADIARDAAVQFLSFPELVAK-SKRSPEKMFRILDLHDAIAELWPEIEPVF  331

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
             S +S +++ TQA+ SL KL DA R  IA FE  +QKD+SKS + GGGIHPLT  +MN++ 
Sbjct  332   SFESTAAVPTQALNSLVKLADAARATIADFEVAMQKDTSKSPIPGGGIHPLTRYSMNFVA  391

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYF-----------------AVSDSDESPLPAIS  636
              +AD+   L+DIF+++       LPD +F                 + S+ +E+P   ++
Sbjct  392   LLADYDAALADIFADSTLHMPSSLPDFFFDTSQASAPPSPAPSSAASTSNYEENPGSPVA  451

Query  635   LRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQS  456
             +R A LIL+LLCKLD  A  Y+++S++YLFLANNLQY+V K+R SRL+  LGE W ++ +
Sbjct  452   VRLARLILVLLCKLDDKAGLYREVSLSYLFLANNLQYIVNKIRGSRLSHLLGEEWATRHA  511

Query  455   AKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSD  276
             AK +QYA+N+ERLGW  V A++   P   + P E+++  + FNA   +A R  +  VV+D
Sbjct  512   AKARQYASNFERLGWSKVAAAI---PAGEVGPAEMRERMRAFNAGLEKACRNQAEWVVAD  568

Query  275   RNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               +R+ ++  +   ++  YR FY      +    E   S++VKF+PEDVG  LS+LF
Sbjct  569   AGMREVVRAVVRGMIVPAYRGFY------VKCRAELGDSAVVKFSPEDVGSRLSELF  619



>ref|XP_010483617.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=636

 Score =   456 bits (1173),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 254/550 (46%), Positives = 366/550 (67%), Gaps = 17/550 (3%)
 Frame = -2

Query  1733  SRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAH  1554
             SRREA +FV+ VR+LQ  M  L    P S+KL+ AQNLM+ AMK L+ EF+++L  NR +
Sbjct  61    SRREAEEFVEAVRHLQSTMHRLVSVNPSSDKLIYAQNLMQSAMKLLESEFYRVLKANREY  120

Query  1553  LDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRL  1374
             LDPE  S  +  SS  +TST  S +   D +  +++            D     M D+++
Sbjct  121   LDPECVSVRSCKSSRFTTSTTVSVSDSEDENTYEENAEEEHRFSGGDADA----MDDLKM  176

Query  1373  IVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLS  1194
             I +CMIS GY+KEC +VYK +R+ I+DE +  LG+E+ +  +I+KM+WEVLE +IK WL 
Sbjct  177   IADCMISTGYAKECVRVYKTVRRSIVDETLYNLGMERFTLHQIQKMEWEVLESKIKTWLK  236

Query  1193  AMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPE  1014
             A+++AV++LF GER L D+VF+S+   I ES F EI++E A+ILF FPE  AK  K +PE
Sbjct  237   AVKLAVRSLFFGERILADHVFSSS-GPIVESSFTEITQEGALILFTFPEYAAKIKKLTPE  295

Query  1013  KVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKD  834
             K+FR LDMY A+AN   EIESIF  +S + +R+Q + SLA+LGDA R+ +  FE+ +QK+
Sbjct  296   KMFRFLDMYEALANLFVEIESIFYFESGAPVRSQVINSLARLGDAARSMMNDFESAIQKE  355

Query  833   SSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDES  654
             +SK+ V GGG+HPLT   MNYL+ +AD+   ++ IF N  P     LPDS + +S  DE+
Sbjct  356   TSKTMVIGGGVHPLTRYVMNYLSFLADYDESIAAIFENWQPTVPAPLPDSLY-ISGGDEA  414

Query  653   PLPA------ISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLN  492
               PA      +S+R AW+ILL LCK+D  A+ YKD+++AYLFLANNLQYVVVKVR+S L 
Sbjct  415   N-PADLYSSTVSVRIAWVILLTLCKIDGKAQPYKDVALAYLFLANNLQYVVVKVRSSNLK  473

Query  491   RFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQ  312
               LG++W+ K  AKVK YA  +E+L WG V+  +PENP   MSPEE K    +FN  F  
Sbjct  474   LLLGDDWVVKHEAKVKLYADKFEKLAWGKVLDLVPENPKEEMSPEEAKDLVGRFNDEFET  533

Query  311   AHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPED  132
             ++RK ++ V+ D  LRD +K+S+++KL     +F+  ++  +    E    +++++ PED
Sbjct  534   SYRKQTSWVIPDPKLRDQIKISVSQKLTLGCTEFHRLNRSGLVGANE----AVLRYTPED  589

Query  131   VGHHLSDLFF  102
             +G++LSDL+F
Sbjct  590   IGNYLSDLYF  599



>gb|KDP46114.1| hypothetical protein JCGZ_06625 [Jatropha curcas]
Length=622

 Score =   455 bits (1171),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 259/581 (45%), Positives = 377/581 (65%), Gaps = 34/581 (6%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+ME  +E +  +I +W+P +S     TSLF + R EA +F+K V+ L++AM FL  
Sbjct  51    FTKSMMEENIENAELIIRRWDPNSSS----TSLF-QHRDEAREFLKSVKRLRQAMHFLVS  105

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E   S KLV AQNLM +AMKRL+KE + IL+  R  LDPES S  +   S    S     
Sbjct  106   EHSASNKLVLAQNLMIIAMKRLEKELYLILSFQRDQLDPESVSGLSSDGSSNLESKEEKG  165

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
             + +                            +D++ IV+CMIS GYSKEC KVYK  RK 
Sbjct  166   SEEQITTR-----------------------SDLKSIVDCMISSGYSKECVKVYKLFRKS  202

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  LGVE+  FS+IRKM+WE L+  IKNWL+A++IAVKTLF  E++LC  VF+++
Sbjct  203   IVDEGLYLLGVERFRFSQIRKMNWEALDHLIKNWLNAVKIAVKTLFTAEKSLCYYVFSAS  262

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
                IRES F EI++E+A  LF FPE I+   K SPE+ F L++++  +++   EIES F+
Sbjct  263   -QTIRESCFTEITEESATNLFRFPELIS-MCKKSPERSFPLMELHEGLSSLWAEIESTFN  320

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              +S S+IR QA++SL +L D++   ++ FE+ +QKDSSK+   GGGIH LT  AMNY++S
Sbjct  321   SESTSAIRLQAISSLLRLRDSVCAILSDFESTIQKDSSKTLAVGGGIHTLTRTAMNYISS  380

Query  761   IADHSNVLSDIFSNTPPIPKDW-LPDSYFAVSD-SDESPLPAISLRYAWlillllckLDV  588
             + DH   LSDIF+++ P      LP+SYF     SD+   PA+S+  A LIL+LLCKLD 
Sbjct  381   LTDHRTTLSDIFADSFPTGNHASLPESYFESPPMSDDGSTPAVSVCLARLILVLLCKLDR  440

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AE YKD+S++YLF+ANNLQ+++  V T+RL   LGE+W+ K + KV++YA+NYE + W 
Sbjct  441   KAEAYKDVSLSYLFMANNLQFIIQMVTTTRLRILLGEDWVLKHAKKVRKYASNYETMAWT  500

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
              V  SLP+     + PE +K+ F++FNA+F + H+K ++ +VSD  LRD LK S+A+KL+
Sbjct  501   KVFLSLPDKNFPDLQPEAVKECFRRFNAAFEEEHKKQTSWIVSDGKLRDGLKASIAKKLV  560

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               YR+FY  + + +  +K  +   +++F P+D+ ++LSDLF
Sbjct  561   PAYREFYGKYLVLLNGQK--NLEMLIRFCPDDLDNYLSDLF  599



>ref|XP_006850618.1| hypothetical protein AMTR_s00034p00164510 [Amborella trichopoda]
 gb|ERN12199.1| hypothetical protein AMTR_s00034p00164510 [Amborella trichopoda]
Length=614

 Score =   455 bits (1170),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 263/578 (46%), Positives = 379/578 (66%), Gaps = 17/578 (3%)
 Frame = -2

Query  1826  MERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRS  1647
             M+++L  +  MIMKW+  +S  AK+TSLF+ +R+E  ++++ V  L+K M  +      S
Sbjct  35    MDQSLFEAQDMIMKWDANSSAYAKITSLFHSNRKEGKEYLRRVGELRKVMNAIVAADASS  94

Query  1646  EKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfd  1467
              KLV AQ LME AMKRL+KEF+QIL  NR HLDPES S  + + +  S S    S  D  
Sbjct  95    PKLVHAQKLMETAMKRLEKEFYQILASNRDHLDPESVSGRSSARASTSDSEPNDSEDDEI  154

Query  1466  vddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEA  1287
                D+         I EVE VSS  M+D++ I ECMIS GY KEC K+Y  +R+ I+DE 
Sbjct  155   QRADES--------IAEVERVSSLAMSDLQSIAECMISSGYGKECVKIYTLVRRSIVDEG  206

Query  1286  ISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIR  1107
             + +LGVE+ S S   K+DW VLE++IK WL A  +A+KTLF GER LCD+VFAS+ D+IR
Sbjct  207   LYKLGVER-SISA-HKVDWVVLEMKIKVWLHAARVALKTLFAGERILCDHVFASS-DSIR  263

Query  1106  ESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSAS  927
             +S + EI+ EAA+ LF FPE+IAK  K +PE++FR+LDMY+AI++  PEI+++FS +  +
Sbjct  264   QSCYSEIAAEAALSLFSFPESIAK-GKRAPERMFRMLDMYDAISDLWPEIDAVFSDEVMA  322

Query  926   SIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHS  747
             S+R++A+++L KLG+ IR  ++ FE+ +QKD+SK+ V G GIHPLT   MNYL  +AD+ 
Sbjct  323   SVRSKALSALVKLGETIRLLLSDFESAIQKDTSKTPVPGAGIHPLTRYTMNYLGFLADYQ  382

Query  746   NVLSDIFSNTPPIPKDWLPDSYFAVS-DSDESPLPAISLRYAWlillllckLDVIAEHYK  570
             + L +I ++ P    + LP+     S DS  SP  A + R +WL+L+LLCKLD  A+HYK
Sbjct  383   DALGEICADWPLNVPESLPEGLLEYSADSLNSPTSAAAARLSWLVLVLLCKLDGKAQHYK  442

Query  569   DISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASL  390
             D++ +YLFL NNL YVV KV+ S L   LGE W++K +AKVKQYA  +ER+ WG VI +L
Sbjct  443   DVAQSYLFLINNLNYVVAKVQGSELGFLLGEEWIAKHAAKVKQYAPKFERVAWGKVIMTL  502

Query  389   PENPTAPM---SPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPY  219
                  + +   +  E +    +FN +F +A R  S   + D  +R+ LK ++A++++  Y
Sbjct  503   QPGEASSLESINDSEARVRLARFNFAFEEAIRMQSGWSIPDLKIREELKATIAQRVVPAY  562

Query  218   RDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             R FY   + + P + E    S VK+APED+ +H+S LF
Sbjct  563   RSFYVRLRSSAP-QVEMVPGSGVKYAPEDLVNHISHLF  599



>emb|CDY44646.1| BnaC04g06160D, partial [Brassica napus]
Length=698

 Score =   457 bits (1176),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 247/552 (45%), Positives = 362/552 (66%), Gaps = 12/552 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+ME ALE +  +I KW+P +    K+ SLF  SR++A +F++CVR+L++AM FL  
Sbjct  4     FSQSMMEEALESAELIIKKWDPNSQSYTKIISLFRHSRKQAKEFIRCVRDLRRAMHFLVS  63

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S+KLV AQNLM++ M  L+KEFFQIL+ NR HLDP+S S  +  SS +        
Sbjct  64    QASKSDKLVLAQNLMQIGMSTLEKEFFQILSSNRDHLDPDSVSVQSTISSNSEFEVYMEY  123

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               D D +            I++VE  S+ VM+D+++I E MI CGY KEC K Y+ IRK 
Sbjct  124   DEDDDDELKKAGES-----ISQVEKASALVMSDLKVIAETMICCGYGKECIKSYQLIRKS  178

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  LG+EK+  S  +KMDW VLE  IKNW+ A +I V TLF GE+ LCD+VF+++
Sbjct  179   IVDEGLHLLGIEKVKTSHFQKMDWHVLEHMIKNWVKAAKIGVTTLFRGEKLLCDHVFSAS  238

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAK--NSPEKVFRLLDMYNAIANHRPEIESI  948
                I +S F +I+KEA + LF  PE +A   K  +  E++F+L+D+Y AI++  P+IE I
Sbjct  239   V-TIGQSCFNQIAKEAGLNLFMLPELVANKEKKQHHHERIFKLMDLYAAISDLWPDIEMI  297

Query  947   FSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYL  768
             FS DS +S++T  +++L KL D+I T + +FET++ KDSSK     GG+H LT   M++L
Sbjct  298   FSFDSLASVKTLVLSTLKKLKDSIHTCLKEFETMIHKDSSKEISPEGGVHKLTRTTMSFL  357

Query  767   TSIADHS--NVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllc  600
             + ++++S  +VLS+I +  P      L +SYF   + + +     A S+  AWLIL+ LC
Sbjct  358   SLLSEYSRVHVLSEILTEHPLKTNTRLLESYFTAPILEDEHVNNHACSVHLAWLILVFLC  417

Query  599   kLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYER  420
             KLD  AE Y D+S++Y+FL NN+Q+V   VR+S L   LG++WL+K  AK+K YA  YE+
Sbjct  418   KLDTKAESYNDVSLSYIFLVNNMQFVADTVRSSHLKNILGDDWLTKHEAKLKSYAEKYEK  477

Query  419   LGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLA  240
               W +V+ SLP   +A +SPEE    FK+F+A+FA A+ K S+CV+ D  LRD LKVS+ 
Sbjct  478   TAWANVLVSLPSKTSAKLSPEEATTCFKRFHAAFAGAYLKQSSCVIVDAKLRDELKVSIV  537

Query  239   RKLLRPYRDFYD  204
             +KL+  YR+FY+
Sbjct  538   KKLVPEYREFYE  549



>ref|XP_008461614.1| PREDICTED: LOW QUALITY PROTEIN: exocyst complex component EXO70B1 
[Cucumis melo]
Length=618

 Score =   454 bits (1167),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 267/578 (46%), Positives = 374/578 (65%), Gaps = 38/578 (7%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQP  1653
             + ME A+  S P+I KW+P+ASE  ++T LF   R E+ +F+  V +L++AM FL     
Sbjct  58    AAMEEAIVNSEPIITKWDPDASEFNRITFLFRHGRAESEEFLNSVNSLRRAMDFLXSANS  117

Query  1652  RSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsd  1473
              S  LV AQNLM+ AM+RL+KEF+QIL+ NR +LDPES S+ +   S A   TG  S   
Sbjct  118   TSSVLVIAQNLMQAAMRRLEKEFYQILSENRQNLDPESISSRSSDRSTADGETGGDS---  174

Query  1472  fdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIID  1293
                             ITE + VS    AD++ I +CMI  GY KEC K+YK IRK I+D
Sbjct  175   ----------------ITEFDRVS----ADLKSIADCMIDSGYGKECVKIYKVIRKSIVD  214

Query  1292  EAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA  1113
             E + RLG EK   S+I K +W+ LE  IKNW+++++IAV TLF GER LCD+VF S  + 
Sbjct  215   ETLYRLGTEKFKLSRILKWNWDSLENIIKNWMNSVKIAVNTLFRGERFLCDHVF-SRSER  273

Query  1112  IRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDS  933
             IRES F EI+KE A+ LF+FPE +AK  K+S +K+F L+++Y+A ++  PEIE IF   S
Sbjct  274   IRESCFYEITKEGAITLFKFPELVAKGKKDS-DKIFILMELYDANSDVLPEIEFIFDSVS  332

Query  932   ASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIAD  753
              S I+TQA TS+ KL D+IR  +++FE+ +QKDSSK+   GGGIHPLT  AM+Y++++ D
Sbjct  333   TSVIKTQAQTSMTKLADSIRDILSEFESTIQKDSSKNPTPGGGIHPLTRSAMSYISALGD  392

Query  752   HSNVLSDIFS-NTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEH  576
             ++  LSDI +    PIP  ++     A +D+  SP+ A   +  WLIL+LLCKLD  AE 
Sbjct  393   YAATLSDILTVENSPIPSSYM--ETIAAADALSSPVAA---QLGWLILVLLCKLDTKAEV  447

Query  575   YKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIA  396
             Y+D+S++YLFLANNL ++V  V T+ L   +G  W++    KVK YA NYE   W  VI 
Sbjct  448   YRDVSLSYLFLANNLNFIVKTVATTNLKMLIGGEWVANHRTKVKVYATNYEATAWNRVIK  507

Query  395   SLPENPTAPMS-PEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPY  219
             SLPE  +  +  PE   +  K+FNA+F +A+RK ++  V D NLRD LKVS+ARK++  Y
Sbjct  508   SLPERGSEEVGLPETAAEGMKRFNAAFEEAYRKQTSWRVEDGNLRDELKVSIARKIVPIY  567

Query  218   RDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             R+FY+     M      + +  V+F+P+D+G++LSDLF
Sbjct  568   REFYEGCAERM------NVNVGVRFSPDDLGNYLSDLF  599



>ref|XP_004171016.1| PREDICTED: uncharacterized LOC101221801 [Cucumis sativus]
Length=604

 Score =   453 bits (1165),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 265/579 (46%), Positives = 372/579 (64%), Gaps = 40/579 (7%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQP  1653
             + ME A+  S P+I KW+P+ASE  ++T LF   R E+ +F+  V +L++AM F      
Sbjct  43    AAMEEAIVNSEPIITKWDPDASEFNRITFLFRHGRAESEEFLNSVNSLRRAMDFFISANS  102

Query  1652  RSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsd  1473
              S  LV AQ LM+ AM+RL+KEF+QIL+ NR +LDPES S+ +   S A   T   S   
Sbjct  103   TSSVLVIAQKLMQAAMRRLEKEFYQILSENRQNLDPESISSRSSDRSTAEGETVGDS---  159

Query  1472  fdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIID  1293
                             ITE + VS    AD++ I +CMI  GY KEC K+YK IRK I+D
Sbjct  160   ----------------ITEFDRVS----ADLKSIADCMIDSGYGKECVKIYKVIRKSIVD  199

Query  1292  EAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA  1113
             E + RLG EK   S+I K  W+ LE  IKNW+++++IAV TLF GER LCD+VF S  + 
Sbjct  200   ETLYRLGTEKFKLSRILKWSWDSLENIIKNWMNSVKIAVNTLFRGERFLCDHVF-SRSER  258

Query  1112  IRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDS  933
             IRES F EI+KE A+ LF+FPE +AK  K+S +K+F L+++Y+A ++  PEIE IF   S
Sbjct  259   IRESCFYEITKEGAITLFKFPELVAKGKKDS-DKIFILMELYDANSDVLPEIELIFDSVS  317

Query  932   ASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIAD  753
              S IRTQA TS+ KL D+IR  + +FE+ +QKDSSK+   GGGIHPLT  AM+Y++S+ D
Sbjct  318   TSVIRTQAQTSMTKLADSIRDILCEFESTIQKDSSKNPTPGGGIHPLTQSAMSYISSLGD  377

Query  752   HSNVLSDIFS--NTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAE  579
             +++ LSDI +  N+P      +P SY     +D++    ++ +  WLIL+LLCKLD  AE
Sbjct  378   YASTLSDILTVENSP------IPSSYMETIAADDALSSPVAAQLGWLILVLLCKLDTKAE  431

Query  578   HYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVI  399
              Y+D+S++YLFLANNL ++V  V T+ L   +G  W++    KVK YA NYE   W  VI
Sbjct  432   VYRDVSLSYLFLANNLNFIVKTVATTNLKMLIGGEWVANHRTKVKVYATNYEATAWNRVI  491

Query  398   ASLPENPTAPM-SPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRP  222
              SLPE  +  + SPE  ++  K+FNA+F +A+RK ++  V D NLRD LKVS+ARK++  
Sbjct  492   KSLPERGSEEVGSPETAEEGLKRFNAAFEEAYRKQTSWRVEDGNLRDELKVSIARKIVPI  551

Query  221   YRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             YR+FY+     M      + +  V+F+P+D+G++LSDLF
Sbjct  552   YREFYEGCIERM------NVNVGVRFSPDDLGNYLSDLF  584



>ref|XP_004150962.1| PREDICTED: uncharacterized protein LOC101221801 [Cucumis sativus]
Length=619

 Score =   453 bits (1165),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 265/579 (46%), Positives = 372/579 (64%), Gaps = 40/579 (7%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQP  1653
             + ME A+  S P+I KW+P+ASE  ++T LF   R E+ +F+  V +L++AM F      
Sbjct  58    AAMEEAIVNSEPIITKWDPDASEFNRITFLFRHGRAESEEFLNSVNSLRRAMDFFISANS  117

Query  1652  RSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsd  1473
              S  LV AQ LM+ AM+RL+KEF+QIL+ NR +LDPES S+ +   S A   T   S   
Sbjct  118   TSSVLVIAQKLMQAAMRRLEKEFYQILSENRQNLDPESISSRSSDRSTAEGETVGDS---  174

Query  1472  fdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIID  1293
                             ITE + VS    AD++ I +CMI  GY KEC K+YK IRK I+D
Sbjct  175   ----------------ITEFDRVS----ADLKSIADCMIDSGYGKECVKIYKVIRKSIVD  214

Query  1292  EAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA  1113
             E + RLG EK   S+I K  W+ LE  IKNW+++++IAV TLF GER LCD+VF S  + 
Sbjct  215   ETLYRLGTEKFKLSRILKWSWDSLENIIKNWMNSVKIAVNTLFRGERFLCDHVF-SRSER  273

Query  1112  IRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDS  933
             IRES F EI+KE A+ LF+FPE +AK  K+S +K+F L+++Y+A ++  PEIE IF   S
Sbjct  274   IRESCFYEITKEGAITLFKFPELVAKGKKDS-DKIFILMELYDANSDVLPEIELIFDSVS  332

Query  932   ASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIAD  753
              S IRTQA TS+ KL D+IR  + +FE+ +QKDSSK+   GGGIHPLT  AM+Y++S+ D
Sbjct  333   TSVIRTQAQTSMTKLADSIRDILCEFESTIQKDSSKNPTPGGGIHPLTQSAMSYISSLGD  392

Query  752   HSNVLSDIFS--NTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAE  579
             +++ LSDI +  N+P      +P SY     +D++    ++ +  WLIL+LLCKLD  AE
Sbjct  393   YASTLSDILTVENSP------IPSSYMETIAADDALSSPVAAQLGWLILVLLCKLDTKAE  446

Query  578   HYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVI  399
              Y+D+S++YLFLANNL ++V  V T+ L   +G  W++    KVK YA NYE   W  VI
Sbjct  447   VYRDVSLSYLFLANNLNFIVKTVATTNLKMLIGGEWVANHRTKVKVYATNYEATAWNRVI  506

Query  398   ASLPENPTAPM-SPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRP  222
              SLPE  +  + SPE  ++  K+FNA+F +A+RK ++  V D NLRD LKVS+ARK++  
Sbjct  507   KSLPERGSEEVGSPETAEEGLKRFNAAFEEAYRKQTSWRVEDGNLRDELKVSIARKIVPI  566

Query  221   YRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             YR+FY+     M      + +  V+F+P+D+G++LSDLF
Sbjct  567   YREFYEGCIERM------NVNVGVRFSPDDLGNYLSDLF  599



>ref|XP_003597314.1| Exocyst complex component [Medicago truncatula]
 gb|AES67565.1| exocyst subunit exo70 family protein [Medicago truncatula]
Length=588

 Score =   449 bits (1156),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 254/584 (43%), Positives = 374/584 (64%), Gaps = 32/584 (5%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +++++  +E +  +I KWN  ++ +    SLF  +R+EA  ++K V++LQ AM +L  
Sbjct  29    FSDAIVDENIETARTLITKWNTVSTSSNHSNSLFTNTRQEAKRYLKAVKSLQSAMMYLVA  88

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
                 S+KLV AQ+LM++A+K+L+ EF+ IL+ NR   D ES S  + +   +S+S    S
Sbjct  89    RDSTSKKLVEAQSLMQLAIKKLENEFYGILSQNRDRFDSESISFRSSTDRRSSSSDEEFS  148

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               D                    + VS   +AD++ I ECMI  GYSKEC  +Y  +RK 
Sbjct  149   DDDGSSLA--------------ADSVSMSAVADLKAIAECMIFTGYSKECVNIYLIVRKS  194

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS-  1125
             I+DEA+  LGVE +SFS+I+KMDWE+LE ++K WL+A+++AV TLF+GER LC+ +F S 
Sbjct  195   IMDEALYNLGVENLSFSQIQKMDWEMLEYKMKCWLNAVKVAVNTLFHGERILCNYIFDSP  254

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
               + I ES F +I +E+A++LF FPEN+AK  K +PEK+FR LD+Y AI+ +  +IESIF
Sbjct  255   EKNNIGESCFADICRESALMLFAFPENVAK-CKKTPEKMFRTLDLYEAISENWNQIESIF  313

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
             S +S S IR+Q V S  +LG+ +RT +  FE+ +QK+SSK  V GGGIHPLT   MNY+ 
Sbjct  314   SSESNSPIRSQVVASQVRLGETVRTMLTDFESAIQKESSKIPVPGGGIHPLTRYVMNYIA  373

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPA-ISLRYAWlillllckLDV  588
              +AD+S  + DI S+ P  P   +P+SY+     DE   P+ I+ R +WLIL++LCKLD 
Sbjct  374   LLADYSEAIGDIVSDWPQTP---VPESYYKSPIHDEDNPPSEIAKRLSWLILVVLCKLDG  430

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AE YKD++++YLFLANN+QYVVVKVR S L   LGE+WL K   KVK+Y   YER+ W 
Sbjct  431   KAEFYKDVALSYLFLANNMQYVVVKVRKSNLRFILGEDWLLKHEMKVKEYVTKYERMAWS  490

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
              V++S+PENPT     E+  ++F+ FN  F +A R     VV D  LR+ +K SL  K++
Sbjct  491   KVLSSIPENPTV----EKASENFQGFNVEFDEAFRMQYLWVVPDLELRNEIKESLVSKIV  546

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFEP  96
               YR+FY   ++ +         S+++++PED+  +LS++   P
Sbjct  547   FKYREFYVKFRVGL--------DSVIRYSPEDLKEYLSEILRGP  582



>ref|XP_009120489.1| PREDICTED: exocyst complex component EXO70A1-like [Brassica rapa]
Length=628

 Score =   449 bits (1156),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 259/590 (44%), Positives = 377/590 (64%), Gaps = 28/590 (5%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             E+ ++  +     +I KW   + E    T+    SR EA +FV+ VR+L   M  L    
Sbjct  23    ETAVQECMSDITTVISKWTSSSDEFLFSTN----SRSEAEEFVEVVRHLHSTMHRLVAVN  78

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
             P SEKL+ AQNLM+ AM  L+ EF ++L  N+ +L PES S  +  SS   +++  +S S
Sbjct  79    PSSEKLIYAQNLMQSAMNLLESEFHRVLKENKQYLHPESVSLRSCRSSRRFSTSTVTSIS  138

Query  1475  dfdvddddddvrvagdSITE-VEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWI  1299
             D + +           +         S  M D+++I +CMIS GY+KEC KVYK +R+ I
Sbjct  139   DSEDEGGGSYEENPAAADEHRFSGGDSDAMDDLKMIADCMISTGYAKECVKVYKTVRRSI  198

Query  1298  IDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTP  1119
             +DE +  L VE+++  +I+KMDWE+LE +IK+WL A ++AV+ LF GER L D+VF+S+ 
Sbjct  199   VDETLHSLSVERLTLHQIQKMDWEILEPKIKSWLQAAKLAVRKLFFGERILADHVFSSST  258

Query  1118  DAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSM  939
             + I E+ F +I++E A+ LF FPE+ AK  K SPEK+FR LDMY ++AN   EIESIF  
Sbjct  259   N-IVEASFTDITQEGALTLFSFPEHAAKIKKLSPEKMFRFLDMYESLANLFVEIESIFYF  317

Query  938   DSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSI  759
             DSA+++R+Q + SLAKLGDA+R  ++ FET +QK++SK+ + GGG+HPLT   MNYL+ +
Sbjct  318   DSAAAVRSQVINSLAKLGDAVRFMMSDFETAIQKEASKTLIVGGGVHPLTRYVMNYLSFL  377

Query  758   ADHSNVLSDIFSN---TPPIPKDWLPDSYFAVSDSDE--------SPLPAISLRYAWlil  612
             AD+   +S IF N   T P P   LP+S F     D+        SP   +S R AW+IL
Sbjct  378   ADYDESISVIFENWQLTVPSP---LPESLFISGGGDDAHPEDLYSSP---VSKRIAWVIL  431

Query  611   lllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAA  432
             L LCK+D  A+ YKD++++YLFLANNLQYVVVKVR+S L   LG++W+ +   KV QYA 
Sbjct  432   LTLCKIDGKAQPYKDVALSYLFLANNLQYVVVKVRSSNLRLLLGDDWVVRHEGKVNQYAE  491

Query  431   NYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLK  252
               E+L WG V+ SLPENP   ++PEE +  F +FN  F  A+RK  + V+ D NLRD +K
Sbjct  492   KCEKLAWGKVLTSLPENPAEEITPEEARALFARFNDEFEAAYRKQISWVIPDPNLRDRIK  551

Query  251   VSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             +SL++KL+    +FY+ ++  +  +    F+  V++ PED+G++LSDL+F
Sbjct  552   ISLSQKLMLVCTEFYEVNRFGLGGDA---FN--VRYTPEDIGNYLSDLYF  596



>gb|AAN31913.1| unknown protein [Arabidopsis thaliana]
Length=634

 Score =   449 bits (1154),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 258/587 (44%), Positives = 375/587 (64%), Gaps = 21/587 (4%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             ES ++  +     +I KW   A+ ++        SRREA +FV  VR+LQ  M  L    
Sbjct  23    ESAVQECMSNINTVISKWTSPAASSSDDFLFSTNSRREAEEFVTAVRHLQSTMHRLVSVN  82

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
             P SEKL+ AQNLM+ AMK L+ EF ++L  NR +LDPE  S  +  SS  STST  S + 
Sbjct  83    PSSEKLIYAQNLMQSAMKLLESEFHRVLKANREYLDPECVSVRSYRSSRFSTSTTTSVSD  142

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
               D    +++            D     M D+++I +CMIS GY+KEC +VYK +RK I+
Sbjct  143   SEDESSYEENADEEHRFSGGDSDA----MDDLKMIADCMISTGYAKECVRVYKTVRKSIV  198

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DE +  L +E+ +  +++KMDWE+LE +IK WL A+++AV+ LF GER L D+VF+S+  
Sbjct  199   DETLHNLQMERFNLHQVQKMDWEILESKIKTWLKAVKLAVRKLFFGERILADHVFSSS-G  257

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
              I ES F EI++E A+ILF FPE  +K  K +PEK+FR LDMY A+AN   EIESIF  +
Sbjct  258   LIVESSFTEITQEGALILFTFPEYASKIKKLTPEKMFRFLDMYEALANLYVEIESIFYFE  317

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             SA+++R+Q + SLA+LGDA R  +  FE+ +QK++SK+ + GGG+HPLT   MNYL+ +A
Sbjct  318   SAAAVRSQVINSLARLGDATRLMMTDFESAIQKETSKTPIIGGGVHPLTRYVMNYLSFLA  377

Query  755   DHSNVLSDIFSN---TPPIPKDWLPDSYFAVSDSDESP----LPAISLRYAWlillllck  597
             D+S+ ++ IF N   + P P   LPDS +     + +P       +S+R AW+ILL LCK
Sbjct  378   DYSDSIAAIFENWKLSVPTP---LPDSLYISGGDEANPEDLYSSTVSVRIAWVILLTLCK  434

Query  596   LDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERL  417
             +D  A+ YKD++++YLFLANNLQYVVVKVR+S L   LG++W+ +   KVK YA  +E+L
Sbjct  435   IDGKAQPYKDVALSYLFLANNLQYVVVKVRSSTLKVLLGDDWVFRHEEKVKLYADKFEKL  494

Query  416   GWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLAR  237
              WG V+  LPE PT  +SPEE K    +FN  F  ++RK ++ V+ D  LRD +K++L++
Sbjct  495   AWGKVLDLLPEIPTDEISPEEAKVLVARFNDEFETSYRKQTSWVIPDPKLRDQIKITLSQ  554

Query  236   KLLRPYRDFYDTHKLT--MPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             KL+    +FY  ++    M  + E    +I ++ PED+G++LSDL+F
Sbjct  555   KLMLVCTEFYRMNRFAYGMVGDNE----AISRYTPEDIGNYLSDLYF  597



>ref|NP_001032105.1| exocyst subunit exo70 family protein H7 [Arabidopsis thaliana]
 gb|AED97225.1| exocyst subunit exo70 family protein H7 [Arabidopsis thaliana]
Length=632

 Score =   448 bits (1153),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 258/587 (44%), Positives = 375/587 (64%), Gaps = 21/587 (4%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             ES ++  +     +I KW   A+ ++        SRREA +FV  VR+LQ  M  L    
Sbjct  23    ESAVQECMSNINTVISKWTSPAASSSDDFLFSTNSRREAEEFVTAVRHLQSTMHRLVSVN  82

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
             P SEKL+ AQNLM+ AMK L+ EF ++L  NR +LDPE  S  +  SS  STST  S + 
Sbjct  83    PSSEKLIYAQNLMQSAMKLLESEFHRVLKANREYLDPECVSVRSYRSSRFSTSTTTSVSD  142

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
               D    +++            D     M D+++I +CMIS GY+KEC +VYK +RK I+
Sbjct  143   SEDESSYEENADEEHRFSGGDSDA----MDDLKMIADCMISTGYAKECVRVYKTVRKSIV  198

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DE +  L +E+ +  +++KMDWE+LE +IK WL A+++AV+ LF GER L D+VF+S+  
Sbjct  199   DETLHNLQMERFNLHQVQKMDWEILESKIKTWLKAVKLAVRKLFFGERILADHVFSSS-G  257

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
              I ES F EI++E A+ILF FPE  +K  K +PEK+FR LDMY A+AN   EIESIF  +
Sbjct  258   LIVESSFTEITQEGALILFTFPEYASKIKKLTPEKMFRFLDMYEALANLYVEIESIFYFE  317

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             SA+++R+Q + SLA+LGDA R  +  FE+ +QK++SK+ + GGG+HPLT   MNYL+ +A
Sbjct  318   SAAAVRSQVINSLARLGDATRLMMTDFESAIQKETSKTPIIGGGVHPLTRYVMNYLSFLA  377

Query  755   DHSNVLSDIFSN---TPPIPKDWLPDSYFAVSDSDESP----LPAISLRYAWlillllck  597
             D+S+ ++ IF N   + P P   LPDS +     + +P       +S+R AW+ILL LCK
Sbjct  378   DYSDSIAAIFENWKLSVPTP---LPDSLYISGGDEANPEDLYSSPVSVRIAWVILLTLCK  434

Query  596   LDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERL  417
             +D  A+ YKD++++YLFLANNLQYVVVKVR+S L   LG++W+ +   KVK YA  +E+L
Sbjct  435   IDGKAQPYKDVALSYLFLANNLQYVVVKVRSSTLKVLLGDDWVFRHEEKVKLYADKFEKL  494

Query  416   GWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLAR  237
              WG V+  LPE PT  +SPEE K    +FN  F  ++RK ++ V+ D  LRD +K++L++
Sbjct  495   AWGKVLDLLPEIPTDEISPEEAKVLVARFNDEFETSYRKQTSWVIPDPKLRDQIKITLSQ  554

Query  236   KLLRPYRDFYDTHKLT--MPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             KL+    +FY  ++    M  + E    +I ++ PED+G++LSDL+F
Sbjct  555   KLMLVCTEFYRMNRFAYGMVGDNE----AISRYTPEDIGNYLSDLYF  597



>ref|NP_200781.1| exocyst subunit exo70 family protein H7 [Arabidopsis thaliana]
 gb|AAK25889.1|AF360179_1 unknown protein [Arabidopsis thaliana]
 dbj|BAB09510.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59417.1| unknown protein [Arabidopsis thaliana]
 gb|AAK74029.1| AT5g59730/mth12_130 [Arabidopsis thaliana]
 gb|AAL31140.1| AT5g59730/mth12_130 [Arabidopsis thaliana]
 gb|AAL34270.1| unknown protein [Arabidopsis thaliana]
 gb|AED97224.1| exocyst subunit exo70 family protein H7 [Arabidopsis thaliana]
Length=634

 Score =   447 bits (1151),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 258/587 (44%), Positives = 375/587 (64%), Gaps = 21/587 (4%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             ES ++  +     +I KW   A+ ++        SRREA +FV  VR+LQ  M  L    
Sbjct  23    ESAVQECMSNINTVISKWTSPAASSSDDFLFSTNSRREAEEFVTAVRHLQSTMHRLVSVN  82

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
             P SEKL+ AQNLM+ AMK L+ EF ++L  NR +LDPE  S  +  SS  STST  S + 
Sbjct  83    PSSEKLIYAQNLMQSAMKLLESEFHRVLKANREYLDPECVSVRSYRSSRFSTSTTTSVSD  142

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
               D    +++            D     M D+++I +CMIS GY+KEC +VYK +RK I+
Sbjct  143   SEDESSYEENADEEHRFSGGDSDA----MDDLKMIADCMISTGYAKECVRVYKTVRKSIV  198

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DE +  L +E+ +  +++KMDWE+LE +IK WL A+++AV+ LF GER L D+VF+S+  
Sbjct  199   DETLHNLQMERFNLHQVQKMDWEILESKIKTWLKAVKLAVRKLFFGERILADHVFSSS-G  257

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
              I ES F EI++E A+ILF FPE  +K  K +PEK+FR LDMY A+AN   EIESIF  +
Sbjct  258   LIVESSFTEITQEGALILFTFPEYASKIKKLTPEKMFRFLDMYEALANLYVEIESIFYFE  317

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             SA+++R+Q + SLA+LGDA R  +  FE+ +QK++SK+ + GGG+HPLT   MNYL+ +A
Sbjct  318   SAAAVRSQVINSLARLGDATRLMMTDFESAIQKETSKTPIIGGGVHPLTRYVMNYLSFLA  377

Query  755   DHSNVLSDIFSN---TPPIPKDWLPDSYFAVSDSDESP----LPAISLRYAWlillllck  597
             D+S+ ++ IF N   + P P   LPDS +     + +P       +S+R AW+ILL LCK
Sbjct  378   DYSDSIAAIFENWKLSVPTP---LPDSLYISGGDEANPEDLYSSPVSVRIAWVILLTLCK  434

Query  596   LDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERL  417
             +D  A+ YKD++++YLFLANNLQYVVVKVR+S L   LG++W+ +   KVK YA  +E+L
Sbjct  435   IDGKAQPYKDVALSYLFLANNLQYVVVKVRSSTLKVLLGDDWVFRHEEKVKLYADKFEKL  494

Query  416   GWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLAR  237
              WG V+  LPE PT  +SPEE K    +FN  F  ++RK ++ V+ D  LRD +K++L++
Sbjct  495   AWGKVLDLLPEIPTDEISPEEAKVLVARFNDEFETSYRKQTSWVIPDPKLRDQIKITLSQ  554

Query  236   KLLRPYRDFYDTHKLT--MPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             KL+    +FY  ++    M  + E    +I ++ PED+G++LSDL+F
Sbjct  555   KLMLVCTEFYRMNRFAYGMVGDNE----AISRYTPEDIGNYLSDLYF  597



>ref|XP_010032272.1| PREDICTED: exocyst complex component EXO70A1-like [Eucalyptus 
grandis]
Length=617

 Score =   446 bits (1148),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 259/617 (42%), Positives = 380/617 (62%), Gaps = 29/617 (5%)
 Frame = -2

Query  1937  MPRKGMRLI-----GFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPE  1773
             MPRKG+  +       SP+Y   S             F ES+ME  +E +  +I KW+  
Sbjct  1     MPRKGISNLFLSSKPLSPSY---SFPSPHVQLTPKHTFSESMMEENIENAESIITKWDLN  57

Query  1772  ASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQ  1593
              S+   V SLF ++RRE+  F+  V++L++AM  L      S+KLV AQNLM++AMKRL+
Sbjct  58    NSDNT-VPSLFQDNRRESMQFLTSVKDLRQAMDSLLSTNSNSDKLVLAQNLMQIAMKRLE  116

Query  1592  KEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEV  1413
             KEF  IL+ ++  LDPES    +   S           S                 ITE 
Sbjct  117   KEFHHILSTDQNQLDPESILGRSFGGSSTFDCEIEEECSGEL--------------ITEA  162

Query  1412  EDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMD  1233
               +S   M D+  I +CMIS GY  EC K+YK +RK   DE + +LG+E+   ++I+K+ 
Sbjct  163   GPISELAMVDLNSIADCMISSGYGSECVKIYKLVRKSFTDENLYQLGIERFRSAQIQKLS  222

Query  1232  WEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEF  1053
             W  L+  IKNWL+A+++AVK +F GE+ LCD+VF+++ + IRES F +I+K+ A+ LF F
Sbjct  223   WTALDHMIKNWLTAVKVAVKNIFRGEKILCDHVFSAS-NIIRESCFSDITKDGAINLFRF  281

Query  1052  PENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIR  873
             PE IA   K S  K++R +++Y A     P+IESIFS +S S +  QA++SL  LG  I 
Sbjct  282   PE-IASRNKPSTGKIYRFMELYEATYQLWPDIESIFSYESTSGVNLQALSSLVSLGKTIH  340

Query  872   TGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDW-  696
               IA+FE+ +Q +SS++TV GGG+HPLT   M +++S+ D+S +LS++ S+  P+P ++ 
Sbjct  341   NIIAEFESTIQNNSSRTTVPGGGVHPLTQSVMAFISSLVDYSEILSEVLSDH-PLPNNFT  399

Query  695   LPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVV  516
             +P+S F     ++ P  A+ +    LIL+LLCKLD  AE YKD+S++YLFLANNL YVV 
Sbjct  400   MPESNFESPGQEDGPTTAVPVHLVRLILVLLCKLDTKAELYKDVSLSYLFLANNLNYVVE  459

Query  515   KVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFK  336
             KV  + LN  LG  WLS+ + KV+QYA++YE L W  V +SLPE+ +A  S E  K  F+
Sbjct  460   KVTITNLNYQLGHEWLSRHARKVEQYASSYEALAWNKVFSSLPESNSAGTSVEAGKGIFR  519

Query  335   KFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSS  156
             KFNA+F +A +K ++ V+ DR LRD +KVS+ +KL   YR+FYDT+   +  E +     
Sbjct  520   KFNAAFEEAWQKQTSLVIPDRRLRDKVKVSIVKKLTPAYREFYDTYLGMLSGETD--LGV  577

Query  155   IVKFAPEDVGHHLSDLF  105
             +V+F P D+ ++LSDLF
Sbjct  578   LVRFGPHDLENYLSDLF  594



>emb|CDX80235.1| BnaC09g35070D [Brassica napus]
Length=626

 Score =   446 bits (1148),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 260/589 (44%), Positives = 379/589 (64%), Gaps = 28/589 (5%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             E+ ++  +     +I KW   + E    T+    SR EA +FV+ VR+L   M  L    
Sbjct  23    ETAVQECMRDITTVISKWTSSSDEFLFSTN----SRSEAAEFVEVVRHLHSTMHRLVAVS  78

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
             P SEKL+ AQNLM+ AM  L+ EF ++L  N+ +L PES S  +  SS   +++  +S S
Sbjct  79    PSSEKLIYAQNLMQSAMNLLESEFHRVLKENKQYLHPESVSLRSCRSSRRFSTSTVTSIS  138

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
             D + +    +   A D         S  M D+++I +CMIS GY+KEC  VYK +R+ I+
Sbjct  139   DSEDEGGSYEENAAADE-HRFSGGDSDAMDDLKMIADCMISTGYAKECVNVYKTVRRSIV  197

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DE +  L VE+++  +I+KMDWE+LE +IK+WL A ++AV+ LF GER L D+VF+S+ +
Sbjct  198   DETLHNLSVERLTLHQIQKMDWEILEPKIKSWLQAAKLAVRKLFFGERILADHVFSSSTN  257

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
              I E+ F +I++E A+ LF FPE+ AK  K SPEK+FR LDMY ++AN   EIESIF  D
Sbjct  258   -IVEASFTDITQEGALALFAFPEHAAKIKKLSPEKMFRFLDMYESLANLFVEIESIFYFD  316

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             SA+++R+Q + SLAKLGDA+R  +  FET +QK++SK+ + GGG+HPLT   MNYL+ +A
Sbjct  317   SAAAVRSQVINSLAKLGDAVRFMMNDFETAIQKEASKTLIVGGGVHPLTRYVMNYLSFLA  376

Query  755   DHSNVLSDIFSN---TPPIPKDWLPDSYFAVSDSDE--------SPLPAISLRYAWlill  609
             D+   +S IF N   T P P   LP+S F     D+        SP   +S R AW+ILL
Sbjct  377   DYDESISVIFENWQLTVPSP---LPESLFISGGGDDAHPEDLYSSP---VSKRIAWVILL  430

Query  608   llckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAAN  429
              LCK+D  A+ YKD++++YLFLANNLQYVVVKVR+S L   LG++W+ K  AKV QYA  
Sbjct  431   TLCKIDGKAQPYKDVALSYLFLANNLQYVVVKVRSSNLRLLLGDDWVVKHEAKVNQYAEK  490

Query  428   YERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKV  249
             +E+L +G V+ SLPENP   ++PEE +  F +FN  F  A+RK  + V+ D NLRD +K+
Sbjct  491   FEKLAYGKVLTSLPENPAEKITPEEARALFARFNDEFEAAYRKQISWVIPDPNLRDRIKI  550

Query  248   SLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             SL++KL+    +FY+ ++  +  +    F++  ++ PED+G++LSDL+F
Sbjct  551   SLSQKLMLVCTEFYEVNRFALGGDA---FNA--RYTPEDIGNYLSDLYF  594



>ref|XP_009141801.1| PREDICTED: LOW QUALITY PROTEIN: exocyst complex component EXO70A1 
[Brassica rapa]
Length=628

 Score =   446 bits (1148),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 252/583 (43%), Positives = 369/583 (63%), Gaps = 20/583 (3%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F  S++E  L+ + P+I KW+P      K  SLF  SR++A +F+ CVR+L++AM FL  
Sbjct  37    FSLSMVEETLDSTEPIIKKWDPNT----KTISLFSHSRKQAKEFIICVRDLRRAMHFLVS  92

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S  LV   +LME+AM RL+KEFF IL+ N   LDPES S  +  SS +       S
Sbjct  93    QHSQSPNLVLTHSLMEIAMSRLEKEFFMILSSNLDQLDPESVSGHSSISSYSEFEYVMQS  152

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               + +   +          I+EVE  S+ VM+D+++I E MISCGY KEC K YK IRK 
Sbjct  153   DDEMEKASES---------ISEVEKASALVMSDLKVIAETMISCGYGKECIKSYKMIRKS  203

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  LG++K   S   + DW VLE  IKNW+ A +I V TLF GE+ LCD+VF+S+
Sbjct  204   IVDEGLHLLGIQKCKISLFNRTDWSVLEPMIKNWIKAAKIGVTTLFKGEKLLCDHVFSSS  263

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIA-KYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
                IR+S F EI+ E+ + LF  PE +  K  K  PE++F+L+D+Y AI+  RPEIE IF
Sbjct  264   T-TIRDSCFYEIANESGLNLFSLPELVVNKEKKPPPERIFKLMDLYAAISELRPEIELIF  322

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
             + DS +S++T A++SL KL ++I T + +FE  +QKDSSK+   GGGIH LT   M++++
Sbjct  323   NFDSVASVKTLAISSLKKLKNSIHTCLTEFELTIQKDSSKALTPGGGIHRLTRTTMSFIS  382

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllckLD  591
             S++ +S VLS+  +           +SYF   + + +     A S+  AWLIL+LLCKLD
Sbjct  383   SLSGYSRVLSEALAEHAIKRNTRFLESYFTAPILEDEHINHHATSVHIAWLILVLLCKLD  442

Query  590   VIAEHYKDISIAYLFLANNLQYVVVKVR-TSRLNRFLGENWLSKQSAKVKQYAANYERLG  414
             + AE YKD+S++YLFL NN++ VV  VR T  L   LG++WL+K  AK++ Y  NYE   
Sbjct  443   IKAESYKDVSLSYLFLVNNIRLVVDTVRSTHHLRNLLGDDWLTKHEAKLRSYTTNYENAA  502

Query  413   WGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
             W  V  ++P   +  +SP++ K HFK+F+ +F +A+ K S+CV+ D  LRD  KV +ARK
Sbjct  503   WAKVYQTVPVRTSTTLSPDQAKTHFKRFHVAFEEAYMKQSSCVILDAKLRDEFKVYIARK  562

Query  233   LLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             L+  Y++FY  + L M +E E +   +V+F P+++ ++LSDLF
Sbjct  563   LVPEYKEFYQKY-LPMLRE-EINIEMLVRFKPDNLENYLSDLF  603



>ref|XP_009419954.1| PREDICTED: exocyst complex component EXO70A1-like [Musa acuminata 
subsp. malaccensis]
Length=639

 Score =   446 bits (1148),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 254/589 (43%), Positives = 373/589 (63%), Gaps = 41/589 (7%)
 Frame = -2

Query  1796  MIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQ-FLAMEQPRSEK---LVRA  1629
             +++KW+PE+S  AK+TSLFYE R EA  F+    +LQ+AM  F+A  +P S     LVRA
Sbjct  51    VVIKWDPESSAYAKITSLFYEDRSEARKFLAEASDLQRAMLVFVADAEPASLSHPCLVRA  110

Query  1628  QNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddd  1449
             Q LM+ AM+RL+KEFFQIL  NR  LDPES S  +  SSV+         +  + +    
Sbjct  111   QTLMQAAMRRLEKEFFQILAANRDLLDPESVSVRSAYSSVSEGPDYDPWENSPEEEAHLA  170

Query  1448  dvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGV  1269
                     I EVE  +  VMAD+R I + M+  GY KEC + YK +RK I+DE + RLG 
Sbjct  171   GKS-----IGEVERAAGVVMADLRAIADTMVFAGYRKECVRTYKSLRKSIVDEGLYRLGF  225

Query  1268  EKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKE  1089
             E+++ ++I+K+DW VLEL++++WL A  +AV+TLF+GER L D+VFA + DA+RE +F +
Sbjct  226   ERLAPAQIQKLDWAVLELKVRSWLVASSVAVRTLFHGERVLLDHVFAGS-DAVREVVFAD  284

Query  1088  ISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQA  909
             I+ EAA+    FPE++AK +K SPEK+FRLLD+Y+A+   RP+IE IFS DS ++IR QA
Sbjct  285   IAGEAALQFLGFPESVAK-SKRSPEKLFRLLDLYDAVTELRPDIELIFSFDSTAAIRAQA  343

Query  908   VTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDI  729
             + SL+KL +A    +A FE+ + K+SS+STV GGG+HP+T +AMNY++ +AD+ + L +I
Sbjct  344   LASLSKLAEAASATLADFESAIMKESSRSTVPGGGVHPVTRNAMNYISLLADYQSALVEI  403

Query  728   FSN----TPPIPKDWLPDSYFAVSDSDES-----------------PLPAISLRYAWlil  612
              ++    TP     +L D++ A ++   +                    AI++R+AWLIL
Sbjct  404   LADFPIQTPTAIPAFLFDTWQAPTEQQTAVSGSSSTPASSSSSEGSRRSAIAVRFAWLIL  463

Query  611   lllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAA  432
              LLCKLD  A  Y+D+ ++YLFLANNLQY+V KVR+ RL   LGE W ++Q+AK +Q+AA
Sbjct  464   SLLCKLDEKAAAYRDVGLSYLFLANNLQYIVNKVRSCRLRELLGEEWATRQAAKARQHAA  523

Query  431   NYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLK  252
              YER  WG V A++   PT  +S  E +   + FNA+  +     S  VV+D  +R+ ++
Sbjct  524   GYERAAWGRVAATI---PTGNVSAGEARGGMRAFNAALEEVRAAGSGWVVADAAMREEVR  580

Query  251   VSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              ++ R +L  YR FY   +  M        ++ V  +P+DVG+ L +LF
Sbjct  581   ANVRRMILPAYRGFYTLWETAMED------AAAVLLSPDDVGNRLGELF  623



>emb|CDX74848.1| BnaA05g05940D [Brassica napus]
Length=610

 Score =   441 bits (1134),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 250/583 (43%), Positives = 367/583 (63%), Gaps = 38/583 (7%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+ME ALE +  +I KW+P +    K+ S+F  SR+EA +F++C+R+L++AM FL  
Sbjct  37    FSQSMMEEALESAETIIKKWDPNSQSYTKIISMFRNSRKEAKEFIRCIRDLRRAMHFLVS  96

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +  +S+KLV AQNLM++ M  L+KEFFQIL+ NR HLDPES+S  +  SS +       +
Sbjct  97    QDSKSDKLVLAQNLMQIGMSTLEKEFFQILSSNRDHLDPESASGQSTISSNSEFEVVMEN  156

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYS-KECFKVYKDIRK  1305
                                  +VED +             +   G S  +C K YK IRK
Sbjct  157   DD------------------DDVEDAA-------------LKKAGESISQCIKSYKLIRK  185

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              I+DE +  LG+EK+  S+ +KMDW VLE  IKNW+ A +I V TLF GE+ LCD+VF++
Sbjct  186   SIVDEGLHLLGIEKVKTSQFQKMDWGVLEHMIKNWIKAAKIGVTTLFRGEKLLCDHVFSA  245

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIA-KYAKNSPEKVFRLLDMYNAIANHRPEIESI  948
             +   I +S F +I+KEA + LF FPE +A K  K   E++F+L+D+Y AI++  P+IE I
Sbjct  246   SI-TIGQSCFNQIAKEAGLNLFMFPELVASKEKKPHHERIFKLMDLYAAISDLWPDIEMI  304

Query  947   FSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYL  768
             FS DS +S++T  +++L KL D+I T + +FE  + KDSSK     GG+H LT   M+++
Sbjct  305   FSFDSLASVKTIILSTLKKLKDSIHTCLKEFEVTIHKDSSKELTPEGGVHKLTRTTMSFI  364

Query  767   TSIADHSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllckL  594
             +S++ +S VLS+I +  P      L + YF   + + +       S+  A LIL+ LCKL
Sbjct  365   SSLSKYSRVLSEILAENPLKRNTRLLEYYFTAPILEDEHVNNHTFSVYLASLILVFLCKL  424

Query  593   DVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLG  414
             D  AE YKD+S++Y+FL NNLQ+VVV VR++RL   LG++WL+K  AK++ YAA YE   
Sbjct  425   DTKAESYKDVSLSYIFLVNNLQFVVVTVRSTRLKSLLGDDWLTKHEAKLRSYAAKYEIAA  484

Query  413   WGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
             W +V ASLP   +  +SPEE    FK+F+ASFA A+ K S+CV+ D  LRD LKVS+ARK
Sbjct  485   WTNVFASLPAKTSTKLSPEEAATCFKRFHASFAGAYMKQSSCVIEDAKLRDELKVSIARK  544

Query  233   LLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             L+  YR FY+ + L +  + +R+   +V F P+++ ++LSDLF
Sbjct  545   LVPEYRKFYEKYLLIL--KHDRNIEMLVSFKPDNLENYLSDLF  585



>ref|XP_004240195.1| PREDICTED: exocyst complex component EXO70A1 [Solanum lycopersicum]
Length=645

 Score =   441 bits (1135),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 251/581 (43%), Positives = 379/581 (65%), Gaps = 10/581 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F  S+ME  ++ +  +I KW+ + S   K TSLF E R+EA  +++CV++L+KAM F   
Sbjct  50    FSRSIMEEHIDNASTIIKKWDHKESSHEKFTSLFQEDRKEAKAYIQCVKDLKKAMHFFVT  109

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +     KLV AQNLM+ AMKRL+ EF+QIL+  + HLDPES S S+RSS  + +++  S 
Sbjct  110   QHSTCNKLVLAQNLMQKAMKRLENEFYQILSTKKQHLDPESISKSSRSSHTSRSTSVDSE  169

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
              S    +      +    S +E E +S   M D+++I +CMI CGY+KEC+K+Y+ IRK 
Sbjct  170   ESTDLGNGSSTIQQNGAGSNSEAEHISFLTMCDLKMIADCMIGCGYAKECWKIYRIIRKS  229

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             ++DE + RLG+E  S + +  M    LE ++K+W+ + ++AVKTLF GER LCD+VF S 
Sbjct  230   VVDEGLYRLGIESRSSAYVNAMRPNDLEHQVKHWIDSTKMAVKTLFYGERLLCDHVF-SN  288

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
                I E+ F +++KE  ++L + PE +AK  K S EK+F L+D++ AIA   P+IESIFS
Sbjct  289   SKTINETCFSDVAKEGGIVLLKLPEIVAK-TKKSDEKIFVLIDLHEAIAELLPQIESIFS  347

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              DS SS++ QA++ L KL  ++   ++ FE  +Q++SSK+TV+GGG+HPLTI   +YL S
Sbjct  348   FDSISSVKLQAISLLNKLKISVLNILSDFELSIQRNSSKTTVSGGGVHPLTISVSDYLAS  407

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIA  582
             +A +S VLSDI S +         ++YF   +S  S + ++S + AW++L+LLCKLD  A
Sbjct  408   LASYSGVLSDIISESTSTK---FSETYF---ESQTSEISSVSGKMAWIVLVLLCKLDSKA  461

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
             E Y DI+++YLFLANN+Q+++ +VR S L+  LGE W+     KVK Y   YE + W  V
Sbjct  462   ELYNDIALSYLFLANNIQFIIERVRGSNLSIILGEEWILNLERKVKLYTTKYENVAWNKV  521

Query  401   IASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRP  222
                LP++    +S + IK++FK+FN SF   +++  + VV D  LRD +KVS+ARKL+  
Sbjct  522   FMCLPQSLDPAISSDTIKEYFKRFNESFEATYQRQKSWVVPDGTLRDEIKVSIARKLVPF  581

Query  221   YRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
             YRDFY+ + + +  EK+     +VKF+P+++G+ LSDLF E
Sbjct  582   YRDFYEYYMVVLSGEKD--LEVLVKFSPDNIGNCLSDLFHE  620



>ref|XP_010937728.1| PREDICTED: exocyst complex component EXO70A1-like [Elaeis guineensis]
Length=649

 Score =   441 bits (1134),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 270/636 (42%), Positives = 395/636 (62%), Gaps = 43/636 (7%)
 Frame = -2

Query  1937  MPRKGMRLI---GFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEAS  1767
             MPRKGMR +    FS  +    S    SP         ++ME  +     +I KW+P+AS
Sbjct  1     MPRKGMRSLLPSHFSFRHHDGRSPAPPSPPQQQQSSSATMMEGKVTAVEAIITKWDPDAS  60

Query  1766  EAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPR----SEKLVRAQNLMEVAMKR  1599
               AK+TSLFYE R EA  F+  V +L  AM     ++      S+ LV AQNLM+ AM+R
Sbjct  61    SFAKITSLFYEDRAEARRFLLAVSDLHHAMLDFVSDKGNLVSGSDTLVLAQNLMQAAMRR  120

Query  1598  LQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSIT  1419
             L+KEF+QIL+ NR  LDPES SA +  SSV+        + D D+    +        I 
Sbjct  121   LEKEFYQILSANRDRLDPESVSARSSGSSVSDAEDDAGGSPDDDIRVAGES-------IG  173

Query  1418  EVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRK  1239
             +VE  ++  MAD+  I E MIS GY KECF++YK +RK IIDE + RLG EK+S S+I+K
Sbjct  174   DVELAATVAMADLHAIAETMISAGYGKECFRIYKILRKSIIDECLYRLGFEKLSPSQIQK  233

Query  1238  MDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILF  1059
             +DWE L+ +I+ WL A  +AVKTLF+GER L D+VF+ + D+IRE+ F +I+++AA+   
Sbjct  234   LDWESLDSKIRTWLGASRVAVKTLFSGERKLLDHVFSGS-DSIREACFADIARDAAVQFL  292

Query  1058  EFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDA  879
              FPE +AK +K SPEK+FR+L++Y+AIA   PEI+ +FS +S S++ TQA+ SL KLG+A
Sbjct  293   SFPELVAK-SKRSPEKMFRILELYDAIAELWPEIDPVFSFESTSAVPTQALNSLVKLGEA  351

Query  878   IRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKD  699
              R  IA FE  +QKD+SKS + GGGIHPLT  +M+++  +AD+   L+DIF+++      
Sbjct  352   ARASIADFEAAMQKDTSKSPIPGGGIHPLTRHSMDFVAWLADYDAALADIFADSSVHVPS  411

Query  698   WLPDSYFAVSDS-----------------DESPLPAISLRYAWlillllckLDVIAEHYK  570
              LP+ +   S +                 +E+P   +++R A LIL+LLCKL+  AE Y+
Sbjct  412   ALPEIFLDTSQASAPPSPAPSSAASTFNYEENPGYPVAVRLARLILVLLCKLNDKAELYR  471

Query  569   DISIAYLFLANNLQYVVVKVRTS-RLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIAS  393
             ++S++YLFLANNLQY+V KVR S RL   LGE W ++ +AK +QYA+N+ERLGW  V A+
Sbjct  472   EVSLSYLFLANNLQYIVNKVRGSTRLRHLLGEEWAAQHAAKARQYASNFERLGWSKVAAA  531

Query  392   LPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRD  213
             +   P   + P E+++  + F+A   +A R  +  VV+D  LR+  + ++   +L  YR 
Sbjct  532   I---PAGEVGPAEMRERMRTFHAGLEEACRNQAEWVVADAGLREEARAAVRGMILPAYRG  588

Query  212   FYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             FY+  +  +        S++V+F+PEDV   LS++F
Sbjct  589   FYEKCRAVLGD------SAVVRFSPEDVRSRLSEVF  618



>ref|XP_007163944.1| hypothetical protein PHAVU_L003900g [Phaseolus vulgaris]
 gb|ESW35938.1| hypothetical protein PHAVU_L003900g [Phaseolus vulgaris]
Length=593

 Score =   436 bits (1122),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 254/559 (45%), Positives = 359/559 (64%), Gaps = 32/559 (6%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWN--------PEASEAAKVTSLFYESRREANDFVKCVRNLQ  1686
             F  S+M+  +E +  +I KW+        P  S +  +  LF  +R +A  ++K V +LQ
Sbjct  23    FSNSLMDENIETARSIISKWDLITPCHKTPSLSLSPAMVPLFTNTRHDAKQYLKAVTSLQ  82

Query  1685  KAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssva  1506
               MQ L      S+ +V++Q LM++AMKRLQ EF++IL+ NR +LDPES +++ R SS  
Sbjct  83    STMQNLVALDSSSDSIVQSQFLMKLAMKRLQTEFYRILSENRDNLDPESVTSTDRQSSSV  142

Query  1505  ststgfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFK  1326
             S      S  +F                     VS+ VMAD++ IVECM+S GYSKEC K
Sbjct  143   SEDDDSLSEEEFRFSGGT---------------VSTVVMADLKSIVECMVSAGYSKECIK  187

Query  1325  VYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTL  1146
             +Y  +RK I+DEA+ RLGVEK+SFS+++KMDWEVLE +IK W++++ +AV+TLF+GER L
Sbjct  188   IYVMMRKSIVDEALYRLGVEKLSFSQVQKMDWEVLESKIKCWVNSVRVAVRTLFHGERLL  247

Query  1145  CDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHR  966
             CD +F S+   I ES F  I ++ A+ LF FPEN+ K  K +PEK+FR LD+YNAI+ +R
Sbjct  248   CDYIFGSSERKIAESCFAAICRDGAVTLFGFPENVVK-GKKTPEKMFRTLDLYNAISRNR  306

Query  965   PEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTI  786
             P+IESIFS +S  SIR Q   S A+LG+AIRT +  FE  +QK+SSK  V GGGIHPLT 
Sbjct  307   PQIESIFSSESTFSIRLQVCASQARLGEAIRTMLINFECAIQKESSKIPVPGGGIHPLTR  366

Query  785   DAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSD-ESPLPAISLRYAWlill  609
               MNY+  + D+++ L +I ++ P  P   LP+SY+  S  + ++    ++ R AWLIL+
Sbjct  367   YVMNYIAFLGDYNDALPEIVADWPQNP---LPESYYRSSHGEGKNRSSELAERIAWLILV  423

Query  608   llckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAAN  429
             LLCKLD  AE YK+++++YLFLANN+QYVVVKVRTS L   LGE+WLSK   KVK+Y + 
Sbjct  424   LLCKLDAKAELYKEVALSYLFLANNMQYVVVKVRTSNLKCILGEHWLSKHEPKVKEYVSK  483

Query  428   YERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKV  249
             YE + WG V  +LPEN TA    E+ +  F+ F  +  +A R   + VV D NL   +K 
Sbjct  484   YESVAWGKVFTTLPENLTA----EQARVIFENFKIAVREACRAQFSWVVPDPNLHAEIKA  539

Query  248   SLARKLLRPYRDFYDTHKL  192
             S+  KL   Y+ F++ ++ 
Sbjct  540   SITDKLEPIYKVFFEKYQF  558



>ref|XP_011090083.1| PREDICTED: exocyst complex component EXO70A1 [Sesamum indicum]
Length=634

 Score =   437 bits (1123),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 246/589 (42%), Positives = 370/589 (63%), Gaps = 17/589 (3%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             E+++E ++  + P+I KW+       K +SLF + RREA  F +   +LQ+A+ +   + 
Sbjct  33    ETMIEESISRAEPIIRKWDLGMGGLQKFSSLFVDDRREAKSFFEAATSLQQAINYYLKQS  92

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
               SE+L+R + LM+VAMKRL+KEF  IL+ NR +LD  S S+ +  +  + +     S  
Sbjct  93    AASEELIRVRKLMKVAMKRLEKEFHMILSANRKNLDSGSVSSRSSRTRSSFSEFFEFSEE  152

Query  1475  dfdvddddddvrvagdSIT-----EVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDI  1311
             + +             +       + E  +   MAD+  I +CMI+CGY +EC +VYK I
Sbjct  153   EVNSTSPPRTSPPPPPTPGGNAKLDAERATEMAMADLMGIADCMIACGYGRECIRVYKSI  212

Query  1310  RKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVF  1131
             RK ++ E++  LGVE++S  +++KM+W VLE +IK WL  ++ AVKTL  GE+ LC+ VF
Sbjct  213   RKSMVIESLYHLGVERLSHPQMKKMEWLVLEPKIKRWLRVVKFAVKTLLQGEKILCEIVF  272

Query  1130  ASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKN-SPEKVFRLLDMYNAIANHRPEIE  954
             +   + + ES F +IS +AA  LF FPEN+AK  K  SPEK+F  LD+Y A+++  PEIE
Sbjct  273   S---EKVAESCFLDISCDAAWNLFSFPENVAKCKKLLSPEKMFIALDIYEAVSDLSPEIE  329

Query  953   SIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMN  774
             S+F+    +S+R QA  + AK+G+A+RT + QFE  +QKDSSKS VAGG +HPLT   MN
Sbjct  330   SLFASKFFTSVRAQATAAQAKMGEAVRTILGQFEAAIQKDSSKSPVAGG-VHPLTRYVMN  388

Query  773   YLTSIADHSNVLSDIFSNTPPIPKDWLPDSYF----AVSDSDESPLPAISLRYAWlilll  606
             YL  ++D+S  +S+I  + P  P+  LP+  F    AVS+ D S  P IS R AWLIL+L
Sbjct  389   YLVFLSDYSVHISNIVKDGPVNPQTPLPEPQFSSLTAVSEEDPSATP-ISRRLAWLILVL  447

Query  605   lckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANY  426
                LD  A  Y + ++ YLFLANNL YVV KV+ S L   +G NW+ K  +KVK+Y A Y
Sbjct  448   FSNLDSKAAQYNNAALPYLFLANNLNYVVYKVQNSNLGLLIGSNWIRKHESKVKRYLAKY  507

Query  425   ERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVS  246
             E+LGW  +++SLPENPT  +SP+E+K+ FKKFN+SF +A++K  + V+ D  +R+S+K S
Sbjct  508   EKLGWSKILSSLPENPTGEISPKEVKECFKKFNSSFQEAYKKQCSWVIPDPKIRESVKAS  567

Query  245   LARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
             +++++L  Y  F+  H+      K+    S +++ PED+  + S +F E
Sbjct  568   VSKRILSSYLVFHQKHR--GKHAKDCTVESFIRYTPEDLEKYFSHMFSE  614



>ref|XP_009131976.1| PREDICTED: exocyst complex component EXO70A1-like [Brassica rapa]
Length=620

 Score =   436 bits (1121),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 259/585 (44%), Positives = 376/585 (64%), Gaps = 27/585 (5%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKW-NPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAME  1659
             ES ++  +     +I KW +P  S  A + S    SRREA +F + VR+L   M  LA  
Sbjct  23    ESAVQECISKINTVISKWTSPSPSSDAHLFST--NSRREAEEFAEAVRHLHITMHRLAAV  80

Query  1658  QPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsst  1479
              P SEKLV AQNLM+ AM  L+ EF ++L  NR +LDPE  S  +  SS  +++    S 
Sbjct  81    NPSSEKLVYAQNLMQSAMNLLESEFHRVLKENRQYLDPECVSVRSYRSSRFASTPTSVSD  140

Query  1478  sdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWI  1299
             S+ +   +++       S  +     S  M D+++I +CMIS GY+KEC KVYK +R+ I
Sbjct  141   SEDETFYEENAAEEHRFSGGD-----SDAMDDLKMIADCMISTGYAKECVKVYKTVRRSI  195

Query  1298  IDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTP  1119
             +DE +  L VE+ +  +++KMDW+ LE +I+ WL A+++AV++LF GER L D+VF+S+ 
Sbjct  196   VDETLHGLAVERFTLHQVQKMDWDTLESKIRTWLPAVKLAVRSLFFGERLLADHVFSSSL  255

Query  1118  DAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSM  939
             + I ES F +I++E A+ LF FPEN AK  K SPEK+FR LDMY ++A+   EIESIF  
Sbjct  256   N-IVESSFTDITQEGALTLFTFPENAAKIKKLSPEKMFRFLDMYESLASLFVEIESIFFF  314

Query  938   DSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSI  759
             DSA+++R Q + SLAKLGDA R  +  FET +QK++S++ V GGG+HPLT   MNYL+ +
Sbjct  315   DSAAAVRAQVINSLAKLGDAARLMMTDFETAIQKETSRTPVVGGGVHPLTRYVMNYLSFL  374

Query  758   ADHSNVLSDIFSN---TPPIPKDWLPDSYFAVSDSDESPL--PAISLRYAWlillllckL  594
             AD+   ++ IF N   T P      P+S FA  ++    L    +S+R AW+ILL LCK+
Sbjct  375   ADYDESIAVIFENWQMTSP------PES-FAGEEARPEELYSSPVSVRIAWVILLTLCKI  427

Query  593   DVIAEHYKDISIAYLFLANNLQYVVVKVRTS-RLNRFLGENWLSKQSAKVKQYAANYERL  417
             D  A+ YKD++++YLFLANNLQYVVVKVR+S  L   LGE+W+ +   KVKQYA  +E+L
Sbjct  428   DGKAQPYKDVALSYLFLANNLQYVVVKVRSSPGLKVLLGEDWVVRHEGKVKQYAEKFEKL  487

Query  416   GWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLAR  237
              WG V+ SLPEN    ++PEE ++ F +FN  F  A+RK  + VV D  LRD +K+SL+ 
Sbjct  488   AWGKVVTSLPENAKEEIAPEEARELFGRFNDEFEAAYRKQMSWVVPDPKLRDWIKISLSG  547

Query  236   KLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             KL+    +F + ++  +  +    F+  V++ PED+G++LSDL+F
Sbjct  548   KLVPVCAEFCEVNRFGLGGDG---FN--VRYTPEDIGNYLSDLYF  587



>ref|XP_006346010.1| PREDICTED: uncharacterized protein LOC102597723 [Solanum tuberosum]
Length=648

 Score =   435 bits (1119),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 253/582 (43%), Positives = 381/582 (65%), Gaps = 9/582 (2%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F  S+ME  ++ +  +I KW+ + S   K TSLF E R+EA ++++CV++L+KAM F   
Sbjct  50    FSRSIMEENIDNADTIIKKWDHKESSNEKFTSLFQEDRKEAKEYIQCVKDLKKAMHFFVT  109

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             +     KLV AQNLM+ AMKRL+ EF+QIL+  + HLDPES S S++SS ++ + +  SS
Sbjct  110   QHSTCNKLVLAQNLMQKAMKRLENEFYQILSTKKEHLDPESVSKSSQSSHISRSISVDSS  169

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
              S    ++           I+E E +S   M+D+++I +CMI  GY+KEC+K+Y+ IRK 
Sbjct  170   ESTDLGNEIQHTTSAES--ISEAEHLSLLTMSDLKMIADCMIDSGYAKECWKIYRIIRKS  227

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE + RLG+E  S + +  M   VLE ++K+W+ + +IAVKTLF GER LCD+VF ST
Sbjct  228   IVDEGLYRLGIESRSSAYVNAMKPNVLEHQVKHWIDSTKIAVKTLFYGERFLCDHVF-ST  286

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
                I E+ F +I+KE  ++L +FPE +AK  K S EK+F L+D++  IA   PEIESIFS
Sbjct  287   SKTINETCFSDIAKEGGIVLLKFPEVVAK-TKKSHEKIFLLMDLHETIAELLPEIESIFS  345

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              DS SS++ QAV+SL KL  ++   I+ FE  +Q++S K+ V GGGIHPLT     YL S
Sbjct  346   FDSISSVKVQAVSSLNKLKISVLNIISDFELSIQRNSLKTPVPGGGIHPLTNSVAEYLAS  405

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPL-PAISLRYAWlillllckLDVI  585
             +A ++ VLS I S++    +    ++YF  +   E+P   ++  + AW++L+LLCKLD  
Sbjct  406   LASYNGVLSYIISDSTSTTE--FSETYFDSALISETPKNSSVCAKLAWIVLVLLCKLDCK  463

Query  584   AEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             AE Y +I+++YLFLANN+Q+++ +VR S L   LG+ W+     KVK Y+  YE + W  
Sbjct  464   AELYNNIALSYLFLANNIQFIIERVRGSALRIILGDEWILNLERKVKLYSTKYENVAWNK  523

Query  404   VIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
             V   LP++    +S + IK+HFK+FN SF + +++  + VV DR LRD +KVS+ARKL+ 
Sbjct  524   VFMCLPQSLDPSISSDMIKEHFKRFNESFEETYQRQKSWVVPDRTLRDEIKVSIARKLVP  583

Query  224   PYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFE  99
              YRDFY+ + + +  EK+     +V+F+P+++G+ LSDLF E
Sbjct  584   FYRDFYEYYMVVLSGEKD--LEVLVRFSPDNIGNCLSDLFHE  623



>ref|XP_011091478.1| PREDICTED: exocyst complex component EXO70A1 [Sesamum indicum]
Length=612

 Score =   434 bits (1116),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 246/577 (43%), Positives = 368/577 (64%), Gaps = 28/577 (5%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQP  1653
             + M+  +  +  +I KW+P      K TSLF E+R EA  FVKCV +L++ M FL  +  
Sbjct  38    TTMQDVIVNADTIISKWDPSRPSLEKFTSLFQENREEAEVFVKCVGDLRRVMHFLVSQHA  97

Query  1652  RSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsd  1473
              S +LV A  LM++AM+RL+KE + IL+  R  L+PES S  +      S          
Sbjct  98    GSSQLVLANKLMKIAMQRLEKELYHILSTRRECLNPESVSGGSSLLLSNSDEEEDDDHVG  157

Query  1472  fdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIID  1293
              D              +++VE      + D++LI   MIS GYSKEC K+Y+  RK I+D
Sbjct  158   SDG-------------VSDVERA----LLDLKLIAGSMISFGYSKECSKIYRITRKSIVD  200

Query  1292  EAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDA  1113
             E + RLG+   + S+I +MD + LE +++ W++  ++AV+TLF GER LCD+VFA + + 
Sbjct  201   EELYRLGIRGYTVSQISRMDQDALEHQVRKWVNTAKVAVRTLFRGERLLCDHVFAVS-ET  259

Query  1112  IRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDS  933
             I+++     + E A+ LF FPE +AK +K SPEK+F +++++  ++   PE ESIFS + 
Sbjct  260   IKQTCIAHTTMEGAINLFRFPETVAK-SKRSPEKIFLVMNLFETLSELWPETESIFSYEP  318

Query  932   ASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIAD  753
              S I+ QA++S+ KL DA +T +++F + +QK+SSK+ + GGGIHPL    MNY++ +AD
Sbjct  319   LSPIKLQALSSMHKLSDAAQTILSEFVSSIQKNSSKTPIPGGGIHPLNCSVMNYVSLLAD  378

Query  752   HSNVLSDIFSNTP-PIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEH  576
             +S +LSDI ++ P  + +   P+SYF   DS  SP   ++ + AW+IL+LLCKLD  AE 
Sbjct  379   NSGILSDILADEPETVARSPFPESYF---DS-RSPTSRVASQLAWIILVLLCKLDSKAEI  434

Query  575   YKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIA  396
             Y+DI ++YLFLANNLQ+VV KV TS L   LG++WLSK   KVK YA NYE + W  V++
Sbjct  435   YRDIGLSYLFLANNLQFVVEKVSTSALKLLLGQDWLSKLQTKVKLYAGNYESVAWAKVLS  494

Query  395   SLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYR  216
             SLP       S  +IK+HFK+FN++F   +RK S+ VV D  LRD +KVS+ARKL+  YR
Sbjct  495   SLPVETEE--SAHKIKEHFKQFNSAFEAEYRKQSSWVVPDPKLRDEIKVSIARKLVPAYR  552

Query  215   DFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +FYD++   +  EK  +   +V+F+P+++G++LSDLF
Sbjct  553   EFYDSNLAILSGEK--NLEILVRFSPDNLGNYLSDLF  587



>ref|XP_009126671.1| PREDICTED: exocyst complex component EXO70A1-like [Brassica rapa]
Length=621

 Score =   434 bits (1115),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 250/580 (43%), Positives = 370/580 (64%), Gaps = 18/580 (3%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             ES ++        +I KW   +S     ++    SR EA +FV+ V++LQ  M  L    
Sbjct  23    ESAVQECTSSINTVISKWTSSSSNEFLFST---NSRHEAEEFVEAVKHLQSTMHRLVSVN  79

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
               S+KLV A NLM+ AMK L+ EF ++LN NR +LDPES S  +   S   +++  +S S
Sbjct  80    ASSDKLVYAHNLMQSAMKLLESEFRRVLNANRDYLDPESVSVRSSYRSSRFSTSTTTSVS  139

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
             D + +   D+         +  D     M D++ I +CMIS GY+KEC  VYK +RK I+
Sbjct  140   DSEDETSYDENPNDHRFSGQDSDA----MDDLKTIADCMISTGYAKECVTVYKTVRKSIV  195

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             +E ++ L VE+++  +++KMDWE LE +I++WL A ++AV++LF GER L D+VF+S+ +
Sbjct  196   EETLNNLAVERLTLHQVQKMDWETLESKIRSWLRAAKLAVRSLFFGERLLADHVFSSSVN  255

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
              I ES F +I++E A+ LF FPEN AK  K SPEK+FR LDMY  +A+   EIE+IF  D
Sbjct  256   -IVESSFTDITQEGALTLFAFPENAAKIKKLSPEKMFRFLDMYETLASLYVEIETIFYFD  314

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             SA+++R+Q ++SL +LGDA+RT +  FET +QKD+S++ V GGG+HPLT   MNYL+ + 
Sbjct  315   SAAAVRSQVISSLTRLGDAVRTMMTAFETAIQKDTSRTPVIGGGVHPLTRYVMNYLSFLV  374

Query  755   DHSNVLSDIFSNTPPIPKDWLPDSYFAVSDS--DESPLPAISLRYAWlillllckLDVIA  582
             D+S  ++ IF N  P     LP S     D+  +E     +S+R AW+ILL LCK+D  A
Sbjct  375   DYSESIAVIFENWQPT---LLPSSCGGEEDAYPEELYSSPVSVRIAWVILLTLCKIDGKA  431

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
             + YKD++++YLFLANNLQYVVVKVRTS +   LGE+W+ +   KVKQYA  +E+L WG V
Sbjct  432   QPYKDVALSYLFLANNLQYVVVKVRTSNVKLLLGEDWVVRHEGKVKQYADKFEKLAWGKV  491

Query  401   IASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRP  222
             + SLPE P   ++PEE K+   +F+  F  ++RK  + V+ D  LRD +KVSL+ KL+  
Sbjct  492   LTSLPEYPAEEITPEEAKELLVRFDDEFEASYRKQISWVIPDPKLRDWIKVSLSHKLMLV  551

Query  221   YRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
               + Y+ ++     +    F+  V++  ED+G++LSDL+F
Sbjct  552   CTELYEINRFGSGGDG---FN--VRYTSEDIGNYLSDLYF  586



>ref|XP_003547470.1| PREDICTED: exocyst complex component EXO70B1-like [Glycine max]
Length=593

 Score =   431 bits (1107),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 248/580 (43%), Positives = 365/580 (63%), Gaps = 33/580 (6%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+M+  +E +  +I KW    S + +   LF  +R+EA  ++  V +LQ  MQ L  
Sbjct  27    FSDSLMDENIETARAIISKWEL-ISPSDQAAPLFSNTRQEAKQYLNAVMSLQSTMQHLVA  85

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
                 S+ L++A  LM++AMKRLQ EF++IL  NR +LDPES +++   SS  S      S
Sbjct  86    LDSSSDTLIQAHFLMQLAMKRLQTEFYRILTQNRDNLDPESVASTDHRSSSVSDDGTDFS  145

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               +F                   + VS+  MAD++ I ECM+S GYSKEC K+Y  +RK 
Sbjct  146   DDEFRFAG---------------DSVSTVAMADLKAIAECMVSAGYSKECVKIYILMRKS  190

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             ++DEA+   GVE+++FS+I+KMDWEVLE +IK+WL+A+   V+TLF+GE+TLCD VF S 
Sbjct  191   MVDEALYHFGVERLTFSQIQKMDWEVLESKIKSWLNAVRFVVRTLFHGEKTLCDYVFGSP  250

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
                I ES F  + +E A  LF FPE +AK  K +PEK+FR LD+Y AI+++R +IESIFS
Sbjct  251   ERKIAESCFAAVCREGAESLFAFPEKVAK-CKKTPEKMFRTLDLYEAISDNRQQIESIFS  309

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              +S S IR+Q   S A+LG+A RT +  FE+ +QK+SSK  + GGGIHPLT   MNY+  
Sbjct  310   SESTSCIRSQVTVSQARLGEAARTMLINFESAIQKESSKIPLPGGGIHPLTRYVMNYIAF  369

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSD-ESPLPAISLRYAWlillllckLDVI  585
             +AD+ + L++I ++    P++ LP+SY+   D + ++    I+ R AWLIL+LLCKLD  
Sbjct  370   LADYGDALAEIVAD---WPQNSLPESYYRSPDREGKNRSSEIAERMAWLILVLLCKLDGK  426

Query  584   AEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGD  405
             AE YK+++++YLFLANN+QYVVVKVR S L   LGE+WL+K   KVK+Y + YE +GW  
Sbjct  427   AELYKEVALSYLFLANNMQYVVVKVRNSNLGFILGEDWLTKHELKVKEYVSKYEHVGWNK  486

Query  404   VIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLR  225
             V  SLPE PTA    E+ +   + F+ +F  A +   + VV D  LR+ +K S+A K + 
Sbjct  487   VFLSLPETPTA----EQARAILECFDVAFHDACKAQFSWVVPDPKLREEIKASIASKFVP  542

Query  224   PYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              +R+ ++ +++           ++    P+D+ H LSD+ 
Sbjct  543   SHRELFEKYQVGS--------ETVFGLTPDDLEHSLSDIL  574



>gb|EPS71941.1| hypothetical protein M569_02816 [Genlisea aurea]
Length=621

 Score =   431 bits (1108),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 250/590 (42%), Positives = 371/590 (63%), Gaps = 31/590 (5%)
 Frame = -2

Query  1847  DH--FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQ  1674
             DH  F E V+   ++ +  +I +W+ +A +  K + LF   R +A  F++ V  LQ AM+
Sbjct  29    DHRAFSEVVLLEDVDSAESVIARWDLDAHKE-KFSPLFAGDREDAKVFLQAVNGLQNAMR  87

Query  1673  FLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvastst  1494
                     S  LVRAQ LM+VA+KRL+KEF  +L+ NR +LD ESSS+S  + S      
Sbjct  88    VYLKHHSSSGNLVRAQRLMQVAIKRLEKEFHVVLSANRKNLDLESSSSSRSARSGVPDEE  147

Query  1493  gfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKD  1314
                                     +  E  +   +AD+R I ECMI CGY KEC K+YK 
Sbjct  148   ESEEGGGTPTK-------------SGSEKSADLAVADLRSIAECMIGCGYGKECVKIYKL  194

Query  1313  IRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNV  1134
             IRK I+DEA+  LG+EK++ S+++KM+W VL+++IKNW+  ++ AVK LF+GE+ LCD V
Sbjct  195   IRKSIVDEALHFLGIEKLNHSQMQKMEWNVLDVKIKNWIRGVKSAVKVLFHGEKILCDTV  254

Query  1133  FASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKN-SPEKVFRLLDMYNAIANHRPEI  957
             FA++ + + ES F +IS +AA+ +F F EN  +  K  SPEK+FR LD+Y AI+  RPEI
Sbjct  255   FAAS-EKLAESCFADISSDAAVSMFSFAENFGRSKKILSPEKIFRALDLYQAISELRPEI  313

Query  956   ESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAM  777
             ++IF  +S   ++T+A  +L KLG+A++  +AQ ET ++KDSSK T  GGG+HPLT   M
Sbjct  314   DAIFWHESQLPVKTEASAALKKLGEAVKLMLAQLETAIEKDSSK-TPPGGGVHPLTRYVM  372

Query  776   NYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYF-----AVSDSDESPLPAISLRYAWlil  612
             NYLT + D++   SDI S+     +  LP+S+F      V   D S    I+ R AWLIL
Sbjct  373   NYLTFLGDYTETFSDIISDWSANQETPLPESFFSSPTAGVGQEDPSS-STITPRLAWLIL  431

Query  611   lllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAA  432
             +LLCKLD  A+ Y D++++YLFLANNL YV+ KVR S L   +G +W+ +  +KV +Y +
Sbjct  432   VLLCKLDGKAKLYDDVALSYLFLANNLNYVISKVRDSNLGLLMGADWILRNRSKVTRYLS  491

Query  431   NYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLK  252
              +ER+GW  VI+SLP N TA + P+++K+HFK+FN +F +A++K S+ V+ D  +RD +K
Sbjct  492   KFERMGWTAVISSLPTNLTADIPPDQLKEHFKQFNRNFEEAYKKQSSWVIPDSEVRDRVK  551

Query  251   VSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             +SL ++++  YR FY+ H              +V++ PED+ ++LSDLFF
Sbjct  552   ISLQKEIVNSYRIFYEKHHHGGGDR------GMVRYIPEDLDNYLSDLFF  595



>ref|XP_008783606.1| PREDICTED: exocyst complex component EXO70A1-like [Phoenix dactylifera]
Length=624

 Score =   431 bits (1108),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 262/595 (44%), Positives = 379/595 (64%), Gaps = 33/595 (6%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLA----  1665
             ++ME  +  +  MI +W+ +A+  AKVTSLF+  R EA +F+  V NLQ+AM F      
Sbjct  30    TLMEDNIASAEAMISRWDADANTFAKVTSLFHAGRAEAREFLHAVSNLQRAMVFFVSGDC  89

Query  1664  --MEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststg  1491
                   RS  LVRAQ LM+ AM+RL+ EF QIL  NR  LDPES S+S R+ S A +   
Sbjct  90    AAPAAARSAALVRAQTLMQTAMRRLEHEFHQILCANRDRLDPESVSSSTRARSSAFSDDT  149

Query  1490  fsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDI  1311
              +S  D                I EVE  S+  MAD+R I E MI+ GY KEC ++YK +
Sbjct  150   ENSDDDEIRAAGAT--------IGEVEQASAGAMADLRAIAEVMIAAGYGKECVRIYKTL  201

Query  1310  RKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVF  1131
             RK I+DE + RLG E++S S+++K+DWEVLEL+I++WL A  +A++TLF+GER LCD VF
Sbjct  202   RKSIVDEGLYRLGFERLSQSQVQKLDWEVLELKIRSWLGAAPVALRTLFSGERILCDYVF  261

Query  1130  ASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIES  951
             A + D I ES F +I+++AA +   FPE +AK  K SPEK+FR+LD+Y+A+++  PEIE+
Sbjct  262   AGS-DPIGESCFADITRDAATLFLGFPEPVAK-TKRSPEKLFRILDLYDAMSDLWPEIEA  319

Query  950   IFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNY  771
             +F  +S +++R+QA+ SL KL +A R  +A FE  +QKD+SKS V GG +HPLT   MNY
Sbjct  320   VFCFESTAAVRSQALASLLKLAEAARATLADFEAAIQKDNSKSPVPGGAVHPLTRYVMNY  379

Query  770   LTSIADHSNVLSDIFSNTP---PIPKDWLPDSYF----------AVSDSDESPLPAISLR  630
             L  +AD+   L+DI+++ P   P P   LP+S+F          + +        AIS+R
Sbjct  380   LVFLADYEASLADIYADFPLQIPTP---LPESFFDSASSTPASPSSTSDGGGAASAISVR  436

Query  629   YAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAK  450
             +AWL+L+LLCKLD  AE Y++++++YLFL+NNLQY+V KVR SRL   LGE+W +K +AK
Sbjct  437   FAWLVLVLLCKLDGKAEVYREVALSYLFLSNNLQYIVNKVRESRLRFLLGEDWAAKHAAK  496

Query  449   VKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRN  270
              + YA+NYERLGW  V A+ P +P A M   E  +  K FN +F  A +  +  VV+D  
Sbjct  497   ARHYASNYERLGWAKVAAATPADPAAEMDAGEAWEKMKGFNQAFEAACQSQADWVVADEV  556

Query  269   LRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +R  +  S+A  +L  YR FY+  +  + ++     +++V+F+PEDV + +  L 
Sbjct  557   MRQEVWASVASMILPAYRVFYERCRAAL-RDSGPAAAAVVRFSPEDVRNRVYGLL  610



>ref|XP_006378741.1| hypothetical protein POPTR_0010s21920g [Populus trichocarpa]
 gb|ERP56538.1| hypothetical protein POPTR_0010s21920g [Populus trichocarpa]
Length=441

 Score =   423 bits (1087),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 217/429 (51%), Positives = 315/429 (73%), Gaps = 6/429 (1%)
 Frame = -2

Query  1388  ADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRI  1209
             +D++ I +CMIS GYS EC K+YK IRK I+DE +  LG+E+   S+I KM+WE LE +I
Sbjct  3     SDLKTIADCMISSGYSIECIKIYKLIRKSIVDEGLYLLGIEEFRPSQILKMNWEALEHQI  62

Query  1208  KNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYA  1029
             KNWL+A++IA KTLF+GE+ LCD+VF+++   IRES F EI+    + LF FPE +AK  
Sbjct  63    KNWLNAVKIAAKTLFSGEKALCDHVFSAS-QTIRESCFSEITI-GGLNLFRFPELVAK-C  119

Query  1028  KNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFET  849
             K  PE++F LLD+Y A+++ RP++E IF  +S S I+ QAV+SL  LG++IR  +++FE+
Sbjct  120   KKLPERIFPLLDLYEALSDIRPDVELIFDSESTSKIKQQAVSSLHGLGESIRAILSEFES  179

Query  848   VLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVS  669
              +QKDSSK+ + GGGIHPLT    +Y++S+AD+S +LSDI +++ P      P++YF   
Sbjct  180   TIQKDSSKTLIVGGGIHPLTQKVTSYISSLADYSRILSDIVADSSPPRNTAFPEAYFESP  239

Query  668   DSDESPLPAISLRYAWlillllckLDVIAE-HYKDISIAYLFLANNLQYVVVKVRTSRLN  492
             + D S  PA+S+  AWLIL+LLCKLD  A+  YKD+S++YLFLANNLQ+V+ KV T+RL 
Sbjct  240   NYDASSTPAVSVHLAWLILVLLCKLDRKADLGYKDMSLSYLFLANNLQFVLDKVCTTRLY  299

Query  491   RFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQ  312
               LGE+W+ K + KV QYA+ YE + WG+  +SLPE  +  +SPE  K+ F++FNA+F +
Sbjct  300   VLLGEDWVFKHAEKVIQYASTYETMAWGNAFSSLPEKNSPLLSPEAAKECFQRFNAAFEE  359

Query  311   AHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPED  132
             A++K ++ VV DR LRD LKVS+A++L+  YR+FYDTHK+ + + K+  F   V+F P+D
Sbjct  360   AYKKQASWVVPDRRLRDELKVSIAKELIPAYREFYDTHKVMLRRVKD--FEVFVRFGPDD  417

Query  131   VGHHLSDLF  105
             +G++LSDLF
Sbjct  418   LGNYLSDLF  426



>gb|AAN31926.1| unknown protein [Arabidopsis thaliana]
Length=559

 Score =   427 bits (1097),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 248/547 (45%), Positives = 353/547 (65%), Gaps = 23/547 (4%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             ES ++  +     +I KW   A+ ++        SRREA +FV  VR+LQ  M  L    
Sbjct  23    ESAVQECMSNINTVISKWTSPAASSSDDFLFSTNSRREAEEFVTAVRHLQSTMHRLVSVN  82

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
             P SEKL+ AQNLM+ AMK L+ EF ++L  NR +LDPE  S  +  SS  STST  S + 
Sbjct  83    PSSEKLIYAQNLMQSAMKLLESEFHRVLKANREYLDPECVSVRSYRSSRFSTSTTTSVSD  142

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
               D    +++               S  M D+++I +CMIS GY+KEC +VYK +RK I+
Sbjct  143   SEDESSYEENADEEH----RFSGGDSDAMDDLKMIADCMISTGYAKECVRVYKTVRKSIV  198

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DE +  L +E+ +  +++KMDWE+LE +IK WL A+++AV+ LF GER L D+VF+S+  
Sbjct  199   DETLHNLQMERFNLHQVQKMDWEILESKIKTWLKAVKLAVRKLFFGERILADHVFSSS-G  257

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMD  936
              I ES F EI++E A+ILF FPE  +K  K +PEK+FR LDMY A+AN   EIESIF  +
Sbjct  258   LIVESSFTEITQEGALILFTFPEYASKIKKLTPEKMFRFLDMYEALANLYVEIESIFYFE  317

Query  935   SASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIA  756
             SA+++R+Q + SLA+LGDA R  +  FE+ +QK++SK+ + GGG+HPLT   MNYL+ +A
Sbjct  318   SAAAVRSQVINSLARLGDATRLMMTDFESAIQKETSKTPIIGGGVHPLTRYVMNYLSFLA  377

Query  755   DHSNVLSDIFSN---TPPIPKDWLPDSYFAVSDSDE--------SPLPAISLRYAWlill  609
             D+S+ ++ IF N   + P P   LPDS + +S  DE        SP   +S+R AW+ILL
Sbjct  378   DYSDSIAAIFENWKLSVPTP---LPDSLY-ISGGDEANPEDLYSSP---VSVRIAWVILL  430

Query  608   llckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAAN  429
              LCK+D  A+ YKD++++YLFLANNLQYVVVKVR+S L   LG++W+ +   KVK YA  
Sbjct  431   TLCKIDGKAQPYKDVALSYLFLANNLQYVVVKVRSSTLKVLLGDDWVFRHEEKVKLYADK  490

Query  428   YERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKV  249
             +E+L WG V+  LPE PT  +SPEE K    +FN  F  ++RK ++ V+ D  LRD +K+
Sbjct  491   FEKLAWGKVLDLLPEIPTDEISPEEAKVLVARFNDEFETSYRKQTSWVIPDPKLRDQIKI  550

Query  248   SLARKLL  228
             +L++KL+
Sbjct  551   TLSQKLM  557



>gb|KCW65316.1| hypothetical protein EUGRSUZ_G02769, partial [Eucalyptus grandis]
Length=602

 Score =   424 bits (1091),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 245/582 (42%), Positives = 361/582 (62%), Gaps = 27/582 (5%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEA-AKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             S +E  L  +  +I KW+  A  +  +VTSLF   R EA  F++  ++L++AM FL    
Sbjct  35    SAVEETLRNAESVIRKWDLNAKTSYTRVTSLFLHDREEAKSFLQSAKDLREAMHFLVASH  94

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
               S+KLV AQ+L ++AMKRL+KE + IL+ NR HLDPES S  +   S  S +   +++ 
Sbjct  95    SGSDKLVLAQSLTQIAMKRLEKELYHILSTNREHLDPESVSRKSSRRSDGSGNGNGTASD  154

Query  1475  dfdvddddddvrvagdSITEVED-VSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWI  1299
                                E ED VS   M D++ +V+CMIS GY  EC K+YK +RK  
Sbjct  155   ------------------DEPEDNVSESTMEDVKSVVDCMISAGYGTECIKIYKLMRKST  196

Query  1298  IDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTP  1119
             +DE I RLG+E++  S+I+K+ W   EL IKNWL+A+++AV+T+F GER LCD VF+++ 
Sbjct  197   VDEGIYRLGIERLKSSQIQKLTWNSRELLIKNWLNAVKVAVQTVFKGERILCDYVFSAS-  255

Query  1118  DAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSM  939
               I ES F EI+KEAA+ LF  PE IA+  K SPE++F+L+++Y A     P+IESIF  
Sbjct  256   GKIGESCFAEITKEAAINLFRIPEIIARI-KGSPERIFKLIELYEATYELWPDIESIFKF  314

Query  938   DSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSI  759
             DS   ++ QA+++L KLG+ ++  ++ +E  +QKDSSK    GGGIH LT   M + TS+
Sbjct  315   DSTLDVKLQALSALVKLGNMVQVILSNYEATIQKDSSKILPEGGGIHSLTRSVMEFATSL  374

Query  758   ADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAE  579
                S+ LSDI  + PP     LP+SYF    + + P+  +S+R AWLIL LLCKLD  AE
Sbjct  375   TKCSSTLSDILMDHPPPGNLNLPESYFNGLSAGDIPMSPVSVRLAWLILGLLCKLDAKAE  434

Query  578   HYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVI  399
              YKD+S++YLFLANNL ++V + R++ L   LG+ W++  + KV+QYAA+YE   W  V+
Sbjct  435   LYKDVSLSYLFLANNLNFIVEEARSTNLKYLLGDEWVATHAEKVRQYAASYEAAAWSKVL  494

Query  398   ASLPE---NPTAP-MSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKL  231
             + LPE   +  +P +SP+      ++F A+F + +RK  +  V D  LRD +KVS+ RKL
Sbjct  495   SLLPEVAADGGSPVLSPKAAGACLQRFGAAFEEEYRKQMSWTVPDGKLRDEIKVSIERKL  554

Query  230   LRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +  YR F +   L + +        +V+F  +D+G++L DLF
Sbjct  555   VPAYRQFCE-RCLGIARGDAEVERKLVRFGADDLGNYLPDLF  595



>ref|XP_010514945.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=603

 Score =   424 bits (1090),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 240/571 (42%), Positives = 359/571 (63%), Gaps = 19/571 (3%)
 Frame = -2

Query  1796  MIMKW-NPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNL  1620
             +I KW +PE+++    +S    S +EA  FV+ V+NL  +M  L    P S  L R Q++
Sbjct  38    LITKWTSPESTDQFLFSS---SSHQEAEQFVRAVKNLHNSMHRLVSVTPESINLNRGQDV  94

Query  1619  MEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvr  1440
             M+ AMK L+ EF ++L  NR +LDPE  +  + +SS  S ST  + +     D+      
Sbjct  95    MKTAMKLLESEFCRVLKENREYLDPECVTIRSWNSSRFSVSTPSTVSDSNGTDEGYFADE  154

Query  1439  vagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKM  1260
                             M D + I ECMIS G+ KEC +VYK +RK I+DE +  LGVE++
Sbjct  155   H------RFSGGDPNAMDDRKTIAECMISTGHVKECVRVYKSVRKSIVDETLHSLGVERL  208

Query  1259  SFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISK  1080
             +  +I+K++WEVLE +IK WL  +++AV++LF GE+ L ++VF+++  +I ES F +I++
Sbjct  209   TLRQIQKLNWEVLETKIKPWLRGVKLAVRSLFYGEKILAEHVFSNS--SILESSFTDITQ  266

Query  1079  EAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTS  900
             E A+ LF FPEN+ K+ K + EK+FR+LDMY  + N   +IESIF+ DS S I++Q   S
Sbjct  267   EGALTLFVFPENVGKFKKLTSEKMFRILDMYETLTNLSSDIESIFTFDSNSVIKSQVTGS  326

Query  899   LAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSN  720
             L KL +A+R+ ++ FET ++K+SSK  V GGGIHPLT   MNYLT +AD+S+ ++ IF N
Sbjct  327   LTKLSEAVRSMMSDFETAIEKESSKKPVNGGGIHPLTRYVMNYLTFLADYSDSIAVIFEN  386

Query  719   -----TPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIA  555
                  + P+PK   P      +  ++     +S+R AW+ILL LCK+D  A+ +K I+++
Sbjct  387   WKISVSSPLPKTLFPCGRGYEAKPEDVYSSPVSVRMAWVILLTLCKIDGKAQPFKHIALS  446

Query  554   YLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPT  375
             YLFL NNL YVVVKVR S+L   LG  W++   AKVKQ+   +E+L WG V+ SLPE+PT
Sbjct  447   YLFLVNNLNYVVVKVRASKLKLLLGVEWVASHEAKVKQFIVKFEKLAWGKVLTSLPEDPT  506

Query  374   APMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHK  195
             A MS EE   H   FN     A+R+  + VV D  LRD +K+ L+RK++  Y + Y+  +
Sbjct  507   AEMSSEEASGHLVSFNIKSELAYRRQISWVVPDSKLRDKIKIGLSRKIIPVYAELYN--R  564

Query  194   LTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             + + K+KE     IV++ P+D+G++LSDL+F
Sbjct  565   VGLFKDKEMFSELIVRYTPDDLGNYLSDLYF  595



>ref|XP_010068853.1| PREDICTED: exocyst complex component EXO70A1-like [Eucalyptus 
grandis]
Length=622

 Score =   425 bits (1092),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 245/582 (42%), Positives = 361/582 (62%), Gaps = 27/582 (5%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEA-AKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             S +E  L  +  +I KW+  A  +  +VTSLF   R EA  F++  ++L++AM FL    
Sbjct  40    SAVEETLRNAESVIRKWDLNAKTSYTRVTSLFLHDREEAKSFLQSAKDLREAMHFLVASH  99

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
               S+KLV AQ+L ++AMKRL+KE + IL+ NR HLDPES S  +   S  S +   +++ 
Sbjct  100   SGSDKLVLAQSLTQIAMKRLEKELYHILSTNREHLDPESVSRKSSRRSDGSGNGNGTASD  159

Query  1475  dfdvddddddvrvagdSITEVED-VSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWI  1299
                                E ED VS   M D++ +V+CMIS GY  EC K+YK +RK  
Sbjct  160   ------------------DEPEDNVSESTMEDVKSVVDCMISAGYGTECIKIYKLMRKST  201

Query  1298  IDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTP  1119
             +DE I RLG+E++  S+I+K+ W   EL IKNWL+A+++AV+T+F GER LCD VF+++ 
Sbjct  202   VDEGIYRLGIERLKSSQIQKLTWNSRELLIKNWLNAVKVAVQTVFKGERILCDYVFSAS-  260

Query  1118  DAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSM  939
               I ES F EI+KEAA+ LF  PE IA+  K SPE++F+L+++Y A     P+IESIF  
Sbjct  261   GKIGESCFAEITKEAAINLFRIPEIIARI-KGSPERIFKLIELYEATYELWPDIESIFKF  319

Query  938   DSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSI  759
             DS   ++ QA+++L KLG+ ++  ++ +E  +QKDSSK    GGGIH LT   M + TS+
Sbjct  320   DSTLDVKLQALSALVKLGNMVQVILSNYEATIQKDSSKILPEGGGIHSLTRSVMEFATSL  379

Query  758   ADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAE  579
                S+ LSDI  + PP     LP+SYF    + + P+  +S+R AWLIL LLCKLD  AE
Sbjct  380   TKCSSTLSDILMDHPPPGNLNLPESYFNGLSAGDIPMSPVSVRLAWLILGLLCKLDAKAE  439

Query  578   HYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVI  399
              YKD+S++YLFLANNL ++V + R++ L   LG+ W++  + KV+QYAA+YE   W  V+
Sbjct  440   LYKDVSLSYLFLANNLNFIVEEARSTNLKYLLGDEWVATHAEKVRQYAASYEAAAWSKVL  499

Query  398   ASLPE---NPTAP-MSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKL  231
             + LPE   +  +P +SP+      ++F A+F + +RK  +  V D  LRD +KVS+ RKL
Sbjct  500   SLLPEVAADGGSPVLSPKAAGACLQRFGAAFEEEYRKQMSWTVPDGKLRDEIKVSIERKL  559

Query  230   LRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +  YR F +   L + +        +V+F  +D+G++L DLF
Sbjct  560   VPAYRQFCE-RCLGIARGDAEVERKLVRFGADDLGNYLPDLF  600



>ref|XP_010521810.1| PREDICTED: exocyst complex component EXO70A1 [Tarenaya hassleriana]
Length=609

 Score =   423 bits (1088),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 252/591 (43%), Positives = 379/591 (64%), Gaps = 38/591 (6%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKW-NPEASEAAKVTSLFYE---SRREANDFVKCVRNLQKAMQFL  1668
             ES+ME +++ S  +I +W +PE  +++  +        ++ EAN F++ V +LQ  MQ L
Sbjct  19    ESLMEGSIQDSEAIISRWTSPELHDSSFCSLSSLFSPGNQEEANRFIEAVTSLQCGMQRL  78

Query  1667  AMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgf  1488
                 P SE LVRAQ+LM +AMK L+KEF++IL   R  LDPES S  +  +S +ST    
Sbjct  79    VKMNPGSEMLVRAQSLMSIAMKHLEKEFYRILKSTRRSLDPESVSIRSSGASSSSTPRSS  138

Query  1487  sstsdfdvddddddvrvagdSITEVE--DVSSFVMADMRLIVECMISCGYSKECFKVYKD  1314
               +      D +    V+ +S  E E     +  MAD+++I +CMI CGYSKEC K+YK 
Sbjct  139   RKSVSDSESDVEFVFSVSNESRLEGERGGEDANAMADLKMIADCMIFCGYSKECLKIYKK  198

Query  1313  IRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNV  1134
             IRK ++ EA+  LG E + F++I+K++WE+LE +IK W+     AV TLF GER LCD V
Sbjct  199   IRKSVVVEALDHLGFEDLRFTQIQKLEWEILESKIKKWVRTAREAVATLFFGERILCDYV  258

Query  1133  FASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIE  954
             F+S+   IRES F E+++E+A+ LF FPEN+AK  + SPEK+FR LD+Y AI+   P+IE
Sbjct  259   FSSS-SFIRESAFAEVTQESALSLFGFPENVAK-CRKSPEKIFRTLDVYQAISEIFPKIE  316

Query  953   SIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMN  774
              +FS DS  ++R+QAV SL  LG+AIR+ I++ E  + K+ SK+ +  GG+H +T   MN
Sbjct  317   QVFSCDSTVAVRSQAVESLYILGEAIRSMISELELSISKEPSKTPIPCGGVHHITRYVMN  376

Query  773   YLTSIADHSNVLSDIFSNTPP-IPKDWLPDSYFAVSDSDESPLPA------ISLRYAWli  615
             ++  +AD++  L+DI + TPP +P+D+L       +   E+P  A      ++   AW+I
Sbjct  377   FIVFLADYTGSLADILTKTPPKLPEDYL-------TGGGENPTGATIVSSPVATNLAWVI  429

Query  614   llllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYA  435
             L+LLCK+D  +  Y D++++YLFLANNL Y+VVKVRTS L   L  NW++K   KV++Y 
Sbjct  430   LVLLCKIDAKSRLYNDVALSYLFLANNLHYIVVKVRTSNLKVPLS-NWVTKHEDKVREYV  488

Query  434   ANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSL  255
             A +ERL WGDV+ SL   PT     EEI   F++FN +F +A+++ S  V+ D  LRD +
Sbjct  489   ARFERLAWGDVMTSLSGVPTE----EEI---FRRFNEAFEEAYKRQSDWVIPDPKLRDEI  541

Query  254   KVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             KVS+ARKL+  Y + Y + ++ +        ++ V++APED+G+++SDL+F
Sbjct  542   KVSVARKLIPGYSEHYKSQRVML--------NANVRYAPEDIGNYISDLYF  584



>gb|KDP46117.1| hypothetical protein JCGZ_06628 [Jatropha curcas]
Length=679

 Score =   421 bits (1082),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 242/532 (45%), Positives = 342/532 (64%), Gaps = 32/532 (6%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+ME  +E +  +I KW+P +S     TSLF + R EA +F+K V+ L++AM FL  
Sbjct  50    FTKSMMEENIENAELIIRKWDPNSSS----TSLF-QHRDEAREFLKSVKRLRQAMHFLVS  104

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
             E   S KLV AQNLM +AMKRL+KE + IL++ R  LDPES S  +        S     
Sbjct  105   EHSASNKLVLAQNLMIIAMKRLEKELYLILSLQRDQLDPESVSGLSSDGWSNLESKEEKG  164

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
             + +                           M+D++ +V+CMIS GYSKEC KVYK IRK 
Sbjct  165   SEEEIT-----------------------TMSDLKSVVDCMISSGYSKECVKVYKLIRKS  201

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  LGVE+  FS+IRKM+WE L+  IKNWL+A++IAVKTLF  E++LC  VF S 
Sbjct  202   IVDEGLYLLGVERFRFSQIRKMNWEALDHLIKNWLNAVKIAVKTLFTAEKSLCYYVF-SA  260

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
                IRES F EI++E+A  LF FPE I+   K SPE++F L++++  +++   EIES F 
Sbjct  261   SQTIRESCFTEITEESATNLFRFPELIS-MCKKSPERIFPLMELHEGLSSLWAEIESTFD  319

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              +S S+IR QA++SL +L D++   ++ FE+ +QKDSSK+   GGGIH LT  AMNY++S
Sbjct  320   SESTSAIRLQAISSLLRLRDSVCAILSDFESTIQKDSSKTLAVGGGIHTLTRTAMNYISS  379

Query  761   IADHSNVLSDIFSNTPPIPKDW-LPDSYFAVSD-SDESPLPAISLRYAWlillllckLDV  588
             + DH   LSDIF+++ P      LP+SYF     SD+   PA+S+  A LIL+LLCKLD 
Sbjct  380   LTDHRTTLSDIFADSFPTGNHASLPESYFESPPMSDDGSTPAVSVCLARLILVLLCKLDR  439

Query  587   IAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWG  408
              AE YKD+S++YLF+ANNLQ+++  V T+RL   LGE+W+ K + KV++YA+NYE + W 
Sbjct  440   KAEAYKDVSLSYLFMANNLQFIIQMVTTTRLRILLGEDWVLKHAKKVRKYASNYETMAWT  499

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLK  252
              V  SLP+     + P   K+ F++FNA+F + ++K ++ +VSD  LRD LK
Sbjct  500   KVFLSLPDKNFPDLQPAAAKECFRRFNAAFEEEYKKQTSWIVSDGKLRDELK  551



>ref|XP_010034603.1| PREDICTED: exocyst complex component EXO70A1-like [Eucalyptus 
grandis]
 gb|KCW52733.1| hypothetical protein EUGRSUZ_J02091 [Eucalyptus grandis]
Length=661

 Score =   419 bits (1076),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 256/637 (40%), Positives = 381/637 (60%), Gaps = 43/637 (7%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPE-----  1773
             MPRKGMR I F P+   S S  R +     D F +++M   +  + P+I KW  +     
Sbjct  1     MPRKGMRTIFFRPS--PSGSPARPAAPIRGDPFADTLMAERIASAEPLIGKWAVDSSSGP  58

Query  1772  -------ASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLME  1614
                     S  A    LF+E R EA  ++  V++L  AM     E   S  +VRA  L++
Sbjct  59    ESSQSPSTSGYAGAAHLFHEGRHEAKLYLSRVKDLHSAMLLCIGEYSNSRLIVRAHELLQ  118

Query  1613  VAMKRLQKEFFQILNMNRAHLD-PEsssasarsssvaststgfsstsdfdvddddddvrv  1437
              A++RL +EF +IL+    +LD PES S  +   S  S+ + F   S+ ++         
Sbjct  119   TAVRRLSQEFHRILSSQLPYLDHPESVSIPSSQISTRSSFSDFEYESEDELSAKQFAAEP  178

Query  1436  agdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKM-  1260
                 + E E + + V++D++ I +C+I+CG+ KEC  +YK +R+ ++DE +  LG EK+ 
Sbjct  179   G---MQEDERIPNAVVSDLKAIADCLIACGHGKECMDIYKIVRRLVVDEELYHLGFEKLI  235

Query  1259  SFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISK  1080
               S+++KMDWEV E++IK+WLSA++ AV+ LF+GER LCD VFA++P ++RES+F  I++
Sbjct  236   GPSQMQKMDWEVQEVKIKSWLSAVKPAVQRLFSGERILCDQVFAASPTSLRESVFSNIAQ  295

Query  1079  EAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTS  900
             +AA+ LF F E  AK  K SPE++FRLLD+Y AIA+  P+IES FS D+ S++R+ A+ S
Sbjct  296   DAAVALFGFAEGAAKAIKKSPERIFRLLDLYEAIASLWPDIESTFSSDATSAVRSLAINS  355

Query  899   LAKLGDAIRTGIAQFETVLQKDSSK-STVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFS  723
             L KLG+A+R  +  FE  +QKDS+K S ++ GGIHPLT D + YL  +AD+S VL+DI +
Sbjct  356   LIKLGEAVRLTLGNFEAAVQKDSAKQSAISSGGIHPLTRDVVKYLARLADYSGVLADILA  415

Query  722   N-----TPPIPKDWLPDSYFAVSDSDES------PLPAISLRYAWlillllckLDVIAEH  576
             +     +P  P+   PDSY A  DS  S         A+   +AWL+L+LLCK+D  AE 
Sbjct  416   DWPVDSSPEHPR--FPDSYCADCDSAASVAAGYGDASAMFTHFAWLVLVLLCKIDGKAEQ  473

Query  575   YKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIA  396
             YKD++++YLFLANNL+YV+ +V  S L   LGE+W+ K  +KVK YA+NYER GW  V +
Sbjct  474   YKDVALSYLFLANNLRYVIDRVDRSNLRHLLGEHWVKKHESKVKLYASNYERTGWSKVFS  533

Query  395   SLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYR  216
             S   + T  +S  + K+  +KFNA+  +   K     V D  LRD +  SLA+KL+  YR
Sbjct  534   S-QADLTVEISSGQAKESLRKFNAALEEGRAKQVGWAVPDPKLRDEIASSLAQKLVPAYR  592

Query  215   DFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               YD      P         +V+F P+D+  +L+ + 
Sbjct  593   RLYDGCPRGDP---------VVRFTPDDLDDYLAGML  620



>ref|XP_010426049.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=606

 Score =   415 bits (1067),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 247/590 (42%), Positives = 365/590 (62%), Gaps = 31/590 (5%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKW-NPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAME  1659
             +SVME        +I KW +PE+ +    +S    S +EA  FV+ V+NL  +M  L   
Sbjct  25    DSVMEEYEFEVQSLITKWTSPESIDQFLFSS---SSHQEAEQFVRAVKNLYNSMNCLVSV  81

Query  1658  QPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsst  1479
              P S  L R QN+M+ AMK L+ EF ++L  NR +LDPE  S  + +SS  S ST  + +
Sbjct  82    TPESINLSRGQNVMKTAMKLLESEFCRVLKENREYLDPECVSIRSWNSSRFSVSTPSTIS  141

Query  1478  sdfdvddddddvrvagdSITEVEDVSSFVMAD------MRLIVECMISCGYSKECFKVYK  1317
                  ++                D   F   D      +++I ECMIS G+ KEC +VYK
Sbjct  142   DSNGTNEGYFA------------DEHRFSGGDPNAMDDLKIIAECMISTGHVKECVRVYK  189

Query  1316  DIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDN  1137
              +RK I+D  +  LGVE+++  +I+K++W+VLE +IK WL  + +AV++LF GE+ L ++
Sbjct  190   SVRKSIVDATLHSLGVERLTLRQIQKLNWKVLETKIKPWLRGVTLAVRSLFYGEKILAEH  249

Query  1136  VFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEI  957
             VF+++  +I ES F EI++E A  LF FPEN+ K+ K + EK+FR+LDMY  + N   +I
Sbjct  250   VFSNS--SISESSFTEITQEGAFTLFGFPENVGKFKKLTSEKMFRILDMYETLTNLSSDI  307

Query  956   ESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAM  777
             ESIF+ DS S I++Q   SLAKL +A+R+ ++ FET ++K+SSK  V GGGIHPLT   M
Sbjct  308   ESIFTFDSNSVIKSQVAGSLAKLSEAVRSMMSDFETAIEKESSKKPVNGGGIHPLTRYVM  367

Query  776   NYLTSIADHSNVLSDIF-----SNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlil  612
             NYLT +AD+S+ ++ IF     S + P+PK   P      +  ++     +S+R AW+IL
Sbjct  368   NYLTFLADYSDSIAVIFEDWKISVSSPLPKTLFPCGRGYEAKPEDLYSSPVSVRMAWVIL  427

Query  611   lllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAA  432
             L LCKLD  A+ +KDI+++YLFL NNL Y+VVKVR S+L   LG  W++   AKVKQ+  
Sbjct  428   LTLCKLDGKAQPFKDIALSYLFLVNNLNYIVVKVRASKLKLLLGVEWVASHEAKVKQFIV  487

Query  431   NYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLK  252
              +E+L WG V+ SLPE+PTA MS EE   H   FN     A+R+  + VV D  LRD +K
Sbjct  488   KFEKLAWGKVLTSLPEDPTAEMSSEEASGHLVSFNIESELAYRRQISWVVPDSKLRDKIK  547

Query  251   VSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             + L+RK++  Y + Y+  ++ + K+KE     IV++ P+D+G++LSDL+F
Sbjct  548   IGLSRKIIPVYAELYN--RVGLFKDKEMFSELIVRYTPDDLGNYLSDLYF  595



>gb|EYU33194.1| hypothetical protein MIMGU_mgv1a002824mg [Erythranthe guttata]
Length=634

 Score =   415 bits (1066),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 252/595 (42%), Positives = 373/595 (63%), Gaps = 36/595 (6%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEA-SEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLA  1665
             F ES+M+  +E +  +I KW+P + S   K TSLF+E+R EAN+F K V  L++AM FL 
Sbjct  31    FSESMMQENIENAETLITKWDPNSPSFDKKFTSLFHENRNEANEFTKSVGELRRAMHFLV  90

Query  1664  MEQPRSE--KLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststg  1491
              ++  S   KLV A  LM++AM RL+KEF+ IL++NR  L+PES S  +      S S  
Sbjct  91    AQRSDSNNRKLVLANKLMKIAMLRLEKEFYYILSINRDCLNPESVSNRSSLFLSRSLSLS  150

Query  1490  fsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDI  1311
              S     +              +  VE  +   MAD++ I E MIS GYSKEC K+Y+  
Sbjct  151   NSDDEIQE--------------LDRVESKAERAMADLKAISETMISSGYSKECSKIYRLT  196

Query  1310  RKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVF  1131
             RK I DE + RLG+   S S+I +MD   LE ++  W+   ++ V+TLF GER LCD+VF
Sbjct  197   RKSITDEELYRLGIGSYSQSQINRMDQRALEHQVDRWIDRAKVVVRTLFRGERLLCDHVF  256

Query  1130  ASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIES  951
             A   + I+++     + E AM LF+FPE +AK +K SPEK+  +++++  I++  PEIES
Sbjct  257   A-VSETIKQTCCAHTTMEGAMNLFKFPEFVAK-SKRSPEKILVMMNLFETISDMWPEIES  314

Query  950   IFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNY  771
             IFS +S S ++ QA++++ KLGD+ +T I++F   +QK+SSK+ V+GGG+HPLT   M+Y
Sbjct  315   IFSYESLSPVKLQALSAMHKLGDSAQTIISEFVLSVQKNSSKTVVSGGGVHPLTCSVMSY  374

Query  770   LTSIADHSNVLSDIFSNTPP---IPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllc  600
             +  +A++S VLSDI ++        +   P+SYF    S  +P   +S R AW++L+LLC
Sbjct  375   VALLAENSGVLSDILNSDEEGERAAQSPFPESYF--DGSPTAPATGVSSRLAWIVLVLLC  432

Query  599   kLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYER  420
             KLD  AE YKDI+++YLFLANN+Q+VV +V T+ +   LGE WLSK   KVK YAANYE 
Sbjct  433   KLDSKAELYKDIALSYLFLANNIQFVVERVSTTAVKLLLGEEWLSKLRKKVKLYAANYEA  492

Query  419   LGWGDVIASLPENPTAPMSPE----------EIKQHFKKFNASFAQAHRKHSACVVSDRN  270
             + WG V++SLP  P A  + E           IK HF++FN+ F  A+RK  A VV+D  
Sbjct  493   VAWGKVVSSLPPPPAAEENEEESSAAAARNATIKGHFRRFNSEFEAAYRKQRAWVVADPK  552

Query  269   LRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             L + +KV + RK++  YR+FYD +   +  E +  F  +V+++P+++G++LS LF
Sbjct  553   LAEEIKVWIERKVVAAYREFYDNNLGILSGEMDLEF--LVRYSPDNLGNYLSGLF  605



>ref|XP_010034604.1| PREDICTED: exocyst complex component EXO70B1-like [Eucalyptus 
grandis]
 gb|KCW52734.1| hypothetical protein EUGRSUZ_J02092 [Eucalyptus grandis]
Length=642

 Score =   406 bits (1044),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 256/627 (41%), Positives = 368/627 (59%), Gaps = 33/627 (5%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEA-  1761
             MPRKGMR I F P      S   A+P+   D F ++ M   +  + P+I KW  ++S   
Sbjct  1     MPRKGMRTIFFKP----PPSDRAATPATSGDPFADASMAERIASAEPLIEKWAADSSSGT  56

Query  1760  ---AKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQK  1590
                A    LF E R EA  ++  V++L  AM     E   S  +VRA  L++ A++RL  
Sbjct  57    SRYASTAFLFREGRHEAELYLSRVKDLHSAMLLCIGEVSNSGVIVRAHELLQTAVRRLSL  116

Query  1589  EFFQILNMNRAHLD-PEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEV  1413
             EF QIL+   +HL  P+   + +  SS  ST + FS       ++       A   + E 
Sbjct  117   EFHQILS---SHLPYPDHGESVSSRSSRTSTLSSFSDFEYESEEELSKKQSAAEPVMQEE  173

Query  1412  EDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEK-MSFSKIRKM  1236
             E V    ++D++ IV+CMI+CGY KEC  +YK +R+ ++DE +  LG E+ +   K++KM
Sbjct  174   ERVPDAAVSDLKAIVDCMIACGYGKECMDIYKIVRRSVVDEELDHLGFERPIHPWKMQKM  233

Query  1235  DWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFE  1056
             DW+VLE+++K+WLSA++ A + LF GER L D VF     ++RES+F  ++++AA+ LF 
Sbjct  234   DWKVLEVKVKSWLSAVKPAFQRLFYGERILSDQVFTGASASVRESVFSHVARDAAVALFG  293

Query  1055  FPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAI  876
             F E  AK  K SP+++F LLD+Y AIAN  P I++ FS D+ S++R+ A+ SL KLG+A+
Sbjct  294   FAEGAAKAIKRSPDRIFCLLDLYEAIANLWPGIKATFSYDATSAVRSHAINSLIKLGEAV  353

Query  875   RTGIAQFETVLQKDSS-KSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTP--PIP  705
             R  +++FE V+QKDSS KS V  GGI PLT++ MNYL  +AD+  VL DI  N P    P
Sbjct  354   RVTLSKFEAVIQKDSSKKSAVPSGGIDPLTVNVMNYLALLADYGGVLKDILVNWPVDGSP  413

Query  704   KD-WLPDSYFAVSDS------DESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLF  546
             K    PDS+FA  +S       +S   A    +AWL+L+LL KLD  AE YKD++++YLF
Sbjct  414   KHPGFPDSHFAGCNSFASIAARDSDASAKFAWFAWLVLVLLSKLDAKAERYKDVALSYLF  473

Query  545   LANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPM  366
             LANNL+YVV KV  S L   LGE W++K  +KVK YA NYER+GW  V ASL  +P+  +
Sbjct  474   LANNLRYVVDKVARSSLRHLLGEQWMAKHESKVKLYATNYERMGWSKVFASL-ADPSVEI  532

Query  365   SPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTM  186
             S    K+  +KF+A+  +   K +   V D+ LRD +  S A KL   YR  YD      
Sbjct  533   SSGHAKESLRKFDAALEEVQTKQAGWAVPDQKLRDVIASSPAEKLKPAYRRLYDGCPRGD  592

Query  185   PKEKERHFSSIVKFAPEDVGHHLSDLF  105
             P          VKF P+D+ ++L+ + 
Sbjct  593   PA---------VKFTPDDLDNYLASML  610



>emb|CDX93267.1| BnaC04g46290D [Brassica napus]
Length=600

 Score =   404 bits (1037),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 235/583 (40%), Positives = 353/583 (61%), Gaps = 49/583 (8%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F  S++E  L+ + P+I KW+P      K  SLF  SR++A +F++C+            
Sbjct  37    FSLSMVEETLDSTEPIIKKWDPNT----KTISLFSHSRKQAKEFIRCI------------  80

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
                              AM RL+KEFF IL+ N   LDPES S  +  SS +       S
Sbjct  81    -----------------AMSRLEKEFFMILSSNLDQLDPESVSGHSSISSYSEFEYVMQS  123

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               + +   +          I+EVE  S+ VM+D+++I E MISCGY KEC K YK IRK 
Sbjct  124   DDEMEKASES---------ISEVEKASALVMSDLKVIAETMISCGYGKECIKSYKMIRKS  174

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             I+DE +  L ++K   S   + DW VLE  IKNW+ A +I V TLF GE+ LCD+VF+++
Sbjct  175   IVDEGLHLLRIQKCKISLFNRTDWSVLEPMIKNWIKAAKIGVTTLFRGEKLLCDHVFSAS  234

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIA-KYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
                IR + F EI+ EA + LF  PE ++ K  K  PE++F+L+D+Y AI++ RP+IE IF
Sbjct  235   T-TIRHTCFYEIANEAGLNLFSLPELVSNKEKKKLPERIFKLMDLYAAISDLRPDIELIF  293

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
               DS + ++T A++SL K  ++I T + +FE  ++KDSSK+   GGGIH LT   M++++
Sbjct  294   HFDSVAPVKTLAISSLKKFKNSIHTCLTEFELKIKKDSSKALTPGGGIHKLTRTTMSFIS  353

Query  764   SIADHSNVLSDIFSNTPPIPKDWLPDSYFA--VSDSDESPLPAISLRYAWlillllckLD  591
             S++++S VL++I +         L +SYF   + + +     A S+  AWLIL+LLCKLD
Sbjct  354   SLSEYSRVLAEILAEHAIKRNTRLLESYFTAPILEDEHINHHATSVHIAWLILVLLCKLD  413

Query  590   VIAEHYKDISIAYLFLANNLQYVVVKVR-TSRLNRFLGENWLSKQSAKVKQYAANYERLG  414
             + AE YKD+S++YLFL NN++ VV  VR T  L   LG++WL+K  AK++ Y  NYE + 
Sbjct  414   IKAESYKDVSLSYLFLVNNIRLVVDTVRSTHHLRNLLGDDWLTKHEAKLRSYTTNYENVA  473

Query  413   WGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
             W  V  ++P   +  +SP++ K HFK+F+ +F +A+ K S+CV+ D  LRD  KVS+ARK
Sbjct  474   WAKVYQTVPARTSTTLSPDQAKTHFKRFHVAFEEAYMKQSSCVILDAKLRDEFKVSIARK  533

Query  233   LLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             L+  Y++FY  + L M +E E +   +V+F P+++ ++LSDLF
Sbjct  534   LVPEYKEFYQKY-LPMLRE-EINIEMLVRFKPDNLENYLSDLF  574



>ref|XP_004142214.1| PREDICTED: uncharacterized protein LOC101209042 [Cucumis sativus]
 gb|KGN54215.1| hypothetical protein Csa_4G293250 [Cucumis sativus]
Length=582

 Score =   401 bits (1030),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 242/615 (39%), Positives = 364/615 (59%), Gaps = 46/615 (7%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWs--ssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASE  1764
             MP+ G ++ GF         S     + S+ S+   ES+++R L+ +  +I KW+ ++  
Sbjct  1     MPKNGKKIFGFCSKVLLPLVSPPFSNNSSSTSEVASESMIDRTLQSAAEIINKWSTQSLA  60

Query  1763  AAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEF  1584
               +V+S+F+ S++EA  F++CV  LQK M  L      S+KLV +  LM+ AMKRLQ EF
Sbjct  61    YTQVSSMFHHSKQEALRFIRCVNELQKVMYLLT-----SQKLVFSHRLMQTAMKRLQVEF  115

Query  1583  FQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDV  1404
             ++IL++NR  LD ESS    R++                                +V  V
Sbjct  116   YRILSVNREPLDVESSPVRVRTAED-----------------------------CDVRKV  146

Query  1403  SSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEV  1224
             SS  MAD+R I +CMIS GY+KEC ++Y  +RK ++DE + RLG+ K S   IRKM+ E 
Sbjct  147   SSVAMADLRAIADCMISSGYTKECVEIYTTVRKSVVDEGMYRLGIGKFSSQIIRKMNSEA  206

Query  1223  LELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPEN  1044
             ++ RI  WL     A+ T+FN ER LCD VF S+ +++RES F +  K+ AMILF FPE 
Sbjct  207   VDFRITKWLEGAITAITTIFNAERDLCDYVFVSS-ESVRESCFTKTCKDGAMILFAFPEV  265

Query  1043  IAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGI  864
             I K  K S + +F LLDM+  I  +   IESIFS +S   I++QA+ SL+ L ++I   +
Sbjct  266   IVKNQK-SQKNLFYLLDMFTVIFENWSRIESIFSFESTEVIQSQAIASLSGLSESISAVL  324

Query  863   AQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDS  684
             + +E+ +Q DSS S    GGIH L++ +M+ L+ +A++  +L  IFS  PP  K  LP  
Sbjct  325   SDYESSIQNDSSNSLSVDGGIHSLSLQSMDCLSHLAEYREILYTIFSRWPPPKKSTLPSD  384

Query  683   YFAVSDSDESPLPAISLRY-AWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVR  507
               + S   +    +    Y A +I +LLCKLD  A    DIS++YLFLANN+++V+ +V+
Sbjct  385   SNSSSLDSDDSPISSVSSYMARIIFILLCKLDSKARQCDDISLSYLFLANNVRFVIWQVQ  444

Query  506   TSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFN  327
             +S L+  LGE W+     KVKQY  +YE+L WG VI++LP NPTA ++  E+ + ++KFN
Sbjct  445   SSNLHYLLGEEWIELHKGKVKQYIDSYEQLAWGKVISTLPVNPTAALTTAEVTEVYEKFN  504

Query  326   ASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVK  147
             +SF +A+RK  + V+ D  LR  + +S+A+  L  YR+FY+TH+  + +E       I +
Sbjct  505   SSFKEAYRKQRSSVIPDPKLRFEI-LSIAKSWLPVYREFYNTHRFPVGEE------VIAR  557

Query  146   FAPEDVGHHLSDLFF  102
               PEDV ++LS LFF
Sbjct  558   LTPEDVENYLSYLFF  572



>ref|XP_010922437.1| PREDICTED: exocyst complex component EXO70A1-like [Elaeis guineensis]
Length=628

 Score =   401 bits (1030),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 266/632 (42%), Positives = 390/632 (62%), Gaps = 39/632 (6%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEA-  1761
             MPR G+R +      W S+    +        F  ++ME  +  +  +I +WN +A+   
Sbjct  1     MPRNGLRALFSHAGRWRSNPPSASPR----QSFSATLMEDHIASAEAIISRWNADANANT  56

Query  1760  -AKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ------PRSEKLVRAQNLMEVAMK  1602
              AKVTSLF+  R EA +F+  V +LQ+AM F    +       RS  L+RAQ LM+ AM+
Sbjct  57    FAKVTSLFHAGRAEAREFLHAVADLQRAMVFFVSGECAAPAAARSAALIRAQTLMQTAMR  116

Query  1601  RLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSI  1422
             RL+ EF QIL  NR  LDPES S+S R+ S A +    +S  D      +         I
Sbjct  117   RLEHEFQQILCTNRDRLDPESVSSSTRTRSRAFSDDTEASDDDEICAAGES--------I  168

Query  1421  TEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKI-  1245
              EVE  S+  MAD+R I E MI+ GY KEC ++YK +RK I+DE + RLG E++S S+I 
Sbjct  169   GEVERASAVAMADLRAIAESMIAAGYGKECVRIYKTLRKSIVDEGLYRLGFERLSQSQIH  228

Query  1244  RKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMI  1065
             +K+DWE L+L+I++WL A  +A++TLF+GER LCD VFA + D+I ES F +I+++AA +
Sbjct  229   QKLDWEALDLKIRSWLVAAPVALRTLFSGERILCDYVFAGS-DSIGESCFADITRDAAAL  287

Query  1064  LFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLG  885
               EFPE++AK  K SPEK+FR+LD+Y+AI++  PEIE++F  +S +++R+QA+ SL KL 
Sbjct  288   FLEFPESVAK-TKRSPEKLFRILDVYDAISDLWPEIEAVFCFESTAAVRSQALASLLKLA  346

Query  884   DAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDI---FSNTP  714
             +A R  +A FET +QKD+SKS V GG +HPLT   MNYL  +AD+   L+DI   FS   
Sbjct  347   EAARAMLADFETAIQKDNSKSPVPGGAVHPLTRYVMNYLAFLADYEASLADIYADFSLQI  406

Query  713   PIPKDWLPDSYFAVSDSDESPLP---------AISLRYAWlillllckLDVIAEHYKDIS  561
             P P   LP+S+F  + +  S             IS R+AWL+L+LLCKLD  AE Y++++
Sbjct  407   PTP---LPESFFDSASTSASSSSASDGGGAASTISPRFAWLVLVLLCKLDGKAEVYREVA  463

Query  560   IAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPEN  381
             ++YLFL+NNLQY+V KVR S L   LG++W +K +AK + YA++YERLGW  V A++P +
Sbjct  464   LSYLFLSNNLQYIVNKVRESHLRFLLGDDWAAKHAAKARHYASSYERLGWAKVAAAVPAD  523

Query  380   PTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDT  201
             P A M   E  +  K FN  F    R  +  VV+D  +R+ ++ S+A  ++  YR FY+ 
Sbjct  524   PAAKMDSSEAWEKMKGFNLMFEATCRCQADWVVADARIREEVRASVASLIVPAYRVFYEG  583

Query  200   HKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              +  +        +++V+F+P DV + +  L 
Sbjct  584   CRAALRDSSAAA-AAVVRFSPGDVKNRVYGLL  614



>ref|XP_010521809.1| PREDICTED: exocyst complex component EXO70A1-like [Tarenaya hassleriana]
Length=627

 Score =   400 bits (1028),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 247/593 (42%), Positives = 368/593 (62%), Gaps = 35/593 (6%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKW-NPE------ASEAAKVTSLFY-ESRREANDFVKCVRNLQ  1686
             F ES+M   +  +  ++ +W +PE      +S    ++SLF   +R E   FV+ + +L+
Sbjct  42    FSESLMADTIVSAEAIVNRWISPELHDSSVSSSFCTLSSLFSPGNREEGRRFVEVIGSLR  101

Query  1685  KAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssva  1506
              AMQ +    P S+KL RAQNLM +AMK LQ+EF++IL  NR +LDPES S     +S +
Sbjct  102   YAMQSVMSVNPGSKKLDRAQNLMRIAMKHLQREFYRILKSNRRYLDPESVSVRTSRASDS  161

Query  1505  ststgfsstsdfdvddddddvrvagdSITEVEDVS--SFVMADMRLIVECMISCGYSKEC  1332
             +TS   S +      D + D   + +S +E E     + VM D+++I +CMISCG+ KEC
Sbjct  162   TTSRCSSRSVSDSELDGESDSSNSDESKSESERGGDDADVMEDLKMIADCMISCGHDKEC  221

Query  1331  FKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGER  1152
                YK IRK II E++ RLG E +S S+I+K+DWE+LE  +KNWL    +AV TLF GER
Sbjct  222   VNTYKKIRKSIIVESLDRLGFENLSLSQIQKLDWEILEKTMKNWLRTARVAVTTLFCGER  281

Query  1151  TLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIAN  972
              LCD+VF+S+ D IRES F EI+ ++A+ LF FPEN+AK  + + EKVF  LD+Y AI+N
Sbjct  282   ILCDHVFSSS-DVIRESCFAEIALDSALSLFGFPENVAK-CRLTSEKVFITLDVYQAISN  339

Query  971   HRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPL  792
                +IE +FS  S SS++ QA+ S +KLG+ IR+ + +FET +  +SSKS + GGG+H L
Sbjct  340   LMLQIELVFSYGSTSSVKLQAIESQSKLGETIRSMLGEFETSISMESSKSPIPGGGVHQL  399

Query  791   TIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPL---PAISLRYAW  621
                 MN++  +AD+S+ L+ I +   P     LP+ +F    ++ +       ++ + AW
Sbjct  400   ARYVMNFIVFLADYSDSLAGILTTETP---STLPEDFFGGGGTETAGAVVYSPVATKLAW  456

Query  620   lillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQ  441
             LIL+LLCK+D  +  Y D++++YLFLANNL Y+V KV TS L   LGE+W++K   KV+Q
Sbjct  457   LILVLLCKIDAKSRLYNDVALSYLFLANNLNYIVDKVSTSNLMVVLGEDWVTKHEEKVRQ  516

Query  440   YAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRD  261
             + A  E++ WG V+ SL          E+ ++  ++FN +F +A++  S+ VV D  LRD
Sbjct  517   FVAKCEKIAWGGVMTSLSGE------TEDAEEILRRFNEAFEEAYKTQSSWVVPDPKLRD  570

Query  260   SLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
              +KVS A KL+  Y +FY    +             V+FAPED+G++LSDL+F
Sbjct  571   EIKVSAAGKLIPAYSEFYKNQNMEN-----------VRFAPEDLGNYLSDLYF  612



>gb|KHN33420.1| hypothetical protein glysoja_005462 [Glycine soja]
Length=580

 Score =   398 bits (1022),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 235/582 (40%), Positives = 356/582 (61%), Gaps = 50/582 (9%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+M++ +E +  +I KW    S + +   LF  +R+EA  ++  V +LQ  MQ L  
Sbjct  27    FSDSLMDQNIETARAIISKWEL-ISPSDQAAPLFSNTRQEAKQYLNAVMSLQSTMQHLVA  85

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
                 S+ L++A  LM++AMKRLQ EF++IL  NR +L PES +++   SS  S       
Sbjct  86    LDSSSDTLIQAHFLMQLAMKRLQAEFYRILAQNRDNLHPESVTSTDHRSSSVS-------  138

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECM--ISCGYSKECFKVYKDIR  1308
                                    +D ++F   + R   + +  ++    KEC K+Y  +R
Sbjct  139   -----------------------DDGTNFSDDEFRFAGDSISTVAMAARKECVKIYILMR  175

Query  1307  KWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFA  1128
             K ++DEA+   GVE+++FS+I+KMDWEVLE +IK+WL+A+  AV+TLF+GE+TLCD VF 
Sbjct  176   KSMVDEALYHFGVERLTFSQIQKMDWEVLESKIKSWLNAVRFAVRTLFHGEKTLCDYVFG  235

Query  1127  STPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESI  948
             S    I ES F  + +E A  LF FPE +AK  K +PEK+FR LD+Y AI+++R +IESI
Sbjct  236   SPERKIAESCFAAVCREGAESLFAFPEKVAK-CKKTPEKMFRTLDLYEAISDNRQQIESI  294

Query  947   FSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYL  768
             FS +S S IR+Q   S A+LG+A RT +  FE+ +QK+SSK  + GGGIHP+T   MNY+
Sbjct  295   FSSESTSCIRSQVTVSQARLGEAARTMLINFESAIQKESSKIPLPGGGIHPVTRYVMNYI  354

Query  767   TSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSD-ESPLPAISLRYAWlillllckLD  591
               +AD+ + L++I ++    P++ LP+SY+   D + ++    I+ R AWLIL+LLCKLD
Sbjct  355   AFLADYGDALAEIVAD---WPQNSLPESYYRSPDREGKNRSSEIAERMAWLILVLLCKLD  411

Query  590   VIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGW  411
               AE YK+++++YLFLANN+QYVVVKVR S L   LGE+WL+K   KVK+Y + YE +GW
Sbjct  412   GKAELYKEVALSYLFLANNMQYVVVKVRNSNLGFILGEDWLTKHELKVKEYVSKYEHVGW  471

Query  410   GDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKL  231
               V  SLPE PTA    E+ +   + F+ +F  A +   + VV D  LR+ +K S+A K 
Sbjct  472   NKVFLSLPETPTA----EQARAILECFDVAFHDACKAQFSWVVPDPKLREEIKASIASKF  527

Query  230   LRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +  +R+ ++ +++           ++    P+D+ H LSD+ 
Sbjct  528   VPSHRELFEKYQVGS--------ETVFGLTPDDLEHSLSDIL  561



>ref|XP_009386540.1| PREDICTED: exocyst complex component EXO70A1-like [Musa acuminata 
subsp. malaccensis]
Length=658

 Score =   400 bits (1028),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 237/584 (41%), Positives = 355/584 (61%), Gaps = 43/584 (7%)
 Frame = -2

Query  1796  MIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAM-----QFLAMEQPRSEKLVR  1632
             ++ KW P+ +  AK +SLF+  R EA +++  VR+LQ+AM        + E      L+R
Sbjct  66    ILAKWEPDDAAYAKSSSLFHGDRAEACEYLAAVRDLQRAMLSFVSSDASSESSSHAALIR  125

Query  1631  AQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvdddd  1452
             AQ LM+ AM+RL+KEF+QIL  NR  LDPES SA + + S AS    +            
Sbjct  126   AQTLMQTAMRRLEKEFYQILAANRHRLDPESVSARSSTHSSASDDAEYDDVRGARNS---  182

Query  1451  ddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLG  1272
                      + +VE  ++  M D+  I E MIS GY KEC KVYK +RK I+DE + RLG
Sbjct  183   ---------MGDVEGAAAIAMDDLHAIAETMISVGYGKECVKVYKVLRKSIVDEGLYRLG  233

Query  1271  VEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFK  1092
              E++S S++ K+DW+VLE +I++WL A  +AV TLF+GER L D+VFAS+ D+IRE++F 
Sbjct  234   FERLSPSQVHKLDWQVLEPKIRSWLGASRVAVSTLFSGERVLSDHVFASS-DSIREAVFA  292

Query  1091  EISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQ  912
             +IS +AA+    FPE++AK  K S EK+FR+LD+  A++   PEIE +FS  S +++R Q
Sbjct  293   DISGDAAVQFLRFPESVAK-CKRSTEKMFRILDLCEAVSELLPEIEPVFSFVSTAAVRDQ  351

Query  911   AVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSD  732
             A+++ +KL +  R  +A FE  + K+ SKS   GGGIHPLT  AM+Y+ ++AD+   L++
Sbjct  352   ALSAYSKLAETARAILADFEAAIHKEHSKSLPPGGGIHPLTRHAMDYVITLADYEPTLAE  411

Query  731   IFSNTP---------------PIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllck  597
             IF++ P                  +   P    ++S  D+     I++R+AWLIL+LLCK
Sbjct  412   IFADFPLHTQSSLSDFFDSSYSESRPSSPAFSSSISSIDDGHGSEIAVRFAWLILVLLCK  471

Query  596   LDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERL  417
             LD  A  Y+D  ++YLFLANNLQY+V KVR+SRL   LGE W ++ +AK +Q+AA YER+
Sbjct  472   LDGKAAAYRDAGLSYLFLANNLQYIVNKVRSSRLWGMLGEEWTARHAAKARQHAAGYERV  531

Query  416   GWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLAR  237
              WG V+A +       +SP E +   + FNA+  +A    +  VV+D  +R+ ++ ++  
Sbjct  532   AWGKVLALVTAE---EVSPGEARDRMRAFNAALEEACTAQAGWVVADAEMREEVRAAVRG  588

Query  236   KLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              LL  YR FY+  ++ +        S  V+F+PE+V   L++LF
Sbjct  589   MLLPAYRGFYEQWRVVLEG------SGAVRFSPEEVRDRLAELF  626



>gb|KHN30212.1| Exocyst complex component 7 [Glycine soja]
Length=585

 Score =   397 bits (1019),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 251/581 (43%), Positives = 361/581 (62%), Gaps = 42/581 (7%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+M+  +E +  +I KW    S + +   LF  +R+EA  ++  V +LQ  MQ L  
Sbjct  26    FSDSLMDENIETARAIISKWEL-ISPSDQTAPLFSNTRQEAKQYLNAVMSLQSTMQHLVA  84

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
                 S+ LV+A  LM++AMKRLQ EF++IL  NR +L PES +++   SS  S      S
Sbjct  85    LDSSSDTLVQAHFLMQLAMKRLQTEFYRILAQNRDNLHPESVTSTDHRSSSVSDDGTNFS  144

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               +F                   + +S+  MA    I ECM+S GYSKEC K Y   RK 
Sbjct  145   DDEFRFAG---------------DSISTVAMA---AIAECMVSAGYSKECIKTYILTRKS  186

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             ++DEA+   GVE++SFS+++KMDW+VLE +IK+WLSA++ A++TLF+GERTLCD VF S 
Sbjct  187   MVDEALYHFGVERLSFSQVQKMDWKVLESKIKSWLSAVKFAIRTLFHGERTLCDYVFGSP  246

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
                I ES F  + +E A  LF FPE +AK  K + EK+FR LD+Y AI+++R +IESIFS
Sbjct  247   ERKIAESCFAAVCREGAESLFAFPEKVAK-CKKTLEKMFRTLDLYEAISDNRLQIESIFS  305

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              +S SSIR+Q   S A+LG+A+RT +  FE  +QK+SSK  V GGGIHPLT   MNY+  
Sbjct  306   SESTSSIRSQVDVSQARLGEAVRTMLVDFEAAIQKESSKIPVPGGGIHPLTRYVMNYIEF  365

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPA-ISLRYAWlillllckLDVI  585
             +AD+ + +          P++ LP+SY+   D +     A I+ R AWLIL+LLCKLD  
Sbjct  366   LADYRDCVD--------WPQNSLPESYYCSPDREGMNRSAEIAERMAWLILVLLCKLDGK  417

Query  584   AEHYKDISIAYLFLANNLQYVVVKVRTSR-LNRFLGENWLSKQSAKVKQYAANYERLGWG  408
             AE YK+++++YLFLANN+QYVVVKVR S+ L   +GE+WL+K   KVK+Y   YER+GW 
Sbjct  418   AELYKEVALSYLFLANNMQYVVVKVRNSKNLGFIVGEDWLTKHELKVKEYVCKYERVGWS  477

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
              V  SLPENPTA    E+ +  ++  +A F +  +  S+ +V DR LR+ +K S+A KL+
Sbjct  478   KVFLSLPENPTA----EQARAIYECLDAEFHETCKAQSSWIVPDRKLREEMKDSIASKLV  533

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               YR+F+  +++ +  +            P+D+ H+LSD+ 
Sbjct  534   PRYREFFGKYRVGLGTD--------FGLTPDDLEHNLSDIL  566



>ref|XP_010686180.1| PREDICTED: exocyst complex component EXO70A1-like [Beta vulgaris 
subsp. vulgaris]
Length=623

 Score =   395 bits (1016),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 216/584 (37%), Positives = 364/584 (62%), Gaps = 17/584 (3%)
 Frame = -2

Query  1826  MERALEISGPMIMKWNPEASEAAKVTSLF-YESRREANDFVKCVRNLQKAMQFLAM----  1662
             ME  ++ S  +I  W+ E S+ +  TSLF + SR E   F++ V++L  A+QF A     
Sbjct  1     MEDTMDSSMKIIASWDYETSDISPNTSLFNHHSRLEVLQFMRAVKDLHAAIQFFATTSAS  60

Query  1661  --EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMN-RAHLDPEsssasarsssvaststg  1491
                 P  +K+V +QNL+ VA KRL  EFF +L  N + H+D  S       SS   ++  
Sbjct  61    SANHPPHKKIVSSQNLLRVAKKRLSSEFFSLLKTNSKHHIDYYSVEDDNSHSSGDLSTLN  120

Query  1490  fsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDI  1311
              ++  + ++    +    + +  +  E+ S+  MAD++LI +CM+S G+ K+C K+YK  
Sbjct  121   RNNFENNNIFTITNYNNNSSEDHSTTEESSA--MADLKLITDCMMSAGFGKKCLKIYKLT  178

Query  1310  RKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVF  1131
             R+  +D+ + +LGV ++   +++K DWE ++ ++  WL  +   VK +F  E+ LC+++F
Sbjct  179   RRSFVDDVLLKLGVRRLKKFQVQKFDWETIDAKMNRWLKIVGTCVK-VFGNEKNLCEHLF  237

Query  1130  -ASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIE  954
              AST  ++ E+ F E+ KEAA++L+  P  +AK++K S +K+ + L++Y  ++    E++
Sbjct  238   SASTLSSVTETCFSEVCKEAALLLYRIPGKLAKHSKKSHDKILKFLNLYEGMSEDISEVD  297

Query  953   SIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMN  774
              IFS +  S++R Q  +S  ++ + ++  + +FE  + KD+SK  V+GG +HPLT   +N
Sbjct  298   RIFSSEVTSAVRLQLRSSHGRVSETVKLMVTEFEASIHKDASKGLVSGGAVHPLTKHVIN  357

Query  773   YLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckL  594
             YL +++ ++ +L  I ++ P   +  LP+SYF      E+    ++L++AWLIL+LL KL
Sbjct  358   YLVNLSHNAILLDKILADYPVSLQSPLPESYF----EGETLSSPVALQFAWLILVLLGKL  413

Query  593   DVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLG  414
             D  +E YKD +++YLFLANNLQYV+ +V++++L   LGE W++K ++KV QYAANYER+G
Sbjct  414   DTKSELYKDAALSYLFLANNLQYVINQVKSTKLYNVLGEKWVTKHTSKVVQYAANYERMG  473

Query  413   WGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARK  234
             WG VI+SLP++ T  +S +++K  FK+FN  F + +RK    +V D  LRD +K S+ RK
Sbjct  474   WGRVISSLPKDITIEISLDKVKDSFKRFNIGFEEEYRKQVDWIVQDSKLRDDMKASIVRK  533

Query  233   LLRPYRDFYDTHKLTMPKEKER-HFSSIVKFAPEDVGHHLSDLF  105
             +   YR  YD +K+ + K +ER    S++KF PED+ ++LSDL 
Sbjct  534   VDLRYRKMYDKYKVVLAKTRERGKIDSVIKFTPEDLENYLSDLL  577



>ref|XP_002534263.1| Exocyst complex component, putative [Ricinus communis]
 gb|EEF28122.1| Exocyst complex component, putative [Ricinus communis]
Length=388

 Score =   387 bits (994),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 196/360 (54%), Positives = 273/360 (76%), Gaps = 4/360 (1%)
 Frame = -2

Query  1178  VKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRL  999
             ++TLFNGER LCD+VFA++ D+IRES F EISKEAA++LF FPE +AK  K+ P+K+FR+
Sbjct  1     MRTLFNGERILCDHVFAAS-DSIRESCFSEISKEAALLLFGFPELVAKSKKSRPDKIFRV  59

Query  998   LDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKST  819
             LDMY AI+ +  EIESIFS +S S++R+QA++SL KL ++I   +++FE+ +QKDSSK+ 
Sbjct  60    LDMYTAISENWMEIESIFSFESISAVRSQALSSLVKLSESILILLSEFESTIQKDSSKTA  119

Query  818   VAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAI  639
             V G  IHPLTI  M++LT + D+SN LSDI S+ PP PK  LP S+    +S ++P P +
Sbjct  120   VPGADIHPLTIYGMHHLTLLGDYSNFLSDIISDWPPPPKTSLPKSFLDSPESVDTPAPPM  179

Query  638   SLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQ  459
             S+R+AWL L+LLCKLD  A+ YKD+S++YLFLANNLQYVV KV+TS L   LGE+WL+K 
Sbjct  180   SVRFAWLTLVLLCKLDGKAKSYKDVSLSYLFLANNLQYVVNKVQTSNLRYLLGEDWLAKH  239

Query  458   SAKVKQYAANYERLGWGDVIASLPE-NPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVV  282
               KVKQ+AANYERL WG +  SL E NP  P+SPE +++ FKKFN  F +A+RK S+C+V
Sbjct  240   ETKVKQFAANYERLAWGHLFDSLAENNPKVPISPEAVRESFKKFNLRFEEAYRKQSSCIV  299

Query  281   SDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             SD  LRD +K+S+++K++  YR+FY+  +  +  E  R+    V++ P++VG++LSDLFF
Sbjct  300   SDPKLRDEIKMSISQKVVPVYREFYEQQRSVI--EGNRNVRLCVRYTPDEVGNYLSDLFF  357



>emb|CDY49576.1| BnaA10g12720D [Brassica napus]
Length=551

 Score =   390 bits (1003),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 203/430 (47%), Positives = 297/430 (69%), Gaps = 25/430 (6%)
 Frame = -2

Query  1391  MADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELR  1212
             M D+++I +CMIS GY+KEC KVYK +R+ I+DE +  L VE+++  +I+KMDWE+LE +
Sbjct  115   MDDLKMIADCMISTGYAKECVKVYKTVRRSIVDETLQTLSVERLTLHQIQKMDWEILEPK  174

Query  1211  IKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKY  1032
             IK+WL A ++AV+ LF GER L D+VF+S+ + I E+ F +I++E A+ LF FPE+ AK 
Sbjct  175   IKSWLQAAKLAVRKLFFGERILADHVFSSSTN-IVEASFTDITQEGALTLFAFPEHAAKI  233

Query  1031  AKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFE  852
              K SPEK+FR LDMY ++AN   EIESIF  DSA+++R+Q + SLAKLGDA+R  ++ FE
Sbjct  234   KKLSPEKMFRFLDMYESLANLFVEIESIFYFDSAAAVRSQVINSLAKLGDAVRFMMSDFE  293

Query  851   TVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAV  672
             T +QK++SK+ + GGG+HPLT   MNYL+ +AD+ +            P+D         
Sbjct  294   TAIQKEASKTLIVGGGVHPLTRYVMNYLSFLADYDDG-----GGDDAHPEDLY-------  341

Query  671   SDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLN  492
                  SP   +S R AW+ILL LCK+D  A+ YKD++++YLFLANNLQYVVVKVR+S L 
Sbjct  342   ----SSP---VSKRIAWVILLTLCKIDGKAQPYKDVALSYLFLANNLQYVVVKVRSSNLR  394

Query  491   RFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQ  312
               LG++W+ +   KV QYA  +E+L WG V+ SLPENP   ++PEE +  F +FN  F  
Sbjct  395   LLLGDDWVVRHEGKVNQYAEKFEKLAWGKVLTSLPENPAEEITPEEARALFARFNDEFEA  454

Query  311   AHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPED  132
             A+RK  + V+ D NLRD +K+SL++KL+    +FY+ ++  +  +    F++  ++ PED
Sbjct  455   AYRKQISWVIPDPNLRDRIKISLSQKLMLVCTEFYEVNRFGLGGDA---FNA--RYTPED  509

Query  131   VGHHLSDLFF  102
             +G++LSDL+F
Sbjct  510   IGNYLSDLYF  519


 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 45/84 (54%), Gaps = 4/84 (5%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             E+ ++  +     +I KW   + E    T+    SR EA +FV+ VR+L   M  L    
Sbjct  23    ETAVQECMSDITTVISKWTSSSDEFLFSTN----SRSEAEEFVEVVRHLHSTMHRLVAVN  78

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEF  1584
             P SEKL+ AQNLM+ AM  L+ EF
Sbjct  79    PSSEKLIYAQNLMQSAMNLLESEF  102



>ref|XP_008447429.1| PREDICTED: exocyst complex component EXO70A1 [Cucumis melo]
Length=582

 Score =   391 bits (1004),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 244/615 (40%), Positives = 366/615 (60%), Gaps = 46/615 (7%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWs--ssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASE  1764
             MP+ G ++ GF     S   S +   + S+ S+   ES+++R L+ +  +I KW+ E+  
Sbjct  1     MPKNGKKIFGFCSKVLSPLVSPSYSNNSSSTSEVASESMIDRTLQSAAEIINKWSTESLA  60

Query  1763  AAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEF  1584
               +V+S+F+ S++EA  F++CV  LQK M  L      S+KLV +  LM++AMKRLQ EF
Sbjct  61    YTEVSSMFHHSKQEALRFIRCVNELQKVMYLLT-----SKKLVFSHRLMQIAMKRLQIEF  115

Query  1583  FQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVEDV  1404
             ++IL++ R   D ESS    R++                                +V  +
Sbjct  116   YRILSVKREPFDVESSPVRVRTAED-----------------------------CDVRKI  146

Query  1403  SSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEV  1224
             SS  MAD+R I +CMIS GY+KEC ++Y  +RK ++DE + RLG+ K S   IRKM+ E 
Sbjct  147   SSVAMADLRAIADCMISTGYTKECVEIYGTVRKSVVDEGMYRLGIAKFSSQIIRKMNSEA  206

Query  1223  LELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPEN  1044
             ++LRI  WL     A+ T+FN ER LCD VFAS+ +++RES F +  K+ AMILF FPE 
Sbjct  207   VDLRITKWLEGAITAITTIFNAERDLCDYVFASS-ESVRESCFTKTCKDGAMILFAFPEV  265

Query  1043  IAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGI  864
             I K  K S + +F  LDM+  I  +   IESIFS +S   I++QA+ SL+ L ++I   +
Sbjct  266   IVKNQK-SQKNLFYSLDMFTVIFENWSRIESIFSFESTEVIQSQAIASLSVLSESISAVL  324

Query  863   AQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDS  684
             + +E+ +Q DSS S    GGIH L++ +M+ L+ +A++  +L  IFS  PP  K  LP  
Sbjct  325   SDYESSIQNDSSSSLSVDGGIHSLSLQSMDCLSHLAEYREILYIIFSRWPPPKKSTLPSD  384

Query  683   YFAVSDSDESPLPAISLRY-AWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVR  507
               + S   +    +    Y A +I +LLCKLD  A    DIS++YLFLANN+++V+ +V+
Sbjct  385   SNSSSLDSDDSPISSVSSYMARIIFILLCKLDSKARQCDDISLSYLFLANNVRFVIWQVQ  444

Query  506   TSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFN  327
             +S L+  LGE W+     KVKQY  +YERL WG VI++LPENPTA ++  E+ + +  FN
Sbjct  445   SSNLHYLLGEEWIELHKGKVKQYIDSYERLAWGKVISTLPENPTAALTTAEVAEVYDNFN  504

Query  326   ASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVK  147
             +SF +A+RK  +C+V D  LR  + +S+A+  L  YR+FY+TH+  + +E       I +
Sbjct  505   SSFKEAYRKQRSCIVPDPKLRFEI-LSIAKSWLPVYREFYNTHRFPVGEE------VIAR  557

Query  146   FAPEDVGHHLSDLFF  102
               PEDV ++LS LFF
Sbjct  558   LTPEDVENYLSYLFF  572



>ref|XP_009140928.1| PREDICTED: exocyst complex component EXO70B1 [Brassica rapa]
Length=600

 Score =   391 bits (1004),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 224/586 (38%), Positives = 347/586 (59%), Gaps = 39/586 (7%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPE----ASEAAKVTSLF-YESRREANDFVKCVRNLQKAM  1677
             F ES++  ++E +     KW  +    A  +  ++S+F  E+R E   FV  + +LQ A+
Sbjct  23    FSESLLLDSIEATESFTKKWISQDHLSACSSCTLSSIFSTENRAEGRKFVDVINSLQYAI  82

Query  1676  QFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvasts  1497
             Q + +  P S KL RA NL+  AMK L+KEF+++L  NR +LDPES S  +  S      
Sbjct  83    QGVTLVNPESHKLTRAHNLLSTAMKHLEKEFYRVLKSNRRNLDPESVSIRSIPSFNPRKK  142

Query  1496  tgfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYK  1317
                 S                   + + E+    +M D+++I +CMIS GY  EC + YK
Sbjct  143   VSIYSN------------------VPKSEEAD--IMTDLQMIADCMISSGYENECVRTYK  182

Query  1316  DIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDN  1137
              IR+ II +++S+LG E +SF KI+K+DW+ +E  IK WL A +I +  LF+GER LCD+
Sbjct  183   KIRRSIIVDSLSKLGFENLSFGKIQKLDWDSMEKNIKKWLEATKIVINNLFDGERILCDH  242

Query  1136  VFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEI  957
             VF+++P ++ ES F EI+ ++A+ LF FP ++A+  + + EK+F  LD+Y  I+N  P I
Sbjct  243   VFSTSP-SVAESCFSEITLDSALTLFIFPVSVAR-CRKTAEKIFLTLDVYQTISNLLPRI  300

Query  956   ESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAM  777
             E IFS DS S++R QA  SL  LG+AI   +A+FE  + K+ SKS + GGG+HPLT   M
Sbjct  301   EEIFSYDSTSAVRFQAADSLRSLGEAINYMVAEFEASIAKEPSKSVIPGGGVHPLTRYVM  360

Query  776   NYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPA-ISLRYAWlillllc  600
             N++  +AD++  L+ + + +  +P   LP+ YF    SD     + ++ R  WLIL+LLC
Sbjct  361   NFVVFLADYNESLAGVLTESD-LP---LPEDYFGGDKSDVGETASTVTTRLGWLILVLLC  416

Query  599   kLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYER  420
             K+D  +  Y++++++YLFLANNL YV+ KVR S L   LG+ W++    KV QY   YE+
Sbjct  417   KIDTKSRIYENVALSYLFLANNLHYVISKVRKSNLRVVLGDEWVANHQGKVSQYLEKYEK  476

Query  419   LGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLA  240
             + WG+V+ SL E     +  +  K+  K+FN  F +A RK S  VV D  +R+ LK S+A
Sbjct  477   VAWGEVLTSLSEEERVVLEEDVAKERLKRFNEVFEEAFRKQSGWVVPDTKMREGLKDSVA  536

Query  239   RKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             +KL      FY+ + +         +  IV++ P+D+G++LS L+ 
Sbjct  537   KKLTYVASLFYEKYHV-------ETWGDIVRYVPKDLGNYLSVLYL  575



>emb|CDX71078.1| BnaC03g11620D [Brassica napus]
Length=555

 Score =   387 bits (994),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 204/431 (47%), Positives = 296/431 (69%), Gaps = 26/431 (6%)
 Frame = -2

Query  1391  MADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELR  1212
             M D+++I +CMIS GY+KEC KVYK +R+ I+DE +  L VE+ +  +++KMDW+ LE +
Sbjct  117   MDDLKMIADCMISTGYAKECVKVYKTVRRSIVDETLHGLAVERFTLHQVQKMDWDTLESK  176

Query  1211  IKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKY  1032
             I+ WL A+++AV++LF GER L D+VF+S+ + I ES F +I++E A+ LF FPEN AK 
Sbjct  177   IRTWLPAVKLAVRSLFFGERLLADHVFSSSLN-IVESSFTDITQEGALTLFTFPENAAKI  235

Query  1031  AKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFE  852
              K SPEK+FR LDMY ++A+   EIESIF  DSA+++R Q + SLAKLGDA R  +  FE
Sbjct  236   KKLSPEKMFRFLDMYESLASLFVEIESIFYFDSAAAVRAQVINSLAKLGDAARLMMTDFE  295

Query  851   TVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAV  672
             T +QK++S++ V GGG+HPLT   MNYL+ +AD+   ++ IF N       W   S    
Sbjct  296   TAIQKETSRTPVVGGGVHPLTRYVMNYLSFLADYDESIAVIFEN-------WQLYS----  344

Query  671   SDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSR-L  495
                  SP   +S+R AW+ILL LCK+D  A+ YKD++++YLFLANNLQYVVVKVR+S  L
Sbjct  345   -----SP---VSVRIAWVILLTLCKIDGKAQPYKDVALSYLFLANNLQYVVVKVRSSSGL  396

Query  494   NRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFA  315
                LGE+W+ +   KVKQYA  +++L WG V+ SLPE P   ++PEE ++ F +FN  F 
Sbjct  397   KVLLGEDWVVRHEGKVKQYAEKFQKLAWGKVLTSLPEYPKEEIAPEEARELFGRFNDEFE  456

Query  314   QAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPE  135
              A+R+  + VV D  LRD +K+SL+ KL+    +FY+ ++  +  +    F+  V++ PE
Sbjct  457   AAYRRQMSWVVPDPKLRDWIKISLSGKLVPVCSEFYEVNRFGLGGDG---FN--VRYTPE  511

Query  134   DVGHHLSDLFF  102
             D+G++LSDL+F
Sbjct  512   DIGNYLSDLYF  522


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 50/90 (56%), Gaps = 3/90 (3%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKW-NPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAME  1659
             ES ++  +     +  KW +P  S  A + S    SRREA +F + VR+L   M  LA  
Sbjct  23    ESAVQECMSKINRVTSKWTSPSPSSDAHLFST--NSRREAEEFAEAVRHLHSTMHRLAAV  80

Query  1658  QPRSEKLVRAQNLMEVAMKRLQKEFFQILN  1569
              P SEKLV AQNLM+ AM  L+ EF ++ +
Sbjct  81    NPSSEKLVYAQNLMQSAMNLLESEFHRVFS  110



>ref|XP_009409718.1| PREDICTED: exocyst complex component EXO70A1-like [Musa acuminata 
subsp. malaccensis]
Length=664

 Score =   390 bits (1002),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 228/596 (38%), Positives = 359/596 (60%), Gaps = 33/596 (6%)
 Frame = -2

Query  1832  SVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQP  1653
             S+ME  +  +  +I+KW+P+AS  A +TSLFYESR EA+ F+  V +LQ+AM        
Sbjct  63    SMMEEKVARAEAIIVKWDPDASAYANITSLFYESRSEAHRFLAEVSDLQRAMLAFVAAAG  122

Query  1652  RSE----KLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfs  1485
             R+      LVRAQ LM+ AM+RL KEF+QIL  NR  LDPES S S RS+  + +     
Sbjct  123   RARLSHPCLVRAQTLMQAAMRRLVKEFYQILAANRDLLDPESVSVSVRSAHSSVSEEPDY  182

Query  1484  stsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRK  1305
              + ++   +++         I++VE  ++  MAD+R I + M+S GYSKEC   Y+ +RK
Sbjct  183   DSWEYRSPEEEALAAGES--ISKVERAAAIAMADLRAIADTMVSAGYSKECITTYQTLRK  240

Query  1304  WIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAS  1125
              I+DE + RLG E++S + + K+DW +LEL++++WL A  +A++TLF+GE  L D+VFA 
Sbjct  241   CIVDEGLCRLGFERLSLAHVLKLDWAMLELKVRSWLGASRVALRTLFHGEHVLLDHVFAG  300

Query  1124  TPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIF  945
             + D +RE++F  I+ +AA+    FP ++AK +K SPEK+FRLLD+Y+ I    PEIE +F
Sbjct  301   S-DTVREALFAYIAGDAALHFLSFPVSVAK-SKRSPEKLFRLLDLYDTIVELWPEIELVF  358

Query  944   SMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLT  765
             S +S + +R QA+ SL+KL +     +A FE+ + ++SS+  V GGG+HP+T   MNY++
Sbjct  359   SFESTAVVRAQALASLSKLAETACATLADFESAILRESSRLAVPGGGVHPMTRYTMNYIS  418

Query  764   SIADHSNVLSDIFSNTP-----PIPKDWLPDSYF-AVSDSDESP----------LPAISL  633
              +AD+ + L++IF++ P     PIP  +L  S   AV      P          + A++ 
Sbjct  419   LLADYESSLAEIFADCPLQTPSPIPDFFLDTSQAPAVHPPASCPSSPGTTTSSYISAVAE  478

Query  632   RYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSA  453
             + AWL+  LLCKLD   E Y+D+ ++ LFLANNLQY+V KVR+ +L   LGE W ++ +A
Sbjct  479   KLAWLVFALLCKLDGKTETYQDVGLSCLFLANNLQYIVSKVRSCQLLELLGEEWAARHAA  538

Query  452   KVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDR  273
             K +Q+AA Y R+ WG + A +P+     +S  E  +  + F A+   A    +  VV+D 
Sbjct  539   KARQHAAGYGRVAWGRMAAGVPKG---EVSAGEAGEWIRAFIAALEAACATQAGWVVTDP  595

Query  272   NLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
              +R+ ++ ++   ++  +R FY      +         ++  ++P+DV   L  LF
Sbjct  596   GMREEVREAVRGMVVPAFRGFYARWHPVIED------VAVASYSPDDVREQLGKLF  645



>emb|CDY60562.1| BnaA02g06880D [Brassica napus]
Length=553

 Score =   386 bits (992),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 198/430 (46%), Positives = 295/430 (69%), Gaps = 26/430 (6%)
 Frame = -2

Query  1391  MADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELR  1212
             M D++ I +CMIS GY+KEC  VYK +RK I++E ++ L VE+++  +++KMDWE LE +
Sbjct  115   MDDLKTIADCMISTGYAKECVTVYKTVRKSIVEETLNNLAVERLTLHQVQKMDWETLESK  174

Query  1211  IKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKY  1032
             I++WL A ++AV++LF GER L D+VF+S+ + I ES F +I++E A+ LF FPEN AK 
Sbjct  175   IRSWLRAAKLAVRSLFFGERLLADHVFSSSVN-IVESSFTDITQEGALTLFAFPENAAKI  233

Query  1031  AKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFE  852
              K SPEK+FR LDMY  +A+   EIE+IF  DSA+++R+Q ++SL +LGDA+RT +  FE
Sbjct  234   KKLSPEKMFRFLDMYETLASLYVEIETIFYFDSAAAVRSQVISSLTRLGDAVRTMMTAFE  293

Query  851   TVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAV  672
             T +QKD+S++ V GGG+HPLT   MNYL+ + D+S  ++D +           P+  ++ 
Sbjct  294   TAIQKDTSRTPVIGGGVHPLTRYVMNYLSFLVDYSESIADAY-----------PEELYS-  341

Query  671   SDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLN  492
                  SP   +S+R AW+ILL LCK+D  A+ YKD++++YLFLANNLQYVVVKVRTS + 
Sbjct  342   -----SP---VSVRIAWVILLTLCKIDGKAQPYKDVALSYLFLANNLQYVVVKVRTSNVK  393

Query  491   RFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQ  312
               LGE+W+ +   KVKQYA  +E+L WG V+ SLPE P   ++PEE K+   +F+  F  
Sbjct  394   LLLGEDWVVRHEGKVKQYADKFEKLAWGKVLTSLPEYPAEEITPEEAKELLVRFDDEFEA  453

Query  311   AHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPED  132
             ++RK  + V+ D  LRD +KVSL+ KL+    + Y+ ++     +    F+  V++  ED
Sbjct  454   SYRKQISWVIPDPKLRDWIKVSLSHKLMLVCTELYEINRFGSGGDG---FN--VRYTSED  508

Query  131   VGHHLSDLFF  102
             +G++LSDL+F
Sbjct  509   IGNYLSDLYF  518



>emb|CDX88720.1| BnaA03g09290D [Brassica napus]
Length=550

 Score =   386 bits (991),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 202/431 (47%), Positives = 295/431 (68%), Gaps = 32/431 (7%)
 Frame = -2

Query  1391  MADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELR  1212
             M D+++I +CMIS GY+KEC KVYK +R+ I+DE +  L VE+ +  +++KMDW+ LE +
Sbjct  118   MDDLKMIADCMISTGYAKECVKVYKTVRRSIVDETLHGLAVERFTLHQVQKMDWDTLESK  177

Query  1211  IKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKY  1032
             I+ WL A+++AV++LF GER L D+VF+S+ + I ES F +I++E A+ LF FPEN AK 
Sbjct  178   IRTWLPAVKLAVRSLFFGERLLADHVFSSSLN-IVESSFTDITQEGALTLFTFPENAAKI  236

Query  1031  AKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFE  852
              K SPEK+FR LDMY ++A+   EIESIF  DSA+++R Q + SLAKLGDA R  +  FE
Sbjct  237   KKLSPEKMFRFLDMYESLASLFVEIESIFFFDSAAAVRAQVINSLAKLGDAARLMMTDFE  296

Query  851   TVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAV  672
             T +QK++S++ V GGG+HPLT   MNYL+ +AD+   +++++S                 
Sbjct  297   TAIQKETSRTPVVGGGVHPLTRYVMNYLSFLADYDESIAELYS-----------------  339

Query  671   SDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTS-RL  495
                  SP   +S+R AW+ILL LCK+D  A+ YKD++++YLFLANNLQYVVVKVR+S  L
Sbjct  340   -----SP---VSVRIAWVILLTLCKIDGKAQPYKDVALSYLFLANNLQYVVVKVRSSPGL  391

Query  494   NRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFA  315
                LGE+W+ +   KVKQYA  +E+L WG V+ SLPENP   ++PEE ++ F +FN  F 
Sbjct  392   KVLLGEDWVVRHEGKVKQYAEKFEKLAWGKVLTSLPENPKEEIAPEEARELFGRFNDEFE  451

Query  314   QAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPE  135
              A+RK  + VV D  LRD +K+SL+ KL+    +F + ++  +  +    F+  V++ PE
Sbjct  452   AAYRKQISWVVPDPKLRDWIKISLSGKLVPVCSEFCEVNRFGLGGDG---FN--VRYTPE  506

Query  134   DVGHHLSDLFF  102
             D+G++LSDL+F
Sbjct  507   DIGNYLSDLYF  517


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKW-NPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAME  1659
             ES ++  +     +I KW +P  S  A + S    SRREA +F + VR+L   M  LA  
Sbjct  23    ESAVQECISKINTVISKWTSPSPSSDAHLFST--NSRREAEEFAEAVRHLHITMHRLAAV  80

Query  1658  QPRSEKLVRAQNLMEVAMKRLQKEFFQ  1578
              P SEKLV AQNLM+ AM  L+ EF Q
Sbjct  81    NPSSEKLVYAQNLMQSAMNLLESEFHQ  107



>ref|XP_010510597.1| PREDICTED: exocyst complex component EXO70A1 [Camelina sativa]
Length=609

 Score =   387 bits (995),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 228/594 (38%), Positives = 350/594 (59%), Gaps = 48/594 (8%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKW-NPE---ASEAAKVTSLFYESRREANDFVKCVRNLQKAMQ  1674
             F ES++  ++E +  +  KW +P+   +S  +  +    ++R E   F++ + +LQ A+Q
Sbjct  23    FSESLLMDSIEAAESLTRKWISPDQSRSSSCSLSSIFSTDNRAEGRRFIEVINSLQYAIQ  82

Query  1673  FLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvastst  1494
              + +  P S KL RA NL+ +AMK+L+KEF+++L  NR +LD ES S  +  S       
Sbjct  83    GVVLVNPDSPKLTRAHNLVTIAMKQLEKEFYRVLKSNRRNLDHESVSVRSSPSFNPRKKV  142

Query  1493  gfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKD  1314
                S                   + + E+    VM D+++I +CMIS GY  EC K+YK 
Sbjct  143   SIYSQ------------------VPKSEEAD--VMTDLKMIADCMISSGYENECVKIYKK  182

Query  1313  IRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNV  1134
             IR+ I+ EA+  LG E +SF KI+K+DW+ +E  IK WL A ++ +  LF+GER LCD+V
Sbjct  183   IRRSIMVEALRNLGFENLSFGKIQKLDWDSMERNIKKWLEATKVVITNLFDGERILCDHV  242

Query  1133  FASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIE  954
             F+ +  ++ ES F EI+ + A+ LF FP ++A+  K + EK+F  LD+Y  I+   P+IE
Sbjct  243   FSPSV-SVAESCFTEITLDNALTLFVFPVSVAR-CKKTVEKIFLTLDVYQTISQLLPQIE  300

Query  953   SIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMN  774
              IFS +S SS+R QA  SL  LG+AI + +A+FE  + K++SKS + GGG+H LT   MN
Sbjct  301   EIFSYNSTSSVRLQAADSLNNLGEAINSMVAEFEASITKEASKSLIPGGGVHQLTRYVMN  360

Query  773   YLTSIADHSNVLSDIFS-NTPPIPKDWLPDSYFAVSDSDE---------SPLPAISLRYA  624
             ++  +AD++  L+ + + +T P+P+D     YF  +D D          S    ++ R+A
Sbjct  361   FIVFLADYNECLAGVLTESTLPLPED-----YFGNNDEDNKEGGETGTSSSSAPVTTRFA  415

Query  623   WlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVK  444
             WLIL+LLCK+D  +  Y D++++YLFLANNL YVV KVRTS L   LG+ W++    KV 
Sbjct  416   WLILVLLCKIDTKSRIYNDMALSYLFLANNLDYVVSKVRTSNLRVVLGDEWVTNHEGKVT  475

Query  443   QYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLR  264
             QY   YE++ WG+VI SL +     +     K+   +FN +F +  +K S  VV D  LR
Sbjct  476   QYLEKYEKIAWGEVITSLSDRDEEMLEEHVAKERLMRFNEAFEETFQKQSEWVVPDSKLR  535

Query  263   DSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             D LK SL +KL      FY  +++        ++  IV+F+PED+G++LSDLF 
Sbjct  536   DDLKGSLTKKLTTVATSFYGKYQV-------ENWEDIVRFSPEDLGYYLSDLFL  582



>emb|CDY68540.1| BnaCnng59460D [Brassica napus]
Length=548

 Score =   385 bits (989),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 198/430 (46%), Positives = 292/430 (68%), Gaps = 26/430 (6%)
 Frame = -2

Query  1391  MADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELR  1212
             M D++ I +CMIS GY+KEC  VYK +RK I++E ++ L VE+++  +++KMDWE LE +
Sbjct  114   MDDLKTIADCMISTGYAKECVTVYKTVRKSIVEETLNNLAVERLTLHQVQKMDWETLESK  173

Query  1211  IKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKY  1032
             I++WL A ++ V++LF GER L D+VF+S+ + I ES F +I++E A+ LF FPEN AK 
Sbjct  174   IRSWLRAAKLTVRSLFFGERLLADHVFSSSVN-IVESSFTDITQEGALTLFAFPENAAKI  232

Query  1031  AKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFE  852
              K SPEK+FR LDMY  +A+   EIE+IF  DSA+++R+Q ++SL +LGDA RT +  FE
Sbjct  233   KKLSPEKMFRFLDMYETLASLYVEIETIFYFDSAAAVRSQVISSLTRLGDAARTMMTAFE  292

Query  851   TVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAV  672
             T +QK++S++ V GGGIHPLT   MNYL+ + D+S  ++D +           P+  ++ 
Sbjct  293   TAIQKETSRTPVTGGGIHPLTRYVMNYLSFLVDYSESIADAY-----------PEELYS-  340

Query  671   SDSDESPLPAISLRYAWlillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLN  492
                  SP   +S+R AW+ILL LCK+D  A+ YKD++++YLFLANNLQYVVVKVRTS + 
Sbjct  341   -----SP---VSVRIAWVILLTLCKIDGKAQPYKDVALSYLFLANNLQYVVVKVRTSNVK  392

Query  491   RFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQ  312
               LGE+W+ +   KVKQYA  +E+L WG V+ SLPE P   ++PEE K+   +F+  F  
Sbjct  393   LLLGEDWVVRHEGKVKQYADKFEKLAWGKVLTSLPEYPAEEITPEEAKEFLVRFDDEFEA  452

Query  311   AHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPED  132
             ++RK  + V+ D  LRD +KVSL+ KL+    + Y+ ++L       R     V++  ED
Sbjct  453   SYRKQISWVIPDPKLRDWIKVSLSHKLMLVCTELYEINRL-----GSRGDGFNVRYTSED  507

Query  131   VGHHLSDLFF  102
             +G++LSDL+F
Sbjct  508   IGNYLSDLYF  517


 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 48/89 (54%), Gaps = 4/89 (4%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             ES ++        +I KW   + E    T+    SRREA +FV+ V++LQ  M  L    
Sbjct  23    ESAVQECTSSINTVISKWTSSSDEFLFSTN----SRREAEEFVEAVKHLQSTMHRLVSVN  78

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILN  1569
               S+KLV A NLM+ AMK L+ EF ++ +
Sbjct  79    ASSDKLVYAHNLMQSAMKLLESEFRRVFS  107



>ref|XP_006409897.1| hypothetical protein EUTSA_v10017620mg [Eutrema salsugineum]
 gb|ESQ51350.1| hypothetical protein EUTSA_v10017620mg [Eutrema salsugineum]
Length=600

 Score =   387 bits (993),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 229/586 (39%), Positives = 346/586 (59%), Gaps = 41/586 (7%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFY-----ESRREANDFVKCVRNLQKAM  1677
             F ES++  ++E +  +  KW       +  +         ++R E   FV+ + +LQ A+
Sbjct  23    FSESLLIDSIEATENLTRKWISPDLSPSSSSCSLSSIFSTDNRLEGRRFVEVISSLQYAI  82

Query  1676  QFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvasts  1497
             Q + +  P S KL RA NL+ +AMK L+KEF++IL  NR +LDPES S  +  S      
Sbjct  83    QGVMLVNPESHKLTRAHNLVTIAMKHLEKEFYRILKSNRRNLDPESVSVRSSRSFNPRQQ  142

Query  1496  tgfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYK  1317
                 S                   + + ED    VM D+++I +CMIS GY  EC K+YK
Sbjct  143   VSIYSN------------------VPKSEDAD--VMTDLKMIADCMISSGYENECVKIYK  182

Query  1316  DIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDN  1137
              IR+ II E++S+LG E +SF KI+K++WE +E  IKNWL A +I +  LF+GER LCD+
Sbjct  183   KIRRSIIVESLSKLGFENLSFGKIQKLEWESMEKNIKNWLEATKIVIANLFDGERILCDH  242

Query  1136  VFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEI  957
             VF+S   +I ES F +I+ ++A+ LF FP ++A+  + + EK+F  LD+Y  I+   P+I
Sbjct  243   VFSSYV-SIAESCFSDITLDSALTLFIFPVSVAR-CRKTVEKIFSTLDVYQTISKLLPQI  300

Query  956   ESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAM  777
             E IFS DS S++R QA  SL  L  AI + +A+FE  + K+SSKS++ GGG+H LT   M
Sbjct  301   EEIFSYDSTSAVRLQAADSLNSLAGAINSMVAEFEASITKESSKSSIPGGGVHQLTRYVM  360

Query  776   NYLTSIADHSNVLSDIFS-NTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllc  600
             N++  +AD++  L+ + + +T P+P+D+  +       S  SP   ++ R+AWLIL+LLC
Sbjct  361   NFVVFLADYNESLAGVLTESTLPLPEDYAGE--LGSLSSSSSP---VTTRFAWLILVLLC  415

Query  599   kLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYER  420
             K+D  +  Y D+++ YLFLANNL YV+ KVRTS L   LG+ W++    +V QY   YER
Sbjct  416   KIDTKSRVYNDVALTYLFLANNLHYVISKVRTSNLRVVLGDEWVASHEGRVSQYLDKYER  475

Query  419   LGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLA  240
             + WG+V+ SL +   A M     K+  K+FN +  +A RK S  VV D  +R+ L+ S+A
Sbjct  476   IAWGEVMTSLSDEE-AVMEENVAKERLKRFNEALEEAFRKQSDWVVPDSKMREDLRDSVA  534

Query  239   RKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             +KL      FY+ H +         +  +V+F PE +G++LSDLF 
Sbjct  535   KKLTCVASSFYEKHHV-------ETWEDVVRFVPEGLGNYLSDLFL  573



>ref|XP_003542014.2| PREDICTED: exocyst complex component EXO70B1-like [Glycine max]
Length=576

 Score =   384 bits (986),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 242/581 (42%), Positives = 353/581 (61%), Gaps = 54/581 (9%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAM  1662
             F +S+M+  +E +  +I KW    S + +   LF  +R+EA  ++  V +LQ  MQ L  
Sbjct  29    FSDSLMDENIETARAIISKWEL-ISPSDQTAPLFSNTRQEAKQYLNAVMSLQSTMQHLVA  87

Query  1661  EQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfss  1482
                 S+ LV+A  LM++AMKRLQ EF++IL  NR +L PES +++   SS  S      S
Sbjct  88    LDSSSDTLVQAHFLMQLAMKRLQTEFYRILAQNRDNLHPESVTSTDHRSSSVSDDGTNFS  147

Query  1481  tsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKW  1302
               +F                   + +S+  M D++ I ECM+S GYSKEC K Y   RK 
Sbjct  148   DDEFRFAG---------------DSISTVAMVDLKAIAECMVSAGYSKECIKTYILTRKS  192

Query  1301  IIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFAST  1122
             ++DEA+   GVE++SFS+++KMDW+VLE +IK+WLSA++ A++TLF+GERTLCD VF S 
Sbjct  193   MVDEALYHFGVERLSFSQVQKMDWKVLESKIKSWLSAVKFAIRTLFHGERTLCDYVFGSP  252

Query  1121  PDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFS  942
                I ES F  + +E A  LF FPE +AK  K +PEK+FR LD+Y AI+++R +IESIFS
Sbjct  253   ERKIAESCFAAVCREGAESLFAFPEKVAK-CKKTPEKMFRTLDLYEAISDNRLQIESIFS  311

Query  941   MDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTS  762
              +S SS                      FE  +QK+SSK  V GGGIHPLT   MNY+  
Sbjct  312   SESTSS--------------------INFEAAIQKESSKIPVPGGGIHPLTRYVMNYIEF  351

Query  761   IADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPA-ISLRYAWlillllckLDVI  585
             +AD+ + +++I ++    P++ LP+SY+   D +     A I+ R AWLIL+LLCKLD  
Sbjct  352   LADYRDCVAEIVAD---WPQNSLPESYYCSPDREGMNRSAEIAERMAWLILVLLCKLDGK  408

Query  584   AEHYKDISIAYLFLANNLQYVVVKVRTSR-LNRFLGENWLSKQSAKVKQYAANYERLGWG  408
             AE YK+++++YLFLANN+QYVVVKVR S+ L   +GE+WL+K   KVK+Y   YER+GW 
Sbjct  409   AELYKEVALSYLFLANNMQYVVVKVRNSKNLGFIVGEDWLTKHELKVKEYVCKYERVGWS  468

Query  407   DVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLL  228
              V  SLPENPTA    E+ +  ++  +A F +  +  S+ +V D  LR+ +K S+A KL+
Sbjct  469   KVFLSLPENPTA----EQARAIYECLDAEFHETCKAQSSWIVPDPKLREEMKDSIASKLV  524

Query  227   RPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
               YR+F+  +++ +  +            P+D+ H+LSD+ 
Sbjct  525   PRYREFFGKYRVGLGTD--------FGLTPDDLEHNLSDIL  557



>ref|XP_010034605.1| PREDICTED: exocyst complex component EXO70A1-like [Eucalyptus 
grandis]
Length=636

 Score =   386 bits (991),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 248/626 (40%), Positives = 363/626 (58%), Gaps = 32/626 (5%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEA-  1761
             M RKG R   F P+     S   A P+ GS+ F + +ME  +    P+I KW   +S   
Sbjct  1     MLRKGKRTSFFKPS----PSDRAARPATGSEPFADVLMEERIASVEPLIKKWATNSSSTS  56

Query  1760  --AKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKE  1587
               A  T LF+E R EA  ++  V++L  AM     E   S  +VRA  L++ A++RL  E
Sbjct  57    GYAGATFLFHEGRHEAALYLSHVKDLHSAMMRCTGEVSNSGVIVRAHELLQTAVRRLSLE  116

Query  1586  FFQILNMNRAHLD-PEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVE  1410
             F QIL+   +HL  P+ + + +  SS +ST   FS                A   + E E
Sbjct  117   FHQILS---SHLPYPDHAESFSSQSSRSSTLLSFSDFQYELEGKLSTKKSTAEPVMQEEE  173

Query  1409  DVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEK-MSFSKIRKMD  1233
              V +  ++ ++ I +CMI+CGY KEC  +YK +R+ ++DE +  LG E+ +   +++KMD
Sbjct  174   RVLNAAVSYVKTIADCMIACGYGKECMDIYKIVRRSVVDEELYHLGFERPIDSWQMQKMD  233

Query  1232  WEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEF  1053
             W+VLE ++K+WL A++ AV+TLF  ER LCD VF + P  ++ES+F  ++++AA+ LF F
Sbjct  234   WKVLEAKVKSWLKAVKPAVQTLFYVERMLCDRVFTTAPALVKESVFSHVARDAAVALFGF  293

Query  1052  PENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIR  873
              E  AK  + SPE++F LLD+Y AIAN  P I++ F   + S++R+ A+ SL+KLG+A+R
Sbjct  294   AEGAAKAIERSPERIFCLLDLYEAIANLWPGIKATFYYHATSAVRSHAINSLSKLGEAVR  353

Query  872   TGIAQFETVLQKDSS-KSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTP--PIPK  702
               ++ FE V+QKDSS KS V  GGI PLT++ MNYL  +AD+  VL DI    P    PK
Sbjct  354   VTLSNFEAVIQKDSSKKSAVPSGGIDPLTVNVMNYLVLLADYGGVLKDILVKWPVDGSPK  413

Query  701   D-WLPDSYFAVSDSDESPLPAIS------LRYAWlillllckLDVIAEHYKDISIAYLFL  543
                 PDSYF   D   S    +S       R+A L+ +LLCKLDV A+ YKD+++ YL L
Sbjct  414   HPGFPDSYFPGCDPATSITVGVSDASAKFARFAQLVDVLLCKLDVKAKRYKDVALYYLIL  473

Query  542   ANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMS  363
             ANNLQY+V KV  S L   LGE+W++   + VK YA+NYER GW  V AS    P+  +S
Sbjct  474   ANNLQYIVNKVAQSSLKHLLGEHWVANHESMVKLYASNYERTGWSKVFAS-SSGPSVEIS  532

Query  362   PEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMP  183
               + K+  +KF+A+  +   K     V+DR LRD + +SLA +L+  YR  YD      P
Sbjct  533   LGQAKESLRKFDAALEEVQAKQVGWAVTDRKLRDDIVLSLAEELVPAYRRLYDGCPRGDP  592

Query  182   KEKERHFSSIVKFAPEDVGHHLSDLF  105
                      +VKF P+D+ ++L+ + 
Sbjct  593   ---------VVKFTPDDLDNYLAGML  609



>gb|KCW52736.1| hypothetical protein EUGRSUZ_J02094 [Eucalyptus grandis]
Length=634

 Score =   386 bits (991),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 249/626 (40%), Positives = 363/626 (58%), Gaps = 32/626 (5%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEA-  1761
             M RKG R   F P+     S   A P+ GS+ F + +ME  +    P+I KW   +S   
Sbjct  1     MLRKGKRTSFFKPS----PSDRAARPATGSEPFADVLMEERIASVEPLIKKWATNSSSTS  56

Query  1760  --AKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKE  1587
               A  T LF+E R EA  ++  V++L  AM     E   S  +VRA  L++ A++RL  E
Sbjct  57    GYAGATFLFHEGRHEAALYLSHVKDLHSAMMRCTGEVSNSGVIVRAHELLQTAVRRLSLE  116

Query  1586  FFQILNMNRAHLD-PEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVE  1410
             F QIL+   +HL  P+ + + +  SS +ST   FS                A   + E E
Sbjct  117   FHQILS---SHLPYPDHAESFSSQSSRSSTLLSFSDFQYELEGKLSTKKSTAEPVMQEEE  173

Query  1409  DVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFS-KIRKMD  1233
              V +  ++ ++ I +CMI+CGY KEC  +YK +R+ ++DE +  LG E+   S +++KMD
Sbjct  174   RVLNAAVSYVKTIADCMIACGYGKECMDIYKIVRRSVVDEELYHLGFERPIDSWQMQKMD  233

Query  1232  WEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEF  1053
             W+VLE ++K+WL A++ AV+TLF  ER LCD VF + P  ++ES+F  ++++AA+ LF F
Sbjct  234   WKVLEAKVKSWLKAVKPAVQTLFYVERMLCDRVFTTAPALVKESVFSHVARDAAVALFGF  293

Query  1052  PENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIR  873
              E  AK  + SPE++F LLD+Y AIAN  P I++ F   + S++R+ A+ SL+KLG+A+R
Sbjct  294   AEGAAKAIERSPERIFCLLDLYEAIANLWPGIKATFYYHATSAVRSHAINSLSKLGEAVR  353

Query  872   TGIAQFETVLQKDSS-KSTVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTP--PIPK  702
               ++ FE V+QKDSS KS V  GGI PLT++ MNYL  +AD+  VL DI    P    PK
Sbjct  354   VTLSNFEAVIQKDSSKKSAVPSGGIDPLTVNVMNYLVLLADYGGVLKDILVKWPVDGSPK  413

Query  701   D-WLPDSYFAVSDSDESPLPAIS------LRYAWlillllckLDVIAEHYKDISIAYLFL  543
                 PDSYF   D   S    +S       R+A L+ +LLCKLDV A+ YKD+++ YL L
Sbjct  414   HPGFPDSYFPGCDPATSITVGVSDASAKFARFAQLVDVLLCKLDVKAKRYKDVALYYLIL  473

Query  542   ANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPENPTAPMS  363
             ANNLQY+V KV  S L   LGE+W++   + VK YA+NYER GW  V AS    P+  +S
Sbjct  474   ANNLQYIVNKVAQSSLKHLLGEHWVANHESMVKLYASNYERTGWSKVFAS-SSGPSVEIS  532

Query  362   PEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDTHKLTMP  183
               + K+  +KF+A+  +   K     V+DR LRD + +SLA +L+  YR  YD      P
Sbjct  533   LGQAKESLRKFDAALEEVQAKQVGWAVTDRKLRDDIVLSLAEELVPAYRRLYDGCPRGDP  592

Query  182   KEKERHFSSIVKFAPEDVGHHLSDLF  105
                      +VKF P+D+ ++L+ + 
Sbjct  593   ---------VVKFTPDDLDNYLAGML  609



>emb|CDX77195.1| BnaC04g39900D [Brassica napus]
Length=584

 Score =   384 bits (986),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 223/589 (38%), Positives = 343/589 (58%), Gaps = 55/589 (9%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPE----ASEAAKVTSLF-YESRREANDFVKCVRNLQKAM  1677
             F ES++  ++E +     KW  +    A  +  ++S+F  E+R E   FV  + +LQ A+
Sbjct  23    FSESLLLDSIEATESFTKKWISQDHLSACSSCTLSSIFSTENRVEGRKFVDVINSLQYAI  82

Query  1676  QFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvasts  1497
             Q + +  P S KL RA NL+  AMK L+KEF+++L  NR +LDPES S  +  S      
Sbjct  83    QGVTLVNPESHKLTRAHNLLSTAMKHLEKEFYRVLKSNRRNLDPESVSIRSIPSFNPRKK  142

Query  1496  tgfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYK  1317
                 S                   + + E+    +M D+++I +CMIS G+  EC + YK
Sbjct  143   VSIYSN------------------VPKSEEAD--IMTDLQMIADCMISSGFENECVRTYK  182

Query  1316  DIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDN  1137
              IR+ II +++S+LG E +SF KI+K+DWE +E  IK WL A +I +  LF+GER LCD+
Sbjct  183   KIRRSIIVDSLSKLGFENLSFGKIQKLDWESMEKNIKKWLEATKIVINNLFDGERILCDH  242

Query  1136  VFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEI  957
             VF+++P ++ ES F EI+ ++A+ LF FP ++A+  + + EK+F  LD+Y  I+N  P I
Sbjct  243   VFSTSP-SVAESCFSEITLDSALTLFIFPVSVAR-CRKTAEKIFLTLDVYQTISNLLPRI  300

Query  956   ESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAM  777
             E IFS DS S++R QA  SL  LG+ I   +A+FE  + K++SKS + GGG+HPLT   M
Sbjct  301   EEIFSYDSTSAVRFQAADSLRSLGETINYMVAEFEASIAKEASKSVIPGGGVHPLTRYVM  360

Query  776   NYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllck  597
             N++  +AD++  L                    A SD  E+    ++ R  WLIL+LLCK
Sbjct  361   NFVVFLADYNESL--------------------AGSDVGETA-STVTTRLGWLILVLLCK  399

Query  596   LDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERL  417
             +D  +  Y++++++YLFLANNL YV+ KVR S L   LG+ W++   AKV QY   YE++
Sbjct  400   IDTKSRIYENVALSYLFLANNLHYVISKVRKSNLRVVLGDEWVANHQAKVCQYLEKYEKV  459

Query  416   GWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLAR  237
              WG+V+ SL ++ T  +     K+  K+FN +F +A RK S  VV D  +R+ LK S+A+
Sbjct  460   AWGEVLTSLSDDGTVVLEDNVAKERLKRFNEAFEEAFRKQSGWVVPDSKMREGLKDSVAK  519

Query  236   KLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFEPSK  90
             KL      FY+ + +         +  IV++ P+D+G++LSDL+    K
Sbjct  520   KLTYVASLFYEKYNV-------ETWEDIVRYVPKDLGNYLSDLYLGTGK  561



>ref|XP_006293428.1| hypothetical protein CARUB_v10025404mg [Capsella rubella]
 gb|EOA26326.1| hypothetical protein CARUB_v10025404mg [Capsella rubella]
Length=609

 Score =   384 bits (987),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 225/593 (38%), Positives = 350/593 (59%), Gaps = 46/593 (8%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKW----NPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQ  1674
             F ES++  ++E +  +  KW       +S  +  +     +R E   FV+   +LQ A+Q
Sbjct  23    FSESLLIDSIEAAETLTRKWISPDLSSSSSCSLSSIFSANNRAEGRRFVEVTNSLQYAIQ  82

Query  1673  FLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvastst  1494
              + +  P S KL RA NL+ +AMK+L+KEF++IL  NR +L+PES S+   S S  + + 
Sbjct  83    GVVLVNPESPKLTRAHNLVTIAMKQLEKEFYRILKSNRRNLEPESVSSVRSSQSFNARNK  142

Query  1493  gfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKD  1314
                 +                  + + E+    VM D+++I +CMIS GY  EC K+YK 
Sbjct  143   VSKYSQ-----------------VPKSEEAD--VMTDLKMIADCMISSGYENECVKIYKK  183

Query  1313  IRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNV  1134
             IR  I+ EA+S LG E +SF KI+K+DW+ +E  IK WL A ++ +  LF+GER LCD+V
Sbjct  184   IRGSIMVEALSNLGFENLSFGKIQKLDWDSMEKNIKKWLEATKVLITNLFDGERILCDHV  243

Query  1133  FASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIE  954
             F+ +  ++ ES F EI+ ++A+ LF FP ++A+  + + EK+F  LD+Y  I+   P+IE
Sbjct  244   FSPSV-SVAESCFTEITLDSALTLFIFPVSVAR-CRKTVEKIFLTLDVYQTISQLLPQIE  301

Query  953   SIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMN  774
              IFS +S S++R QA  SL  LG+AI + +A+FE  + K++SKS + GGG+H LT   MN
Sbjct  302   EIFSYNSTSAVRLQAADSLKNLGEAINSMVAEFEASITKEASKSLIPGGGVHQLTRYVMN  361

Query  773   YLTSIADHSNVLSDIFS-NTPPIPKDWLPDSYFAVSDSDE--------SPLPAISLRYAW  621
             ++  +AD++  L+ + + +T P+P+D     YF  +D D         S    ++ R+AW
Sbjct  362   FIVFLADYNECLAGVLTESTLPLPED-----YFGNNDEDNNKGGETGTSSSSPVTTRFAW  416

Query  620   lillllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQ  441
             LIL+LLCK+D  +  Y D++++YLFLANNL YV+ KVRTS L   LG+ W++    KV Q
Sbjct  417   LILVLLCKIDTKSRMYSDMALSYLFLANNLHYVISKVRTSNLRVVLGDEWVTNHEGKVTQ  476

Query  440   YAANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRD  261
             Y   YE++ WG+VI SL +     +     K+   +FN +F +A +K S  VV D  LR+
Sbjct  477   YLEKYEKIAWGEVITSLSDTDEEMLEEHVAKERLTRFNEAFEEAFQKQSEWVVPDSKLRE  536

Query  260   SLKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
              LK S+ +KL      FY  + +        ++  IV++APED+G+++SDLF 
Sbjct  537   DLKESVTKKLTTVATSFYGKYHV-------ENWEDIVRYAPEDLGNYISDLFL  582



>ref|XP_006409898.1| hypothetical protein EUTSA_v10017781mg [Eutrema salsugineum]
 gb|ESQ51351.1| hypothetical protein EUTSA_v10017781mg [Eutrema salsugineum]
Length=578

 Score =   382 bits (982),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 234/590 (40%), Positives = 347/590 (59%), Gaps = 61/590 (10%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKW-NPEASEAAK------VTSLFYES-RREANDFVKCVRNLQ  1686
             F ES+ME ++E +  +I +W +P+  + +       +TSLF    R EA  F+  V+ L 
Sbjct  22    FSESLMEDSIEDAESIIHRWISPQLLDISSSSSFCCITSLFSTGNREEATRFIAAVKTLH  81

Query  1685  KAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssva  1506
               M  L    P S KLVRA+NLM ++M  L KEF++IL  NR +LDPES S  +R     
Sbjct  82    SGMVRLISTNPASLKLVRAENLMRISMDHLAKEFYRILKSNRRYLDPESVSVRSRK----  137

Query  1505  ststgfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFK  1326
                                        ++  ED  +  MAD+++I +CM S GY +ECF+
Sbjct  138   ---------------------------VSHGEDADA--MADLKMIADCMTSSGYGRECFR  168

Query  1325  VYKDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTL  1146
             +Y+ IRK II EA+ RLG E +S S+++K+DWE LE +++NWL A   AV TLF GER L
Sbjct  169   IYRKIRKSIIVEAMDRLGFEDLSLSQMQKLDWEYLEKKMRNWLRAARKAVTTLFYGERIL  228

Query  1145  CDNVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHR  966
              D+VF+S+  AIRES F EI+ ++A+ +F FPEN+AK ++ SPEK+F  LD+Y +I    
Sbjct  229   SDHVFSSSSAAIRESSFAEITLQSALTMFTFPENMAK-SRKSPEKIFLTLDVYQSIVELL  287

Query  965   PEIESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTI  786
             P IE +FS DS S +++Q   +L  L + + + + +FE+ + K+SSKS ++GGGIH LT 
Sbjct  288   PVIEEVFSYDSTSPVKSQIDVTLTDLEEGVISMLDEFESSIAKESSKSLISGGGIHQLTR  347

Query  785   DAMNYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlilll  606
               MN++  +AD+S+ L+DI S TP         S+    DS  S  P ++ R +WLIL L
Sbjct  348   YVMNFIVFLADYSDPLADIISKTPS--------SFTGDVDSSSSSSP-LAKRISWLILFL  398

Query  605   lckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANY  426
             LCK+D  +  Y D++++YLFL NNL YV VKVRTS L   L E+WL K   KVK+Y A +
Sbjct  399   LCKIDAKSRLYNDVALSYLFLINNLNYVGVKVRTSNLKEILSEDWLEKHEGKVKKYVAKF  458

Query  425   ERLGWGDVIASLPENPTAPMSPEEIKQH--FKKFNASFAQAHRKHSACVVSDRNLRDSLK  252
               + WG+++  +    T     EE +     ++F+  F +A+++ +  VV D  LRD +K
Sbjct  459   VEIVWGEMVVMMTSLSTTAEEEEEEEAEEVVRRFSDRFEEAYKRQTGWVVPDSKLRDEIK  518

Query  251   VSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             VS+A  L+  Y +     ++ + K         V F PED+G++LSDL+F
Sbjct  519   VSVAMMLIPAYAECNKKCRVGLRKN--------VGFVPEDIGNYLSDLYF  560



>emb|CDY31722.1| BnaA04g16580D [Brassica napus]
Length=582

 Score =   382 bits (982),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 222/589 (38%), Positives = 341/589 (58%), Gaps = 55/589 (9%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKWNPE----ASEAAKVTSLF-YESRREANDFVKCVRNLQKAM  1677
             F ES++  ++E +     KW  +    A  +  ++S+F  E+R E   FV  + +LQ A+
Sbjct  23    FSESLLLDSIEATESFTKKWISQDHLSACSSCTLSSIFSTENRAEGRKFVDVINSLQYAI  82

Query  1676  QFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvasts  1497
             Q + +  P S KL RA NL+  AMK L+KEF+++L  NR +LDPES S  +  S      
Sbjct  83    QGVTLVNPESHKLTRAHNLLSTAMKHLEKEFYRVLKSNRRNLDPESVSIRSIPSFNPRKK  142

Query  1496  tgfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYK  1317
                 S                   + + E+    +M D+++I +CMIS GY  EC + YK
Sbjct  143   VSIYSN------------------VPKSEEAD--IMTDLQMIADCMISSGYENECVRTYK  182

Query  1316  DIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDN  1137
              IR+ II +++S+LG E +SF KI+K+DW+ +E  IK WL A +I +  LF+GER LCD+
Sbjct  183   KIRRSIIVDSLSKLGFENLSFGKIQKLDWDSMEKNIKKWLEATKIVINNLFDGERILCDH  242

Query  1136  VFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEI  957
             VF+++P ++ ES F EI+ ++A+ LF FP ++A+  + + EK+F  LD+Y  I+N  P I
Sbjct  243   VFSTSP-SVAESCFSEITLDSALTLFIFPVSVAR-CRKTAEKIFLTLDVYQTISNLLPRI  300

Query  956   ESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAM  777
             E IFS DS S++R QA  SL  LG+AI   +A+FE  + K++SKS + GGG+HPLT   M
Sbjct  301   EEIFSYDSTSAVRFQAADSLRSLGEAINYMVAEFEASIAKEASKSVIPGGGVHPLTRYVM  360

Query  776   NYLTSIADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllck  597
             N++  +AD++  L                    A SD  E+    ++ R  WLIL+LLCK
Sbjct  361   NFVVFLADYNESL--------------------AGSDVGETA-STVTTRLGWLILVLLCK  399

Query  596   LDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERL  417
             +D  +  Y++++++YLFLANNL YV+ KVR S L   LG+ W++    KV QY   YE++
Sbjct  400   IDTKSRIYENVALSYLFLANNLHYVISKVRKSNLRVVLGDEWVANHQGKVSQYLEKYEKV  459

Query  416   GWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLAR  237
              WG+V+ SL E     +  +  K+  K+FN  F +A RK S  VV D  +R+ LK S+A+
Sbjct  460   AWGEVLTSLSEEERVVLEEDVAKERLKRFNEVFEEAFRKQSGWVVPDTKMREGLKDSVAK  519

Query  236   KLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFFEPSK  90
             KL      FY+ + +         +  IV++ P+D+G++LSDL+    +
Sbjct  520   KLTYVASLFYEKYHV-------ETWGDIVRYVPKDLGNYLSDLYLGTGR  561



>ref|XP_004495266.1| PREDICTED: uncharacterized protein LOC101497388 [Cicer arietinum]
Length=506

 Score =   379 bits (974),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 220/469 (47%), Positives = 309/469 (66%), Gaps = 22/469 (5%)
 Frame = -2

Query  1820  RALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEK  1641
             + ++ +  +I KWNPE S  AK+TSLFY ++ EA ++V CV  LQ+AM  L    P S+K
Sbjct  39    KRIDAAEAIIQKWNPETSLYAKITSLFYNNKNEAIEYVHCVNQLQRAMHSLLEYDPSSQK  98

Query  1640  LVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfsstsdfdvd  1461
             L+ AQNLM++AMKRLQKEF+QIL+MNRAHLDPES S  +  ++  S             D
Sbjct  99    LIHAQNLMQIAMKRLQKEFYQILSMNRAHLDPESISVGSSRTTFCSDDGTPVDDVREAED  158

Query  1460  dddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAIS  1281
                         I+EVE VSS  +AD++ I +CM+S GY+KEC KVY  +RK I++E I 
Sbjct  159   S-----------ISEVERVSSDSVADLKTIADCMVSNGYAKECVKVYITVRKSIVNEGIY  207

Query  1280  RLGVE-KMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRE  1104
              LG E ++SFSK+ KMDWEVLE++IK+WL A+ I+V+TLF GER LC  +FAS+  +IRE
Sbjct  208   GLGFEEQISFSKVNKMDWEVLEMKIKSWLEAVNISVRTLFVGERNLCHRIFASS--SIRE  265

Query  1103  SIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASS  924
               F EIS+  A +LF FPE + +  K+ PEK+F +LDMY AI    PEIESIFS +S ++
Sbjct  266   ICFSEISRVGATLLFRFPELVTRTKKSPPEKIFSVLDMYVAITVLLPEIESIFSFNSTNA  325

Query  923   IRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSIADHSN  744
             I++QA  S  +L   +R  +++FE+ + KD+SKS     G+H LT   M YLTS+AD+SN
Sbjct  326   IKSQAYDSRYRLIQCVRNILSEFESAIVKDTSKSPANFEGVHSLTTRTMQYLTSLADYSN  385

Query  743   VLSDIF--SNTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllckLDVIAEHYK  570
             VL++IF   N PP  K  L +  +A   + E      S+  A LI++L+CK++  ++ +K
Sbjct  386   VLNEIFLDINHPP-SKSPLSEDIYATETATE-----FSVWMARLIVVLVCKIEGKSKQWK  439

Query  569   DISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYE  423
             + S+ YLF+ANNLQ+++ KVR S+L   LG++W  K  AKVKQ   +YE
Sbjct  440   NASLCYLFVANNLQHLMEKVRASKLQYVLGDDWELKHIAKVKQLMEDYE  488



>gb|KCW52738.1| hypothetical protein EUGRSUZ_J02096, partial [Eucalyptus grandis]
Length=624

 Score =   383 bits (983),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 247/632 (39%), Positives = 361/632 (57%), Gaps = 44/632 (7%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEAA  1758
             M RKG R   F P+     S   A P+ GS+ F +++ME  +    P+I KW  ++S  +
Sbjct  1     MLRKGKRTSFFKPS----PSDCAARPATGSEPFADTLMEERIASVEPLIKKWAADSSSTS  56

Query  1757  KVTS---LFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKE  1587
             + T    LF+E R EA  ++  V++L  AM     E   S  +VRA  L++ A++RL  E
Sbjct  57    RYTGAAFLFHEGRHEAALYLSHVKDLHSAMLCCTGEVSNSGVIVRAHELLQTAVRRLSLE  116

Query  1586  FFQILNMNRAHLD-PEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVE  1410
             F QIL+   +HL  P+ + + +  SS  ST + FS                A   + E E
Sbjct  117   FHQILS---SHLPYPDHAESFSSQSSRYSTLSSFSDFEYELEGKLSTKKSAAEPVMQEEE  173

Query  1409  DVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEKMSFS-KIRKMD  1233
              V +  ++D++ I +CMI+CGY KEC  +YK +R+ ++DE +  LG E+   S +++KMD
Sbjct  174   RVPNAAVSDIKTIADCMIACGYGKECMDIYKIVRRSVVDEELYHLGFERPIDSWQMQKMD  233

Query  1232  WEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEF  1053
             W+VLE ++K WLSA++ AV+TLF  ER LCD VF + P ++ ES+F  ++++AA+ LF F
Sbjct  234   WKVLEAKVKGWLSAVKPAVQTLFYVERMLCDRVFTTAPASVGESVFSHVARDAAVALFGF  293

Query  1052  PENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIR  873
              E  AK  K SPE++F LLD+Y A+AN R +IE  FS D+ S++R+ A   L KLG+A+ 
Sbjct  294   AEGAAKAIKRSPERIFCLLDIYEAVANLRLDIEFTFSSDATSTVRSHAFNLLTKLGEAVP  353

Query  872   TGIAQFETVLQKDSSK-STVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKD-  699
               +  FE  +QKDSSK S V  GGIHPLT D MNYL  +AD+  VL DI ++ P      
Sbjct  354   VMLGNFEAAIQKDSSKQSAVPSGGIHPLTRDVMNYLALLADYGGVLRDILADWPVDSSQK  413

Query  698   --WLPDSYFAVSDSDESPLPAISL------------RYAWlillllckLDVIAEHYKDIS  561
                 P SYF   D      PA S+            R+A L L+L CKLDV A+ YKD++
Sbjct  414   YPGFPYSYFPGCD------PATSITAGDGDASVKFARFAQLALVLQCKLDVKAKRYKDVA  467

Query  560   IAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPEN  381
             ++YLFLANNLQYVV KV  S L   LGE+W++   + VK YA NYER GW  V AS    
Sbjct  468   LSYLFLANNLQYVVNKVAQSNLKHLLGEHWVANHESMVKLYADNYERTGWSKVFAS-SSG  526

Query  380   PTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDT  201
              +  +S    K+  ++F+A+  +   K +   V+D+ LRD + +SLA + +  +R  YD 
Sbjct  527   LSVEISLGRAKESLRRFDAALEEVQAKQAGWAVTDQKLRDDIALSLAEEFVPAHRRLYDG  586

Query  200   HKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
                  P         +VKF P+D+ ++L+ + 
Sbjct  587   CPRGDP---------VVKFTPDDLDNYLAGML  609



>ref|XP_010034607.1| PREDICTED: exocyst complex component EXO70A1-like [Eucalyptus 
grandis]
Length=636

 Score =   382 bits (982),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 246/632 (39%), Positives = 361/632 (57%), Gaps = 44/632 (7%)
 Frame = -2

Query  1937  MPRKGMRLIGFSPNYWsssstvraspsagSDHFYESVMERALEISGPMIMKWNPEASEAA  1758
             M RKG R   F P+     S   A P+ GS+ F +++ME  +    P+I KW  ++S  +
Sbjct  1     MLRKGKRTSFFKPS----PSDCAARPATGSEPFADTLMEERIASVEPLIKKWAADSSSTS  56

Query  1757  KVTS---LFYESRREANDFVKCVRNLQKAMQFLAMEQPRSEKLVRAQNLMEVAMKRLQKE  1587
             + T    LF+E R EA  ++  V++L  AM     E   S  +VRA  L++ A++RL  E
Sbjct  57    RYTGAAFLFHEGRHEAALYLSHVKDLHSAMLCCTGEVSNSGVIVRAHELLQTAVRRLSLE  116

Query  1586  FFQILNMNRAHLD-PEsssasarsssvaststgfsstsdfdvddddddvrvagdSITEVE  1410
             F QIL+   +HL  P+ + + +  SS  ST + FS                A   + E E
Sbjct  117   FHQILS---SHLPYPDHAESFSSQSSRYSTLSSFSDFEYELEGKLSTKKSAAEPVMQEEE  173

Query  1409  DVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWIIDEAISRLGVEK-MSFSKIRKMD  1233
              V +  ++D++ I +CMI+CGY KEC  +YK +R+ ++DE +  LG E+ +   +++KMD
Sbjct  174   RVPNAAVSDIKTIADCMIACGYGKECMDIYKIVRRSVVDEELYHLGFERPIDSWQMQKMD  233

Query  1232  WEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPDAIRESIFKEISKEAAMILFEF  1053
             W+VLE ++K WLSA++ AV+TLF  ER LCD VF + P ++ ES+F  ++++AA+ LF F
Sbjct  234   WKVLEAKVKGWLSAVKPAVQTLFYVERMLCDRVFTTAPASVGESVFSHVARDAAVALFGF  293

Query  1052  PENIAKYAKNSPEKVFRLLDMYNAIANHRPEIESIFSMDSASSIRTQAVTSLAKLGDAIR  873
              E  AK  K SPE++F LLD+Y A+AN R +IE  FS D+ S++R+ A   L KLG+A+ 
Sbjct  294   AEGAAKAIKRSPERIFCLLDIYEAVANLRLDIEFTFSSDATSTVRSHAFNLLTKLGEAVP  353

Query  872   TGIAQFETVLQKDSSK-STVAGGGIHPLTIDAMNYLTSIADHSNVLSDIFSNTPPIPKD-  699
               +  FE  +QKDSSK S V  GGIHPLT D MNYL  +AD+  VL DI ++ P      
Sbjct  354   VMLGNFEAAIQKDSSKQSAVPSGGIHPLTRDVMNYLALLADYGGVLRDILADWPVDSSQK  413

Query  698   --WLPDSYFAVSDSDESPLPAISL------------RYAWlillllckLDVIAEHYKDIS  561
                 P SYF   D      PA S+            R+A L L+L CKLDV A+ YKD++
Sbjct  414   YPGFPYSYFPGCD------PATSITAGDGDASVKFARFAQLALVLQCKLDVKAKRYKDVA  467

Query  560   IAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDVIASLPEN  381
             ++YLFLANNLQYVV KV  S L   LGE+W++   + VK YA NYER GW  V AS    
Sbjct  468   LSYLFLANNLQYVVNKVAQSNLKHLLGEHWVANHESMVKLYADNYERTGWSKVFAS-SSG  526

Query  380   PTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRPYRDFYDT  201
              +  +S    K+  ++F+A+  +   K +   V+D+ LRD + +SLA + +  +R  YD 
Sbjct  527   LSVEISLGRAKESLRRFDAALEEVQAKQAGWAVTDQKLRDDIALSLAEEFVPAHRRLYDG  586

Query  200   HKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
                  P         +VKF P+D+ ++L+ + 
Sbjct  587   CPRGDP---------VVKFTPDDLDNYLAGML  609



>ref|XP_002881000.1| hypothetical protein ARALYDRAFT_344647 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57259.1| hypothetical protein ARALYDRAFT_344647 [Arabidopsis lyrata subsp. 
lyrata]
Length=605

 Score =   379 bits (974),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 228/592 (39%), Positives = 345/592 (58%), Gaps = 49/592 (8%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKW----NPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQ  1674
             F ES++  ++E +  +  KW       +S  +  +    E+R E   F++ + +LQ A+Q
Sbjct  23    FSESLLMDSIEAAETLTRKWISPNLSSSSSCSLSSIFSTENRVEGRRFIEVINSLQYAIQ  82

Query  1673  FLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvastst  1494
              + +  P S KL RA NL+ +AMK+L+KEF++IL  NR +LDPES  +S   ++    S 
Sbjct  83    GVVLVNPESPKLTRAHNLVTIAMKQLEKEFYRILKSNRRNLDPESVRSSPSFNARNKVSI  142

Query  1493  gfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKD  1314
                                    + + E+    VM D+++I +CMIS GY  EC K+YK 
Sbjct  143   YSQ--------------------VPKSEEAD--VMTDLKMISDCMISSGYENECIKIYKK  180

Query  1313  IRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNV  1134
             IR  I+ EA+S LG E +SF KI+K+DW+ +E  IK WL A ++ +  LF GER LCD+V
Sbjct  181   IRGSIMVEALSNLGFENLSFGKIQKLDWDSMEKNIKKWLEATKVLIANLFEGERILCDHV  240

Query  1133  FASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIE  954
             F+ +  ++ ES F EI+ ++A+ LF FP ++A+  K + EK+F  LD+Y  I+   P+IE
Sbjct  241   FSPSV-SVAESCFTEITLDSALTLFIFPVSVAR-CKKTVEKIFLTLDIYQTISQLMPQIE  298

Query  953   SIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMN  774
              IFS DS S++R QA  SL  LG+ I + +A+FE  + K+SSKS + GGG+H LT   MN
Sbjct  299   EIFSYDSTSAVRLQAADSLKNLGEEINSMVAEFEASITKESSKSPIPGGGVHQLTRYVMN  358

Query  773   YLTSIADHSNVLSDIFS-NTPPIPKDWLPDSYFAVSDSDESP-------LPAISLRYAWl  618
             ++  +AD+   L+ + + +T P+P+D     YF  +D D             ++ R AWL
Sbjct  359   FIVFLADYHECLAGVLTESTLPLPED-----YFGNNDEDNKDGETRSSSSSTVTTRIAWL  413

Query  617   illllckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQY  438
             IL+LLCK+D  +  Y D++++YLFLANNL YV+ KVRTS L   LG+ W++    KV QY
Sbjct  414   ILVLLCKIDTKSRMYNDMALSYLFLANNLHYVISKVRTSNLRVVLGDEWVTNHEGKVTQY  473

Query  437   AANYERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDS  258
                YE++ WG+VI SL ++    +     K+  K+FN +F +A +K S  V  D  LR+ 
Sbjct  474   LEKYEKIAWGEVIMSLSDSNEEMLKENVAKERLKRFNDAFEEAFQKQSEWVAPDSKLRND  533

Query  257   LKVSLARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             LK S+ +KL      FY  + +   +E        V+FAPED+G++LSDLF 
Sbjct  534   LKDSVTKKLTSVATSFYAKYHVENWEE--------VRFAPEDLGNYLSDLFL  577



>gb|EPS59557.1| hypothetical protein M569_15248 [Genlisea aurea]
Length=608

 Score =   376 bits (966),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 235/580 (41%), Positives = 350/580 (60%), Gaps = 17/580 (3%)
 Frame = -2

Query  1835  ESVMERALEISGPMIMKWNPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQFLAMEQ  1656
             E+V    ++ +  +I+KW  +A +  K +SLF   R +A  F+  V +L  AM+    ++
Sbjct  35    ETVTAEEIDSAESVILKWQLDAHKHEKFSSLFAGGREDAKRFLHAVSSLHTAMRVCLKQK  94

Query  1655  PRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvaststgfssts  1476
               S++L R Q LM++A+KRL+KEF+  L+ NR  LD ES S S  + S  +T     S S
Sbjct  95    SSSDELHRCQKLMQIAIKRLEKEFYVTLSANRKKLDSESVSLSLSNRSSLATPGSSDSDS  154

Query  1475  dfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKDIRKWII  1296
               D    ++       S  E     S  M D+R I ECMI CGY  EC K+YK +RK I+
Sbjct  155   IEDEITAEEIGVKTPKSGPE-----SVAMEDLRSIAECMIECGYGSECVKIYKLLRKSIV  209

Query  1295  DEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNVFASTPD  1116
             DEA+  L +E+ S S++++M+W VL+ +IK WL AM+ A+  LF+GE+ LCD VFAS+ +
Sbjct  210   DEAMHFLEIERTSPSEMQQMEWNVLDAKIKTWLRAMKTAIGILFHGEKILCDAVFASS-E  268

Query  1115  AIRESIFKEISKEAAMILFEFPENIAKYAKN-SPEKVFRLLDMYNAIANHRPEIESIFSM  939
              +  S F +I ++AA+ +F F  N  K  K  +PEK+FR LD+Y AI +  PEIESIF  
Sbjct  269   TLAASCFADICRDAAVDMFSFAGNFGKSRKILTPEKLFRALDLYQAITDSWPEIESIFWH  328

Query  938   DSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMNYLTSI  759
             +S+S ++ +A  +L KLG+A +  IAQFET +QKDSSK T  GGG+HPLT   MN+LT +
Sbjct  329   ESSSPVKAEAGAALGKLGEAAKLMIAQFETAIQKDSSK-TPPGGGVHPLTRYVMNFLTFL  387

Query  758   ADHSNVLSDIFSNTPPIPKDWLPDSYFAVSDSDESPLPA-ISLRYAWlillllckLDVIA  582
              D+S  +S+I ++ P      LP S+F+ S S   P  A I+   AW IL+LLCKLD   
Sbjct  388   GDYSGSVSEILADWPLNKDINLPASFFSSSPSAVDPSAAVITACLAWFILVLLCKLDGKG  447

Query  581   EHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERLGWGDV  402
               YK+ +++YLFL NNL YVV KV+ S L   LG +W+ K   K  +Y ++YER+GW  V
Sbjct  448   TLYKNAALSYLFLGNNLNYVVSKVKGSNLRLLLGPDWIRKNRIKANRYLSSYERMGWTKV  507

Query  401   IASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLARKLLRP  222
             I++LP++PTA + P +  +HFK+FN  F +A +   + V+ D   RD ++ SL ++++  
Sbjct  508   ISTLPDDPTAEIPPHQAVEHFKQFNRCFEEARKTQVSWVIPDIEARDRVRSSLGKEIVCF  567

Query  221   YRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             YR FY   ++   K         V++ P+++  + S   F
Sbjct  568   YRIFYQKQRIDDEK--------TVRYTPDELEIYFSHELF  599



>gb|AAD24371.1| unknown protein [Arabidopsis thaliana]
Length=605

 Score =   376 bits (965),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 222/585 (38%), Positives = 342/585 (58%), Gaps = 35/585 (6%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKW----NPEASEAAKVTSLFYESRREANDFVKCVRNLQKAMQ  1674
             F ES++  ++E +  +  KW       +S  +  +    ++R E   FV+ + +LQ A+Q
Sbjct  23    FSESLLMDSIEAAETLTRKWISPDLSSSSSCSLSSIFSTDNRVEGRRFVEVINSLQYAIQ  82

Query  1673  FLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvastst  1494
              + +  P S KL RA NL+ +AMK+L+KEF++IL  NR +LDPES S  +  S  A    
Sbjct  83    GVVLVNPESPKLTRAHNLVTIAMKQLEKEFYRILKSNRRNLDPESVSVRSSPSFNARNKV  142

Query  1493  gfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVYKD  1314
                S                   + + E+    VM D+++I +CMIS GY  EC K+YK 
Sbjct  143   SIYSQ------------------VPKSEEAD--VMTDLKMIADCMISSGYENECIKIYKK  182

Query  1313  IRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCDNV  1134
             IR  I+ EA+S LG E +SF KI+K+DW+ +E  IK WL A ++ +  LF GER L D+V
Sbjct  183   IRGSIMVEALSNLGFENLSFGKIQKLDWDSMEKNIKKWLEATKVLITNLFEGERILSDHV  242

Query  1133  FASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPEIE  954
             F+ +  ++ ES F EI+ ++A+ LF FP ++A+  K + EK+F  LD+Y  I+   P+IE
Sbjct  243   FSPSV-SVAESCFTEITLDSALTLFIFPVSVAR-CKKTVEKIFLTLDIYQTISQLMPQIE  300

Query  953   SIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDAMN  774
              IFS DS +++R QA  SL  LG+ I + +A+FE  + K+SSK+ + GG +H LT   MN
Sbjct  301   EIFSYDSTTAVRLQAADSLNNLGEEINSMVAEFEASITKESSKTPIRGGSVHQLTRYVMN  360

Query  773   YLTSIADHSNVLSDIFS-NTPPIPKDWLPDSYFAVSDSDESPLPAISLRYAWlillllck  597
             ++  +AD+   L+ + + +T P+P+D+  ++    ++ +      ++ R AWLIL+LLCK
Sbjct  361   FIVFLADYHECLAGVLTESTLPLPEDYFGNNDEDNNEGETGSSSTVTTRIAWLILVLLCK  420

Query  596   LDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANYERL  417
             +D  +  Y D++++YLFLANNL YV+ KVRTS +   LG+ W++    KV QY   YE++
Sbjct  421   IDTKSRMYNDMALSYLFLANNLHYVISKVRTSNMRVVLGDEWVTNHEGKVTQYLEKYEKI  480

Query  416   GWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVSLAR  237
              WG+VI SL ++    +     K+   +FN  F +A +K S  VV D  LRD LK S+  
Sbjct  481   AWGEVITSLFDSNEEMLEEHVAKERLMRFNEGFEEAFQKQSEWVVPDSKLRDDLKDSVTE  540

Query  236   KLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLFF  102
             KL      FY+ + +   +E        VKFAPED+ ++LSDLF 
Sbjct  541   KLTTVTTTFYEKYHVENWEE--------VKFAPEDLDNYLSDLFL  577



>ref|NP_683286.2| exocyst subunit exo70 family protein H6 [Arabidopsis thaliana]
 gb|AAF75081.1|AC007583_17 It contains a interferon alpha/beta domain PF|00143. EST gb|N96176 
comes from this gene [Arabidopsis thaliana]
 gb|AEE28170.1| exocyst subunit exo70 family protein H6 [Arabidopsis thaliana]
Length=615

 Score =   375 bits (962),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 229/587 (39%), Positives = 356/587 (61%), Gaps = 28/587 (5%)
 Frame = -2

Query  1841  FYESVMERALEISGPMIMKW------NPEASEAAKVTSLFYESRREANDFVKCVRNLQKA  1680
             F ES++  ++E +   I +W      +  +S  +  +    ++R E   F++ +  LQ A
Sbjct  23    FSESLIGDSVEAADAFICQWVTPHLCDSSSSSCSLSSLFSAQNRLEGRRFLEVLGKLQYA  82

Query  1679  MQFLAMEQPRSEKLVRAQNLMEVAMKRLQKEFFQILNMNRAHLDPEsssasarsssvast  1500
             +Q      P S KL + Q+LM  AMK L+KEF+++L  NR  L PES S  +  S++ S 
Sbjct  83    IQSTVAMNPDSAKLAKGQDLMRKAMKHLEKEFYRVLKSNRRFLSPESVSGWSSESNIPSR  142

Query  1499  stgfsstsdfdvddddddvrvagdSITEVEDVSSFVMADMRLIVECMISCGYSKECFKVY  1320
             S+G +S S  D +   +     G  I    +  + V  D+++I  CMIS GY K+C K+Y
Sbjct  143   SSGTASDSSSDGELYSESSSELGKDIGGGGNSDAIV--DLKMIANCMISSGYEKDCVKIY  200

Query  1319  KDIRKWIIDEAISRLGVEKMSFSKIRKMDWEVLELRIKNWLSAMEIAVKTLFNGERTLCD  1140
             K  RK II + +S LG EK++ ++++K++WE+LE +IK W+    +A+ TLFNGER L D
Sbjct  201   KKFRKKIIVDTLSHLGFEKLTSTQMQKLEWEILEKKIKIWVIVARVAITTLFNGERILSD  260

Query  1139  NVFASTPDAIRESIFKEISKEAAMILFEFPENIAKYAKNSPEKVFRLLDMYNAIANHRPE  960
             ++F+S+   + ES F +I+ ++A+ LF F   +AK ++ + EK+F  LD+Y  I    P+
Sbjct  261   HIFSSS---VAESCFVDITLQSALNLFIFSLTVAK-SRKTAEKIFPTLDVYQTILQLTPK  316

Query  959   IESIFSMDSASSIRTQAVTSLAKLGDAIRTGIAQFETVLQKDSSKSTVAGGGIHPLTIDA  780
             I+ IFS DS +++R QA  SL KL +++   + +F++ + K+SSKS ++GGG+H LT   
Sbjct  317   IDQIFSYDSTAAVRLQANESLEKLSESVNAMMTEFQSSITKESSKSAISGGGVHQLTRYV  376

Query  779   MNYLTSIADHSNVLSDIFSNTP-PIPKDWLPDSYFAVSDS-DESPLPAISLRYAWlilll  606
             MN++  +AD+S+ L+ I   +  P+P+D+   S      S D SP+ A   R AWLIL+L
Sbjct  377   MNFIVFLADYSDSLATILKESSLPLPEDYFSSSGEENPGSGDRSPMAA---RLAWLILVL  433

Query  605   lckLDVIAEHYKDISIAYLFLANNLQYVVVKVRTSRLNRFLGENWLSKQSAKVKQYAANY  426
             LCK+D  +  Y D +++YLFLANNL YVV KVRTS L   LG++W++    KV QY   Y
Sbjct  434   LCKIDAKSRLYNDSALSYLFLANNLHYVVTKVRTSNLRLVLGDDWVANHEVKVNQYLEKY  493

Query  425   ERLGWGDVIASLPENPTAPMSPEEIKQHFKKFNASFAQAHRKHSACVVSDRNLRDSLKVS  246
             E++ WGDVIASLP + TA    EE     ++FN +F +A++KH   VV D NLRD ++ S
Sbjct  494   EKMAWGDVIASLPGDSTAGTEAEE---SLRRFNEAFEEAYKKHKTWVVPDPNLRDEIQAS  550

Query  245   LARKLLRPYRDFYDTHKLTMPKEKERHFSSIVKFAPEDVGHHLSDLF  105
             +ARKL+  Y  FY  H +           +IV+F PED+ ++++DL+
Sbjct  551   IARKLMPGYTGFYKKHPVGS--------CNIVRFTPEDLNNYITDLY  589



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5974774278840