BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14792_g2_i1 len=216 path=[459:0-135 1220:136-215]

Length=216
                                                                      Score     E

ref|XP_010026226.1|  PREDICTED: L-type lectin-domain containing r...  68.2    2e-13   
gb|KCW58874.1|  hypothetical protein EUGRSUZ_H01501                   68.2    2e-13   
gb|AAR11299.1|  lectin-like receptor kinase 7;2                       66.2    3e-13   Medicago truncatula
ref|XP_010039194.1|  PREDICTED: L-type lectin-domain containing r...  68.2    3e-13   
gb|KCW49572.1|  hypothetical protein EUGRSUZ_K03097                   68.2    3e-13   
ref|XP_010262582.1|  PREDICTED: L-type lectin-domain containing r...  63.2    3e-13   
gb|KCW62715.1|  hypothetical protein EUGRSUZ_G00291                   67.0    1e-12   
ref|XP_011010880.1|  PREDICTED: L-type lectin-domain containing r...  62.8    6e-12   
gb|KCW58878.1|  hypothetical protein EUGRSUZ_H015041                  69.3    6e-12   
gb|KCW74966.1|  hypothetical protein EUGRSUZ_E03710                   70.1    6e-12   
gb|KCW49568.1|  hypothetical protein EUGRSUZ_K03093                   62.0    6e-12   
ref|XP_010057734.1|  PREDICTED: L-type lectin-domain containing r...  70.1    7e-12   
gb|KCW74968.1|  hypothetical protein EUGRSUZ_E03712                   70.1    7e-12   
ref|XP_010037814.1|  PREDICTED: L-type lectin-domain containing r...  62.8    7e-12   
gb|KCW58869.1|  hypothetical protein EUGRSUZ_H01495                   69.7    7e-12   
ref|XP_010037813.1|  PREDICTED: L-type lectin-domain containing r...  62.0    7e-12   
gb|KCW49547.1|  hypothetical protein EUGRSUZ_K03066                   70.1    7e-12   
ref|XP_010070227.1|  PREDICTED: L-type lectin-domain containing r...  69.7    7e-12   
ref|XP_010037812.1|  PREDICTED: L-type lectin-domain containing r...  62.4    8e-12   
ref|XP_010037806.1|  PREDICTED: L-type lectin-domain containing r...  69.3    1e-11   
ref|XP_010026228.1|  PREDICTED: L-type lectin-domain containing r...  66.6    1e-11   
ref|XP_011019818.1|  PREDICTED: L-type lectin-domain containing r...  62.0    1e-11   
ref|XP_011014312.1|  PREDICTED: L-type lectin-domain containing r...  62.0    1e-11   
gb|KEH22956.1|  L-type lectin-domain receptor kinase IV.2-like pr...  58.5    2e-11   
emb|CDP14363.1|  unnamed protein product                              60.8    2e-11   
gb|KCW49558.1|  hypothetical protein EUGRSUZ_K03082                   60.5    2e-11   
ref|XP_009144571.1|  PREDICTED: L-type lectin-domain containing r...  59.3    2e-11   
ref|XP_010028188.1|  PREDICTED: L-type lectin-domain containing r...  68.2    3e-11   
ref|XP_010048167.1|  PREDICTED: L-type lectin-domain containing r...  62.4    3e-11   
emb|CDP14365.1|  unnamed protein product                              59.7    3e-11   
gb|KEH22940.1|  L-type lectin-domain receptor kinase IV.2-like pr...  58.5    3e-11   
ref|XP_010026224.1|  PREDICTED: L-type lectin-domain containing r...  68.2    3e-11   
ref|XP_007026951.1|  Concanavalin A-like lectin protein kinase fa...  59.7    3e-11   
ref|XP_006381210.1|  hypothetical protein POPTR_0006s08940g           60.5    4e-11   
ref|XP_010066063.1|  PREDICTED: L-type lectin-domain containing r...  62.0    4e-11   
gb|KCW49550.1|  hypothetical protein EUGRSUZ_K03069                   59.3    4e-11   
ref|NP_190949.1|  L-type lectin-domain containing receptor kinase...  55.8    5e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAO42880.1|  At3g53810                                             55.5    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403652.1|  hypothetical protein EUTSA_v10010174mg           55.5    5e-11   
ref|XP_002877942.1|  hypothetical protein ARALYDRAFT_485775           55.1    5e-11   
gb|KCW80347.1|  hypothetical protein EUGRSUZ_C01712                   62.0    6e-11   
ref|XP_006293079.1|  hypothetical protein CARUB_v10019366mg           55.8    8e-11   
ref|XP_010026227.1|  PREDICTED: L-type lectin-domain containing r...  66.6    9e-11   
ref|XP_010068014.1|  PREDICTED: L-type lectin-domain containing r...  66.6    9e-11   
ref|XP_010040833.1|  PREDICTED: L-type lectin-domain containing r...  66.6    9e-11   
ref|XP_010515881.1|  PREDICTED: L-type lectin-domain containing r...  54.7    1e-10   
ref|XP_010070228.1|  PREDICTED: L-type lectin-domain containing r...  66.6    1e-10   
ref|XP_006295761.1|  hypothetical protein CARUB_v10024881mg           54.3    1e-10   
ref|XP_010040815.1|  PREDICTED: L-type lectin-domain containing r...  66.6    1e-10   
ref|XP_010427040.1|  PREDICTED: L-type lectin-domain containing r...  54.3    1e-10   
ref|XP_006381201.1|  hypothetical protein POPTR_0006s08870g           58.9    1e-10   
ref|XP_006387090.1|  hypothetical protein POPTR_1896s002101g          59.3    1e-10   
ref|XP_010065281.1|  PREDICTED: L-type lectin-domain containing r...  66.2    1e-10   
ref|XP_006381203.1|  hypothetical protein POPTR_0006s08890g           58.5    1e-10   
gb|KCW62702.1|  hypothetical protein EUGRSUZ_G00265                   66.2    1e-10   
ref|XP_010070231.1|  PREDICTED: L-type lectin-domain containing r...  66.2    1e-10   
ref|XP_002309078.1|  hypothetical protein POPTR_0006s08970g           58.5    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_009116078.1|  PREDICTED: L-type lectin-domain containing r...  55.1    1e-10   
emb|CDY65835.1|  BnaA09g54750D                                        55.1    1e-10   
gb|KEH41557.1|  L-type lectin-domain receptor kinase IV.2-like pr...  57.0    2e-10   
ref|XP_002881547.1|  hypothetical protein ARALYDRAFT_482773           56.2    2e-10   
ref|XP_010230080.1|  PREDICTED: uncharacterized protein LOC100822922  57.8    2e-10   
ref|XP_004137932.1|  PREDICTED: L-type lectin-domain containing r...  65.9    2e-10   
ref|XP_004156651.1|  PREDICTED: L-type lectin-domain containing r...  65.9    2e-10   
ref|XP_010028192.1|  PREDICTED: L-type lectin-domain containing r...  65.5    2e-10   
ref|XP_006432458.1|  hypothetical protein CICLE_v10003226mg           56.6    2e-10   
ref|XP_010517048.1|  PREDICTED: L-type lectin-domain containing r...  55.8    3e-10   
ref|XP_010504152.1|  PREDICTED: L-type lectin-domain containing r...  52.8    3e-10   
ref|XP_010033699.1|  PREDICTED: L-type lectin-domain containing r...  65.1    3e-10   
ref|XP_010504154.1|  PREDICTED: L-type lectin-domain containing r...  52.8    3e-10   
ref|XP_010504155.1|  PREDICTED: L-type lectin-domain containing r...  52.8    3e-10   
gb|KCW53420.1|  hypothetical protein EUGRSUZ_J02660                   65.1    3e-10   
gb|KCW49552.1|  hypothetical protein EUGRSUZ_K03072                   65.1    4e-10   
gb|KDP35671.1|  hypothetical protein JCGZ_09109                       64.7    4e-10   
ref|XP_010262573.1|  PREDICTED: L-type lectin-domain containing r...  64.7    4e-10   
ref|XP_010262575.1|  PREDICTED: L-type lectin-domain containing r...  64.7    5e-10   
gb|KFK36661.1|  hypothetical protein AALP_AA4G153600                  56.2    5e-10   
ref|XP_006494080.1|  PREDICTED: L-type lectin-domain containing r...  55.5    5e-10   
gb|KDO58876.1|  hypothetical protein CISIN_1g040242mg                 55.5    5e-10   
gb|KCW49573.1|  hypothetical protein EUGRSUZ_K03098                   63.2    6e-10   
gb|KCW47898.1|  hypothetical protein EUGRSUZ_K01640                   55.8    6e-10   
ref|XP_010036353.1|  PREDICTED: L-type lectin-domain containing r...  55.8    6e-10   
ref|XP_008442520.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...  64.3    7e-10   
gb|AAP47579.1|  receptor kinase Lecrk                                 64.3    7e-10   Gossypium hirsutum [American cotton]
ref|XP_006410963.1|  hypothetical protein EUTSA_v10016355mg           54.3    7e-10   
gb|KCW62712.1|  hypothetical protein EUGRSUZ_G00286                   63.9    8e-10   
ref|XP_010037807.1|  PREDICTED: L-type lectin-domain containing r...  56.6    8e-10   
ref|XP_010936217.1|  PREDICTED: L-type lectin-domain containing r...  58.2    8e-10   
gb|KCW44894.1|  hypothetical protein EUGRSUZ_L015252                  63.5    9e-10   
ref|XP_006480860.1|  PREDICTED: L-type lectin-domain containing r...  63.9    9e-10   
ref|XP_006429139.1|  hypothetical protein CICLE_v10011218mg           63.9    9e-10   
ref|XP_009409023.1|  PREDICTED: L-type lectin-domain containing r...  58.9    1e-09   
ref|NP_001058830.1|  Os07g0131100                                     56.6    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465527.1|  hypothetical protein SORBIDRAFT_01g040590        56.6    1e-09   Sorghum bicolor [broomcorn]
gb|EEC81465.1|  hypothetical protein OsI_24777                        56.6    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_010456033.1|  PREDICTED: L-type lectin-domain containing r...  54.3    1e-09   
ref|XP_009133202.1|  PREDICTED: L-type lectin-domain containing r...  52.8    1e-09   
ref|XP_010424659.1|  PREDICTED: L-type lectin-domain containing r...  54.3    1e-09   
ref|XP_006363073.1|  PREDICTED: L-type lectin-domain containing r...  63.2    1e-09   
ref|XP_010039190.1|  PREDICTED: L-type lectin-domain containing r...  63.2    1e-09   
ref|XP_009350195.1|  PREDICTED: L-type lectin-domain containing r...  63.2    1e-09   
ref|XP_009347933.1|  PREDICTED: L-type lectin-domain containing r...  63.2    1e-09   
ref|XP_010033698.1|  PREDICTED: L-type lectin-domain containing r...  63.2    2e-09   
ref|XP_010041231.1|  PREDICTED: L-type lectin-domain containing r...  63.2    2e-09   
gb|KCW53417.1|  hypothetical protein EUGRSUZ_J02657                   63.2    2e-09   
ref|XP_009350447.1|  PREDICTED: L-type lectin-domain containing r...  63.2    2e-09   
gb|EAZ02656.1|  hypothetical protein OsI_24767                        53.9    2e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001058820.1|  Os07g0130100                                     53.9    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007207541.1|  hypothetical protein PRUPE_ppa016194mg           62.8    2e-09   
gb|KCW44394.1|  hypothetical protein EUGRSUZ_L02124                   62.4    2e-09   
gb|KCW58873.1|  hypothetical protein EUGRSUZ_H01500                   62.8    2e-09   
gb|KCW58870.1|  hypothetical protein EUGRSUZ_H01496                   62.8    2e-09   
ref|XP_010026230.1|  PREDICTED: L-type lectin-domain containing r...  62.8    2e-09   
ref|XP_010262576.1|  PREDICTED: L-type lectin-domain containing r...  62.8    2e-09   
ref|XP_010262584.1|  PREDICTED: L-type lectin-domain containing r...  62.8    2e-09   
ref|XP_010025783.1|  PREDICTED: L-type lectin-domain containing r...  62.8    2e-09   
ref|XP_004492166.1|  PREDICTED: L-type lectin-domain containing r...  62.8    2e-09   
ref|XP_008240448.1|  PREDICTED: L-type lectin-domain containing r...  62.8    2e-09   
gb|KCW58879.1|  hypothetical protein EUGRSUZ_H01505                   62.4    2e-09   
ref|XP_010107337.1|  L-type lectin-domain containing receptor kin...  62.0    2e-09   
ref|XP_002446842.1|  hypothetical protein SORBIDRAFT_06g023520        53.9    2e-09   Sorghum bicolor [broomcorn]
ref|XP_010262585.1|  PREDICTED: L-type lectin-domain containing r...  62.8    2e-09   
ref|XP_006341207.1|  PREDICTED: L-type lectin-domain containing r...  55.1    3e-09   
ref|XP_002461413.1|  hypothetical protein SORBIDRAFT_02g002240        51.2    3e-09   Sorghum bicolor [broomcorn]
ref|XP_008369932.1|  PREDICTED: L-type lectin-domain containing r...  62.4    3e-09   
ref|XP_006387255.1|  hypothetical protein POPTR_1407s00200g           55.5    3e-09   
ref|XP_010107339.1|  L-type lectin-domain containing receptor kin...  62.4    3e-09   
dbj|BAJ93671.1|  predicted protein                                    53.9    3e-09   
ref|XP_007026953.1|  Receptor lectin kinase                           62.0    4e-09   
ref|XP_010107335.1|  L-type lectin-domain containing receptor kin...  56.2    4e-09   
ref|XP_007206532.1|  hypothetical protein PRUPE_ppa019569mg           62.0    4e-09   
ref|XP_010228396.1|  PREDICTED: uncharacterized protein LOC100823194  53.9    4e-09   
ref|XP_011020400.1|  PREDICTED: L-type lectin-domain containing r...  52.0    4e-09   
ref|XP_008240568.1|  PREDICTED: L-type lectin-domain containing r...  62.0    4e-09   
ref|XP_009593324.1|  PREDICTED: L-type lectin-domain containing r...  62.0    4e-09   
ref|XP_011020399.1|  PREDICTED: L-type lectin-domain containing r...  51.6    4e-09   
ref|XP_009778121.1|  PREDICTED: L-type lectin-domain containing r...  61.6    5e-09   
ref|XP_010262581.1|  PREDICTED: L-type lectin-domain containing r...  61.6    5e-09   
ref|XP_007208048.1|  hypothetical protein PRUPE_ppa002342mg           61.6    5e-09   
ref|XP_010107332.1|  L-type lectin-domain containing receptor kin...  62.0    5e-09   
emb|CDP21076.1|  unnamed protein product                              61.6    5e-09   
ref|XP_010262572.1|  PREDICTED: L-type lectin-domain containing r...  61.6    6e-09   
ref|XP_008240589.1|  PREDICTED: L-type lectin-domain containing r...  61.6    6e-09   
emb|CDP14355.1|  unnamed protein product                              61.6    6e-09   
ref|XP_002872841.1|  lectin protein kinase family protein             53.1    6e-09   
ref|XP_009334389.1|  PREDICTED: L-type lectin-domain containing r...  61.6    6e-09   
ref|XP_008240435.1|  PREDICTED: L-type lectin-domain containing r...  61.2    6e-09   
ref|XP_010065280.1|  PREDICTED: L-type lectin-domain containing r...  61.2    6e-09   
ref|XP_007140499.1|  hypothetical protein PHAVU_008G117800g           61.2    6e-09   
ref|XP_010070226.1|  PREDICTED: L-type lectin-domain containing r...  61.2    6e-09   
ref|XP_002890460.1|  predicted protein                                52.0    7e-09   
ref|XP_004965305.1|  PREDICTED: L-type lectin-domain containing r...  53.5    7e-09   
emb|CAN77672.1|  hypothetical protein VITISV_019444                   61.2    7e-09   Vitis vinifera
emb|CBI30516.3|  unnamed protein product                              61.2    7e-09   
ref|XP_008240475.1|  PREDICTED: L-type lectin-domain containing r...  61.2    7e-09   
ref|XP_010088607.1|  L-type lectin-domain containing receptor kin...  61.2    7e-09   
ref|XP_010654251.1|  PREDICTED: L-type lectin-domain containing r...  61.2    7e-09   
ref|XP_009347934.1|  PREDICTED: L-type lectin-domain containing r...  61.2    7e-09   
ref|XP_010228395.1|  PREDICTED: uncharacterized protein LOC100823228  52.8    7e-09   
ref|XP_009350450.1|  PREDICTED: L-type lectin-domain containing r...  61.2    7e-09   
ref|XP_010456036.1|  PREDICTED: L-type lectin-domain containing r...  50.8    8e-09   
ref|XP_010429650.1|  PREDICTED: L-type lectin-domain containing r...  51.6    8e-09   
ref|XP_010429638.1|  PREDICTED: L-type lectin-domain containing r...  50.8    8e-09   
gb|EMS46773.1|  L-type lectin-domain containing receptor kinase IV.1  54.3    9e-09   
ref|XP_007208273.1|  hypothetical protein PRUPE_ppa015709mg           60.8    9e-09   
gb|KFK30833.1|  hypothetical protein AALP_AA6G031600                  52.0    9e-09   
ref|XP_010256839.1|  PREDICTED: L-type lectin-domain containing r...  60.8    9e-09   
emb|CDP17270.1|  unnamed protein product                              60.8    1e-08   
emb|CDP17279.1|  unnamed protein product                              60.8    1e-08   
ref|XP_008240576.1|  PREDICTED: L-type lectin-domain containing r...  60.8    1e-08   
dbj|BAC57688.1|  putative receptor-like protein kinase                51.2    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ38579.1|  hypothetical protein OsJ_22967                        51.2    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02657.1|  hypothetical protein OsI_24768                        51.2    1e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_001058821.2|  Os07g0130200                                     51.2    1e-08   Oryza sativa Japonica Group [Japonica rice]
emb|CDP17273.1|  unnamed protein product                              60.8    1e-08   
ref|XP_008448149.1|  PREDICTED: L-type lectin-domain containing r...  60.8    1e-08   
ref|XP_010037815.1|  PREDICTED: L-type lectin-domain containing r...  60.5    1e-08   
ref|XP_010262894.1|  PREDICTED: L-type lectin-domain containing r...  60.1    1e-08   
ref|XP_003557624.2|  PREDICTED: L-type lectin-domain containing r...  52.8    1e-08   
gb|EMS54258.1|  L-type lectin-domain containing receptor kinase IV.1  57.4    1e-08   
gb|KDO52362.1|  hypothetical protein CISIN_1g036051mg                 60.1    1e-08   
emb|CDP17268.1|  unnamed protein product                              60.5    1e-08   
ref|XP_006424894.1|  hypothetical protein CICLE_v10030157mg           53.1    1e-08   
ref|XP_010256840.1|  PREDICTED: L-type lectin-domain containing r...  60.5    1e-08   
ref|XP_006488377.1|  PREDICTED: putative L-type lectin-domain con...  53.1    1e-08   
emb|CDP14364.1|  unnamed protein product                              60.5    1e-08   
dbj|BAC57690.1|  putative receptor-like protein kinase                50.1    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058822.2|  Os07g0130300                                     50.1    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010936300.1|  PREDICTED: L-type lectin-domain containing r...  60.1    2e-08   
gb|EMT19416.1|  Lectin-domain containing receptor kinase A4.2         50.8    2e-08   
ref|NP_567234.1|  L-type lectin-domain containing receptor kinase...  50.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|EMT07131.1|  Lectin-domain containing receptor kinase A4.3         52.4    2e-08   
ref|XP_003552189.1|  PREDICTED: L-type lectin-domain containing r...  60.1    2e-08   
ref|NP_567233.1|  L-type lectin-domain containing receptor kinase...  51.6    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|EMT06508.1|  Lectin-domain containing receptor kinase A4.2         52.8    2e-08   
emb|CDP14357.1|  unnamed protein product                              59.7    2e-08   
gb|KCW49555.1|  hypothetical protein EUGRSUZ_K03077                   60.1    2e-08   
gb|KEH22942.1|  lectin-like receptor kinase family protein, putative  57.4    2e-08   
ref|XP_010037808.1|  PREDICTED: L-type lectin-domain containing r...  59.7    2e-08   
gb|EMT08163.1|  Lectin-domain containing receptor kinase A4.3         57.0    2e-08   
ref|XP_004165544.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...  59.7    2e-08   
emb|CDP14356.1|  unnamed protein product                              59.3    2e-08   
ref|XP_007206374.1|  hypothetical protein PRUPE_ppa017920mg           59.7    2e-08   
ref|XP_002445040.1|  hypothetical protein SORBIDRAFT_07g003240        55.1    3e-08   Sorghum bicolor [broomcorn]
ref|XP_004142200.1|  PREDICTED: L-type lectin-domain containing r...  59.7    3e-08   
ref|XP_003581453.1|  PREDICTED: L-type lectin-domain containing r...  49.3    3e-08   
ref|XP_010262895.1|  PREDICTED: L-type lectin-domain containing r...  59.7    3e-08   
ref|XP_008240486.1|  PREDICTED: L-type lectin-domain containing r...  59.7    3e-08   
ref|XP_009350763.1|  PREDICTED: L-type lectin-domain containing r...  59.7    3e-08   
gb|KGN54269.1|  hypothetical protein Csa_4G296230                     59.7    3e-08   
ref|XP_004305189.1|  PREDICTED: L-type lectin-domain containing r...  59.7    3e-08   
ref|XP_009417021.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...  53.9    3e-08   
ref|XP_002441537.1|  hypothetical protein SORBIDRAFT_09g028880        53.1    3e-08   Sorghum bicolor [broomcorn]
emb|CDP13825.1|  unnamed protein product                              53.5    3e-08   
ref|XP_002314159.2|  hypothetical protein POPTR_0009s04030g           48.5    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010539955.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...  59.3    3e-08   
emb|CDP14367.1|  unnamed protein product                              59.3    3e-08   
gb|EMS64362.1|  L-type lectin-domain containing receptor kinase IV.1  53.9    3e-08   
gb|KDO52363.1|  hypothetical protein CISIN_1g007869mg                 59.3    3e-08   
ref|XP_008369930.1|  PREDICTED: L-type lectin-domain containing r...  59.3    3e-08   
emb|CDP17277.1|  unnamed protein product                              59.3    3e-08   
gb|EPS73694.1|  hypothetical protein M569_01059                       48.9    3e-08   
ref|XP_006657424.1|  PREDICTED: L-type lectin-domain containing r...  50.1    3e-08   
emb|CDP10819.1|  unnamed protein product                              59.3    4e-08   
emb|CDP19583.1|  unnamed protein product                              59.3    4e-08   
ref|XP_008790452.1|  PREDICTED: L-type lectin-domain containing r...  58.9    4e-08   
emb|CDP10820.1|  unnamed protein product                              58.9    4e-08   
gb|EMT08195.1|  Lectin-domain containing receptor kinase A4.3         53.1    4e-08   
ref|XP_003562841.2|  PREDICTED: uncharacterized protein LOC100846075  53.9    4e-08   
ref|XP_010276641.1|  PREDICTED: L-type lectin-domain containing r...  58.9    4e-08   
emb|CDP17271.1|  unnamed protein product                              58.9    5e-08   
emb|CDP07846.1|  unnamed protein product                              58.9    5e-08   
ref|XP_008801685.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...  58.9    5e-08   
gb|KFK30832.1|  hypothetical protein AALP_AA6G031500                  50.4    5e-08   
ref|XP_008664036.1|  PREDICTED: uncharacterized protein LOC103642561  53.9    5e-08   
gb|AFW57378.1|  putative lectin-like receptor protein kinase fami...  53.9    5e-08   
emb|CDP14370.1|  unnamed protein product                              58.9    5e-08   
ref|XP_011019817.1|  PREDICTED: L-type lectin-domain containing r...  58.5    5e-08   
ref|XP_003561446.1|  PREDICTED: L-type lectin-domain containing r...  48.9    5e-08   
ref|XP_008785542.1|  PREDICTED: L-type lectin-domain containing r...  58.5    5e-08   
emb|CDP14368.1|  unnamed protein product                              58.5    6e-08   
ref|XP_002534539.1|  kinase, putative                                 58.5    6e-08   Ricinus communis
ref|XP_004966927.1|  PREDICTED: L-type lectin-domain containing r...  52.4    6e-08   
gb|KDP27315.1|  hypothetical protein JCGZ_20940                       49.7    6e-08   
ref|XP_009144569.1|  PREDICTED: L-type lectin-domain containing r...  47.8    6e-08   
ref|XP_009144572.1|  PREDICTED: L-type lectin-domain containing r...  47.4    6e-08   
emb|CDP17269.1|  unnamed protein product                              58.5    7e-08   
ref|XP_010262892.1|  PREDICTED: L-type lectin-domain containing r...  58.5    7e-08   
ref|XP_010269393.1|  PREDICTED: L-type lectin-domain containing r...  58.5    7e-08   
ref|XP_008790453.1|  PREDICTED: L-type lectin-domain containing r...  58.5    7e-08   
ref|XP_010262574.1|  PREDICTED: L-type lectin-domain containing r...  58.5    7e-08   
ref|XP_010936216.1|  PREDICTED: L-type lectin-domain containing r...  58.5    7e-08   
gb|KEH22944.1|  L-type lectin-domain receptor kinase IV.2-like pr...  58.5    7e-08   
emb|CDP17278.1|  unnamed protein product                              57.8    7e-08   
emb|CAB75472.1|  receptor like protein kinase                         58.2    8e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396450.1|  hypothetical protein EUTSA_v10028492mg           52.8    8e-08   
ref|XP_006287213.1|  hypothetical protein CARUB_v10000390mg           47.4    8e-08   
ref|NP_190129.2|  concanavalin A-like lectin kinase-like protein      58.2    8e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KEH22960.1|  L-type lectin-domain receptor kinase IV.2-like pr...  58.2    8e-08   
ref|XP_010456038.1|  PREDICTED: L-type lectin-domain containing r...  53.5    8e-08   
ref|XP_002872839.1|  hypothetical protein ARALYDRAFT_911976           53.1    8e-08   
gb|KCW49575.1|  hypothetical protein EUGRSUZ_K03100                   57.4    9e-08   
ref|XP_009130388.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...  57.8    9e-08   
gb|KEH22938.1|  L-type lectin-domain receptor kinase IV.2-like pr...  51.2    9e-08   
gb|KEH22948.1|  lectin-like receptor kinase                           57.4    1e-07   
gb|AFW58954.1|  putative lectin-like receptor protein kinase fami...  53.1    1e-07   
ref|XP_008663409.1|  PREDICTED: L-type lectin-domain containing r...  53.1    1e-07   
emb|CDY55369.1|  BnaA02g36540D                                        47.4    1e-07   
ref|XP_003529112.1|  PREDICTED: L-type lectin-domain containing r...  57.8    1e-07   
ref|XP_007207858.1|  hypothetical protein PRUPE_ppa022557mg           57.8    1e-07   
ref|XP_008240584.1|  PREDICTED: L-type lectin-domain containing r...  57.8    1e-07   
emb|CDP14359.1|  unnamed protein product                              57.8    1e-07   
ref|XP_006381205.1|  hypothetical protein POPTR_0006s089001g          57.8    1e-07   
gb|EPS60067.1|  hypothetical protein M569_14734                       51.2    1e-07   
ref|XP_002438288.1|  hypothetical protein SORBIDRAFT_10g011160        50.4    1e-07   Sorghum bicolor [broomcorn]
dbj|BAC83286.1|  putative receptor-type protein kinase LRK1           47.4    1e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EMT08194.1|  Lectin-domain containing receptor kinase A4.3         52.4    1e-07   
ref|XP_010262579.1|  PREDICTED: L-type lectin-domain containing r...  57.4    1e-07   
gb|EMT21877.1|  Lectin-domain containing receptor kinase A4.3         52.4    1e-07   
ref|XP_010262578.1|  PREDICTED: L-type lectin-domain containing r...  57.4    1e-07   
ref|XP_010262577.1|  PREDICTED: L-type lectin-domain containing r...  57.4    1e-07   
gb|EAZ02674.1|  hypothetical protein OsI_24787                        50.8    1e-07   
ref|XP_006424885.1|  hypothetical protein CICLE_v10027957mg           53.9    1e-07   
ref|XP_008366733.1|  PREDICTED: L-type lectin-domain containing r...  57.4    1e-07   
ref|XP_010276639.1|  PREDICTED: L-type lectin-domain containing r...  57.4    1e-07   
gb|KFK41426.1|  hypothetical protein AALP_AA2G129400                  52.0    1e-07   
gb|KDO72805.1|  hypothetical protein CISIN_1g044561mg                 53.5    1e-07   
gb|EMS46625.1|  L-type lectin-domain containing receptor kinase IV.1  47.4    2e-07   
emb|CDP10818.1|  unnamed protein product                              57.4    2e-07   
dbj|BAJ98510.1|  predicted protein                                    50.8    2e-07   
gb|EMT21747.1|  Lectin-domain containing receptor kinase A4.2         48.1    2e-07   
gb|EMS52129.1|  L-type lectin-domain containing receptor kinase IV.2  49.7    2e-07   
ref|XP_009593326.1|  PREDICTED: L-type lectin-domain containing r...  57.0    2e-07   
ref|XP_002438287.1|  hypothetical protein SORBIDRAFT_10g011150        57.0    2e-07   
ref|XP_010438141.1|  PREDICTED: L-type lectin-domain containing r...  51.6    2e-07   
ref|XP_010943349.1|  PREDICTED: L-type lectin-domain containing r...  57.0    2e-07   
ref|XP_002303928.1|  lectin protein kinase                            48.5    2e-07   
ref|XP_007016341.1|  Concanavalin A-like lectin protein kinase fa...  48.1    2e-07   
ref|XP_006488669.1|  PREDICTED: L-type lectin-domain containing r...  52.8    2e-07   
ref|XP_006424884.1|  hypothetical protein CICLE_v10030413mg           52.8    2e-07   
emb|CDY35246.1|  BnaA01g07850D                                        56.2    2e-07   
dbj|BAJ98654.1|  predicted protein                                    47.4    3e-07   
dbj|BAC82941.1|  putative receptor kinase                             50.8    3e-07   
ref|XP_010936301.1|  PREDICTED: L-type lectin-domain containing r...  50.4    3e-07   
ref|XP_002452862.1|  hypothetical protein SORBIDRAFT_04g033790        48.9    3e-07   
ref|XP_009123695.1|  PREDICTED: L-type lectin-domain containing r...  47.8    3e-07   
emb|CDY02414.1|  BnaA02g23230D                                        47.8    3e-07   
ref|XP_009134432.1|  PREDICTED: L-type lectin-domain containing r...  49.3    3e-07   
ref|XP_008350441.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...  56.2    3e-07   
ref|XP_009417022.1|  PREDICTED: L-type lectin-domain containing r...  56.2    3e-07   
ref|XP_006846310.1|  hypothetical protein AMTR_s00012p00254100        56.6    3e-07   
ref|XP_009334391.1|  PREDICTED: L-type lectin-domain containing r...  56.6    3e-07   
ref|XP_003562843.2|  PREDICTED: uncharacterized protein LOC100846686  47.4    3e-07   
ref|XP_010918286.1|  PREDICTED: L-type lectin-domain containing r...  49.7    3e-07   
gb|KDP42214.1|  hypothetical protein JCGZ_02944                       56.2    3e-07   
emb|CDX97474.1|  BnaC08g13390D                                        52.4    4e-07   
gb|AFW77019.1|  putative lectin-like receptor protein kinase fami...  46.6    4e-07   
ref|NP_001168373.1|  uncharacterized protein LOC100382142 precursor   46.6    4e-07   
emb|CDP17280.1|  unnamed protein product                              56.2    4e-07   
emb|CDM82996.1|  unnamed protein product                              51.2    4e-07   
ref|XP_010068032.1|  PREDICTED: L-type lectin-domain containing r...  55.5    4e-07   
ref|XP_009334392.1|  PREDICTED: L-type lectin-domain containing r...  56.2    4e-07   
ref|XP_009334398.1|  PREDICTED: L-type lectin-domain containing r...  56.2    4e-07   
ref|XP_010325844.1|  PREDICTED: L-type lectin-domain containing r...  56.2    4e-07   
ref|XP_009778122.1|  PREDICTED: L-type lectin-domain containing r...  56.2    4e-07   
ref|XP_010262583.1|  PREDICTED: L-type lectin-domain containing r...  56.2    4e-07   
ref|XP_010325846.1|  PREDICTED: L-type lectin-domain containing r...  56.2    4e-07   
gb|KEH22937.1|  L-type lectin-domain receptor kinase IV.2-like pr...  55.8    5e-07   
ref|XP_010425973.1|  PREDICTED: probable L-type lectin-domain con...  53.1    5e-07   
ref|XP_010425972.1|  PREDICTED: probable L-type lectin-domain con...  53.1    5e-07   
gb|AER41625.1|  legume+lectins+beta+domain+containing+protein         55.5    5e-07   
ref|XP_010520344.1|  PREDICTED: L-type lectin-domain containing r...  53.5    5e-07   
gb|EMT15256.1|  Lectin-domain containing receptor kinase A4.3         48.9    5e-07   
emb|CDY21254.1|  BnaC02g28690D                                        47.0    5e-07   
gb|KEH22950.1|  L-type lectin-domain receptor kinase IV.2-like pr...  55.8    5e-07   
ref|XP_002531545.1|  carbohydrate binding protein, putative           55.8    5e-07   
ref|XP_006363099.1|  PREDICTED: L-type lectin-domain containing r...  55.8    6e-07   
ref|XP_002436918.1|  hypothetical protein SORBIDRAFT_10g011000        55.8    6e-07   
ref|XP_008387804.1|  PREDICTED: L-type lectin-domain containing r...  55.8    6e-07   
gb|EMT31035.1|  Lectin-domain containing receptor kinase A4.3         47.0    6e-07   
ref|XP_010276640.1|  PREDICTED: L-type lectin-domain containing r...  55.5    6e-07   
ref|XP_010228231.1|  PREDICTED: L-type lectin-domain containing r...  55.5    7e-07   
ref|XP_003557392.2|  PREDICTED: L-type lectin-domain containing r...  55.5    7e-07   
ref|XP_004959787.1|  PREDICTED: uncharacterized protein LOC101759149  55.8    7e-07   
gb|AER41624.1|  legume+lectins+beta+domain+containing+protein         49.7    7e-07   
ref|XP_004246353.1|  PREDICTED: L-type lectin-domain containing r...  55.5    8e-07   
ref|XP_010228230.1|  PREDICTED: L-type lectin-domain containing r...  55.1    8e-07   
dbj|BAC57691.1|  putative receptor-like protein kinase                50.8    8e-07   
gb|EAZ02659.1|  hypothetical protein OsI_24770                        50.8    8e-07   
ref|XP_006658254.1|  PREDICTED: uncharacterized protein LOC102702395  48.1    9e-07   
dbj|BAJ91501.1|  predicted protein                                    46.2    9e-07   
ref|XP_010923243.1|  PREDICTED: L-type lectin-domain containing r...  54.7    9e-07   
gb|KDP42206.1|  hypothetical protein JCGZ_02936                       46.6    9e-07   
ref|XP_009105689.1|  PREDICTED: putative L-type lectin-domain con...  55.1    9e-07   
ref|XP_004955417.1|  PREDICTED: L-type lectin-domain containing r...  42.7    9e-07   
ref|XP_009419258.1|  PREDICTED: L-type lectin-domain containing r...  55.1    1e-06   
ref|XP_009131928.1|  PREDICTED: L-type lectin-domain containing r...  55.1    1e-06   
tpg|DAA60210.1|  TPA: putative lectin-like receptor protein kinas...  54.7    1e-06   
gb|KFK34629.1|  hypothetical protein AALP_AA5G171000                  40.8    1e-06   
ref|XP_002314160.2|  hypothetical protein POPTR_0009s04020g           52.0    1e-06   
emb|CDM84607.1|  unnamed protein product                              54.7    1e-06   
emb|CDY06846.1|  BnaC01g09450D                                        54.7    1e-06   
ref|XP_008653697.1|  PREDICTED: L-type lectin-domain containing r...  54.7    1e-06   
dbj|BAJ89274.1|  predicted protein                                    52.4    1e-06   
ref|XP_010039199.1|  PREDICTED: L-type lectin-domain containing r...  53.9    1e-06   
gb|KCW49574.1|  hypothetical protein EUGRSUZ_K03099                   54.3    1e-06   
gb|EMT24756.1|  Lectin-domain containing receptor kinase A4.3         48.1    1e-06   
ref|XP_008649316.1|  PREDICTED: L-type lectin-domain containing r...  54.7    1e-06   
ref|XP_009416774.1|  PREDICTED: uncharacterized protein LOC103997323  54.7    1e-06   
ref|XP_008679762.1|  PREDICTED: L-type lectin-domain containing r...  43.5    1e-06   
gb|KEH22945.1|  L-type lectin-domain receptor kinase IV.2-like pr...  54.3    1e-06   
dbj|BAK02747.1|  predicted protein                                    48.1    1e-06   
emb|CDY38792.1|  BnaA07g28640D                                        54.3    2e-06   
emb|CDX90938.1|  BnaA03g26180D                                        48.9    2e-06   
dbj|BAC06927.1|  putative receptor-type protein kinase LRK1           46.2    2e-06   
gb|EEE67461.1|  hypothetical protein OsJ_24851                        46.2    2e-06   
gb|KDP39903.1|  hypothetical protein JCGZ_03434                       54.3    2e-06   
ref|XP_010553278.1|  PREDICTED: L-type lectin-domain containing r...  54.3    2e-06   
ref|XP_010535515.1|  PREDICTED: L-type lectin-domain containing r...  54.3    2e-06   
ref|XP_010262571.1|  PREDICTED: L-type lectin-domain containing r...  54.3    2e-06   
ref|NP_177170.1|  putative L-type lectin-domain containing recept...  54.3    2e-06   
ref|XP_010514881.1|  PREDICTED: probable L-type lectin-domain con...  51.6    2e-06   
ref|XP_006846321.1|  hypothetical protein AMTR_s00012p00255090        48.5    2e-06   
ref|NP_001058828.1|  Os07g0130900                                     45.1    2e-06   
gb|EEC81464.1|  hypothetical protein OsI_24775                        45.1    2e-06   
emb|CDY07773.1|  BnaA03g17380D                                        52.8    2e-06   
dbj|BAC24931.1|  putative receptor-type protein kinase LRK1           54.3    2e-06   
ref|XP_004958114.1|  PREDICTED: L-type lectin-domain containing r...  54.3    2e-06   
emb|CDY14223.1|  BnaA08g13540D                                        53.9    2e-06   
ref|XP_010429626.1|  PREDICTED: L-type lectin-domain containing r...  48.9    2e-06   
ref|XP_007016342.1|  Concanavalin A-like lectin protein kinase fa...  53.9    2e-06   
ref|NP_190130.1|  concanavalin A-like lectin kinase-like protein      54.3    2e-06   
ref|XP_006488672.1|  PREDICTED: putative L-type lectin-domain con...  53.9    2e-06   
ref|XP_006424893.1|  hypothetical protein CICLE_v10030201mg           53.9    2e-06   
ref|XP_009417024.1|  PREDICTED: uncharacterized protein LOC103997501  51.6    2e-06   
ref|XP_010535585.1|  PREDICTED: LOW QUALITY PROTEIN: probable L-t...  50.8    2e-06   
ref|XP_010422596.1|  PREDICTED: L-type lectin-domain containing r...  48.5    2e-06   
ref|XP_009150071.1|  PREDICTED: probable L-type lectin-domain con...  53.9    2e-06   
dbj|BAC57685.1|  putative receptor-like protein kinase                48.5    2e-06   
gb|EAZ02664.1|  hypothetical protein OsI_24776                        54.3    2e-06   
ref|NP_001058829.1|  Os07g0131000                                     54.3    2e-06   
ref|XP_008653275.1|  PREDICTED: L-type lectin-domain containing r...  48.9    2e-06   
ref|XP_002436919.1|  hypothetical protein SORBIDRAFT_10g011010        49.7    2e-06   
gb|ACL36481.1|  lectin receptor-type kinase                           48.5    2e-06   
gb|EMT13663.1|  Lectin-domain containing receptor kinase A4.2         48.5    2e-06   
ref|XP_009109056.1|  PREDICTED: L-type lectin-domain containing r...  53.9    2e-06   
ref|XP_009143456.1|  PREDICTED: L-type lectin-domain containing r...  42.4    3e-06   
ref|XP_010541360.1|  PREDICTED: LOW QUALITY PROTEIN: probable L-t...  51.2    3e-06   
ref|XP_010456972.1|  PREDICTED: L-type lectin-domain containing r...  48.9    3e-06   
gb|KFK41427.1|  hypothetical protein AALP_AA2G129500                  53.9    3e-06   
emb|CDX91384.1|  BnaC04g07660D                                        42.4    3e-06   
emb|CDM84371.1|  unnamed protein product                              47.0    3e-06   
gb|EEC81827.1|  hypothetical protein OsI_25577                        49.3    3e-06   
gb|EMS56217.1|  L-type lectin-domain containing receptor kinase IV.1  47.0    3e-06   
ref|XP_004492169.1|  PREDICTED: L-type lectin-domain containing r...  43.9    3e-06   
emb|CAD41145.2|  OSJNBa0081C01.17                                     53.5    3e-06   
ref|XP_004492168.1|  PREDICTED: L-type lectin-domain containing r...  53.5    3e-06   
ref|XP_009416778.1|  PREDICTED: L-type lectin-domain containing r...  53.5    3e-06   
ref|NP_001053397.1|  Os04g0531500                                     53.5    3e-06   
gb|ADK62369.1|  lectin receptor kinase                                48.1    3e-06   
ref|XP_002463074.1|  hypothetical protein SORBIDRAFT_02g037300        53.5    3e-06   
ref|XP_009347936.1|  PREDICTED: L-type lectin-domain containing r...  53.5    3e-06   
ref|XP_006664666.1|  PREDICTED: L-type lectin-domain containing r...  43.5    3e-06   
ref|XP_006341008.1|  PREDICTED: L-type lectin-domain containing r...  53.5    3e-06   
ref|XP_009150070.1|  PREDICTED: probable L-type lectin-domain con...  53.5    3e-06   
ref|XP_009350197.1|  PREDICTED: L-type lectin-domain containing r...  53.5    3e-06   
ref|XP_002867426.1|  hypothetical protein ARALYDRAFT_353897           53.5    3e-06   
ref|XP_009150069.1|  PREDICTED: probable L-type lectin-domain con...  53.5    3e-06   
ref|XP_002888754.1|  lectin protein kinase family protein             53.5    3e-06   
dbj|BAK00406.1|  predicted protein                                    49.7    3e-06   
ref|XP_009392037.1|  PREDICTED: L-type lectin-domain containing r...  47.4    3e-06   
emb|CAJ86404.1|  OSIGBa0125M19.7                                      53.5    3e-06   
ref|XP_009150073.1|  PREDICTED: probable L-type lectin-domain con...  49.7    3e-06   
ref|XP_009150074.1|  PREDICTED: probable L-type lectin-domain con...  49.7    3e-06   
emb|CDY11617.1|  BnaC06g31220D                                        53.1    3e-06   
emb|CDX84969.1|  BnaC05g20860D                                        52.8    4e-06   
gb|AFW70950.1|  putative lectin-like receptor protein kinase fami...  48.1    4e-06   
ref|XP_009105688.1|  PREDICTED: putative L-type lectin-domain con...  48.5    4e-06   
emb|CDY38791.1|  BnaA07g28630D                                        48.5    4e-06   
emb|CAA65153.1|  receptor like protein kinase                         41.2    4e-06   
ref|XP_002461845.1|  hypothetical protein SORBIDRAFT_02g009160        53.1    4e-06   
emb|CDY11619.1|  BnaC06g31200D                                        48.5    4e-06   
ref|XP_006283271.1|  hypothetical protein CARUB_v10004305mg           53.1    4e-06   
gb|ACL36475.1|  lectin receptor kinase 1                              47.8    4e-06   
gb|ADK62373.1|  lectin receptor kinase                                47.8    4e-06   
gb|ACL36479.1|  unknown                                               47.8    4e-06   
gb|EMS47973.1|  L-type lectin-domain containing receptor kinase IV.1  43.1    4e-06   
gb|KDP37830.1|  hypothetical protein JCGZ_06732                       53.1    4e-06   
ref|XP_010228229.1|  PREDICTED: L-type lectin-domain containing r...  53.1    4e-06   
ref|NP_181307.1|  receptor lectin kinase                              41.2    4e-06   
gb|KCW49566.1|  hypothetical protein EUGRSUZ_K03091                   45.4    4e-06   
ref|XP_010447897.1|  PREDICTED: L-type lectin-domain containing r...  53.1    4e-06   
ref|XP_006400862.1|  hypothetical protein EUTSA_v10012880mg           53.1    4e-06   
gb|EMT19415.1|  Lectin-domain containing receptor kinase A4.3         53.1    4e-06   
ref|XP_008652229.1|  PREDICTED: L-type lectin-domain containing r...  48.1    4e-06   
tpg|DAA60209.1|  TPA: putative lectin-like receptor protein kinas...  48.1    4e-06   
dbj|BAG99918.1|  unnamed protein product                              52.4    4e-06   
ref|XP_009798367.1|  PREDICTED: L-type lectin-domain containing r...  53.1    4e-06   
dbj|BAK03310.1|  predicted protein                                    53.1    4e-06   
ref|XP_006293210.1|  hypothetical protein CARUB_v10019531mg           53.1    5e-06   
ref|XP_010438358.1|  PREDICTED: L-type lectin-domain containing r...  53.1    5e-06   
dbj|BAJ93092.1|  predicted protein                                    53.1    5e-06   
ref|XP_010438357.1|  PREDICTED: L-type lectin-domain containing r...  53.1    5e-06   
gb|EEC82314.1|  hypothetical protein OsI_26590                        44.3    5e-06   
ref|XP_002461416.1|  hypothetical protein SORBIDRAFT_02g002290        45.4    5e-06   
ref|XP_010685694.1|  PREDICTED: L-type lectin-domain containing r...  52.8    5e-06   
ref|XP_006286465.1|  hypothetical protein CARUB_v10000410mg           52.8    5e-06   
gb|AER41662.1|  legume+lectins+beta+domain+containing+protein         48.5    6e-06   
ref|XP_004976332.1|  PREDICTED: L-type lectin-domain containing r...  53.1    6e-06   
ref|XP_006488671.1|  PREDICTED: putative L-type lectin-domain con...  52.8    6e-06   
ref|NP_194634.1|  Concanavalin A-like lectin protein kinase famil...  52.8    6e-06   
ref|NP_200836.1|  concanavalin A-like lectin kinase-like protein      49.3    6e-06   
ref|XP_006301627.1|  hypothetical protein CARUB_v10022069mg           52.8    6e-06   
ref|XP_010682687.1|  PREDICTED: L-type lectin-domain containing r...  52.8    6e-06   
gb|EMS55343.1|  L-type lectin-domain containing receptor kinase V.9   46.2    6e-06   
ref|XP_006290706.1|  hypothetical protein CARUB_v10016803mg           52.8    6e-06   
ref|XP_010509284.1|  PREDICTED: L-type lectin-domain containing r...  40.8    7e-06   
ref|XP_009120557.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...  52.8    7e-06   
gb|EAY92001.1|  hypothetical protein OsI_13690                        45.8    7e-06   
ref|NP_001147990.1|  lectin-like receptor kinase 7 precursor          43.5    7e-06   
ref|XP_008675109.1|  PREDICTED: lectin-like receptor kinase 7 iso...  43.5    7e-06   
ref|XP_002520512.1|  kinase, putative                                 48.5    7e-06   
ref|XP_010918306.1|  PREDICTED: L-type lectin-domain containing r...  52.4    7e-06   
ref|XP_004976331.1|  PREDICTED: L-type lectin-domain containing r...  52.4    7e-06   
emb|CDX99161.1|  BnaA06g18520D                                        52.4    7e-06   
ref|XP_010228392.1|  PREDICTED: uncharacterized protein LOC100821369  47.0    7e-06   
ref|XP_002467174.1|  hypothetical protein SORBIDRAFT_01g020940        46.2    8e-06   
ref|XP_006363072.1|  PREDICTED: L-type lectin-domain containing r...  52.4    8e-06   
gb|EEE66919.1|  hypothetical protein OsJ_23770                        52.4    8e-06   
gb|KDO37326.1|  hypothetical protein CISIN_1g045713mg                 51.2    8e-06   
ref|XP_010248189.1|  PREDICTED: L-type lectin-domain containing r...  52.0    8e-06   
dbj|BAJ86501.1|  predicted protein                                    45.8    8e-06   
ref|XP_009417026.1|  PREDICTED: L-type lectin-domain containing r...  52.4    8e-06   
ref|XP_010512091.1|  PREDICTED: putative L-type lectin-domain con...  52.4    8e-06   
ref|XP_010248186.1|  PREDICTED: L-type lectin-domain containing r...  52.0    9e-06   
ref|XP_010529819.1|  PREDICTED: L-type lectin-domain containing r...  52.4    9e-06   
ref|XP_002877404.1|  lectin protein kinase family protein             52.4    9e-06   
gb|EEE66512.1|  hypothetical protein OsJ_22983                        52.0    9e-06   
ref|XP_006848074.1|  hypothetical protein AMTR_s00029p00202030        52.4    9e-06   
gb|AAR11298.1|  lectin-like receptor kinase 7;1                       52.0    9e-06   



>ref|XP_010026226.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=724

 Score = 68.2 bits (165),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +L L  V V++RKRKF +VLEDWE  YG HRFKY++LY ATKGF+
Sbjct  284  MLILGAVYVIRRKRKFAEVLEDWERDYGPHRFKYKDLYTATKGFR  328


 Score = 33.9 bits (76),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+++++LG G  G VYRG+LP + ++
Sbjct  325  KGFRDQELLGAGGFGQVYRGILPTSNIE  352



>gb|KCW58874.1| hypothetical protein EUGRSUZ_H01501 [Eucalyptus grandis]
Length=642

 Score = 68.2 bits (165),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +L L  V V++RKRKF +VLEDWE  YG HRFKY++LY ATKGF+
Sbjct  285  MLILGAVYVIRRKRKFAEVLEDWERDYGPHRFKYKDLYTATKGFR  329


 Score = 33.1 bits (74),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+++++LG G  G VYRG+LP + ++
Sbjct  326  KGFRDQELLGAGGFGQVYRGILPTSNIE  353



>gb|AAR11299.1| lectin-like receptor kinase 7;2 [Medicago truncatula]
 gb|KEH22957.1| L-type lectin-domain receptor kinase IV.2-like protein [Medicago 
truncatula]
Length=669

 Score = 66.2 bits (160),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            ++ L V+  ++R++KF ++LEDWEH YG HRFK+++LY ATKGFK+
Sbjct  298  MITLGVIYYIKRRKKFAELLEDWEHEYGPHRFKFKDLYFATKGFKE  343


 Score = 35.0 bits (79),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG+G  G VY+G++P ++L+
Sbjct  339  KGFKEKGLLGVGGFGRVYKGVMPGSKLE  366



>ref|XP_010039194.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=669

 Score = 68.2 bits (165),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            IL  A+   ++++RKF +VLEDWEH YG HRFKY++LY+ATKGF+
Sbjct  300  ILVFAMAYAIRKRRKFAEVLEDWEHEYGPHRFKYKDLYVATKGFR  344


 Score = 33.1 bits (74),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+++++LG G  G VY+GLLP ++ +
Sbjct  341  KGFRDQELLGAGGFGRVYKGLLPTSKTE  368



>gb|KCW49572.1| hypothetical protein EUGRSUZ_K03097 [Eucalyptus grandis]
Length=656

 Score = 68.2 bits (165),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            IL  A+   ++++RKF +VLEDWEH YG HRFKY++LY+ATKGF+
Sbjct  287  ILVFAMAYAIRKRRKFAEVLEDWEHEYGPHRFKYKDLYVATKGFR  331


 Score = 32.7 bits (73),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+++++LG G  G VY+GLLP ++ +
Sbjct  328  KGFRDQELLGAGGFGRVYKGLLPTSKTE  355



>ref|XP_010262582.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Nelumbo nucifera]
Length=658

 Score = 63.2 bits (152),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  19   VVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            ++ +V RKRKF +V+EDWE  YG HRFKY++LY+ATKGF+
Sbjct  291  ILFIVTRKRKFAEVVEDWELEYGPHRFKYKDLYVATKGFR  330


 Score = 37.4 bits (85),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+++ +LGIG  G VYRG+LP +++Q
Sbjct  327  KGFRDKGLLGIGGFGRVYRGVLPTSKIQ  354



>gb|KCW62715.1| hypothetical protein EUGRSUZ_G00291, partial [Eucalyptus grandis]
Length=675

 Score = 67.0 bits (162),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            IL  AV  V++R+RKF +VLEDWE  Y  HRFKY++LY+ATKGF+
Sbjct  306  ILVFAVAYVIRRRRKFAEVLEDWERDYSPHRFKYKDLYVATKGFR  350


 Score = 32.0 bits (71),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++ ++LG G  G VYRG+LP  + +
Sbjct  347  KGFRDEELLGTGGFGRVYRGVLPTMKTE  374



>ref|XP_011010880.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Populus euphratica]
Length=668

 Score = 62.8 bits (151),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            ++   ++R RKF +VLEDWEH YG HRFK+++LY ATKGF+
Sbjct  305  SISYAIRRTRKFAEVLEDWEHDYGPHRFKFKDLYTATKGFR  345


 Score = 33.9 bits (76),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++ ++LG G  G VY+G+LP +++Q
Sbjct  342  KGFRDEELLGSGGFGRVYKGVLPSSKIQ  369



>gb|KCW58878.1| hypothetical protein EUGRSUZ_H015041, partial [Eucalyptus grandis]
Length=406

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            L VV V++RKRKF +VLEDWE  YG HRFKY++LY ATKGF+  +  G
Sbjct  275  LGVVYVIRRKRKFAEVLEDWERDYGPHRFKYKDLYTATKGFRNQELLG  322



>gb|KCW74966.1| hypothetical protein EUGRSUZ_E03710 [Eucalyptus grandis]
Length=610

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            IL L+V+ V++RKRKF +VLEDWE  YG HRFKY++LY+ATKGF++ +  G
Sbjct  245  ILILSVIYVMRRKRKFAEVLEDWERDYGPHRFKYKDLYIATKGFREQELLG  295



>gb|KCW49568.1| hypothetical protein EUGRSUZ_K03093 [Eucalyptus grandis]
Length=636

 Score = 62.0 bits (149),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            IL  A+   ++++RKF +VLEDWE  Y  HRFKY +LY+ATKGF+
Sbjct  286  ILVFAMAYAIRKRRKFSEVLEDWERDYSPHRFKYTDLYVATKGFR  330


 Score = 34.3 bits (77),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+++++LG G  G VYRG+LP ++++
Sbjct  327  KGFRDQELLGAGGFGRVYRGVLPTSKIE  354



>ref|XP_010057734.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=666

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            IL L+V+ V++RKRKF +VLEDWE  YG HRFKY++LY+ATKGF++ +  G
Sbjct  301  ILILSVIYVMRRKRKFAEVLEDWERDYGPHRFKYKDLYIATKGFREQELLG  351



>gb|KCW74968.1| hypothetical protein EUGRSUZ_E03712 [Eucalyptus grandis]
Length=633

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            IL L+V+ V++RKRKF +VLEDWE  YG HRFKY++LY+ATKGF++ +  G
Sbjct  301  ILILSVIYVMRRKRKFAEVLEDWERDYGPHRFKYKDLYIATKGFREQELLG  351



>ref|XP_010037814.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
 gb|KCW49571.1| hypothetical protein EUGRSUZ_K03096 [Eucalyptus grandis]
Length=668

 Score = 62.8 bits (151),  Expect(2) = 7e-12, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            IL  A+   ++++RKF +VLEDWE  Y  HRFKY++LY+ATKGF+
Sbjct  300  ILVFAMAYAIRKRRKFAEVLEDWERDYSPHRFKYKDLYVATKGFR  344


 Score = 33.9 bits (76),  Expect(2) = 7e-12, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+++++LG G  G VYRG+LP + ++
Sbjct  341  KGFRDQELLGAGGFGRVYRGVLPTSNIE  368



>gb|KCW58869.1| hypothetical protein EUGRSUZ_H01495 [Eucalyptus grandis]
Length=602

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +L L VV V++RKRKF +VLEDWE  YG HRF+Y++LY+ATKGF+
Sbjct  245  MLILGVVYVIRRKRKFAEVLEDWERDYGPHRFRYKDLYIATKGFR  289



>ref|XP_010037813.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=668

 Score = 62.0 bits (149),  Expect(2) = 7e-12, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            IL  A+   ++++RKF +VLEDWE  Y  HRFKY +LY+ATKGF+
Sbjct  300  ILVFAMAYAIRKRRKFSEVLEDWERDYSPHRFKYTDLYVATKGFR  344


 Score = 34.3 bits (77),  Expect(2) = 7e-12, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+++++LG G  G VYRG+LP ++++
Sbjct  341  KGFRDQELLGAGGFGRVYRGVLPTSKIE  368



>gb|KCW49547.1| hypothetical protein EUGRSUZ_K03066 [Eucalyptus grandis]
Length=738

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +L L+VV V++RKRKF +VLEDWE  YG HRFK+++LY+ATKGF++ +  G
Sbjct  369  MLILSVVYVIRRKRKFAEVLEDWERDYGPHRFKFKDLYIATKGFREQELLG  419



>ref|XP_010070227.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=645

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +L L VV V++RKRKF +VLEDWE  YG HRF+Y++LY+ATKGF+
Sbjct  288  MLILGVVYVIRRKRKFAEVLEDWERDYGPHRFRYKDLYIATKGFR  332



>ref|XP_010037812.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
 gb|KCW49559.1| hypothetical protein EUGRSUZ_K03083 [Eucalyptus grandis]
Length=664

 Score = 62.4 bits (150),  Expect(2) = 8e-12, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            IL  A+   ++++RKF +VLEDWE  Y  HRFKY++LY+ATKGF+
Sbjct  300  ILVFAMAYAIRKRRKFAEVLEDWERDYSPHRFKYKDLYVATKGFR  344


 Score = 33.9 bits (76),  Expect(2) = 8e-12, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+++++LG G  G VYRG+LP + ++
Sbjct  341  KGFRDQELLGAGGFGRVYRGVLPTSNIE  368



>ref|XP_010037806.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=667

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +L L+VV V++RKRKF +VLEDWE  YG HRFK+++LY+ATKGF++ +  G
Sbjct  298  MLILSVVYVIRRKRKFAEVLEDWERDYGPHRFKFKDLYIATKGFREQELLG  348



>ref|XP_010026228.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Eucalyptus grandis]
Length=241

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            ++L L VV V++RKRKF +VLEDWE  YG HRFKY++LY ATKGF+  +  G
Sbjct  7    LMLILGVVYVIRRKRKFAEVLEDWERDYGPHRFKYKDLYTATKGFRNQELLG  58



>ref|XP_011019818.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
isoform X2 [Populus euphratica]
Length=670

 Score = 62.0 bits (149),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            ++  V++R RKF +VLEDWE  YG HRFKY++LY ATKGF+
Sbjct  307  SISYVIRRTRKFAEVLEDWELDYGPHRFKYKDLYTATKGFR  347


 Score = 33.5 bits (75),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++ ++LG G  G VY+G+LP +++Q
Sbjct  344  KGFRDEELLGSGGFGRVYKGVLPASKIQ  371



>ref|XP_011014312.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Populus euphratica]
Length=670

 Score = 62.0 bits (149),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            ++  V++R RKF +VLEDWE  YG HRFKY++LY ATKGF+
Sbjct  307  SISYVIRRTRKFAEVLEDWELDYGPHRFKYKDLYTATKGFR  347


 Score = 33.5 bits (75),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++ ++LG G  G VY+G+LP +++Q
Sbjct  344  KGFRDEELLGSGGFGRVYKGVLPASKIQ  371



>gb|KEH22956.1| L-type lectin-domain receptor kinase IV.2-like protein [Medicago 
truncatula]
Length=668

 Score = 58.5 bits (140),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  37   RKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            R++KF ++LEDWE  YG HRFK+++LY ATKGF++
Sbjct  308  RRKKFAEILEDWEQEYGPHRFKFKDLYFATKGFRE  342


 Score = 36.6 bits (83),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG+G  G VY+G+LP ++L+
Sbjct  338  KGFREKGLLGVGGFGRVYKGVLPSSKLE  365



>emb|CDP14363.1| unnamed protein product [Coffea canephora]
Length=673

 Score = 60.8 bits (146),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
             +V  V+ K+KF +VLEDWEH YG HRFKY++LY+ATK F+
Sbjct  306  GIVYQVRIKKKFAEVLEDWEHDYGPHRFKYKDLYIATKRFR  346


 Score = 33.9 bits (76),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  132  FQERKILGIGVLGIVYRGLLPETQLQ  209
            F++R++LG G  G VYRG+LP ++L+
Sbjct  345  FRDRELLGRGGFGKVYRGVLPSSKLE  370



>gb|KCW49558.1| hypothetical protein EUGRSUZ_K03082 [Eucalyptus grandis]
Length=625

 Score = 60.5 bits (145),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            IL  A+   ++++RKF +VLEDWE  +  HRFKY +LY+ATKGF+
Sbjct  286  ILVFAMAYAIRKRRKFAEVLEDWERDFSPHRFKYTDLYVATKGFR  330


 Score = 34.3 bits (77),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+++++LG G  G VYRG+LP ++++
Sbjct  327  KGFRDQELLGAGGFGRVYRGVLPTSKIE  354



>ref|XP_009144571.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.4-like 
isoform X2 [Brassica rapa]
Length=629

 Score = 59.3 bits (142),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  25   KVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            K+ +R+RKFE+ LEDWE  +G HR KY++LY ATKGFK+
Sbjct  278  KLPRRRRKFEEELEDWETRFGKHRLKYKDLYHATKGFKE  316


 Score = 35.4 bits (80),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQ  203
            +GF+E+ +LG G  G VYRG++P+T+
Sbjct  312  KGFKEKDLLGSGGFGSVYRGVMPKTK  337



>ref|XP_010028188.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
 gb|KCW54876.1| hypothetical protein EUGRSUZ_I00837 [Eucalyptus grandis]
Length=668

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +L L+VV V++RKR+F +VLE+WE  YG HRFK++ELY+ATKGF++ +  G
Sbjct  299  MLILSVVYVIRRKRRFAEVLEEWERDYGPHRFKFKELYIATKGFREQELLG  349



>ref|XP_010048167.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=668

 Score = 62.4 bits (150),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            IL  A+V  ++++RKF +VLEDWE  Y  HRFKY++LY+ATKGF+
Sbjct  299  ILVFAMVYAIRKRRKFAEVLEDWECDYSPHRFKYKDLYVATKGFR  343


 Score = 31.6 bits (70),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+++++LG G  G VY+G+LP ++ +
Sbjct  340  KGFRDQELLGAGGFGRVYKGVLPTSKTE  367



>emb|CDP14365.1| unnamed protein product [Coffea canephora]
Length=655

 Score = 59.7 bits (143),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             ++  V+ K KF +VLEDWEH YG HRFKY++LY+ATK F+  +  G
Sbjct  288  GIIYQVRIKEKFAEVLEDWEHDYGPHRFKYKDLYIATKRFRDREVLG  334


 Score = 34.7 bits (78),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  132  FQERKILGIGVLGIVYRGLLPETQLQ  209
            F++R++LG G  G VYRG+LP ++L+
Sbjct  327  FRDREVLGRGGFGKVYRGVLPSSKLE  352



>gb|KEH22940.1| L-type lectin-domain receptor kinase IV.2-like protein [Medicago 
truncatula]
Length=671

 Score = 58.5 bits (140),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            ++ L V+  ++RK  F ++LEDWEH YG HRFK+++LY ATKGF++
Sbjct  301  MITLGVIYYIKRKM-FAEILEDWEHEYGPHRFKFKDLYFATKGFRE  345


 Score = 35.8 bits (81),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG+G  G VY+G++P ++L+
Sbjct  341  KGFREKGLLGVGGFGRVYKGVIPSSKLE  368



>ref|XP_010026224.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
 gb|KCW58865.1| hypothetical protein EUGRSUZ_H01491 [Eucalyptus grandis]
Length=667

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            ++L L+VV V++RKRK  +VLEDWE  YG HRFKY +LY ATKGF+
Sbjct  297  LMLILSVVYVIRRKRKLAEVLEDWEREYGPHRFKYRDLYTATKGFR  342



>ref|XP_007026951.1| Concanavalin A-like lectin protein kinase family protein [Theobroma 
cacao]
 gb|EOY07453.1| Concanavalin A-like lectin protein kinase family protein [Theobroma 
cacao]
Length=669

 Score = 59.7 bits (143),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
             V   ++RKRKF +V+EDWE  YG HRFKY++LY+ATKGFK
Sbjct  303  GVAYFIRRKRKFAEVVEDWELEYGPHRFKYKDLYVATKGFK  343


 Score = 34.3 bits (77),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++++++G G  G VYRG+LP ++L+
Sbjct  340  KGFKDKELVGAGGFGRVYRGVLPTSKLE  367



>ref|XP_006381210.1| hypothetical protein POPTR_0006s08940g [Populus trichocarpa]
 gb|ERP59007.1| hypothetical protein POPTR_0006s08940g [Populus trichocarpa]
Length=672

 Score = 60.5 bits (145),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  31   VQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            ++R RKF +VLEDWE  YG HRFKY++LY ATKGF+
Sbjct  314  IRRTRKFAEVLEDWELDYGPHRFKYKDLYTATKGFR  349


 Score = 33.5 bits (75),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++ ++LG G  G VY+G+LP +++Q
Sbjct  346  KGFRDEELLGSGGFGRVYKGVLPTSKIQ  373



>ref|XP_010066063.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
 gb|KCW63838.1| hypothetical protein EUGRSUZ_G01510 [Eucalyptus grandis]
Length=669

 Score = 62.0 bits (149),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            L  A+V  ++++RKF +VLEDWE  Y  HRFKY++LY+ATKGF+
Sbjct  301  LVFAMVYAIRKRRKFTEVLEDWERDYSPHRFKYKDLYVATKGFR  344


 Score = 31.6 bits (70),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+++++LG G  G VY+G+LP ++ +
Sbjct  341  KGFRDQELLGAGGFGRVYKGVLPTSKTE  368



>gb|KCW49550.1| hypothetical protein EUGRSUZ_K03069 [Eucalyptus grandis]
Length=654

 Score = 59.3 bits (142),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            IL  AV   +++ RKF +VLEDWE  Y  HRFKY +LY+ATKGF
Sbjct  283  ILVFAVAYAIRKHRKFAEVLEDWERDYSLHRFKYIDLYVATKGF  326


 Score = 34.7 bits (78),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF + ++LG+G  G VYRG+LP T+ +
Sbjct  324  KGFGDEELLGVGGFGRVYRGVLPTTKTE  351



>ref|NP_190949.1| L-type lectin-domain containing receptor kinase IV.2 [Arabidopsis 
thaliana]
 sp|Q9M345.1|LRK42_ARATH RecName: Full=L-type lectin-domain containing receptor kinase 
IV.2; Short=Arabidopsis thaliana lectin-receptor kinase a4; 
Short=AthlecRK-a4; Short=LecRK-IV.2; AltName: Full=Protein 
SMALL, GLUED-TOGETHER, AND COLLAPSED POLLEN; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB88343.1| serine/threonine-specific kinase like protein [Arabidopsis thaliana]
 gb|AEE79146.1| L-type lectin-domain containing receptor kinase IV.2 [Arabidopsis 
thaliana]
Length=677

 Score = 55.8 bits (133),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +V+RK+K+E+ L+DWE  +G +RF+++ELY ATKGFK+
Sbjct  312  IVRRKKKYEEELDDWETEFGKNRFRFKELYHATKGFKE  349


 Score = 37.7 bits (86),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VYRG+LP T+L+
Sbjct  345  KGFKEKDLLGSGGFGRVYRGILPTTKLE  372



>gb|AAO42880.1| At3g53810 [Arabidopsis thaliana]
 dbj|BAE99502.1| serine/threonine-specific kinase like protein [Arabidopsis thaliana]
Length=677

 Score = 55.5 bits (132),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +V+RK+K+E+ L+DWE  +G +RF+++ELY ATKGFK+
Sbjct  312  IVRRKKKYEEELDDWETEFGKNRFRFKELYHATKGFKE  349


 Score = 37.7 bits (86),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VYRG+LP T+L+
Sbjct  345  KGFKEKDLLGSGGFGRVYRGILPTTKLE  372



>ref|XP_006403652.1| hypothetical protein EUTSA_v10010174mg [Eutrema salsugineum]
 gb|ESQ45105.1| hypothetical protein EUTSA_v10010174mg [Eutrema salsugineum]
Length=673

 Score = 55.5 bits (132),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +V+R++KFE+ L+DWE  +G +RF+++ELY ATKGFK+
Sbjct  308  IVRRRKKFEEELDDWETEFGKNRFRFKELYHATKGFKE  345


 Score = 37.7 bits (86),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VYRG+LP T+L+
Sbjct  341  KGFKEKDLLGSGGFGRVYRGILPTTKLE  368



>ref|XP_002877942.1| hypothetical protein ARALYDRAFT_485775 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54201.1| hypothetical protein ARALYDRAFT_485775 [Arabidopsis lyrata subsp. 
lyrata]
Length=678

 Score = 55.1 bits (131),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +V+RK+K+E+ L+DWE  +G +RF+++ELY ATKGFK+
Sbjct  313  IVRRKKKYEEELDDWETEFGKNRFRFKELYHATKGFKE  350


 Score = 38.1 bits (87),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VYRG+LP T+L+
Sbjct  346  KGFKEKDLLGSGGFGRVYRGILPSTKLE  373



>gb|KCW80347.1| hypothetical protein EUGRSUZ_C01712 [Eucalyptus grandis]
Length=574

 Score = 62.0 bits (149),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            IL  A+V  ++++RKF +VLEDWE  Y  HRFKY++LY+ATKGF+
Sbjct  205  ILVFAMVYAIRKRRKFAEVLEDWECDYSPHRFKYKDLYVATKGFR  249


 Score = 31.2 bits (69),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+++++LG G  G VY+G+LP ++ +
Sbjct  246  KGFRDQELLGAGGFGRVYKGVLPTSKTE  273



>ref|XP_006293079.1| hypothetical protein CARUB_v10019366mg [Capsella rubella]
 gb|EOA25977.1| hypothetical protein CARUB_v10019366mg [Capsella rubella]
Length=723

 Score = 55.8 bits (133),  Expect(2) = 8e-11, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            VI+ LA   +V+RK+K+E+ L+DWE  +G +RF+++ELY ATKGFK+
Sbjct  350  VIIFLAFY-IVRRKKKYEEELDDWETEFGKNRFRFKELYHATKGFKE  395


 Score = 37.0 bits (84),  Expect(2) = 8e-11, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VYRG+LP T+++
Sbjct  391  KGFKEKDLLGSGGFGRVYRGILPTTKIE  418



>ref|XP_010026227.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
 gb|KCW58875.1| hypothetical protein EUGRSUZ_H01502 [Eucalyptus grandis]
Length=655

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +L L  V V++RKRK  +VLEDWE  YG HRFKY++LY+ATKGF+
Sbjct  298  VLILGAVYVIRRKRKLAEVLEDWEREYGPHRFKYKDLYIATKGFQ  342



>ref|XP_010068014.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
 gb|KCW62694.1| hypothetical protein EUGRSUZ_G00255 [Eucalyptus grandis]
Length=663

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            IL  +VV V++RKRKF +VLEDWE  YG HRFKY++L++ATKGF++ +  G
Sbjct  298  ILISSVVYVMRRKRKFAEVLEDWERDYGPHRFKYKDLHIATKGFREQELLG  348



>ref|XP_010040833.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
 gb|KCW44881.1| hypothetical protein EUGRSUZ_L01538 [Eucalyptus grandis]
Length=667

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +L L+VV V++RKR+F +VLE+WE  YG HRFK+++LY+ATKGF++ +  G
Sbjct  298  MLILSVVYVIRRKRRFAEVLEEWERDYGPHRFKFKDLYIATKGFREQELLG  348



>ref|XP_010515881.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2 
[Camelina sativa]
Length=680

 Score = 54.7 bits (130),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +V+R++K+E+ L+DWE  +G +RF+++ELY ATKGFK+
Sbjct  314  IVRRRKKYEEELDDWETEFGKNRFRFKELYHATKGFKE  351


 Score = 37.7 bits (86),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VYRG+LP T+L+
Sbjct  347  KGFKEKDLLGSGGFGRVYRGILPTTKLE  374



>ref|XP_010070228.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
 gb|KCW58872.1| hypothetical protein EUGRSUZ_H01498 [Eucalyptus grandis]
Length=666

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            +L L  + V++RKRK  +VLEDWE  YG HRFKY++LY+ATKGF+  +  G+   G
Sbjct  297  VLILGAIYVIRRKRKLAEVLEDWERDYGPHRFKYKDLYIATKGFQDQELLGVGGFG  352



>ref|XP_006295761.1| hypothetical protein CARUB_v10024881mg [Capsella rubella]
 gb|EOA28659.1| hypothetical protein CARUB_v10024881mg [Capsella rubella]
Length=675

 Score = 54.3 bits (129),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  19   VVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            V   V+RKRKF + L+DWE  +G +RF++++LY ATKGFK+
Sbjct  309  VCYFVRRKRKFAEELDDWEKEFGKNRFRFKDLYYATKGFKE  349


 Score = 38.1 bits (87),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VY+GL+P+T+L+
Sbjct  345  KGFKEKDLLGSGGFGSVYKGLMPDTKLE  372



>ref|XP_010040815.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=625

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +L L+VV V++RKR+F +VLE+WE  YG HRFK+++LY+ATKGF++ +  G
Sbjct  264  MLILSVVYVIRRKRRFAEVLEEWERDYGPHRFKFKDLYIATKGFREQELLG  314



>ref|XP_010427040.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Camelina sativa]
Length=677

 Score = 54.3 bits (129),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +V+R++K+E+ L+DWE  +G +RF+++ELY ATKGFK+
Sbjct  311  IVRRRKKYEEELDDWETEFGKNRFRFKELYHATKGFKE  348


 Score = 37.7 bits (86),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VYRG+LP T+L+
Sbjct  344  KGFKEKDLLGSGGFGRVYRGILPTTKLE  371



>ref|XP_006381201.1| hypothetical protein POPTR_0006s08870g, partial [Populus trichocarpa]
 gb|ERP58998.1| hypothetical protein POPTR_0006s08870g, partial [Populus trichocarpa]
Length=656

 Score = 58.9 bits (141),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  31   VQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            ++R RKF +VLEDWE  YG HRFK+++LY ATKGF+
Sbjct  298  IRRTRKFAEVLEDWELDYGPHRFKFKDLYTATKGFR  333


 Score = 33.5 bits (75),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++ ++LG G  G VY+G+LP +++Q
Sbjct  330  KGFRDEELLGSGGFGRVYKGVLPTSKIQ  357



>ref|XP_006387090.1| hypothetical protein POPTR_1896s002101g, partial [Populus trichocarpa]
 gb|ERP46004.1| hypothetical protein POPTR_1896s002101g, partial [Populus trichocarpa]
Length=417

 Score = 59.3 bits (142),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 6/50 (12%)
 Frame = +1

Query  7    LGLAVVKV------VQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            L LA+V V      ++R RKF +VLEDWE  YG HRFK+++LY ATKGF+
Sbjct  221  LSLALVAVSSIFYAIRRTRKFAEVLEDWELDYGPHRFKFKDLYTATKGFR  270


 Score = 33.1 bits (74),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++ ++LG G  G VY+G+LP +++Q
Sbjct  267  KGFRDEELLGSGGFGRVYKGVLPTSRIQ  294



>ref|XP_010065281.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=663

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            IL  +V+ V++RK+KF +VLEDWE  YG HRFKY++LY+ATKGF++ +  G
Sbjct  298  ILISSVIYVMRRKQKFAEVLEDWEREYGPHRFKYKDLYIATKGFREQELLG  348



>ref|XP_006381203.1| hypothetical protein POPTR_0006s08890g [Populus trichocarpa]
 gb|ERP59000.1| hypothetical protein POPTR_0006s08890g [Populus trichocarpa]
Length=546

 Score = 58.5 bits (140),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            ++   ++R RKF +VLEDWE  YG HRFK+++LY ATKGF+
Sbjct  183  SIFYAIRRTRKFAEVLEDWELDYGPHRFKFKDLYTATKGFR  223


 Score = 33.5 bits (75),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++ ++LG G  G VY+G+LP +++Q
Sbjct  220  KGFRDEELLGSGGFGRVYKGVLPTSRIQ  247



>gb|KCW62702.1| hypothetical protein EUGRSUZ_G00265 [Eucalyptus grandis]
Length=589

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            IL  +V+ V++RK+KF +VLEDWE  YG HRFKY++LY+ATKGF++ +  G
Sbjct  298  ILISSVIYVMRRKQKFAEVLEDWEREYGPHRFKYKDLYIATKGFREQELLG  348



>ref|XP_010070231.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=667

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            +L L  V V++RKRK  +VLEDWE  YG HRFKY++LY+ATKGF   +  G+   G
Sbjct  298  VLILGAVYVIRRKRKLAEVLEDWERDYGPHRFKYKDLYIATKGFHDQELLGVGRFG  353



>ref|XP_002309078.1| hypothetical protein POPTR_0006s08970g [Populus trichocarpa]
 gb|EEE92601.1| hypothetical protein POPTR_0006s08970g [Populus trichocarpa]
Length=534

 Score = 58.5 bits (140),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  31   VQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            ++R RKF +VLEDWE  YG HRFK+++LY ATKGF+
Sbjct  171  IRRTRKFAEVLEDWELDYGPHRFKFKDLYTATKGFR  206


 Score = 33.5 bits (75),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++ ++LG G  G VY+G+LP +++Q
Sbjct  203  KGFRDEELLGSGGFGRVYKGVLPTSKIQ  230



>ref|XP_009116078.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2 
[Brassica rapa]
Length=671

 Score = 55.1 bits (131),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            V +R++KFE+ L+DWE  +G +RF+++ELY ATKGFK+
Sbjct  306  VARRRKKFEEELDDWETEFGKNRFRFKELYHATKGFKE  343


 Score = 37.0 bits (84),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VYRG+LP T+++
Sbjct  339  KGFKEKDLLGSGGFGRVYRGILPTTKIE  366



>emb|CDY65835.1| BnaA09g54750D [Brassica napus]
Length=659

 Score = 55.1 bits (131),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            V +R++KFE+ L+DWE  +G +RF+++ELY ATKGFK+
Sbjct  294  VARRRKKFEEELDDWETEFGKNRFRFKELYHATKGFKE  331


 Score = 37.0 bits (84),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VYRG+LP T+++
Sbjct  327  KGFKEKDLLGSGGFGRVYRGILPTTKIE  354



>gb|KEH41557.1| L-type lectin-domain receptor kinase IV.2-like protein [Medicago 
truncatula]
Length=645

 Score = 57.0 bits (136),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            ++ L V+  ++RK KF ++LEDWEH YG HRFK+++LY ATKGF
Sbjct  301  MITLGVMYYIKRK-KFSEILEDWEHEYGPHRFKFKDLYFATKGF  343


 Score = 34.7 bits (78),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF E+ +LG+G  G VY+G++P ++L+
Sbjct  341  KGFGEKGLLGVGGFGRVYKGVIPSSKLE  368



>ref|XP_002881547.1| hypothetical protein ARALYDRAFT_482773 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57806.1| hypothetical protein ARALYDRAFT_482773 [Arabidopsis lyrata subsp. 
lyrata]
Length=670

 Score = 56.2 bits (134),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  19   VVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            V  +V+R+RKF + LEDWE  +G +RF++++LY ATKGFK+
Sbjct  304  VCYIVRRRRKFAEELEDWEKEFGKNRFRFKDLYYATKGFKE  344


 Score = 35.4 bits (80),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VY+G++P T+L+
Sbjct  340  KGFKEKGLLGTGGFGSVYKGVMPGTKLE  367



>ref|XP_010230080.1| PREDICTED: uncharacterized protein LOC100822922 [Brachypodium 
distachyon]
Length=1363

 Score = 57.8 bits (138),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +G+ VV +V+R  ++++V EDWE  YG HRF Y++LY ATKGFK
Sbjct  316  VGIGVVLMVRRHFRYKEVREDWEVEYGPHRFSYKDLYRATKGFK  359


 Score = 33.9 bits (76),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+++ ++G+G  G VY+G+LP ++L+
Sbjct  356  KGFKDKYLIGVGGFGSVYKGVLPGSKLE  383


 Score = 50.1 bits (118),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  4     ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
             ++G  ++ +V+R+ ++ ++ EDWE  +G HRF Y++L+ AT+GF
Sbjct  999   LVGTTIILLVRRRMRYAELHEDWEDEFGPHRFSYKDLFRATEGF  1042


 Score = 32.0 bits (71),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +3

Query  126   QGFQERKILGIGVLGIVYRGLLPETQLQ  209
             +GF  + +LG G  G VY+G+LP ++L+
Sbjct  1040  EGFHNKNLLGHGGFGKVYKGVLPVSKLE  1067



>ref|XP_004137932.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Cucumis sativus]
 gb|KGN58851.1| hypothetical protein Csa_3G734050 [Cucumis sativus]
Length=706

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            L++V V++RKRKF ++LEDWE  YG HRFKY++LY AT GFK+ +  G
Sbjct  332  LSIVHVIRRKRKFAELLEDWELDYGPHRFKYKDLYTATNGFKEKEILG  379



>ref|XP_004156651.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Cucumis sativus]
Length=703

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            L++V V++RKRKF ++LEDWE  YG HRFKY++LY AT GFK+ +  G
Sbjct  332  LSIVHVIRRKRKFAELLEDWELDYGPHRFKYKDLYTATNGFKEKEILG  379



>ref|XP_010028192.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
 gb|KCW54885.1| hypothetical protein EUGRSUZ_I00850 [Eucalyptus grandis]
Length=668

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +L L+VV +++RKR+F +VLE+WE  YG HRFK+++LY+ATKGF++ +  G
Sbjct  299  MLILSVVYMIRRKRRFAEVLEEWERDYGPHRFKFKDLYIATKGFREQELLG  349



>ref|XP_006432458.1| hypothetical protein CICLE_v10003226mg [Citrus clementina]
 gb|ESR45698.1| hypothetical protein CICLE_v10003226mg [Citrus clementina]
Length=689

 Score = 56.6 bits (135),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +A + V++R R  +D+LEDWE  YG+ RF+Y ELY ATKGF++
Sbjct  317  IAAILVLRRIRNGDDILEDWEVEYGARRFRYSELYSATKGFRE  359


 Score = 34.7 bits (78),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ ++G G  G VYRG++P T L+
Sbjct  355  KGFREKNLVGSGGFGKVYRGVIPSTGLE  382



>ref|XP_010517048.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Camelina sativa]
Length=675

 Score = 55.8 bits (133),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  19   VVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            V  +V+R+RKF + LEDWE  +G +RF++++LY ATKGFK+
Sbjct  309  VFYIVRRRRKFAEELEDWEKEFGKNRFRFKDLYYATKGFKE  349


 Score = 35.0 bits (79),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VY+G++P T+L+
Sbjct  345  KGFKEKDLLGSGGFGSVYKGVMPGTKLE  372



>ref|XP_010504152.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
isoform X1 [Camelina sativa]
 ref|XP_010504153.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
isoform X2 [Camelina sativa]
Length=676

 Score = 52.8 bits (125),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +V+R++K+E+ L+DWE  +G +RF++++LY ATKGFK+
Sbjct  310  IVRRRKKYEEELDDWETEFGKNRFRFKDLYHATKGFKE  347


 Score = 37.7 bits (86),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VYRG+LP T+L+
Sbjct  343  KGFKEKDLLGSGGFGRVYRGILPTTKLE  370



>ref|XP_010033699.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=664

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            IL  +VV V++RKRKF +VLEDWE  YG HRFKY++L +ATKGF++ +  G
Sbjct  299  ILISSVVYVMRRKRKFAEVLEDWERDYGPHRFKYKDLSIATKGFREQELLG  349



>ref|XP_010504154.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
isoform X3 [Camelina sativa]
Length=674

 Score = 52.8 bits (125),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +V+R++K+E+ L+DWE  +G +RF++++LY ATKGFK+
Sbjct  310  IVRRRKKYEEELDDWETEFGKNRFRFKDLYHATKGFKE  347


 Score = 37.7 bits (86),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VYRG+LP T+L+
Sbjct  343  KGFKEKDLLGSGGFGRVYRGILPTTKLE  370



>ref|XP_010504155.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
isoform X4 [Camelina sativa]
Length=675

 Score = 52.8 bits (125),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +V+R++K+E+ L+DWE  +G +RF++++LY ATKGFK+
Sbjct  310  IVRRRKKYEEELDDWETEFGKNRFRFKDLYHATKGFKE  347


 Score = 37.7 bits (86),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VYRG+LP T+L+
Sbjct  343  KGFKEKDLLGSGGFGRVYRGILPTTKLE  370



>gb|KCW53420.1| hypothetical protein EUGRSUZ_J02660 [Eucalyptus grandis]
Length=635

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            IL  +VV V++RKRKF +VLEDWE  YG HRFKY++L +ATKGF++ +  G
Sbjct  270  ILISSVVYVMRRKRKFAEVLEDWERDYGPHRFKYKDLSIATKGFREQELLG  320



>gb|KCW49552.1| hypothetical protein EUGRSUZ_K03072 [Eucalyptus grandis]
Length=669

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            IL  A+   ++++RKF +VLEDWEH Y  HRFKY+++Y+ATKGF+
Sbjct  300  ILVFAMAYAIRKRRKFAEVLEDWEHDYSPHRFKYKDIYVATKGFR  344



>gb|KDP35671.1| hypothetical protein JCGZ_09109 [Jatropha curcas]
Length=669

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            L VV  ++RK+KF +VLEDWE  YG HRFKY++LY++TKGF++ +  G
Sbjct  302  LGVVYFIRRKKKFAEVLEDWELDYGPHRFKYKDLYISTKGFREKELLG  349



>ref|XP_010262573.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Nelumbo nucifera]
Length=677

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  19   VVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            V+ +V+RKRKF ++LEDWE  YG HRFKY++LY+AT GF++ +  G+   G
Sbjct  314  VLFIVRRKRKFAELLEDWELNYGPHRFKYKDLYIATNGFRENELLGIGGFG  364



>ref|XP_010262575.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Nelumbo nucifera]
Length=688

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  19   VVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            V+ +V+RK KF +V+EDWE  YG HRFKY +LY+ATKGFK+ +  G+   G
Sbjct  320  VLSIVRRKIKFAEVVEDWELEYGPHRFKYRDLYIATKGFKEKELLGIGGFG  370



>gb|KFK36661.1| hypothetical protein AALP_AA4G153600 [Arabis alpina]
Length=672

 Score = 56.2 bits (134),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +V+R+RKF + L+DWE  +G +RF+Y++LY ATKGFK+
Sbjct  309  IVRRRRKFAEELDDWEKEFGKNRFRYKDLYYATKGFKE  346


 Score = 33.9 bits (76),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VY+G++P ++L+
Sbjct  342  KGFKEKDLLGSGGFGSVYKGVMPGSKLE  369



>ref|XP_006494080.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Citrus sinensis]
Length=689

 Score = 55.5 bits (132),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +A + V++R R  +D+LEDWE  YG+ RF+Y ELY ATKGF++
Sbjct  317  IAAILVLRRIRNGDDILEDWEVEYGACRFRYSELYSATKGFRE  359


 Score = 34.7 bits (78),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ ++G G  G VYRG++P T L+
Sbjct  355  KGFREKNLVGSGGFGKVYRGVIPSTGLE  382



>gb|KDO58876.1| hypothetical protein CISIN_1g040242mg, partial [Citrus sinensis]
Length=662

 Score = 55.5 bits (132),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +A + V++R R  +D+LEDWE  YG+ RF+Y ELY ATKGF++
Sbjct  317  IAAILVLRRIRNGDDILEDWEVEYGACRFRYSELYSATKGFRE  359


 Score = 34.7 bits (78),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ ++G G  G VYRG++P T L+
Sbjct  355  KGFREKNLVGSGGFGKVYRGVIPSTGLE  382



>gb|KCW49573.1| hypothetical protein EUGRSUZ_K03098 [Eucalyptus grandis]
Length=581

 Score = 63.2 bits (152),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +L L+VV +++RK+KF +VLEDWEH YG + FKY++LY+A KGF+
Sbjct  265  MLILSVVYLIRRKKKFAEVLEDWEHDYGPYMFKYKDLYIAIKGFR  309


 Score = 26.9 bits (58),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 19/28 (68%), Gaps = 3/28 (11%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF   ++LG G  G +YRG+LP ++ +
Sbjct  306  KGF---RVLGAGGFGRIYRGVLPTSKTE  330



>gb|KCW47898.1| hypothetical protein EUGRSUZ_K01640, partial [Eucalyptus grandis]
Length=614

 Score = 55.8 bits (133),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +V RKR+  +VLEDWE  YG H+F Y+EL+ ATKGFK
Sbjct  264  LVSRKRRSREVLEDWEVQYGPHKFTYKELFAATKGFK  300


 Score = 33.9 bits (76),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++R++LG G  G VYRGLL  + +Q
Sbjct  297  KGFKDRELLGKGGFGRVYRGLLLASNMQ  324



>ref|XP_010036353.1| PREDICTED: L-type lectin-domain containing receptor kinase V.9-like 
[Eucalyptus grandis]
Length=632

 Score = 55.8 bits (133),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +V RKR+  +VLEDWE  YG H+F Y+EL+ ATKGFK
Sbjct  277  LVSRKRRSREVLEDWEVQYGPHKFTYKELFAATKGFK  313


 Score = 33.9 bits (76),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++R++LG G  G VYRGLL  + +Q
Sbjct  310  KGFKDRELLGKGGFGRVYRGLLLASNMQ  337



>ref|XP_008442520.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing 
receptor kinase IV.1-like [Cucumis melo]
Length=707

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 38/52 (73%), Gaps = 2/52 (4%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            VILG   V V++RKRKF ++LEDWE  YG HRFKY++LY AT GFK  +  G
Sbjct  331  VILGF--VYVIRRKRKFAELLEDWELDYGPHRFKYKDLYTATNGFKXKEILG  380



>gb|AAP47579.1| receptor kinase Lecrk [Gossypium hirsutum]
Length=641

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +V+RKRKF DV+EDWE  YG HRFK+++LY+ATKGFK  +  G
Sbjct  309  LVRRKRKFADVVEDWELEYGPHRFKFKDLYIATKGFKDKELLG  351



>ref|XP_006410963.1| hypothetical protein EUTSA_v10016355mg [Eutrema salsugineum]
 gb|ESQ52416.1| hypothetical protein EUTSA_v10016355mg [Eutrema salsugineum]
Length=674

 Score = 54.3 bits (129),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +V+R+RKF + L+DWE  +G +RF++++LY ATKGFK+
Sbjct  311  IVRRRRKFAEELDDWEKEFGKNRFRFKDLYYATKGFKE  348


 Score = 35.0 bits (79),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VY+G++P T+L+
Sbjct  344  KGFKEKDLLGSGGFGSVYKGVMPGTKLE  371



>gb|KCW62712.1| hypothetical protein EUGRSUZ_G00286 [Eucalyptus grandis]
Length=548

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             +VV V++RKR+F +VLE+WE  YG HRFK+++LY+ATKGF++ +  G
Sbjct  182  FSVVYVIRRKRRFAEVLEEWERDYGPHRFKFKDLYIATKGFREQELLG  229



>ref|XP_010037807.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
 gb|KCW49554.1| hypothetical protein EUGRSUZ_K03076 [Eucalyptus grandis]
Length=669

 Score = 56.6 bits (135),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
             A+   ++++RKF +VLEDWE     HRFKY++LY+ATKGF+
Sbjct  303  FAMAYAIRKRRKFAEVLEDWERDNSPHRFKYKDLYVATKGFR  344


 Score = 33.1 bits (74),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+++++LG G  G VYRG+LP ++ +
Sbjct  341  KGFRDQELLGAGGFGRVYRGVLPTSRAE  368



>ref|XP_010936217.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Elaeis guineensis]
Length=656

 Score = 58.2 bits (139),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            L +  +V RK+KF ++LEDWE  YG  RF Y++LY AT GFK
Sbjct  298  LVITHLVMRKKKFAEILEDWEQEYGPQRFTYKDLYRATNGFK  339


 Score = 31.2 bits (69),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  129  GFQERKILGIGVLGIVYRGLLPETQLQ  209
            GF++  +LG G  G VYRG+LP ++ +
Sbjct  337  GFKDEGLLGAGGFGRVYRGVLPTSKAE  363



>gb|KCW44894.1| hypothetical protein EUGRSUZ_L015252, partial [Eucalyptus grandis]
Length=488

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +L L+VV V++RKR+F +VLE+WE  YG HRFK+++LY+ATKGF++ +  G
Sbjct  127  MLILSVVYVIRRKRRFAEVLEEWERDYGPHRFKFKDLYIATKGFREQELLG  177



>ref|XP_006480860.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Citrus sinensis]
Length=683

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             VV V++RKRKF + LEDWE  YG HRF+Y++LY+ATKGF++ +  G
Sbjct  321  GVVYVIRRKRKFAEELEDWELDYGPHRFRYKDLYIATKGFREKELLG  367



>ref|XP_006429139.1| hypothetical protein CICLE_v10011218mg [Citrus clementina]
 gb|ESR42379.1| hypothetical protein CICLE_v10011218mg [Citrus clementina]
Length=683

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             VV V++RKRKF + LEDWE  YG HRF+Y++LY+ATKGF++ +  G
Sbjct  321  GVVYVIRRKRKFAEELEDWELDYGPHRFRYKDLYIATKGFREKELLG  367



>ref|XP_009409023.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Musa acuminata subsp. malaccensis]
Length=653

 Score = 58.9 bits (141),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  31   VQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            ++R++KF +VLEDWEH +G HRF Y++LY ATKGF
Sbjct  300  LRRRKKFAEVLEDWEHEFGPHRFHYKDLYRATKGF  334


 Score = 30.0 bits (66),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF +  +LG G  G VYRG+L +++++
Sbjct  332  KGFDDENLLGAGGFGRVYRGVLSKSKIE  359



>ref|NP_001058830.1| Os07g0131100 [Oryza sativa Japonica Group]
 dbj|BAC24930.1| putative receptor-type protein kinase LRK1 [Oryza sativa Japonica 
Group]
 dbj|BAD31926.1| putative receptor-type protein kinase LRK1 [Oryza sativa Japonica 
Group]
 dbj|BAF20744.1| Os07g0131100 [Oryza sativa Japonica Group]
 gb|EAZ38587.1| hypothetical protein OsJ_22976 [Oryza sativa Japonica Group]
Length=676

 Score = 56.6 bits (135),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +G+A+V +V+R  ++++V EDWE  YG HRF Y++L+ ATKGFK
Sbjct  307  IGVAIVLLVRRHLRYKEVREDWEVEYGPHRFAYKDLFDATKGFK  350


 Score = 32.3 bits (72),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+ + ++G G  G VY+G+LP ++L+
Sbjct  347  KGFKNKNLVGTGGFGRVYKGVLPNSRLE  374



>ref|XP_002465527.1| hypothetical protein SORBIDRAFT_01g040590 [Sorghum bicolor]
 gb|EER92525.1| hypothetical protein SORBIDRAFT_01g040590 [Sorghum bicolor]
Length=651

 Score = 56.6 bits (135),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            V L  A+V V +R+ KF ++ EDWE  +GSHRF Y++L+ AT GFK
Sbjct  282  VALATAIVVVAKRRAKFAELREDWEAGFGSHRFAYKDLFYATGGFK  327


 Score = 32.3 bits (72),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  129  GFQERKILGIGVLGIVYRGLLPETQLQ  209
            GF+++ +LG G  G VY G+LP++++Q
Sbjct  325  GFKDKNLLGRGGFGRVYMGVLPKSKVQ  351



>gb|EEC81465.1| hypothetical protein OsI_24777 [Oryza sativa Indica Group]
Length=637

 Score = 56.6 bits (135),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +G+A+V +V+R  ++++V EDWE  YG HRF Y++L+ ATKGFK
Sbjct  268  IGVAIVLLVRRHLRYKEVREDWEVEYGPHRFAYKDLFDATKGFK  311


 Score = 32.3 bits (72),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+ + ++G G  G VY+G+LP ++L+
Sbjct  308  KGFKNKNLVGTGGFGRVYKGVLPNSRLE  335



>ref|XP_010456033.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.4-like 
[Camelina sativa]
 ref|XP_010456034.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.4-like 
[Camelina sativa]
 ref|XP_010456035.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.4-like 
[Camelina sativa]
 ref|XP_010456037.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.4-like 
[Camelina sativa]
Length=725

 Score = 54.3 bits (129),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +V+R+RKF + LEDWE  +G +R +++ELY ATKGFK
Sbjct  370  IVRRRRKFAEELEDWETEFGKNRLRFKELYYATKGFK  406


 Score = 34.7 bits (78),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQ  203
            +GF+++ +LG G  G VYRG LP+T+
Sbjct  403  KGFKDKNLLGSGGFGRVYRGFLPKTK  428



>ref|XP_009133202.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1 
[Brassica rapa]
Length=676

 Score = 52.8 bits (125),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +V+R+RKF + ++DWE  +G +RF++++LY ATKGFK+
Sbjct  314  LVRRRRKFAEEMDDWEKEFGKNRFRFKDLYYATKGFKE  351


 Score = 35.8 bits (81),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+ +LG G  G VY+G++P T+L+
Sbjct  347  KGFKEKDLLGTGGFGSVYKGVMPGTKLE  374



>ref|XP_010424659.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.4-like 
[Camelina sativa]
Length=596

 Score = 54.3 bits (129),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +V+RKRKF + LEDWE  +G +R +++ELY ATKGFK
Sbjct  241  IVRRKRKFAEELEDWEIEFGKNRLRFKELYYATKGFK  277


 Score = 34.7 bits (78),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQ  203
            +GF+++ +LG G  G VYRG LP+T+
Sbjct  274  KGFKDKNLLGSGGFGRVYRGFLPKTK  299



>ref|XP_006363073.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Solanum tuberosum]
Length=666

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    VILGLAV-VKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            V++  +V +  V RKRKF ++LEDWE  YG HRFKY++LY+ATKGF   K  G
Sbjct  294  VVIAFSVLIYYVGRKRKFAELLEDWELEYGPHRFKYKDLYIATKGFANKKLLG  346



>ref|XP_010039190.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=618

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            L  A+   ++++RKF +VLEDWEH Y  HRFKY+++Y+ATKGF+
Sbjct  250  LVFAMAYAIRKRRKFAEVLEDWEHDYSPHRFKYKDIYVATKGFR  293



>ref|XP_009350195.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Pyrus x bretschneideri]
Length=668

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             ++ +++R+RKF ++LEDWE  YG  RFKY+ELY+ATKGFK+ +  G
Sbjct  301  GLIYIIRRRRKFAELLEDWELEYGPQRFKYKELYIATKGFKENEILG  347



>ref|XP_009347933.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Pyrus x bretschneideri]
Length=668

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             ++ +++R+RKF ++LEDWE  YG  RFKY+ELY+ATKGFK+ +  G
Sbjct  301  GLIYIIRRRRKFAELLEDWELEYGPQRFKYKELYIATKGFKENEILG  347



>ref|XP_010033698.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=663

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            IL  +VV V++RKRKF +VLEDWE  YG HR KY++LY+ATKGF++
Sbjct  298  ILISSVVYVMRRKRKFAEVLEDWERDYGPHRLKYKDLYIATKGFRE  343



>ref|XP_010041231.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
 gb|KCW44518.1| hypothetical protein EUGRSUZ_L01973 [Eucalyptus grandis]
Length=655

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +L L VV +++RKRK  +VLEDWE  YG HRFKY++LY  TKGF+  +  G
Sbjct  298  VLILGVVYMIRRKRKLAEVLEDWERDYGPHRFKYKDLYNWTKGFRDQQLLG  348



>gb|KCW53417.1| hypothetical protein EUGRSUZ_J02657 [Eucalyptus grandis]
Length=688

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            IL  +VV V++RKRKF +VLEDWE  YG HR KY++LY+ATKGF++
Sbjct  323  ILISSVVYVMRRKRKFAEVLEDWERDYGPHRLKYKDLYIATKGFRE  368



>ref|XP_009350447.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Pyrus x bretschneideri]
Length=668

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             ++ +++R+RKF ++LEDWE  YG  RFKY+ELY+ATKGFK+ +  G
Sbjct  301  GLIYIIRRRRKFAELLEDWELEYGPQRFKYKELYIATKGFKENEILG  347



>gb|EAZ02656.1| hypothetical protein OsI_24767 [Oryza sativa Indica Group]
Length=681

 Score = 53.9 bits (128),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            +++G A+V VV+R+ ++ ++ EDWE  +G HRF Y+EL+ AT GF
Sbjct  314  LVVGGAIVMVVRRRSRYAELREDWEVEFGPHRFSYKELFRATDGF  358


 Score = 34.3 bits (77),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  129  GFQERKILGIGVLGIVYRGLLPETQLQ  209
            GF ++ +LG G  G VYRG+LP+++L+
Sbjct  357  GFADKHLLGSGGFGKVYRGVLPKSKLE  383



>ref|NP_001058820.1| Os07g0130100 [Oryza sativa Japonica Group]
 dbj|BAC57687.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAC84734.1| putative receptor kinase Lecrk [Oryza sativa Japonica Group]
 dbj|BAF20734.1| Os07g0130100 [Oryza sativa Japonica Group]
 gb|EAZ38578.1| hypothetical protein OsJ_22966 [Oryza sativa Japonica Group]
 dbj|BAG91714.1| unnamed protein product [Oryza sativa Japonica Group]
Length=681

 Score = 53.9 bits (128),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            +++G A+V VV+R+ ++ ++ EDWE  +G HRF Y+EL+ AT GF
Sbjct  314  LVVGGAIVMVVRRRSRYAELREDWEVEFGPHRFSYKELFRATDGF  358


 Score = 34.3 bits (77),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  129  GFQERKILGIGVLGIVYRGLLPETQLQ  209
            GF ++ +LG G  G VYRG+LP+++L+
Sbjct  357  GFADKHLLGSGGFGKVYRGVLPKSKLE  383



>ref|XP_007207541.1| hypothetical protein PRUPE_ppa016194mg, partial [Prunus persica]
 gb|EMJ08740.1| hypothetical protein PRUPE_ppa016194mg, partial [Prunus persica]
Length=627

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             V+  ++RKRKF ++LEDWE  YG  RFKY+ELY+ATKGF++ +  G
Sbjct  265  GVIYAIRRKRKFAELLEDWELEYGPQRFKYKELYIATKGFREKELLG  311



>gb|KCW44394.1| hypothetical protein EUGRSUZ_L02124 [Eucalyptus grandis]
Length=490

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGL  159
            ++ L  + V++RKRK  +VLEDWE  YG HRFKY++LY+ATKGF+  +  G+
Sbjct  133  VMILGAIYVIRRKRKLAEVLEDWERDYGPHRFKYKDLYIATKGFQDQELLGV  184



>gb|KCW58873.1| hypothetical protein EUGRSUZ_H01500, partial [Eucalyptus grandis]
Length=626

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +L L  + V++RKRK  +VLEDWE  YG +RFKY++LY ATKGF+  +  G
Sbjct  272  VLILGAIYVIRRKRKLAEVLEDWERDYGPYRFKYKDLYTATKGFRNQELLG  322



>gb|KCW58870.1| hypothetical protein EUGRSUZ_H01496 [Eucalyptus grandis]
Length=615

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGL  159
            ++ L  + V++RKRK  +VLEDWE  YG HRFKY++LY+ATKGF+  +  G+
Sbjct  258  VMILGAIYVIRRKRKLAEVLEDWERDYGPHRFKYKDLYIATKGFQDQELLGV  309



>ref|XP_010026230.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=687

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +L L  + V++RKRK  +VLEDWE  YG +RFKY++LY ATKGF+  +  G
Sbjct  330  VLILGAIYVIRRKRKLAEVLEDWERDYGPYRFKYKDLYTATKGFRNQELLG  380



>ref|XP_010262576.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Nelumbo nucifera]
Length=667

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  31   VQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            + RKRKF +VLEDWE  YG HRFK++ELY+ATKGF++ +  G
Sbjct  310  ILRKRKFAEVLEDWELDYGPHRFKFKELYIATKGFREKELLG  351



>ref|XP_010262584.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Nelumbo nucifera]
Length=693

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  19   VVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            ++ +V+RKRKF + LEDWE  YG HRFKY++LY ATKGF+  +  G+   G
Sbjct  330  ILFIVRRKRKFAEELEDWELEYGPHRFKYKDLYTATKGFRDKELLGIGGFG  380



>ref|XP_010025783.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=655

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +L L  + V++RKRK  +VLEDWE  YG +RFKY++LY ATKGF+  +  G
Sbjct  298  VLILGAIYVIRRKRKLAEVLEDWERDYGPYRFKYKDLYTATKGFRNQELLG  348



>ref|XP_004492166.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Cicer arietinum]
Length=668

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            ++ L V+ +++RK+ F ++LEDWEH YG HRFK+++LY ATKGF++ +  G
Sbjct  297  MITLGVIYLIKRKKMFAEILEDWEHEYGPHRFKFKDLYFATKGFRERELLG  347



>ref|XP_008240448.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Prunus mume]
Length=659

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +++  ++RK+KF ++LEDWE  YG  RFKYEELY+ATKGF++ +  G
Sbjct  300  SLIYAIRRKKKFAELLEDWELEYGPQRFKYEELYMATKGFREKELLG  346



>gb|KCW58879.1| hypothetical protein EUGRSUZ_H01505 [Eucalyptus grandis]
Length=578

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +L L  + V++RKRK  +VLEDWE  YG +RFKY++LY ATKGF+  +  G
Sbjct  221  VLILGAIYVIRRKRKLAEVLEDWERDYGPYRFKYKDLYTATKGFRNQELLG  271



>ref|XP_010107337.1| L-type lectin-domain containing receptor kinase IV.2 [Morus notabilis]
 gb|EXC14817.1| L-type lectin-domain containing receptor kinase IV.2 [Morus notabilis]
Length=375

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            L VV  ++RKRKF +++EDWE  YG  R+KY+ LY+ATKGFK+ +  G
Sbjct  305  LGVVYFIKRKRKFAELVEDWELEYGPQRYKYKHLYIATKGFKEKELLG  352



>ref|XP_002446842.1| hypothetical protein SORBIDRAFT_06g023520 [Sorghum bicolor]
 gb|EES11170.1| hypothetical protein SORBIDRAFT_06g023520 [Sorghum bicolor]
Length=691

 Score = 53.9 bits (128),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +1

Query  4    ILGLAVVKV--VQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +L L VV    V+R+ ++ +V EDWE  +G HRF Y+ELY ATKGFK
Sbjct  315  VLALVVVAFLWVRRRVRYAEVREDWEVEFGPHRFSYKELYHATKGFK  361


 Score = 33.9 bits (76),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+ + +LG G  G VY+G+LP+++L+
Sbjct  358  KGFKNKMLLGTGGFGRVYKGVLPKSKLE  385



>ref|XP_010262585.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Nelumbo nucifera]
 ref|XP_010262587.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Nelumbo nucifera]
Length=672

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            L ++ +V+RKRKF +++EDWE  YG HRFK+++LY+AT GF+  +  G+   G
Sbjct  306  LGIIFIVRRKRKFAELVEDWELDYGPHRFKFKDLYIATNGFRDTELLGIGGFG  358



>ref|XP_006341207.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Solanum tuberosum]
Length=658

 Score = 55.1 bits (131),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            VI+ L ++  + +K KF ++ E+WE  YG HRFKY++LY ATKGF
Sbjct  300  VIVVLVIIYYIGKKMKFAELQEEWELDYGPHRFKYKDLYTATKGF  344


 Score = 32.3 bits (72),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF  + +LG G  G VYRG+LP + +Q
Sbjct  342  KGFSSKDLLGSGGFGRVYRGVLPISNIQ  369



>ref|XP_002461413.1| hypothetical protein SORBIDRAFT_02g002240 [Sorghum bicolor]
 gb|EER97934.1| hypothetical protein SORBIDRAFT_02g002240 [Sorghum bicolor]
Length=685

 Score = 51.2 bits (121),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            V LG  VV +V+R+ ++ ++ EDWE  +G HRF Y++L+  T GFK
Sbjct  318  VTLGTLVVMLVRRRMRYAELREDWEVDFGPHRFSYKDLFNGTDGFK  363


 Score = 36.2 bits (82),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 14/30 (47%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  120  GHQGFQERKILGIGVLGIVYRGLLPETQLQ  209
            G  GF+++ +LG G  G VYRG+LP+++L+
Sbjct  358  GTDGFKDKHLLGQGGFGRVYRGVLPKSKLE  387



>ref|XP_008369932.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Malus domestica]
Length=668

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             ++ +++RKRK+ ++LEDWE  YG  RFKY+ELY+ATKGFK+ +  G
Sbjct  301  GLIYIIRRKRKYAELLEDWELEYGPQRFKYKELYVATKGFKEKEILG  347



>ref|XP_006387255.1| hypothetical protein POPTR_1407s00200g, partial [Populus trichocarpa]
 gb|ERP46169.1| hypothetical protein POPTR_1407s00200g, partial [Populus trichocarpa]
Length=479

 Score = 55.5 bits (132),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            ++   ++  RKF +VLEDWE  YG HRFK+++LY ATKGF+
Sbjct  306  SISYAIRWTRKFAEVLEDWELDYGPHRFKFKDLYTATKGFR  346


 Score = 32.0 bits (71),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++ ++LG G  G VY+G+ P +++Q
Sbjct  343  KGFRDEELLGSGGFGRVYKGVFPTSKIQ  370



>ref|XP_010107339.1| L-type lectin-domain containing receptor kinase IV.1 [Morus notabilis]
 gb|EXC14819.1| L-type lectin-domain containing receptor kinase IV.1 [Morus notabilis]
Length=673

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 5/53 (9%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            L VV  ++RKRKF +++EDWE  YG  R+KY+ LY+ATKGFK+      EFLG
Sbjct  305  LGVVYFIKRKRKFAELVEDWELEYGPQRYKYKHLYIATKGFKEK-----EFLG  352



>dbj|BAJ93671.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score = 53.9 bits (128),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +G+  + +V+R  ++++V EDWE  YG HRF Y++L+ ATKGFK
Sbjct  314  VGILAITMVRRHIRYKEVREDWEVEYGPHRFSYKDLFRATKGFK  357


 Score = 33.1 bits (74),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+++  +G G  G VY+GLLP+++ Q
Sbjct  354  KGFKDKNFIGAGGFGRVYKGLLPKSKSQ  381



>ref|XP_007026953.1| Receptor lectin kinase [Theobroma cacao]
 gb|EOY07455.1| Receptor lectin kinase [Theobroma cacao]
Length=669

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             V   ++RKRKF +V+EDWE  YG HRFKY++LY+ATKGFK  +  G
Sbjct  303  GVAYFMRRKRKFAEVVEDWELEYGPHRFKYKDLYVATKGFKDKELLG  349



>ref|XP_010107335.1| L-type lectin-domain containing receptor kinase IV.2 [Morus notabilis]
 gb|EXC14815.1| L-type lectin-domain containing receptor kinase IV.2 [Morus notabilis]
Length=245

 Score = 56.2 bits (134),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            L VV  ++RKRKF +++EDWE  YG  R+KY+ LY+ATKGFK+
Sbjct  69   LGVVYFIKRKRKFAELVEDWELEYGPQRYKYKHLYIATKGFKE  111


 Score = 30.8 bits (68),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+E+++ G G  G VY+G+LP T+ +
Sbjct  107  KGFKEKELSGRGGFGSVYKGVLPTTKTE  134



>ref|XP_007206532.1| hypothetical protein PRUPE_ppa019569mg [Prunus persica]
 gb|EMJ07731.1| hypothetical protein PRUPE_ppa019569mg [Prunus persica]
Length=671

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             ++  ++RKRKF ++LEDWE  YG  RFKY++LY+ATKGFK+ +  G
Sbjct  304  GLIYFIRRKRKFAELLEDWELEYGPQRFKYKDLYIATKGFKENELLG  350



>ref|XP_010228396.1| PREDICTED: uncharacterized protein LOC100823194 [Brachypodium 
distachyon]
Length=1316

 Score = 53.9 bits (128),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  1     VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
             +++G+  + +V+R+ K+ ++ EDWE  +G HRF Y++LY AT+GFK
Sbjct  956   IVVGVVAIFLVRRRLKYAELKEDWEIEFGPHRFSYKDLYHATEGFK  1001


 Score = 33.1 bits (74),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126   QGFQERKILGIGVLGIVYRGLLPETQLQ  209
             +GF+ + +LG G  G VY+G+LP ++L+
Sbjct  998   EGFKNKFLLGAGGFGKVYKGILPSSRLE  1025


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            + +G  VV  V+R+ ++ ++ E+WE  +G HRF Y++L  ATKGFK
Sbjct  308  IFVGAIVVLFVRRRLRYTELRENWEVEFGPHRFSYKDLVHATKGFK  353



>ref|XP_011020400.1| PREDICTED: L-type lectin-domain containing receptor kinase V.9-like 
isoform X2 [Populus euphratica]
Length=666

 Score = 52.0 bits (123),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  34   QRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            ++K +F ++LEDWE  YGSHRF Y++L+ ATKGF
Sbjct  316  RKKAQFTEILEDWEVQYGSHRFSYKDLFEATKGF  349


 Score = 35.0 bits (79),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF ER++LG G  G VYRG+LP + +Q
Sbjct  347  KGFCERELLGKGGFGKVYRGVLPGSNVQ  374



>ref|XP_008240568.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Prunus mume]
Length=668

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             ++  ++RKRKF ++LEDWE  YG  RFKY+ELY+ATKGFK+ +  G
Sbjct  301  GLIYFIRRKRKFAELLEDWELEYGPQRFKYKELYIATKGFKEKELLG  347



>ref|XP_009593324.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Nicotiana tomentosiformis]
Length=665

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = +1

Query  1    VILGLAV-VKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            V++  +V +  V RKRKF ++LEDWE  YG HRFKY++LY+ATKGF
Sbjct  296  VVIAFSVLIYYVGRKRKFAELLEDWELEYGPHRFKYKDLYIATKGF  341



>ref|XP_011020399.1| PREDICTED: L-type lectin-domain containing receptor kinase V.9-like 
isoform X1 [Populus euphratica]
Length=666

 Score = 51.6 bits (122),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  34   QRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            ++K +F ++LEDWE  YGSHRF Y++L+ ATKGF
Sbjct  316  RKKAQFTEILEDWEVQYGSHRFSYKDLFEATKGF  349


 Score = 35.0 bits (79),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF ER++LG G  G VYRG+LP + +Q
Sbjct  347  KGFCERELLGKGGFGKVYRGVLPGSNVQ  374



>ref|XP_009778121.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Nicotiana sylvestris]
Length=665

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +1

Query  1    VILGLAV-VKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            V++  +V +  V RKRKF ++LEDWE  YG HRFKY++LY ATKGF   +  G    G
Sbjct  296  VVIAFSVLIYYVGRKRKFAELLEDWELEYGPHRFKYKDLYFATKGFANKELLGFGGFG  353



>ref|XP_010262581.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Nelumbo nucifera]
Length=670

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 7/63 (11%)
 Frame = +1

Query  4    ILGLAVVKVVQ-------RKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLE  162
            I+GL ++  V        R+RKF  VLEDWE  YG HRFK+++LY+ATKGF++ +  G+ 
Sbjct  296  IIGLVLMSTVMAGTLFILRRRKFAQVLEDWELEYGPHRFKFKDLYIATKGFREQELLGIG  355

Query  163  FLG  171
              G
Sbjct  356  GFG  358



>ref|XP_007208048.1| hypothetical protein PRUPE_ppa002342mg [Prunus persica]
 gb|EMJ09247.1| hypothetical protein PRUPE_ppa002342mg [Prunus persica]
Length=685

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             ++  ++RKRKF ++LEDWE  YG  RFKY+ELY+ATKGFK+ +  G
Sbjct  318  GLIYFIRRKRKFAELLEDWELEYGPQRFKYKELYIATKGFKEKELLG  364



>ref|XP_010107332.1| L-type lectin-domain containing receptor kinase IV.1 [Morus notabilis]
 gb|EXC14812.1| L-type lectin-domain containing receptor kinase IV.1 [Morus notabilis]
Length=1077

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            L VV  ++RKRKF +++EDWE  YG  R+KY+ LY+ATKGFK+ +  G
Sbjct  308  LGVVYFIKRKRKFAELVEDWELQYGPQRYKYKHLYIATKGFKEKELLG  355



>emb|CDP21076.1| unnamed protein product [Coffea canephora]
Length=678

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            I+   V   ++RK KF +VLE+WE  YG HRFKY++LY+ATKGF + +  G
Sbjct  307  IIAFGVAYYLRRKWKFAEVLEEWELAYGPHRFKYKDLYIATKGFTQKQLLG  357



>ref|XP_010262572.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Nelumbo nucifera]
Length=670

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             A +  + RKRKF +VLEDWE  YG HRFK+++LY+ATKGF++ +  G
Sbjct  306  FAGILFILRKRKFAEVLEDWELDYGPHRFKFKDLYIATKGFREKELLG  353



>ref|XP_008240589.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Prunus mume]
Length=668

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             V+  ++RKRKF ++LEDWE  YG  RFKY+ELY+AT+GF++ +  G
Sbjct  305  GVIYAIRRKRKFAELLEDWELEYGPQRFKYKELYIATEGFREKELLG  351



>emb|CDP14355.1| unnamed protein product [Coffea canephora]
Length=672

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             ++  V+ K+KF +VLEDWE  YG HRFKY++LY+ATKGF+  +  G
Sbjct  306  GIIYQVRTKKKFAEVLEDWERDYGPHRFKYKDLYIATKGFRDKELLG  352



>ref|XP_002872841.1| lectin protein kinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49100.1| lectin protein kinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=673

 Score = 53.1 bits (126),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +V+R+RKF + LEDWE  +G +R ++++LY ATKGFK
Sbjct  319  IVRRRRKFAEELEDWETEFGKNRLRFKDLYYATKGFK  355


 Score = 33.1 bits (74),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQ  203
            +GF+++ +LG G  G VYRG++P T+
Sbjct  352  KGFKDKDLLGSGGFGSVYRGVMPTTK  377



>ref|XP_009334389.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Pyrus x bretschneideri]
 ref|XP_009334390.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Pyrus x bretschneideri]
Length=668

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  19   VVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            ++ V++RK KF ++LEDWE  YG  RFKY+ELY+ATKGFK+ +  G
Sbjct  302  LIYVIRRKSKFAELLEDWELEYGPQRFKYKELYIATKGFKEKELLG  347



>ref|XP_008240435.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Prunus mume]
Length=634

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  31   VQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            ++RKRKF ++LEDWE  YG  RFKY++LY+ATKGFK+ +  G
Sbjct  309  IRRKRKFAELLEDWELEYGPQRFKYKDLYIATKGFKENELLG  350



>ref|XP_010065280.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
 gb|KCW62701.1| hypothetical protein EUGRSUZ_G00264 [Eucalyptus grandis]
Length=663

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            IL  +VV V++RKRKF +VLEDWE  YG H+ KY++LY+ATKGF++
Sbjct  298  ILISSVVYVMRRKRKFAEVLEDWERDYGPHQLKYKDLYIATKGFRE  343



>ref|XP_007140499.1| hypothetical protein PHAVU_008G117800g [Phaseolus vulgaris]
 gb|ESW12493.1| hypothetical protein PHAVU_008G117800g [Phaseolus vulgaris]
Length=668

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +++ LAVV V++RK KF+++LEDWE  YG HRFKY++L LATKGF++
Sbjct  298  IMVALAVVHVIKRK-KFKELLEDWEQDYGPHRFKYKDLSLATKGFRE  343



>ref|XP_010070226.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
 gb|KCW58868.1| hypothetical protein EUGRSUZ_H01494 [Eucalyptus grandis]
Length=679

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  22   VKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            V V++RKR+  +VLEDWE  YG HRFKY++LY+ATKGF+  +  G
Sbjct  306  VYVMRRKRELAEVLEDWERDYGLHRFKYKDLYIATKGFRDQQLLG  350



>ref|XP_002890460.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66719.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=274

 Score = 52.0 bits (123),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +V+RK+K+E+ L+DWE  +G +RF+++ELY ATKGFK+
Sbjct  209  IVRRKKKYEEELDDWETEFGKNRFRFKELYHATKGFKE  246


 Score = 34.3 bits (77),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPET  200
            +GF+E+ +LG G  G VYRG+LP++
Sbjct  242  KGFKEKDLLGSGGFGRVYRGILPKS  266



>ref|XP_004965305.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Setaria italica]
Length=673

 Score = 53.5 bits (127),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            I+G  ++ +V+R+ K+ ++ EDWE  +G HRF Y++L+ AT GFK
Sbjct  309  IVGTTIILLVRRRMKYAEINEDWEAEFGPHRFSYKDLFHATDGFK  353


 Score = 32.7 bits (73),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +3

Query  129  GFQERKILGIGVLGIVYRGLLPETQLQ  209
            GF+ + +LG G  G VY+GLLP ++L+
Sbjct  351  GFKNKNLLGQGGFGKVYKGLLPVSRLE  377



>emb|CAN77672.1| hypothetical protein VITISV_019444 [Vitis vinifera]
Length=616

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  22   VKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            V +++RK+KF + LEDWE  YG HRFKY++LY ATKGFK  +  G
Sbjct  306  VYLIRRKKKFAEELEDWELDYGPHRFKYKDLYFATKGFKDKELLG  350



>emb|CBI30516.3| unnamed protein product [Vitis vinifera]
Length=618

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  22   VKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            V +++RK+KF + LEDWE  YG HRFKY++LY ATKGFK  +  G
Sbjct  356  VYLIRRKKKFAEELEDWELDYGPHRFKYKDLYFATKGFKDKELLG  400



>ref|XP_008240475.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Prunus mume]
Length=660

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             ++  ++RKRKF ++LEDWE  YG  RFKY++LY+ATKGFK+ +  G
Sbjct  298  GLIYFIRRKRKFAELLEDWELEYGPQRFKYKDLYIATKGFKENELLG  344



>ref|XP_010088607.1| L-type lectin-domain containing receptor kinase IV.1 [Morus notabilis]
 gb|EXB36748.1| L-type lectin-domain containing receptor kinase IV.1 [Morus notabilis]
Length=676

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            L VV  ++RKRKF +++EDWE  YG  R+KY+ LY+ATKGFK+ +  G
Sbjct  308  LGVVYFIKRKRKFAELVEDWELQYGPQRYKYKHLYIATKGFKEKELLG  355



>ref|XP_010654251.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1 
[Vitis vinifera]
Length=680

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  22   VKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            V +++RK+KF + LEDWE  YG HRFKY++LY ATKGFK  +  G
Sbjct  319  VYLIRRKKKFAEELEDWELDYGPHRFKYKDLYFATKGFKDKELLG  363



>ref|XP_009347934.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Pyrus x bretschneideri]
Length=657

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  19   VVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            V   ++RK+KF D+LEDWE  YG  RFKY ELY+ATKGF++ +  G
Sbjct  297  VYYAIRRKKKFADLLEDWELEYGPQRFKYRELYIATKGFREKELLG  342



>ref|XP_010228395.1| PREDICTED: uncharacterized protein LOC100823228 [Brachypodium 
distachyon]
Length=1317

 Score = 52.8 bits (125),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            ++G+ +V +++R+ ++ ++ EDWE  +G HRF Y++LY AT+GFK
Sbjct  951  VVGIVIVLLMRRRLRYAELREDWEVEFGPHRFSYKDLYHATEGFK  995


 Score = 33.1 bits (74),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126   QGFQERKILGIGVLGIVYRGLLPETQLQ  209
             +GF++  +LG G  G VY+G+LP+++++
Sbjct  992   EGFKDHHLLGAGGFGKVYKGVLPKSKME  1019


 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            ++LG+ +   V+R R++ ++ EDWE  +G HRF Y++LY AT+GFK     G+   G
Sbjct  302  LVLGIIIFLFVRRHRRYAELKEDWEVEFGPHRFPYKDLYYATQGFKNKNLLGVGGFG  358



>ref|XP_009350450.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Pyrus x bretschneideri]
Length=657

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  19   VVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            V   ++RK+KF D+LEDWE  YG  RFKY ELY+ATKGF++ +  G
Sbjct  297  VYYAIRRKKKFADLLEDWELEYGPQRFKYRELYIATKGFREKELLG  342



>ref|XP_010456036.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.4-like 
[Camelina sativa]
Length=667

 Score = 50.8 bits (120),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +V+R+RKF + LEDWE  +  +R K+++LY ATKGFK
Sbjct  313  IVRRRRKFAEELEDWETEFEKNRLKFKDLYYATKGFK  349


 Score = 35.0 bits (79),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQ  203
            +GF+++ +LG G  G VYRGL+P+T+
Sbjct  346  KGFKDKNLLGSGGFGRVYRGLMPKTK  371



>ref|XP_010429650.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.4-like 
[Camelina sativa]
Length=674

 Score = 51.6 bits (122),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +V+R+RKF + LE WE  +G +R +++ELY ATKGFK
Sbjct  319  IVRRRRKFAEELEGWETEFGKNRLRFKELYYATKGFK  355


 Score = 34.7 bits (78),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQ  203
            +GF+++ +LG G  G VYRG LP+T+
Sbjct  352  KGFKDKNLLGSGGFGRVYRGFLPKTK  377



>ref|XP_010429638.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.4 
[Camelina sativa]
Length=672

 Score = 50.8 bits (120),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +V+R+RKF + LEDWE  +  +R K+++LY ATKGFK
Sbjct  318  IVRRRRKFAEELEDWETEFEKNRLKFKDLYYATKGFK  354


 Score = 35.0 bits (79),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQ  203
            +GF+++ +LG G  G VYRGL+P+T+
Sbjct  351  KGFKDKNLLGSGGFGRVYRGLMPKTK  376



>gb|EMS46773.1| L-type lectin-domain containing receptor kinase IV.1 [Triticum 
urartu]
Length=667

 Score = 54.3 bits (129),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +G A+  +V+R R++ ++ EDWE  +G HRF Y++LY AT+GFK
Sbjct  312  VGTAITLLVRRHRRYAELREDWEVEFGPHRFSYKDLYHATEGFK  355


 Score = 31.6 bits (70),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+ + +LG G  G VY+G+LP + L+
Sbjct  352  EGFKNKNLLGEGGFGKVYKGVLPVSNLE  379



>ref|XP_007208273.1| hypothetical protein PRUPE_ppa015709mg [Prunus persica]
 gb|EMJ09472.1| hypothetical protein PRUPE_ppa015709mg [Prunus persica]
Length=659

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +++  ++RK+KF ++LEDWE  YG  RFKY+ELY+ATKGF++ +  G
Sbjct  300  SLIYAIRRKKKFAELLEDWELEYGPQRFKYKELYMATKGFREKELLG  346



>gb|KFK30833.1| hypothetical protein AALP_AA6G031600 [Arabis alpina]
Length=658

 Score = 52.0 bits (123),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            VI  L V  +++RKRKF + LEDWE     +R K+++LY ATKGFK+
Sbjct  295  VIFSLLVYLIMRRKRKFAEELEDWEADLKKNRLKFKDLYDATKGFKE  341


 Score = 33.9 bits (76),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQ  203
            +GF+E+ +LG G  G VY+G++P+T+
Sbjct  337  KGFKEKDLLGSGGFGSVYKGVMPKTR  362



>ref|XP_010256839.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Nelumbo nucifera]
Length=687

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +V RKRKF +++EDWE  YG HRFKY++LY ATKGF+  +  G
Sbjct  326  IVARKRKFAELVEDWEMEYGPHRFKYKDLYHATKGFRDKELLG  368



>emb|CDP17270.1| unnamed protein product [Coffea canephora]
Length=677

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +IL   V   + RK KF +VLE+WE  YG HRFKY++LY+ATKGF++ +  G
Sbjct  306  IILTSGVAYYLWRKWKFAEVLEEWELAYGPHRFKYKDLYIATKGFREKELLG  357



>emb|CDP17279.1| unnamed protein product [Coffea canephora]
Length=697

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            I+       ++RK K+ +VLE+WEH YG HRFKY++LY+ATKGF +
Sbjct  326  IVAFGAAYYLRRKWKYAEVLEEWEHAYGPHRFKYKDLYIATKGFTE  371



>ref|XP_008240576.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Prunus mume]
Length=664

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +++  ++RK+KF ++LEDWE  YG  RFKY+ELY+ATKGF++ +  G
Sbjct  300  SLIYAIRRKKKFAELLEDWELEYGPQRFKYKELYMATKGFREKELLG  346



>dbj|BAC57688.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=713

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +G+ V+ +V+R++++ ++ EDWE  +G HRF Y++L+ AT+GF+
Sbjct  346  MGILVILLVRRRKRYTELREDWEVEFGPHRFPYKDLHHATQGFE  389


 Score = 34.3 bits (77),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            QGF+ + +LG+G  G VY+G+LP + ++
Sbjct  386  QGFESKCLLGVGGFGRVYKGVLPNSNVE  413



>gb|EAZ38579.1| hypothetical protein OsJ_22967 [Oryza sativa Japonica Group]
Length=698

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +G+ V+ +V+R++++ ++ EDWE  +G HRF Y++L+ AT+GF+
Sbjct  331  MGILVILLVRRRKRYTELREDWEVEFGPHRFPYKDLHHATQGFE  374


 Score = 34.3 bits (77),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            QGF+ + +LG+G  G VY+G+LP + ++
Sbjct  371  QGFESKCLLGVGGFGRVYKGVLPNSNVE  398



>gb|EAZ02657.1| hypothetical protein OsI_24768 [Oryza sativa Indica Group]
Length=698

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +G+ V+ +V+R++++ ++ EDWE  +G HRF Y++L+ AT+GF+
Sbjct  331  MGILVILLVRRRKRYTELREDWEVEFGPHRFPYKDLHHATQGFE  374


 Score = 34.3 bits (77),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            QGF+ + +LG+G  G VY+G+LP + ++
Sbjct  371  QGFESKCLLGVGGFGRVYKGVLPNSNVE  398



>ref|NP_001058821.2| Os07g0130200 [Oryza sativa Japonica Group]
 dbj|BAC84735.1| putative receptor kinase Lecrk [Oryza sativa Japonica Group]
 dbj|BAF20735.2| Os07g0130200 [Oryza sativa Japonica Group]
Length=688

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +G+ V+ +V+R++++ ++ EDWE  +G HRF Y++L+ AT+GF+
Sbjct  321  MGILVILLVRRRKRYTELREDWEVEFGPHRFPYKDLHHATQGFE  364


 Score = 34.3 bits (77),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            QGF+ + +LG+G  G VY+G+LP + ++
Sbjct  361  QGFESKCLLGVGGFGRVYKGVLPNSNVE  388



>emb|CDP17273.1| unnamed protein product [Coffea canephora]
Length=677

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +IL   V   + RK KF +VLE+WE  YG HRFKY++LY+ATKGF++ +  G
Sbjct  306  IILTSGVAYYLWRKWKFAEVLEEWELAYGPHRFKYKDLYIATKGFREKELLG  357



>ref|XP_008448149.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Cucumis melo]
Length=679

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 5/53 (9%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            L V+  + R+RKF ++LEDWE  YG  RFKY++LY ATKGF++      EFLG
Sbjct  305  LGVIYFIYRRRKFAEILEDWELEYGPQRFKYKDLYRATKGFREK-----EFLG  352



>ref|XP_010037815.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
 gb|KCW49576.1| hypothetical protein EUGRSUZ_K03102 [Eucalyptus grandis]
Length=671

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            IL   +   ++++RKF +VLEDWE  Y  HRFKY++LY+ATKGF++ +  G
Sbjct  302  ILVFVMAYAIRKRRKFAEVLEDWERDYSPHRFKYKDLYVATKGFREQELLG  352



>ref|XP_010262894.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Nelumbo nucifera]
Length=414

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  19   VVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGL  159
            V+  V+ KRKF +VLEDWE  YG HRFKY++LY+ATKGF+  +  G+
Sbjct  57   VIFTVKSKRKFSEVLEDWELDYGPHRFKYKDLYIATKGFRDKELLGI  103



>ref|XP_003557624.2| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Brachypodium distachyon]
Length=1324

 Score = 52.8 bits (125),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  4     ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
             ++G A++  ++R+ ++ ++ EDWE  +G HRF Y++LY AT+GFK
Sbjct  958   VVGTAIILFMRRRSRYAELREDWEVEFGPHRFSYKDLYHATEGFK  1002


 Score = 32.3 bits (72),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126   QGFQERKILGIGVLGIVYRGLLPETQLQ  209
             +GF+ + +LG G  G VY+G+LP ++L+
Sbjct  999   EGFKNQHLLGAGGFGKVYKGVLPVSKLE  1026


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            + +G+AV  +V+R R++ ++ EDWE  +G HRF Y++LY AT+GFK     G+   G
Sbjct  301  LTVGIAVFLLVRRHRRYAELREDWEVEFGPHRFPYKDLYYATQGFKNKNLLGVGGFG  357



>gb|EMS54258.1| L-type lectin-domain containing receptor kinase IV.1 [Triticum 
urartu]
Length=623

 Score = 57.4 bits (137),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            ++LG+ V   V+R  KF ++ EDWE  +G HRF Y+ELY ATKGF
Sbjct  258  LVLGIGVYIFVRRLVKFSELREDWEDAFGPHRFSYKELYHATKGF  302


 Score = 28.1 bits (61),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF ++ +LG G  G VYRG L +  ++
Sbjct  300  KGFSDKNLLGAGGFGSVYRGKLRKPDME  327



>gb|KDO52362.1| hypothetical protein CISIN_1g036051mg, partial [Citrus sinensis]
Length=420

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             VV V++RKRKF + LEDWE  YG HRF+Y++LY+ATKGF++ +  G
Sbjct  58   GVVYVIRRKRKFAEELEDWELDYGPHRFRYKDLYIATKGFREKELLG  104



>emb|CDP17268.1| unnamed protein product [Coffea canephora]
Length=663

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +IL   V   ++RK KF +VLE+WE  YG HRFKY++LY+ATKGF++ +  G
Sbjct  306  LILISGVAYYLRRKWKFAEVLEEWELAYGPHRFKYKDLYIATKGFREQELLG  357



>ref|XP_006424894.1| hypothetical protein CICLE_v10030157mg, partial [Citrus clementina]
 gb|ESR38134.1| hypothetical protein CICLE_v10030157mg, partial [Citrus clementina]
Length=646

 Score = 53.1 bits (126),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  37   RKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +K+K+E+V EDWE  Y  HRF Y+ LY ATKGFK
Sbjct  292  KKKKYEEVYEDWEKEYSPHRFSYKNLYKATKGFK  325


 Score = 32.0 bits (71),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++++I+G G  G VYRG+LP +  +
Sbjct  322  KGFKDKEIIGRGGSGKVYRGVLPSSHAE  349



>ref|XP_010256840.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Nelumbo nucifera]
Length=721

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            + L V   V R+RKF +++EDWE  YG HRFKY++LYLATKGF
Sbjct  350  VALGVHFFVTRRRKFAELVEDWEIDYGPHRFKYKDLYLATKGF  392



>ref|XP_006488377.1| PREDICTED: putative L-type lectin-domain containing receptor 
kinase II.2-like [Citrus sinensis]
Length=670

 Score = 53.1 bits (126),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  37   RKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +K+K+E+V EDWE  Y  HRF Y+ LY ATKGFK
Sbjct  316  KKKKYEEVYEDWEKEYSPHRFSYKNLYKATKGFK  349


 Score = 32.0 bits (71),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++++I+G G  G VYRG+LP +  +
Sbjct  346  KGFKDKEIIGRGGSGKVYRGVLPSSHAE  373



>emb|CDP14364.1| unnamed protein product [Coffea canephora]
Length=665

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +1

Query  7    LGLAVVKVVQR---KRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            L +A+  V+ R   K KF +VLEDWEH YG HRFKY++L +ATKGF+
Sbjct  300  LSIAISGVIYRVRIKTKFAEVLEDWEHEYGPHRFKYKDLCIATKGFR  346



>dbj|BAC57690.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=695

 Score = 50.1 bits (118),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            +G+A+V +V+R++++ ++ EDWE  +G HRF Y++L  AT GF
Sbjct  330  VGIAMVFLVRRRQRYAELREDWEDEFGPHRFAYKDLLHATDGF  372


 Score = 34.7 bits (78),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  129  GFQERKILGIGVLGIVYRGLLPETQLQ  209
            GF ++ ILG G  G VY+G+LP+++L+
Sbjct  371  GFSDKHILGAGGFGRVYKGILPKSKLE  397



>ref|NP_001058822.2| Os07g0130300 [Oryza sativa Japonica Group]
 dbj|BAC84737.1| putative receptor kinase Lecrk [Oryza sativa Japonica Group]
 gb|EAZ02658.1| hypothetical protein OsI_24769 [Oryza sativa Indica Group]
 gb|EAZ38580.1| hypothetical protein OsJ_22968 [Oryza sativa Japonica Group]
 dbj|BAF20736.2| Os07g0130300 [Oryza sativa Japonica Group]
Length=671

 Score = 50.1 bits (118),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            +G+A+V +V+R++++ ++ EDWE  +G HRF Y++L  AT GF
Sbjct  306  VGIAMVFLVRRRQRYAELREDWEDEFGPHRFAYKDLLHATDGF  348


 Score = 34.7 bits (78),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  129  GFQERKILGIGVLGIVYRGLLPETQLQ  209
            GF ++ ILG G  G VY+G+LP+++L+
Sbjct  347  GFSDKHILGAGGFGRVYKGILPKSKLE  373



>ref|XP_010936300.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Elaeis guineensis]
Length=670

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            +I    V+ VV+RK KF ++LEDWE  YGSHRF Y +LY AT GF+     G+   G
Sbjct  309  LITAAVVLFVVRRKNKFAEILEDWELEYGSHRFSYRDLYRATNGFEDSGLLGVGGFG  365



>gb|EMT19416.1| Lectin-domain containing receptor kinase A4.2 [Aegilops tauschii]
Length=667

 Score = 50.8 bits (120),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +G  V+ +V+RK ++ ++ EDWE  +G HRF Y++L+ AT+GFK
Sbjct  303  VGSMVILLVRRKLRYAELKEDWEIEFGPHRFSYKDLFHATEGFK  346


 Score = 34.3 bits (77),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+ + +LG G  G VY+G LP T+L+
Sbjct  343  EGFKNKHLLGAGGFGKVYKGALPSTKLE  370



>ref|NP_567234.1| L-type lectin-domain containing receptor kinase IV.4 [Arabidopsis 
thaliana]
 sp|O81291.1|LRK44_ARATH RecName: Full=L-type lectin-domain containing receptor kinase 
IV.4; Short=LecRK-IV.4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC19274.1| T14P8.4 [Arabidopsis thaliana]
 emb|CAB80735.1| AT4g02420 [Arabidopsis thaliana]
 gb|AEE82168.1| concanavalin A-like lectin kinase-like protein [Arabidopsis thaliana]
Length=669

 Score = 50.8 bits (120),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +++R+RKF + +EDWE  +G +R ++++LY ATKGFK
Sbjct  315  IMKRRRKFAEEVEDWETEFGKNRLRFKDLYYATKGFK  351


 Score = 34.3 bits (77),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQ  203
            +GF+++ ILG G  G VY+G++P+T+
Sbjct  348  KGFKDKNILGSGGFGSVYKGIMPKTK  373



>gb|EMT07131.1| Lectin-domain containing receptor kinase A4.3 [Aegilops tauschii]
Length=673

 Score = 52.4 bits (124),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 4/50 (8%)
 Frame = +1

Query  1    VILGLAVVKV----VQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            ++  L VV +    ++R+ K+ +V EDWE  +G HRF Y++LY AT+GFK
Sbjct  307  IVFALGVVSIMVLLIRRRIKYAEVREDWEVEFGPHRFSYKDLYRATEGFK  356


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+ + +LG G  G VY+G+LP ++++
Sbjct  353  EGFKSKMLLGTGGFGGVYKGVLPNSKME  380



>ref|XP_003552189.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Glycine max]
 gb|KHN04723.1| L-type lectin-domain containing receptor kinase IV.1 [Glycine 
soja]
Length=667

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            ++ LAVV V++RK KF ++LEDWE  YG HRFKY++L LATKGF++ +  G
Sbjct  298  MVALAVVHVIKRK-KFTELLEDWEQDYGPHRFKYKDLSLATKGFREKELLG  347



>ref|NP_567233.1| L-type lectin-domain containing receptor kinase IV.3 [Arabidopsis 
thaliana]
 sp|O81292.1|LRK43_ARATH RecName: Full=L-type lectin-domain containing receptor kinase 
IV.3; Short=LecRK-IV.3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC19286.1| T14P8.3 [Arabidopsis thaliana]
 emb|CAB80734.1| AT4g02410 [Arabidopsis thaliana]
 gb|AAM19812.1| AT4g02410/T14P8_3 [Arabidopsis thaliana]
 gb|AAM19843.1| AT4g02410/T14P8_3 [Arabidopsis thaliana]
 gb|AEE82167.1| L-type lectin-like protein kinase 1 [Arabidopsis thaliana]
Length=674

 Score = 51.6 bits (122),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +V+R+RKF +  EDWE  +G +R ++++LY ATKGFK
Sbjct  320  IVRRRRKFAEEFEDWETEFGKNRLRFKDLYYATKGFK  356


 Score = 33.1 bits (74),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQ  203
            +GF+++ +LG G  G VYRG++P T+
Sbjct  353  KGFKDKDLLGSGGFGRVYRGVMPTTK  378



>gb|EMT06508.1| Lectin-domain containing receptor kinase A4.2 [Aegilops tauschii]
Length=1352

 Score = 52.8 bits (125),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  7     LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
             +G A+  +V+R +++ ++ EDWE  +G HRF Y++LY AT+GFK
Sbjct  997   MGTAITLLVRRHQRYAELREDWEVEFGPHRFSYKDLYHATEGFK  1040


 Score = 32.0 bits (71),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +3

Query  126   QGFQERKILGIGVLGIVYRGLLPETQLQ  209
             +GF+ + +LG G  G VY+G+LP + L+
Sbjct  1037  EGFKNKNLLGEGGFGKVYKGVLPVSHLE  1064


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            +G+ +  +V+R R++ ++ EDWE  +G HRF Y++LY AT+GF+     G+   G
Sbjct  343  VGVTIFLLVRRHRRYAELREDWEVEFGPHRFPYKDLYYATQGFRNKNLLGVGGFG  397



>emb|CDP14357.1| unnamed protein product [Coffea canephora]
Length=587

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
             V+  V+ K+KF +VLEDWE  YG HR+KY++LY+ATKGF+
Sbjct  306  GVIYHVRIKKKFAEVLEDWEREYGPHRYKYKDLYIATKGFR  346



>gb|KCW49555.1| hypothetical protein EUGRSUZ_K03077 [Eucalyptus grandis]
Length=658

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            IL  A+   ++++RKF +VLEDWE  Y  HR KY++LY+ATKGF+
Sbjct  300  ILVFAMAYAIRKQRKFAEVLEDWERDYSEHRIKYKDLYVATKGFR  344



>gb|KEH22942.1| lectin-like receptor kinase family protein, putative [Medicago 
truncatula]
Length=214

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGL  159
            ++ L V+  ++ K KF++VLEDWEH YG HRFK+++LY ATKGF++ +  G+
Sbjct  76   MISLGVMYYIKLK-KFDEVLEDWEHEYGPHRFKFKDLYFATKGFRENELLGV  126



>ref|XP_010037808.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=669

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            IL  A+   ++++RKF +VLEDWE  Y  HR KY++LY+ATKGF+
Sbjct  300  ILVFAMAYAIRKQRKFAEVLEDWERDYSEHRIKYKDLYVATKGFR  344



>gb|EMT08163.1| Lectin-domain containing receptor kinase A4.3 [Aegilops tauschii]
Length=706

 Score = 57.0 bits (136),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            ++LG+ V   V+R+ KF ++ EDWE  +  HRF Y+ELY ATKGF
Sbjct  334  LVLGIGVYIFVRRRLKFSELREDWEDAFAPHRFSYKELYHATKGF  378


 Score = 27.3 bits (59),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLL  191
            +GF ++ +LG G  G VYRG L
Sbjct  376  KGFSDKNLLGAGGFGSVYRGKL  397



>ref|XP_004165544.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing 
receptor kinase IV.2-like [Cucumis sativus]
Length=677

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 5/53 (9%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            L ++  + R+RKF ++LEDWE  YG  RFKY++LY ATKGF++      EFLG
Sbjct  305  LGLIYFIYRRRKFAEILEDWELEYGPQRFKYKDLYKATKGFREK-----EFLG  352



>emb|CDP14356.1| unnamed protein product [Coffea canephora]
Length=401

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  19   VVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +V  V+RKRKF +V+E+WE  YG HRF+Y++LY+ATKGFK
Sbjct  35   IVYYVRRKRKFAEVVEEWELAYGPHRFRYKDLYIATKGFK  74



>ref|XP_007206374.1| hypothetical protein PRUPE_ppa017920mg, partial [Prunus persica]
 gb|EMJ07573.1| hypothetical protein PRUPE_ppa017920mg, partial [Prunus persica]
Length=676

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  31   VQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            ++RK+KF ++LEDWE  YG  RFKY+ELY+ATKGF++ +  G
Sbjct  317  IRRKKKFAELLEDWELEYGPQRFKYKELYMATKGFREKELLG  358



>ref|XP_002445040.1| hypothetical protein SORBIDRAFT_07g003240 [Sorghum bicolor]
 gb|EES14535.1| hypothetical protein SORBIDRAFT_07g003240 [Sorghum bicolor]
Length=1367

 Score = 55.1 bits (131),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  7     LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
             +G  V+ V+QR+ K+ +V EDWE  +G HRF Y++L+ AT GFK
Sbjct  1021  IGTIVILVIQRRLKYAEVREDWEAEFGPHRFSYKDLFHATGGFK  1064


 Score = 29.3 bits (64),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 11/27 (41%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  129   GFQERKILGIGVLGIVYRGLLPETQLQ  209
             GF+ + +LG G  G VY+G+LP + ++
Sbjct  1062  GFKNKHLLGEGGFGKVYKGVLPLSNVE  1088


 Score = 46.2 bits (108),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKS  150
            LG     +++R  ++ +V EDWE  +G HRF Y++L+ AT GF + K+
Sbjct  315  LGTIAFLLLRRHFRYAEVREDWELEFGPHRFSYKDLFHATGGFDQNKN  362


 Score = 29.6 bits (65),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 20/27 (74%), Gaps = 1/27 (4%)
 Frame = +3

Query  129  GF-QERKILGIGVLGIVYRGLLPETQL  206
            GF Q + +LG+G  G VY+G+LP ++L
Sbjct  356  GFDQNKNLLGVGGFGRVYKGVLPISRL  382



>ref|XP_004142200.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Cucumis sativus]
Length=678

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 5/53 (9%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            L ++  + R+RKF ++LEDWE  YG  RFKY++LY ATKGF++      EFLG
Sbjct  306  LGLIYFIYRRRKFAEILEDWELEYGPQRFKYKDLYKATKGFREK-----EFLG  353



>ref|XP_003581453.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Brachypodium distachyon]
Length=692

 Score = 49.3 bits (116),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +G  ++  V RK +++++ EDWE  +G HRF +++L+ ATKGFK+
Sbjct  329  VGTVILLFVLRKLRYKELREDWEVDFGPHRFSFKDLFHATKGFKQ  373


 Score = 35.0 bits (79),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++R +LG G  G VY+G+LP+++++
Sbjct  369  KGFKQRNLLGEGGFGKVYKGVLPKSKME  396



>ref|XP_010262895.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Nelumbo nucifera]
Length=658

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGL  159
             ++ +++RKRKF +V EDWE  YG HRFK+++LY+AT+GF + +  G+
Sbjct  308  GILFILRRKRKFAEVHEDWELQYGPHRFKFKDLYIATRGFSEKELLGM  355



>ref|XP_008240486.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Prunus mume]
Length=676

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +++  ++RK+KF ++LEDWE  YG  RFKY+ELY+ATKGF + +  G
Sbjct  317  SLIYAIRRKKKFAELLEDWELEYGPQRFKYKELYMATKGFMEKELLG  363



>ref|XP_009350763.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Pyrus x bretschneideri]
Length=666

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            + ++  ++ KRKF ++LEDWE  YG  RFKY ELY+ATKGFK+ +  G
Sbjct  302  VGIIYAIRWKRKFAELLEDWELEYGPQRFKYRELYVATKGFKEKELLG  349



>gb|KGN54269.1| hypothetical protein Csa_4G296230 [Cucumis sativus]
Length=667

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 5/53 (9%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            L ++  + R+RKF ++LEDWE  YG  RFKY++LY ATKGF++      EFLG
Sbjct  306  LGLIYFIYRRRKFAEILEDWELEYGPQRFKYKDLYKATKGFREK-----EFLG  353



>ref|XP_004305189.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Fragaria vesca subsp. vesca]
Length=672

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +++RKRKF +VLEDWE  YG  RFKY+ELY+ATKGF++
Sbjct  310  IIRRKRKFAEVLEDWELEYGPQRFKYKELYIATKGFRE  347



>ref|XP_009417021.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing 
receptor kinase IV.3-like [Musa acuminata subsp. malaccensis]
Length=1330

 Score = 53.9 bits (128),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = +1

Query  1     VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
             +I+G+ VV +++R+ K+ ++LEDWE  YG HRF Y++L+ A KGF+
Sbjct  968   IIVGI-VVFILRRRTKYSELLEDWELEYGPHRFSYKDLFKAAKGFR  1012


 Score = 30.0 bits (66),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +3

Query  126   QGFQERKILGIGVLGIVYRGLLPETQ  203
             +GF++ ++LG G  G VY+G+LP ++
Sbjct  1009  KGFRDTELLGRGGFGRVYKGVLPSSR  1034


 Score = 44.7 bits (104),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  40   KRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            K K+ ++LEDWE  YG +RF Y++L+ ATKGF
Sbjct  313  KIKYAELLEDWELEYGPYRFSYKDLFGATKGF  344


 Score = 28.9 bits (63),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLP  194
            +GF + ++LG G  G VY+G+LP
Sbjct  342  KGFMDEELLGRGGFGRVYKGVLP  364



>ref|XP_002441537.1| hypothetical protein SORBIDRAFT_09g028880 [Sorghum bicolor]
 gb|EES19967.1| hypothetical protein SORBIDRAFT_09g028880 [Sorghum bicolor]
Length=671

 Score = 53.1 bits (126),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            ++ G  VV +V+R  ++++V EDWE  YG HRF Y++LY ATKGF
Sbjct  303  LLTGTIVVLLVRRHFRYKEVHEDWEVEYGPHRFAYKDLYNATKGF  347


 Score = 30.8 bits (68),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 10/26 (38%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQ  203
            +GF  + ++G+G  G VY+G+LP ++
Sbjct  345  KGFSAKNLIGVGGFGRVYKGVLPTSK  370



>emb|CDP13825.1| unnamed protein product [Coffea canephora]
Length=332

 Score = 53.5 bits (127),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
             ++  V+ K+KF +VLEDWEH YG HRFKY++LY+ TK F+
Sbjct  52   GIIYQVRIKKKFAEVLEDWEHDYGYHRFKYKDLYITTKMFR  92


 Score = 30.4 bits (67),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +3

Query  132  FQERKILGIGVLGIVYRGLLPETQLQ  209
            F++R++LG G  G VY G+LP ++L+
Sbjct  91   FRDRELLGRGDFGKVYIGVLPSSKLE  116



>ref|XP_002314159.2| hypothetical protein POPTR_0009s04030g [Populus trichocarpa]
 gb|EEE88114.2| hypothetical protein POPTR_0009s04030g [Populus trichocarpa]
Length=676

 Score = 48.5 bits (114),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  37   RKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            R++K+E++ EDWE  YG  R  Y++LY ATKGF
Sbjct  319  RRKKYEELREDWEQEYGPQRISYKDLYKATKGF  351


 Score = 35.4 bits (80),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF ++++LG G  G VYRG+LP + +Q
Sbjct  349  KGFTDKELLGCGGFGKVYRGVLPSSNMQ  376



>ref|XP_010539955.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing 
receptor kinase V.9-like [Tarenaya hassleriana]
Length=671

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    ILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            I+ + V+ V  +++KF ++LEDWE  +G HRF Y++LY+ATKGFK  +  G
Sbjct  305  IVSVFVLMVFHQRKKFMEILEDWEVQFGPHRFSYKDLYIATKGFKNSELLG  355



>emb|CDP14367.1| unnamed protein product [Coffea canephora]
Length=672

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +1

Query  7    LGLAVVKVVQRKR---KFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            L +A+  V+ R R   KF +VL+DWE  YG HRFKY++LY+ATKGF+
Sbjct  299  LSIAISGVIYRVRINKKFAEVLDDWEREYGPHRFKYKDLYIATKGFR  345



>gb|EMS64362.1| L-type lectin-domain containing receptor kinase IV.1 [Triticum 
urartu]
Length=670

 Score = 53.9 bits (128),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +G  V  VV+R+ K+ +V EDWE  +G HRF Y++L+ AT+GFK
Sbjct  306  MGTLVTLVVRRRLKYAEVREDWEGEFGPHRFSYKDLFHATRGFK  349


 Score = 30.0 bits (66),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF+ + +LG G  G VY+G+LP   ++
Sbjct  346  RGFKNKHLLGEGGFGKVYKGVLPSCNVE  373



>gb|KDO52363.1| hypothetical protein CISIN_1g007869mg [Citrus sinensis]
Length=586

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             VV V++ KRKF + LEDWE  +G HRF+Y++LY+ATKGF++ +  G
Sbjct  224  GVVYVIRMKRKFAEELEDWELDHGPHRFRYKDLYIATKGFREKELLG  270



>ref|XP_008369930.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Malus domestica]
Length=661

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  19   VVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            V   ++RK+KF ++LEDWE  YG  RFKY ELY+ATKGF++ +  G
Sbjct  301  VYYAIRRKKKFAELLEDWELEYGPQRFKYRELYIATKGFREKELLG  346



>emb|CDP17277.1| unnamed protein product [Coffea canephora]
Length=682

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 9/71 (13%)
 Frame = +1

Query  31   VQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG---------*SIE  183
            ++RK KF +VLE+WE  YG HRFKY++LY+ATKGF + +  G    G           +E
Sbjct  321  LKRKWKFAEVLEEWELAYGPHRFKYKDLYIATKGFTEKQLLGEGGFGRVYKGVLPTNKVE  380

Query  184  VYCLKLNYSAR  216
            V   K++Y AR
Sbjct  381  VAVKKVSYHAR  391



>gb|EPS73694.1| hypothetical protein M569_01059, partial [Genlisea aurea]
Length=662

 Score = 48.9 bits (115),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  31   VQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            + ++ K+ +V+E WE  Y SHRFKY +LY ATKGFK
Sbjct  305  INQRVKYSEVIEGWELDYISHRFKYRDLYKATKGFK  340


 Score = 35.0 bits (79),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF++R +LG G  G VYRG++P T+++
Sbjct  337  KGFKDRGLLGTGGFGKVYRGVMPGTKVE  364



>ref|XP_006657424.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Oryza brachyantha]
Length=1202

 Score = 50.1 bits (118),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  10   GLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            G+ +V  V+R+  + ++ EDWE  +G HRF Y++LY AT+GFK
Sbjct  829  GVLLVLCVRRRLMYREIQEDWEVEFGPHRFSYKDLYDATQGFK  871


 Score = 33.5 bits (75),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 14/33 (42%), Positives = 23/33 (70%), Gaps = 4/33 (12%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLP----ETQLQC  212
            QGF+++ +LG+G  G VY+G+LP    E  ++C
Sbjct  868  QGFKDKCLLGVGGFGKVYKGVLPVSKQEVAVKC  900


 Score = 49.3 bits (116),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            +++G A+  +V+R+ ++ ++ EDWE  +G HRF Y +L+ AT+GF
Sbjct  230  LVVGTAISLLVRRRMRYAELREDWEVEFGPHRFTYRDLFHATEGF  274


 Score = 29.3 bits (64),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 11/22 (50%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLL  191
            +GF ++ +LGIG  G VY+G+L
Sbjct  272  EGFDDKNLLGIGGAGRVYKGIL  293



>emb|CDP10819.1| unnamed protein product [Coffea canephora]
Length=678

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             V   ++RK KF +VLE+WE  YG HRFKY++LY+ATKGF++ +  G
Sbjct  311  GVAYYLRRKWKFAEVLEEWELAYGPHRFKYKDLYIATKGFREKEVLG  357



>emb|CDP19583.1| unnamed protein product [Coffea canephora]
Length=677

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
              V   ++RK KF +VLE+WE  YG HRFKY++LY+ATKGF + +  G
Sbjct  310  FGVAYYLRRKWKFAEVLEEWELAYGPHRFKYKDLYIATKGFTQKQLLG  357



>ref|XP_008790452.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Phoenix dactylifera]
Length=626

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  19   VVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            V+ VV+RK KF ++LEDWE  YG+HRF Y +LY AT GFK     G+   G
Sbjct  305  VLFVVRRKNKFAEILEDWELEYGTHRFSYRDLYRATHGFKDSGLLGVGGFG  355



>emb|CDP10820.1| unnamed protein product [Coffea canephora]
Length=685

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +IL   V     RK KF +VLE+WE  YG HRFKY++LY+ATKGF++ +  G
Sbjct  307  LILISGVAYYRSRKWKFAEVLEEWELAYGPHRFKYKDLYIATKGFREKEMLG  358



>gb|EMT08195.1| Lectin-domain containing receptor kinase A4.3 [Aegilops tauschii]
Length=643

 Score = 53.1 bits (126),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            +G+ V  +V+R+ ++ +V EDWE  +G HRF Y++L+ ATKGF +
Sbjct  301  MGIIVYILVRRRLRYAEVHEDWEKAFGPHRFSYKDLFQATKGFSQ  345


 Score = 30.4 bits (67),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 11/27 (41%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQL  206
            +GF ++ +LG G  G VY+G+L E+ +
Sbjct  341  KGFSQKNLLGAGGFGSVYKGVLRESHM  367



>ref|XP_003562841.2| PREDICTED: uncharacterized protein LOC100846075 [Brachypodium 
distachyon]
Length=1243

 Score = 53.9 bits (128),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            LG+ +   V+R+ K+ ++ EDWE  +G HRF Y+EL+ ATKGF +
Sbjct  319  LGVGIYIFVRRRIKYSELREDWEDAFGPHRFTYKELFHATKGFSE  363


 Score = 29.6 bits (65),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLL  191
            +GF E+ +LG G  G VYRG+L
Sbjct  359  KGFSEKNLLGEGGFGSVYRGVL  380


 Score = 52.4 bits (124),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  31   VQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            V R+R+F +V EDWE+ +G HRF Y++L+ AT GFK
Sbjct  886  VFRRRRFSEVREDWEYEFGPHRFAYKDLFHATNGFK  921


 Score = 28.5 bits (62),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 18/27 (67%), Gaps = 0/27 (0%)
 Frame = +3

Query  129  GFQERKILGIGVLGIVYRGLLPETQLQ  209
            GF+   ++G+G  G VY+G+LP +  +
Sbjct  919  GFKCSNLVGVGGFGRVYKGVLPASNFE  945



>ref|XP_010276641.1| PREDICTED: L-type lectin-domain containing receptor kinase V.9-like 
[Nelumbo nucifera]
Length=680

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            LA+V +++R  +F +V+EDWE  YG HRFKY +L++ATKGFK
Sbjct  314  LAIVLILRRNIQFREVVEDWEIQYGPHRFKYRDLFVATKGFK  355



>emb|CDP17271.1| unnamed protein product [Coffea canephora]
Length=663

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +IL   V   + RK KF +VLE+WE  YG HRFKY++LY+AT+GF++ +  G
Sbjct  306  IILTSGVAYYLWRKWKFAEVLEEWELAYGPHRFKYKDLYIATEGFREKELLG  357



>emb|CDP07846.1| unnamed protein product [Coffea canephora]
Length=553

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  31   VQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            ++RK KF +V+E+WE  YG HRFKY++LY+ATKGF++ +  G
Sbjct  315  LRRKWKFAEVMEEWELAYGPHRFKYKDLYIATKGFREKELLG  356



>ref|XP_008801685.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing 
receptor kinase IV.1-like [Phoenix dactylifera]
Length=613

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLE  162
            +I+G A   +V+R+ K+ ++LEDWEH YG HRF +++L+ ATKGFK  +  G++
Sbjct  302  MIVGAATF-LVRRRNKYAELLEDWEHEYGPHRFSFKDLFRATKGFKDKELLGVK  354



>gb|KFK30832.1| hypothetical protein AALP_AA6G031500 [Arabis alpina]
Length=1248

 Score = 50.4 bits (119),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +1

Query  28   VVQRKRKFEDVLEDWEHVYG-SHRFKYEELYLATKGFK  138
            ++ R+RKF + LEDWE   G +HR KY++LY ATKGFK
Sbjct  895  ILTRRRKFAEELEDWETKLGKNHRLKYKDLYYATKGFK  932


 Score = 32.7 bits (73),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQ  203
            +GF++  +LG G  G VY+G++P+T+
Sbjct  929  KGFKDNDLLGSGCFGSVYKGVMPKTE  954


 Score = 46.6 bits (109),  Expect(2) = 9e-08, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  40   KRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            KRKF + LEDWE  +  +R K+++LY ATKGFK+
Sbjct  235  KRKFAEELEDWETDFKKNRLKFKDLYYATKGFKE  268


 Score = 35.8 bits (81),  Expect(2) = 9e-08, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQ  203
            +GF+E+ +LG G  G VY+G++P+TQ
Sbjct  264  KGFKEKDLLGSGGFGSVYKGVMPKTQ  289



>ref|XP_008664036.1| PREDICTED: uncharacterized protein LOC103642561 [Zea mays]
Length=1374

 Score = 53.9 bits (128),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  7     LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
             +G  V  VV+R+ K+ +V EDWE  +G HRF Y++LY AT GFK
Sbjct  1010  IGTIVTLVVRRRLKYAEVREDWEGEFGPHRFSYKDLYHATGGFK  1053


 Score = 29.3 bits (64),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 11/27 (41%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  129   GFQERKILGIGVLGIVYRGLLPETQLQ  209
             GF+ + +LG G  G VY+G+LP + ++
Sbjct  1051  GFKNKHLLGEGGFGKVYKGVLPLSNVE  1077


 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            LG+    +V+R  ++ ++ EDWE  +G HRF Y++L+ AT GF+     G+   G
Sbjct  315  LGVVAFLLVRRHVRYAEIREDWELEFGPHRFSYKDLFHATGGFENKNLLGIGGFG  369



>gb|AFW57378.1| putative lectin-like receptor protein kinase family protein [Zea 
mays]
Length=669

 Score = 53.9 bits (128),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            +G  V  VV+R+ K+ +V EDWE  +G HRF Y++LY AT GFK
Sbjct  305  IGTIVTLVVRRRLKYAEVREDWEGEFGPHRFSYKDLYHATGGFK  348


 Score = 29.3 bits (64),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 11/27 (41%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  129  GFQERKILGIGVLGIVYRGLLPETQLQ  209
            GF+ + +LG G  G VY+G+LP + ++
Sbjct  346  GFKNKHLLGEGGFGKVYKGVLPLSNVE  372



>emb|CDP14370.1| unnamed protein product [Coffea canephora]
Length=673

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  31   VQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            ++RK KF +V+E+WE  YG HRFKY++LY+ATKGF++ +  G
Sbjct  315  LRRKWKFAEVMEEWELAYGPHRFKYKDLYIATKGFREKELLG  356



>ref|XP_011019817.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
isoform X1 [Populus euphratica]
Length=675

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  31   VQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFK  138
            ++R+RKF +VLEDWE  YG HRF + +LY+ATKGF+
Sbjct  312  IRRRRKFAEVLEDWELDYGPHRFNFRDLYIATKGFR  347



>ref|XP_003561446.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Brachypodium distachyon]
Length=667

 Score = 48.9 bits (115),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  13   LAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            L V+ +V+R+RK+ +V EDWE  +G HRF  ++L+ AT+GF
Sbjct  313  LIVLLLVRRRRKYAEVQEDWEVEFGPHRFSLKDLFRATEGF  353


 Score = 34.3 bits (77),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF  R +LG G  G VY+G+LP+++L+
Sbjct  351  EGFNNRHLLGRGGFGRVYKGVLPKSKLE  378



>ref|XP_008785542.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Phoenix dactylifera]
Length=669

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  34   QRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG  171
            +R++K+ ++LEDWEH YG HRF Y++L+ ATKGFK+    G    G
Sbjct  312  RRRKKYGEILEDWEHEYGPHRFSYKDLFKATKGFKEENLLGFGGFG  357



>emb|CDP14368.1| unnamed protein product [Coffea canephora]
Length=674

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 2/52 (4%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            VI GLA    + RK KF +VLE+WE  YG HRFK+++LY+ATKGF++ +  G
Sbjct  307  VISGLAYY--LGRKWKFAEVLEEWELAYGPHRFKFKDLYIATKGFREKELLG  356



>ref|XP_002534539.1| kinase, putative [Ricinus communis]
 gb|EEF27843.1| kinase, putative [Ricinus communis]
Length=669

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  22   VKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            V  ++RKRKF + LEDWE  Y  HRFKY++LY+ATKGFK  +  G
Sbjct  305  VYFIRRKRKFAEELEDWELDYWPHRFKYKDLYIATKGFKDKELLG  349



>ref|XP_004966927.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Setaria italica]
Length=678

 Score = 52.4 bits (124),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            +G   V +V+R  ++++V EDWE  YG HRF Y++LY ATKGF
Sbjct  311  IGTITVILVRRHLRYKEVHEDWEVEYGPHRFTYKDLYHATKGF  353


 Score = 30.8 bits (68),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 10/26 (38%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQ  203
            +GF  + ++G+G  G VY+G+LP ++
Sbjct  351  KGFSSKHLIGVGGFGRVYKGVLPTSK  376



>gb|KDP27315.1| hypothetical protein JCGZ_20940 [Jatropha curcas]
Length=549

 Score = 49.7 bits (117),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  37   RKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            RK+++ +VLEDWE  YG  R  Y++LY ATKGF
Sbjct  199  RKKRYGEVLEDWEQQYGPQRISYKDLYKATKGF  231


 Score = 33.5 bits (75),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQLQ  209
            +GF ++++LG G  G VY+G+LP   +Q
Sbjct  229  KGFNDKELLGCGGFGKVYKGVLPSNNVQ  256



>ref|XP_009144569.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.4-like 
isoform X1 [Brassica rapa]
Length=667

 Score = 47.8 bits (112),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  52   EDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            E+ LEDWE  +G HR KY++LY ATKGFK+
Sbjct  325  EEELEDWETRFGKHRLKYKDLYHATKGFKE  354


 Score = 35.4 bits (80),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQ  203
            +GF+E+ +LG G  G VYRG++P+T+
Sbjct  350  KGFKEKDLLGSGGFGSVYRGVMPKTK  375



>ref|XP_009144572.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.4-like 
isoform X3 [Brassica rapa]
Length=611

 Score = 47.4 bits (111),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  52   EDVLEDWEHVYGSHRFKYEELYLATKGFKK  141
            E+ LEDWE  +G HR KY++LY ATKGFK+
Sbjct  269  EEELEDWETRFGKHRLKYKDLYHATKGFKE  298


 Score = 35.4 bits (80),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  126  QGFQERKILGIGVLGIVYRGLLPETQ  203
            +GF+E+ +LG G  G VYRG++P+T+
Sbjct  294  KGFKEKDLLGSGGFGSVYRGVMPKTK  319



>emb|CDP17269.1| unnamed protein product [Coffea canephora]
Length=682

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   AVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
             V   ++RK KF ++LE+WE  YG HRFKY++LY+ATKGF++ +  G
Sbjct  315  GVAYYLRRKWKFAELLEEWELAYGPHRFKYKDLYIATKGFREKELLG  361



>ref|XP_010262892.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Nelumbo nucifera]
Length=659

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    VILGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWG  156
            +++ + V   + R++KF +VLEDWE  YG HRF Y++LY ATKGFK  +  G
Sbjct  291  LLITIIVTVYMIRRKKFAEVLEDWEQEYGPHRFAYKDLYRATKGFKDKELLG  342



>ref|XP_010269393.1| PREDICTED: L-type lectin-domain containing receptor kinase V.9-like 
[Nelumbo nucifera]
Length=682

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 3/52 (6%)
 Frame = +1

Query  34   QRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGFKKGKSWGLEFLG*SIEVY  189
            +RK KF +VLEDWE  YG HRF+Y++L++ATKGFK+ +  G    G   EVY
Sbjct  326  RRKIKFSEVLEDWEVQYGPHRFRYKDLFVATKGFKEKELLGRGGFG---EVY  374



>ref|XP_008790453.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Phoenix dactylifera]
Length=661

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +1

Query  7    LGLAVVKVVQRKRKFEDVLEDWEHVYGSHRFKYEELYLATKGF  135
            + LA   V+ RKRKF +++EDWE  YG HRF Y++LY+ATKGF
Sbjct  301  VALATFMVI-RKRKFAELIEDWELQYGPHRFSYKDLYMATKGF  342



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509447715952