BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1475_g1_i2 len=1001 path=[979:0-119 1099:120-1000]

Length=1001
                                                                      Score     E

ref|XP_011086152.1|  PREDICTED: transcription factor bHLH112-like       109   3e-23   
ref|XP_009629262.1|  PREDICTED: transcription factor bHLH112-like       107   1e-22   
ref|XP_009802434.1|  PREDICTED: transcription factor bHLH112-like       103   1e-21   
ref|XP_003635184.1|  PREDICTED: transcription factor bHLH112 isof...    100   4e-20   
ref|XP_010646711.1|  PREDICTED: transcription factor bHLH112 isof...    100   4e-20   
ref|XP_009764035.1|  PREDICTED: transcription factor bHLH112-like     99.8    4e-20   
emb|CDO99682.1|  unnamed protein product                              95.5    1e-18   
ref|XP_010240994.1|  PREDICTED: transcription factor bHLH123-like     88.6    4e-16   
ref|XP_009617305.1|  PREDICTED: transcription factor bHLH112-like     85.5    2e-15   
ref|XP_010267864.1|  PREDICTED: transcription factor bHLH112-like     86.3    2e-15   
ref|XP_004232764.1|  PREDICTED: transcription factor bHLH112          80.5    2e-13   
ref|XP_007025886.1|  Transcription factor, putative                   78.6    9e-13   
ref|XP_011009499.1|  PREDICTED: transcription factor bHLH112-like...  78.2    1e-12   
ref|XP_011009498.1|  PREDICTED: transcription factor bHLH112-like...  78.2    1e-12   
ref|XP_002317263.2|  hypothetical protein POPTR_0011s03560g           77.0    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006377272.1|  hypothetical protein POPTR_0011s03560g           76.6    4e-12   
ref|XP_007148281.1|  hypothetical protein PHAVU_006G195000g           76.6    4e-12   
ref|XP_007148280.1|  hypothetical protein PHAVU_006G195000g           76.6    4e-12   
ref|XP_011096171.1|  PREDICTED: transcription factor bHLH112 isof...  73.9    3e-11   
ref|XP_011096172.1|  PREDICTED: transcription factor bHLH112 isof...  73.9    3e-11   
ref|XP_006383985.1|  hypothetical protein POPTR_0004s02870g           66.6    9e-09   
gb|KDP20840.1|  hypothetical protein JCGZ_21311                       63.5    9e-08   
ref|XP_006449161.1|  hypothetical protein CICLE_v10015039mg           61.2    4e-07   
ref|XP_006467939.1|  PREDICTED: transcription factor bHLH112-like...  61.2    5e-07   
gb|KDO75640.1|  hypothetical protein CISIN_1g011373mg                 61.2    5e-07   
gb|KDO75641.1|  hypothetical protein CISIN_1g011373mg                 60.8    5e-07   
ref|XP_006449162.1|  hypothetical protein CICLE_v10015039mg           60.8    6e-07   
ref|XP_006467938.1|  PREDICTED: transcription factor bHLH112-like...  60.8    6e-07   
ref|XP_011003381.1|  PREDICTED: transcription factor bHLH112 isof...  60.1    1e-06   
ref|XP_011003380.1|  PREDICTED: transcription factor bHLH112 isof...  60.1    1e-06   
ref|XP_011003379.1|  PREDICTED: transcription factor bHLH112 isof...  60.1    1e-06   
ref|XP_008224896.1|  PREDICTED: transcription factor bHLH112 isof...  56.2    2e-05   
ref|XP_010057695.1|  PREDICTED: transcription factor bHLH112-like     55.8    3e-05   
gb|AFK38358.1|  unknown                                               53.9    9e-05   
ref|XP_007211684.1|  hypothetical protein PRUPE_ppa005924mg           53.9    1e-04   
ref|XP_002518591.1|  transcription factor, putative                   53.1    2e-04   Ricinus communis
ref|XP_003528420.1|  PREDICTED: transcription factor bHLH123-like     52.4    3e-04   
ref|XP_007159223.1|  hypothetical protein PHAVU_002G2196001g          52.0    4e-04   



>ref|XP_011086152.1| PREDICTED: transcription factor bHLH112-like [Sesamum indicum]
Length=469

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 106/361 (29%), Positives = 153/361 (42%), Gaps = 96/361 (27%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWWNPTRNMFGSYLCSASMNDIGSFVAWPPSH-------------HD  661
            MA++F    VCGG WWNP RN+FGS  C++++ND+GSF  W  +H              D
Sbjct  1    MAEDFQ-GGVCGGNWWNPQRNLFGSSPCASAINDMGSF-GWLQNHDLMMDVSTARSISDD  58

Query  660  GEVTAEVNG------------RPPSTDHSPTATAAATDDWNQVLMQDNE-RGDRSYGSML  520
               +A  +G            + P+ D +    A+ TDDWNQ L+ D+  R +  Y  ML
Sbjct  59   SACSAASDGASSVLIQDVQKPQQPTGDGNMPMFASTTDDWNQDLLHDHSGRSEDDYSRML  118

Query  519  QE--DLNYGVQETLTV--------------------------------------------  478
            QE   LNY +  T  V                                            
Sbjct  119  QEAAGLNYRLTTTDVVDKCPDQNHKNWSAKNFCEDSSINPFKQVNNQSFPLEPQPSNSLT  178

Query  477  -----IPSSSQELSTSFPITS---YNNYPPNLLKSMFDADPHQPHQQCLISSQPV-ISYA  325
                 +P++SQ LST+FP+ +   Y+    +LL+++FD D  QPH+Q L+ +Q    S  
Sbjct  179  SSTQCVPTNSQGLSTTFPLMNSASYSYSTSSLLQTLFDTDSDQPHEQSLLDNQATNYSSY  238

Query  324  PATTAAMTNYGPNlsdfspsppkfssllsPTNH----------HLQFPssislwdsslts  175
            P      T + P+L+    +     +   P NH          +    +S +    S   
Sbjct  239  PNHRINSTEFLPSLTKAPTTSKPSLAKQQPANHLPFTNNTSFWNAMAAASGANVLPSTQP  298

Query  174  cSFPSPTFTDKK---PAITAKLNGSNNKELRDSSCVANKTKPDFKRPRIETPSPLPTFKV  4
               P P     K   P I+AK +   + +   S+      +P FKRPRIETPSPLPTFKV
Sbjct  299  RFLPPPMINSAKSNLPNISAKHHKEEDPKDLASAVKKFSNEPSFKRPRIETPSPLPTFKV  358

Query  3    R  1
            R
Sbjct  359  R  359



>ref|XP_009629262.1| PREDICTED: transcription factor bHLH112-like [Nicotiana tomentosiformis]
Length=447

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 115/345 (33%), Positives = 160/345 (46%), Gaps = 84/345 (24%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWWNPTRNMFGSYLCSASMNDIGSFVAWPPSHH-DGEVTAEVNGRPP  625
            MADEF  A VCGG WWN +R++FGS LC+AS   IG+  AWP +   D + +   N    
Sbjct  1    MADEFQ-AGVCGGNWWNSSRSIFGSSLCAAS--SIGNNFAWPNNDLLDMKSSCRSNDESG  57

Query  624  STDHS--------------------PTATAAATDDWNQVLMQDNERGDRSYGSMLQEDLN  505
            ++D S                     +++ ++T DWN  +M  NER D SY S+LQEDLN
Sbjct  58   NSDESVVLQELPKHDSTLQMLGIGLSSSSTSSTPDWNHTMMHGNERADSSYPSILQEDLN  117

Query  504  YGV---QET------------LTVIPSSSQE-------------------------LSTS  445
              +   QET             T+   SS+                          +S+S
Sbjct  118  SSLNYRQETGVDCSHELGKNFSTITEDSSRNSFKHQDFTLGMNPITSSTNTDQSTVISSS  177

Query  444  FPI-TSYNNYPPNLLKSMFDADPHQPHQQCLISSQPVI-SYAPATTAAMTNYGPNlsdfs  271
            FP+ +S++NYP  LL+++FD DP  P QQ          +  P    A  NY PNL+D  
Sbjct  178  FPMNSSFSNYPSALLQTLFDNDPPPPPQQQPQQQSLFTNNNQPMNFPATLNYRPNLNDHF  237

Query  270  psppkfssllsPTNHHLQ----FPssislwdssltscSFPS--------PTFTDKK--PA  133
                     L   +   Q    FP +     +++     PS        PTF +K   P 
Sbjct  238  SPSLPKFPPLLRPSLPKQTPSNFPFTNPTSLNNMRGNLLPSMHSQLLPLPTFHEKSSAPN  297

Query  132  ITAKLNGSNNKELRDSSC-VANKTKPDFKRPRIETPSPLPTFKVR  1
            ++AK   SN +E R+S    +  ++P FKRPR+ETPSPLPTFKVR
Sbjct  298  VSAK---SNVEEFRESRAKKSGNSEPAFKRPRMETPSPLPTFKVR  339



>ref|XP_009802434.1| PREDICTED: transcription factor bHLH112-like [Nicotiana sylvestris]
Length=336

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 136/287 (47%), Gaps = 75/287 (26%)
 Frame = -3

Query  801  MADEFSTAAVCG-GGWWNPTRNMFGSYLCSASMND--IGSFVAWPPSHHDGEVTAEVNGR  631
            MADE+  A VCG   WWN T+N+FG   C++S+ D  IG+ ++WP S    ++  +++  
Sbjct  1    MADEYFQAGVCGESSWWNSTKNIFGLSPCASSIYDDPIGNLISWPISDL-LDMKTKIDLS  59

Query  630  PPSTDHSPTATAAATDDWNQVLMQDNERGDRSYGSMLQEDLNYGV---QETLTVIP----  472
             PS          +T DWN      N++ D +Y SMLQED+N  +   QE     P    
Sbjct  60   SPS----------STLDWNHSA---NDKLDNTYPSMLQEDINSSLNYQQENGVDCPNKLK  106

Query  471  ----SSSQELST-SFPITSYNNYPPNLLKSMFDADP-HQPHQQCLISSQPVISYAPATTA  310
                S +++ ST S P+     Y  +LL+++FD DP  QP Q    ++QP+   +     
Sbjct  107  RNFSSITEDSSTNSKPMNQDFTYYSDLLQTLFDTDPDQQPQQSFFTNNQPINCTSSNYRQ  166

Query  309  AMTNYGPNlsdfspsppkfssllsPTNHHLQFPssislwdssltscSFPSPTFTDKKPAI  130
            +  ++ P+L                                         PT ++ + ++
Sbjct  167  SFNDFAPSL-----------------------------------------PTSSEIRASL  185

Query  129  TAKLNGSNNKELRDSSCVA----NKTKPDFKRPRIETPSPLPTFKVR  1
                + SN +E+R+S+  +    N  +P +KRPRIETPSPLPTFKVR
Sbjct  186  PNITSKSNIEEIRESTSRSLTKNNSNEPSYKRPRIETPSPLPTFKVR  232



>ref|XP_003635184.1| PREDICTED: transcription factor bHLH112 isoform X1 [Vitis vinifera]
 emb|CBI18658.3| unnamed protein product [Vitis vinifera]
Length=464

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 109/361 (30%), Positives = 150/361 (42%), Gaps = 99/361 (27%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWWNPTRNMF--GSYLCSASMNDIGSFVAWP--------------PS  670
            MADEF T  VCGG WWNP RN F  G   CS ++ND GSF  WP               S
Sbjct  1    MADEFQTG-VCGGTWWNPARNSFIGGPSPCSTALNDTGSF-GWPTEMVDIKARSCEESAS  58

Query  669  HHDGEVTAEVNGRPPSTDHSP-----------------TATAAATDDWNQVLMQDNERGD  541
              D  +  +   +P   D +                   ++++ T DWN  L++ + R +
Sbjct  59   VSDSSIVFQDIQKPQQPDSASGGGSMLMESTLQMMGFGLSSSSTTTDWNPALIRGSGRAE  118

Query  540  RSYGSMLQEDL------------------------------------NYGV---QETLTV  478
             +Y SMLQ+D+                                    N G    Q+ L  
Sbjct  119  SNYHSMLQDDMSSRLNGMDSPQIQKDWSPKNFSTGGEDSSICALKPMNQGFALDQQRLNS  178

Query  477  IPSSS------QELSTSFPITSYN-NYPPNLLKSMFDADPHQPHQQCLISSQPVISYAPA  319
            I SS       Q  S+ FP+ S +  YP  LL+ ++D DP QP Q    +     S    
Sbjct  179  INSSGDSTVTCQGFSSGFPMGSASYGYPSTLLQGLYDPDP-QPQQYLFDNRSMNYSSMAN  237

Query  318  TTAAMTNYGPNlsdfspsppkfssllsPTNHHLQFPs------sislwdssltscSFPSP  157
               +M    P+   +SP          P N HL F +      + +   + + +  FPSP
Sbjct  238  YRTSMNELSPSWPKYSPYMKPSLPKQQP-NSHLHFTNNTPFWNASAAALNDIRASFFPSP  296

Query  156  -------TFTDKKPAITAKLNGSNNKELRDSSCVANKT--KPDFKRPRIETPSPLPTFKV  4
                   TF ++KP  +      N +E+RDS  V  K+  +P FKRPRIETPSPLPTFKV
Sbjct  297  QSQFLTPTF-EEKPNCSKLTTKLNTEEVRDSGSVLKKSSAEPAFKRPRIETPSPLPTFKV  355

Query  3    R  1
            R
Sbjct  356  R  356



>ref|XP_010646711.1| PREDICTED: transcription factor bHLH112 isoform X2 [Vitis vinifera]
Length=462

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 109/361 (30%), Positives = 150/361 (42%), Gaps = 99/361 (27%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWWNPTRNMF--GSYLCSASMNDIGSFVAWP--------------PS  670
            MADEF T  VCGG WWNP RN F  G   CS ++ND GSF  WP               S
Sbjct  1    MADEFQTG-VCGGTWWNPARNSFIGGPSPCSTALNDTGSF-GWPTEMVDIKARSCEESAS  58

Query  669  HHDGEVTAEVNGRPPSTDHSP-----------------TATAAATDDWNQVLMQDNERGD  541
              D  +  +   +P   D +                   ++++ T DWN  L++ + R +
Sbjct  59   VSDSSIVFQDIQKPQQPDSASGGGSMLMESTLQMMGFGLSSSSTTTDWNPALIRGSGRAE  118

Query  540  RSYGSMLQEDL------------------------------------NYGV---QETLTV  478
             +Y SMLQ+D+                                    N G    Q+ L  
Sbjct  119  SNYHSMLQDDMSSRLNGMDSPQIQKDWSPKNFSTGGEDSSICALKPMNQGFALDQQRLNS  178

Query  477  IPSSS------QELSTSFPITSYN-NYPPNLLKSMFDADPHQPHQQCLISSQPVISYAPA  319
            I SS       Q  S+ FP+ S +  YP  LL+ ++D DP QP Q    +     S    
Sbjct  179  INSSGDSTVTCQGFSSGFPMGSASYGYPSTLLQGLYDPDP-QPQQYLFDNRSMNYSSMAN  237

Query  318  TTAAMTNYGPNlsdfspsppkfssllsPTNHHLQFPs------sislwdssltscSFPSP  157
               +M    P+   +SP          P N HL F +      + +   + + +  FPSP
Sbjct  238  YRTSMNELSPSWPKYSPYMKPSLPKQQP-NSHLHFTNNTPFWNASAAALNDIRASFFPSP  296

Query  156  -------TFTDKKPAITAKLNGSNNKELRDSSCVANKT--KPDFKRPRIETPSPLPTFKV  4
                   TF ++KP  +      N +E+RDS  V  K+  +P FKRPRIETPSPLPTFKV
Sbjct  297  QSQFLTPTF-EEKPNCSKLTTKLNTEEVRDSGSVLKKSSAEPAFKRPRIETPSPLPTFKV  355

Query  3    R  1
            R
Sbjct  356  R  356



>ref|XP_009764035.1| PREDICTED: transcription factor bHLH112-like [Nicotiana sylvestris]
Length=455

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 111/352 (32%), Positives = 156/352 (44%), Gaps = 90/352 (26%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWWNPTRNMFGSYLCSASMNDIGSFVAWPPSH-HDGEVTAEVNGRPP  625
            MADEF  A VCGG WWN +R++FGS LC+AS   IG+  AWP +   D + +   N    
Sbjct  1    MADEFQ-AGVCGGNWWNSSRSIFGSSLCAAS--SIGNNFAWPNNDLLDMKSSCRSNDESG  57

Query  624  STDHS-------------------------PTATAAATDDWNQVLMQDNERGDRSYGSML  520
            ++D S                          +++ ++T DWN  +M  NER D SY ++L
Sbjct  58   NSDDSVVLQELPKHHQQPHDSTLQMLGIGLSSSSISSTPDWNHTMMHGNERADSSYPTIL  117

Query  519  QEDLNYGV---QET-----------------------------------LTVIPSS----  466
            QEDLN  +   QET                                   +  I SS    
Sbjct  118  QEDLNSSLNYRQETGVDCSHELGKNFSTITEDSSNNSYKQVNHQDFTLGMNPITSSTNTD  177

Query  465  -SQELSTSFPI-TSYNNYPPNLLKSMFDADPHQPHQQCLISSQPVISYAPATTAAMTNYG  292
             S  +S+SFP+ +S++NYP  LL+++FD DP    QQ    S    +  P       NY 
Sbjct  178  QSTVISSSFPMNSSFSNYPSALLQTLFDNDPPPHQQQPQQQSLFTNNNQPMNFPVSLNYR  237

Query  291  PNlsdfspsppkfssllsPTNHHLQ----FPssislwdssltscSFP---------SPTF  151
            PNL+D           L   +   Q    FP +     +++     P         SPTF
Sbjct  238  PNLNDHFSPSLPKFPPLLRPSLPKQTPSSFPFTDPTSLNNMRGNLLPSMHSQLLLQSPTF  297

Query  150  TDKK--PAITAKLNGSNNKELRDSSCVANKTKPDFKRPRIETPSPLPTFKVR  1
             +K   P  +AK +    +E R  +  +  ++P FKRPR+ETPSPLPTFKVR
Sbjct  298  HEKSSVPNNSAKSDVEGFRESR--AKKSGNSEPAFKRPRMETPSPLPTFKVR  347



>emb|CDO99682.1| unnamed protein product [Coffea canephora]
Length=468

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 110/368 (30%), Positives = 161/368 (44%), Gaps = 109/368 (30%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWWNPTRNMFGSYLCSAS-MNDIGSFVAWPPSHHDGEVTA--EVNGR  631
            MADEF    VCGG WWN +R+MFGS  CS+  ++D+GSF  W     D +  +  + +G 
Sbjct  1    MADEFQ-GEVCGGSWWNSSRSMFGSSPCSSGILHDLGSF-GWSTDFLDSKARSSDDQSGN  58

Query  630  PPSTDHSPTA-------------------------------TAAATDDWNQVLMQ--DNE  550
              ++D S                                  ++ +T DW++ LM    N 
Sbjct  59   SANSDGSIVIQDLQKPNQPESASNNSNLSIDSTLQILGIGLSSPSTTDWDRTLMHGSSNG  118

Query  549  RGDRS-YGSMLQED----LNYGVQETLTVIPSSSQE------------------------  457
            R D+S Y  MLQED    +NY  +  L   P+   +                        
Sbjct  119  RSDQSNYQPMLQEDHNSSMNYRQERGLDSCPADQIQKDWSSTLKNNFSTIVEEDSSINSF  178

Query  456  ------------------------LSTSFPITSYN-NYPPNLLKSMFDADPHQPHQQCLI  352
                                    +STSFPI+S +  Y   LL+++FD +  QP QQ L 
Sbjct  179  KSSGNQPLNSITTTSQCTAATCAGVSTSFPISSASYGYSSTLLQTLFDTEVPQP-QQSLY  237

Query  351  SSQPVISYAPATTAAMTNYGPNlsdfspsppkfssllsPTNHHLQFPssislwdss----  184
             ++P ++Y P+TT+    + P+L  FSP P   ++     + +  F +  +   +     
Sbjct  238  GTRP-MNY-PSTTSYQNEFSPSLPKFSPLPKLQNTNSLQLSTNPNFCNGSAAAFNDLRVN  295

Query  183  ---ltscSFPSPTFTDK--KPAITAKLNGSNNKELRDSSCVANK--TKPDFKRPRIETPS  25
                    FPS TF +K   P+IT K+   +N  +R    VA K  ++P FKRPRIETPS
Sbjct  296  FFPSVQSQFPSSTFNEKPSLPSITTKV---SNDGIRGLGSVAKKSSSEPAFKRPRIETPS  352

Query  24   PLPTFKVR  1
            PLPTFKVR
Sbjct  353  PLPTFKVR  360



>ref|XP_010240994.1| PREDICTED: transcription factor bHLH123-like [Nelumbo nucifera]
Length=463

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 108/363 (30%), Positives = 150/363 (41%), Gaps = 104/363 (29%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWWNPTRNMF--GSYLCSASMNDIGSFVAWPPSHHD-----------  661
            MAD+F T  VC G WWNPTRN F   S  CS ++NDIGSF  WP    D           
Sbjct  1    MADQFQTG-VCSGNWWNPTRNGFNGNSSPCSTALNDIGSF-GWPTEMVDMKTRSTEESAS  58

Query  660  -------------GEVTAEVNGRPPSTDHSPTA-----TAAATDDWNQVLMQDNERGDRS  535
                          +V   V+G     D +        ++  T DWNQ L++ + RG+ +
Sbjct  59   VCDSSIVFSDTQKQQVADSVSGGGVLMDSTLQIMGFGLSSPTTVDWNQALLRSSGRGEAN  118

Query  534  YGSMLQEDL------------------------NYGV--------------------QET  487
            + SMLQE+L                        N+ V                    Q+ 
Sbjct  119  FHSMLQEELSSRHSFRQETSMESSQLQKEWSPKNFSVSGEDSSINALKQINQVFALDQQR  178

Query  486  LTVIPSSS------QELSTSFPITSYN-NYPPNLLKSMFDADPHQPHQQCLISSQPVISY  328
            L  I SSS      Q L TSFP++S +      LL+ +F+ DP Q  Q    +    I+ 
Sbjct  179  LNSINSSSECTVTCQGLPTSFPMSSTSYGCTSTLLQGLFETDP-QSQQSSFENGS--INL  235

Query  327  APATTAAMTNYGPNlsdfspsppkfssllsPTNH-HLQ----FPssislwdssltscSFP  163
             P       +  P+   FS            TN  H      F ++ +   + + S  FP
Sbjct  236  LPNCRINSNDISPSWPKFSQLLKTSPPKQQSTNQLHFSNKGPFWNASAAAMNEVRSSYFP  295

Query  162  S-------PTFTDKKPAITAKLNGSNNKELRDSSCVANK--TKPDFKRPRIETPSPLPTF  10
            S       PTF ++KP  +     S+ +++RDS+    K  ++P FKRPRIET  PLPTF
Sbjct  296  SSQTQLLTPTF-EEKPNCSNLTAKSSTEDVRDSASAVKKGNSEPAFKRPRIET--PLPTF  352

Query  9    KVR  1
            KVR
Sbjct  353  KVR  355



>ref|XP_009617305.1| PREDICTED: transcription factor bHLH112-like [Nicotiana tomentosiformis]
Length=353

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 97/288 (34%), Positives = 132/288 (46%), Gaps = 60/288 (21%)
 Frame = -3

Query  801  MADEFSTAAVCG-GGWWNPTRNMFG-SYLCSASMND-IGSFVAWPPSHHDGEVTAEVNGR  631
            MADEF    VCG   WWN T+N+FG S  C +S+ D IG  ++WP S      T   +  
Sbjct  1    MADEFQ-VGVCGENSWWNSTKNIFGLSPNCVSSIYDPIGHLISWPISDLLDMKTKSSDDS  59

Query  630  PPSTDHSPTATAAATDDWNQVLMQDNERGDRSYGSMLQEDLNYGV---QETLTVIPSSSQ  460
                     +  ++T DWN      N++ D +Y SMLQEDLN  +   QE     P   +
Sbjct  60   TLQILGIDLSLPSSTPDWNH---SPNDKLDDTYLSMLQEDLNSSLNYQQENAVNCPKLKR  116

Query  459  ELSTSFPITSYN--NYPPN--------LLKSMFDADP-HQPHQQCLISSQPVISYAPATT  313
              S+    +S N  N P N        LL+++FD DP  QP Q    ++QP+        
Sbjct  117  NFSSITEDSSTNSFNKPMNQDFPYYSELLQTLFDTDPNQQPQQSFYTNNQPI------NC  170

Query  312  AAMTNYGPNlsdfspsppkfssllsPTNHHLQFPssislwdssltscSFPSPTFTDKKPA  133
             + T Y  NL DF+PS P          H L+                 PS       P 
Sbjct  171  TSSTKYKQNLDDFAPSLPT---------HLLK-----------------PSSEILANLPN  204

Query  132  ITAKLNGSNNKELRDSSCVANKT----KPDFKRPRIETPSPLPTFKVR  1
            + +K   SN +E+ +S+  +       +P +KRPRIETPSPLPTFKVR
Sbjct  205  LFSK---SNIEEIPESTSSSLSKNSSNEPSYKRPRIETPSPLPTFKVR  249



>ref|XP_010267864.1| PREDICTED: transcription factor bHLH112-like [Nelumbo nucifera]
Length=468

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 110/367 (30%), Positives = 155/367 (42%), Gaps = 108/367 (29%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWW-NPTRNMF--GSYLCSASMNDIGSFVAWPPSHHDG---------  658
            MADEF T  +C G WW NPTRN F  GS  CS ++ND GSF  WP    D          
Sbjct  1    MADEFQTG-ICSGNWWNNPTRNGFNGGSSPCSTALNDTGSF-GWPAEMVDMKARSCEESA  58

Query  657  ---------------EVTAEVNGRPPSTDHSPTA-----TAAATDDWNQVLMQDNERGDR  538
                           +VT  V G     D +        ++  T DWNQ L++ + R   
Sbjct  59   SASDSSTAFQDTQKPQVTDSVGGGGVLMDSTLQIMGFGLSSPTTMDWNQALLRSSGRAQT  118

Query  537  SYGSMLQEDLN------------------------------------------YGV-QET  487
            ++ S+LQE+L+                                          Y + Q++
Sbjct  119  NFHSVLQEELSSRPSFRQETGMESQLQKEWSPKNFCGSGEDSSVNAFRQINQVYALDQQS  178

Query  486  LTVIPSSS-------QELSTSFPITSYN-NYPPNLLKSMFDADPHQPHQQCLISSQPVIS  331
            L  + SSS       Q L TSFP+ S +      LL+ +F+ DP QP Q  L +    I+
Sbjct  179  LNSVNSSSDCTVTACQGLPTSFPMVSSSYGCTSTLLQGLFEPDP-QPQQSSLENRS--IN  235

Query  330  YAPATTAAM--TNYGPNlsdfspsppkfssllsPTNHHLQFP------ssislwdsslts  175
            + P+T+  M      P+   FS           PTN  L FP      ++ +   + +  
Sbjct  236  FPPSTSYHMDPNELSPSWPKFSQLLRSLPPKQQPTN-QLHFPNNVPFWNATAAAMNEVRP  294

Query  174  cSFPS-------PTFTDKKPAITAKLNGSNNKELRDSSCVANKTKPD--FKRPRIETPSP  22
              FPS       PTF ++KP+ +     S+ +E+RDS+    K   +  FKRPRIETP P
Sbjct  295  SYFPSSQTQFLTPTF-EEKPSCSNLTAKSSTEEVRDSATAVKKGSSEAVFKRPRIETP-P  352

Query  21   LPTFKVR  1
            +PTFKVR
Sbjct  353  MPTFKVR  359



>ref|XP_004232764.1| PREDICTED: transcription factor bHLH112 [Solanum lycopersicum]
Length=440

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 93/186 (50%), Gaps = 46/186 (25%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWWNPTRNMFGSYLCSASMNDIGSFVAWPPSH-HDGEVTAEVNGRPP  625
            MADE+  A+VCGG WWN +R++FGS LC++S+    S  AW   H  D + +   N    
Sbjct  1    MADEYQ-ASVCGGNWWNSSRSIFGSSLCASSVPLGNSNFAWTNDHLLDMKSSCRSNDESG  59

Query  624  STDHSPTA------------------TAAATDDWNQVLMQDNERGDRSYGSML-QEDLNY  502
            ++D S                     +++  D+W+  LM  N+R + SY S+L QED+N 
Sbjct  60   NSDESVVLQELPKHDSTLQILGSGLNSSSTNDNWSHTLMHGNDRSESSYPSILQQEDINS  119

Query  501  GV---QETLTVIPSSS---------------------QELSTSFPI-TSYNNYPPNLLKS  397
             +   QE+     S+S                      ++S++FP+ +S++NYP  LL++
Sbjct  120  SMNYQQESGVDCSSNSFKQDFTLGMNHPITSSTNTHHDQISSTFPMNSSFSNYPSALLQT  179

Query  396  MFDADP  379
            +FD DP
Sbjct  180  LFDNDP  185



>ref|XP_007025886.1| Transcription factor, putative [Theobroma cacao]
 gb|EOY28508.1| Transcription factor, putative [Theobroma cacao]
Length=466

 Score = 78.6 bits (192),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 104/350 (30%), Positives = 143/350 (41%), Gaps = 98/350 (28%)
 Frame = -3

Query  768  GGGWWNPTRNMFG--SYLCSASMNDIGSFVAWPPSHHDGE------------------VT  649
            GG WWN +++MF   S  CSA + D+GSF +W     D +                  V 
Sbjct  11   GGTWWNSSKSMFSGCSSPCSAGIADMGSFGSWGADMVDTKAARSCDQESNNSVSDSSIVF  70

Query  648  AEVNGRPPSTDHSPTATA----------------AATDDWNQVLMQDNERGDRSYGSMLQ  517
               + +P   D     ++                + T DWNQ L++ N R + SY S+LQ
Sbjct  71   QGAHQKPQQADSDSGGSSILIDSTLQMMGFGLSSSTTSDWNQSLLRSNGRTE-SYNSILQ  129

Query  516  EDLNYGV---QET----------------------------------LTVIPS-----SS  463
            ED+N  +   QET                                   +V  S     + 
Sbjct  130  EDINSRLSCRQETGMDSSQIQKNWSPKTYASPGEDSSITTFKPINQDFSVTKSGDSTPAC  189

Query  462  QELSTSFPITSYN-NYPPN-LLKSMFDADPHQPHQQCLISSQPVISYAPATTAAMTNYG-  292
            Q LS  FP+ S +  YP   LL+S+F+ DP QP Q  L +       APAT  A  N   
Sbjct  190  QGLSAGFPMGSASYGYPSTVLLQSLFEPDP-QPQQSLLNNRSINYMSAPATYGANANELS  248

Query  291  --PNlsdfspsppkfssllsPTNHHLQ----FPssislwdssltscSFPSP-------TF  151
              P         P       P++ H      F ++ S   S + +   PSP       TF
Sbjct  249  SPPWPKLAPCLRPSLPKQQQPSSLHFSNNTPFWNASSTGLSDVKASFLPSPQSQFLAQTF  308

Query  150  TDKKPAITAKLNGSNNKELRDSSCVANKTKPDFKRPRIETPSPLPTFKVR  1
             D+KP   +    +N +E+RDS      ++P FKRPRIETPSPLPTFKVR
Sbjct  309  -DEKPNCPSLTIKTNTEEVRDS-MKKGSSEPPFKRPRIETPSPLPTFKVR  356



>ref|XP_011009499.1| PREDICTED: transcription factor bHLH112-like isoform X2 [Populus 
euphratica]
Length=467

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 83/247 (34%), Positives = 114/247 (46%), Gaps = 58/247 (23%)
 Frame = -3

Query  582  DWNQVLMQDNERGDRSYGSMLQEDLNYGV-------------------------QETLTV  478
            DWNQ L+  N R + SY SMLQED+N G                          Q+ L  
Sbjct  117  DWNQALLSGNGRPE-SYNSMLQEDMNSGGLNSSQIQKDWSPKSYAKTAEDFSLDQQRLNP  175

Query  477  IPSSS------QELSTSF---PITSYNNYPPNLLKSMFDADPHQPHQ-QCLISSQPVISY  328
            + SSS      Q  ST F   P  SY  YP  L++S+F+ D  QPHQ Q L +++P+   
Sbjct  176  VNSSSNSPPTCQGFSTGFSMEPTASYG-YPSTLIQSLFEPDHPQPHQVQSLFNNRPMNYL  234

Query  327  APATTAAMTNYG----PNlsdfspsppkfssllsPTNHHLQ----FPssislwdssltsc  172
            +PA     TN      P+ +  SP           ++ H      + ++     + + + 
Sbjct  235  SPAAPNYGTNMSELSSPSWTKVSPLIKSCLQKQQASSLHFTNNTTYWNASPTGINDIRAS  294

Query  171  SFPS-------PTFTDKK--PAITAKLNGSNNKELRDSSCVANK-TKPDFKRPRIETPSP  22
              PS       PTF +K   P +T +    N +E+RDS  V  K  +P+FKRPRIE PSP
Sbjct  295  FLPSSPSQFLLPTFEEKPNCPGLTIE---PNREEVRDSVSVVKKGCEPEFKRPRIEAPSP  351

Query  21   LPTFKVR  1
            LPTFKVR
Sbjct  352  LPTFKVR  358



>ref|XP_011009498.1| PREDICTED: transcription factor bHLH112-like isoform X1 [Populus 
euphratica]
Length=483

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 83/247 (34%), Positives = 114/247 (46%), Gaps = 58/247 (23%)
 Frame = -3

Query  582  DWNQVLMQDNERGDRSYGSMLQEDLNYGV-------------------------QETLTV  478
            DWNQ L+  N R + SY SMLQED+N G                          Q+ L  
Sbjct  117  DWNQALLSGNGRPE-SYNSMLQEDMNSGGLNSSQIQKDWSPKSYAKTAEDFSLDQQRLNP  175

Query  477  IPSSS------QELSTSF---PITSYNNYPPNLLKSMFDADPHQPHQ-QCLISSQPVISY  328
            + SSS      Q  ST F   P  SY  YP  L++S+F+ D  QPHQ Q L +++P+   
Sbjct  176  VNSSSNSPPTCQGFSTGFSMEPTASYG-YPSTLIQSLFEPDHPQPHQVQSLFNNRPMNYL  234

Query  327  APATTAAMTNYG----PNlsdfspsppkfssllsPTNHHLQ----FPssislwdssltsc  172
            +PA     TN      P+ +  SP           ++ H      + ++     + + + 
Sbjct  235  SPAAPNYGTNMSELSSPSWTKVSPLIKSCLQKQQASSLHFTNNTTYWNASPTGINDIRAS  294

Query  171  SFPS-------PTFTDKK--PAITAKLNGSNNKELRDSSCVANK-TKPDFKRPRIETPSP  22
              PS       PTF +K   P +T +    N +E+RDS  V  K  +P+FKRPRIE PSP
Sbjct  295  FLPSSPSQFLLPTFEEKPNCPGLTIE---PNREEVRDSVSVVKKGCEPEFKRPRIEAPSP  351

Query  21   LPTFKVR  1
            LPTFKVR
Sbjct  352  LPTFKVR  358



>ref|XP_002317263.2| hypothetical protein POPTR_0011s03560g [Populus trichocarpa]
 gb|EEE97875.2| hypothetical protein POPTR_0011s03560g [Populus trichocarpa]
Length=459

 Score = 77.0 bits (188),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 104/364 (29%), Positives = 148/364 (41%), Gaps = 103/364 (28%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWW-NPTRNMF-----------------GSYLCSASMNDIGSFVAWP  676
            MA+EF  A +CG  WW N +++MF                 G+Y  S +  D+       
Sbjct  1    MAEEFQ-AGICGENWWMNSSKSMFIGGLSPCSTVSLPSDHMGTYNGSWATADMVDLKPRS  59

Query  675  PSHHDGEVTAEVNGRPPSTDHSPTATAAATD--------------------------DWN  574
             S  +   T  V+    +  +SP    A +D                          DWN
Sbjct  60   ISCKESHNTTSVSDTSIAFLNSPKPQQANSDSGGSSNLIDSTLQMMGFGLSSSSSSSDWN  119

Query  573  QVLMQDNERGDRSYGSMLQEDLNYGV-------------------------QETLTVIPS  469
            Q L+  N R + SY SMLQED+N G                          Q+ L  + S
Sbjct  120  QALLSGNGRTE-SYNSMLQEDMNSGGLNSSQIRKDWSPKSYARTAEDFSLDQQRLNPVNS  178

Query  468  SS------QELSTSF---PITSYNNYPPNLLKSMFDADPHQPHQ-QCLISSQPVISYAPA  319
            SS      Q  ST F   P  SY  YP  L++S+F+ D  QP Q Q L +++P+   +P 
Sbjct  179  SSNSPPTCQGFSTGFSMEPTASYC-YPSTLIQSLFEPDHLQPQQVQSLFNNRPMNYLSPT  237

Query  318  TTAAMTNYG----PNlsdfspsppkfssllsPTNHHLQ----FPssislwdssltscSFP  163
                 TN      P+ +  SP           ++ H      + ++     + + +   P
Sbjct  238  APNYGTNMSELSSPSWTKVSPLIKSCLQKQQASSLHFTNNTTYWNASPTGINDIRASFLP  297

Query  162  S-------PTFTDKK--PAITAKLNGSNNKELRDSSCVANK-TKPDFKRPRIETPSPLPT  13
            S       PTF +K   P++T +    N +E+RDS  V  K  +P FKRPRIE PSPLPT
Sbjct  298  SSPSQFLLPTFQEKPNCPSLTIQ---PNREEVRDSVSVVKKGCEPAFKRPRIEAPSPLPT  354

Query  12   FKVR  1
            FKVR
Sbjct  355  FKVR  358



>ref|XP_006377272.1| hypothetical protein POPTR_0011s03560g [Populus trichocarpa]
 gb|ABK95256.1| unknown [Populus trichocarpa]
 gb|ERP55069.1| hypothetical protein POPTR_0011s03560g [Populus trichocarpa]
Length=467

 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 104/364 (29%), Positives = 148/364 (41%), Gaps = 103/364 (28%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWW-NPTRNMF-----------------GSYLCSASMNDIGSFVAWP  676
            MA+EF  A +CG  WW N +++MF                 G+Y  S +  D+       
Sbjct  1    MAEEFQ-AGICGENWWMNSSKSMFIGGLSPCSTVSLPSDHMGTYNGSWATADMVDLKPRS  59

Query  675  PSHHDGEVTAEVNGRPPSTDHSPTATAAATD--------------------------DWN  574
             S  +   T  V+    +  +SP    A +D                          DWN
Sbjct  60   ISCKESHNTTSVSDTSIAFLNSPKPQQANSDSGGSSNLIDSTLQMMGFGLSSSSSSSDWN  119

Query  573  QVLMQDNERGDRSYGSMLQEDLNYGV-------------------------QETLTVIPS  469
            Q L+  N R + SY SMLQED+N G                          Q+ L  + S
Sbjct  120  QALLSGNGRTE-SYNSMLQEDMNSGGLNSSQIRKDWSPKSYARTAEDFSLDQQRLNPVNS  178

Query  468  SS------QELSTSF---PITSYNNYPPNLLKSMFDADPHQPHQ-QCLISSQPVISYAPA  319
            SS      Q  ST F   P  SY  YP  L++S+F+ D  QP Q Q L +++P+   +P 
Sbjct  179  SSNSPPTCQGFSTGFSMEPTASYC-YPSTLIQSLFEPDHLQPQQVQSLFNNRPMNYLSPT  237

Query  318  TTAAMTNYG----PNlsdfspsppkfssllsPTNHHLQ----FPssislwdssltscSFP  163
                 TN      P+ +  SP           ++ H      + ++     + + +   P
Sbjct  238  APNYGTNMSELSSPSWTKVSPLIKSCLQKQQASSLHFTNNTTYWNASPTGINDIRASFLP  297

Query  162  S-------PTFTDKK--PAITAKLNGSNNKELRDSSCVANK-TKPDFKRPRIETPSPLPT  13
            S       PTF +K   P++T +    N +E+RDS  V  K  +P FKRPRIE PSPLPT
Sbjct  298  SSPSQFLLPTFQEKPNCPSLTIQ---PNREEVRDSVSVVKKGCEPAFKRPRIEAPSPLPT  354

Query  12   FKVR  1
            FKVR
Sbjct  355  FKVR  358



>ref|XP_007148281.1| hypothetical protein PHAVU_006G195000g [Phaseolus vulgaris]
 gb|ESW20275.1| hypothetical protein PHAVU_006G195000g [Phaseolus vulgaris]
Length=451

 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 94/349 (27%), Positives = 139/349 (40%), Gaps = 88/349 (25%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWW--NPTRNMF--GSYLCSASMNDIGSFVAWPPSHHDGEVTAEVNG  634
            MA+EF  AA+CG  WW  NPTR++F   S  CS +  D G++  W  +       +  N 
Sbjct  1    MAEEFQ-AAICGESWWNINPTRSVFPLMSSTCSVAAADAGNYSTWQSTEDINNFISSDNS  59

Query  633  ------RPPSTDHSPTATAAATDD-----------------WNQVLM----------QDN  553
                    P    S + T +   D                 WNQ L+          +  
Sbjct  60   LSFLDVEKPQQRDSASGTGSILIDSTLQMMGFGMSSSTSSNWNQSLLGSDFHSVLQEETG  119

Query  552  ERGDRSYGSMLQEDL---NYGV---------------------QETLTVIPSSSQELSTS  445
              G  S+ S +Q+D    N+                       Q++L+ + +S+  LS  
Sbjct  120  MGGGSSHDSQIQKDWSPKNFSSAAGQDSTVDAFKSMNQEFSLDQQSLSSVVTSTGSLSDG  179

Query  444  FPITSYN-NYPPNLLKSMFDADPHQPHQQCLISSQPVISYAPATTAAMTNYG--------  292
            FP+ S +  YP  L++S+++ +  QP  Q  + + P +SY+ +T     NYG        
Sbjct  180  FPVVSASYGYPSTLIQSLYEPEA-QPQPQNSLFTNPTMSYSSST----ANYGTCSNELSP  234

Query  291  ----------PNlsdfspsppkfssllsPTNHHLQFPssislwdssltscSFPSPTFTDK  142
                      P+      S   FS   S  N   +    I     + +   + +P F DK
Sbjct  235  TWSKISSLLKPSTPKQQLSGLHFSDTTSFWNGSAEALHDIRAGVFASSQPQYQTPKFEDK  294

Query  141  KPAITAKLNGSNNKELRD--SSCVANKTKPDFKRPRIETPSPLPTFKVR  1
                   LN    +E  D  SS   N ++P FKR RIETPSPLPTFKVR
Sbjct  295  SNTPNTLLNKLKREESPDAASSAKKNSSEPAFKRQRIETPSPLPTFKVR  343



>ref|XP_007148280.1| hypothetical protein PHAVU_006G195000g [Phaseolus vulgaris]
 gb|ESW20274.1| hypothetical protein PHAVU_006G195000g [Phaseolus vulgaris]
Length=453

 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 94/349 (27%), Positives = 139/349 (40%), Gaps = 88/349 (25%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWW--NPTRNMF--GSYLCSASMNDIGSFVAWPPSHHDGEVTAEVNG  634
            MA+EF  AA+CG  WW  NPTR++F   S  CS +  D G++  W  +       +  N 
Sbjct  1    MAEEFQ-AAICGESWWNINPTRSVFPLMSSTCSVAAADAGNYSTWQSTEDINNFISSDNS  59

Query  633  ------RPPSTDHSPTATAAATDD-----------------WNQVLM----------QDN  553
                    P    S + T +   D                 WNQ L+          +  
Sbjct  60   LSFLDVEKPQQRDSASGTGSILIDSTLQMMGFGMSSSTSSNWNQSLLGSDFHSVLQEETG  119

Query  552  ERGDRSYGSMLQEDL---NYGV---------------------QETLTVIPSSSQELSTS  445
              G  S+ S +Q+D    N+                       Q++L+ + +S+  LS  
Sbjct  120  MGGGSSHDSQIQKDWSPKNFSSAAGQDSTVDAFKSMNQEFSLDQQSLSSVVTSTGSLSDG  179

Query  444  FPITSYN-NYPPNLLKSMFDADPHQPHQQCLISSQPVISYAPATTAAMTNYG--------  292
            FP+ S +  YP  L++S+++ +  QP  Q  + + P +SY+ +T     NYG        
Sbjct  180  FPVVSASYGYPSTLIQSLYEPEA-QPQPQNSLFTNPTMSYSSST----ANYGTCSNELSP  234

Query  291  ----------PNlsdfspsppkfssllsPTNHHLQFPssislwdssltscSFPSPTFTDK  142
                      P+      S   FS   S  N   +    I     + +   + +P F DK
Sbjct  235  TWSKISSLLKPSTPKQQLSGLHFSDTTSFWNGSAEALHDIRAGVFASSQPQYQTPKFEDK  294

Query  141  KPAITAKLNGSNNKELRD--SSCVANKTKPDFKRPRIETPSPLPTFKVR  1
                   LN    +E  D  SS   N ++P FKR RIETPSPLPTFKVR
Sbjct  295  SNTPNTLLNKLKREESPDAASSAKKNSSEPAFKRQRIETPSPLPTFKVR  343



>ref|XP_011096171.1| PREDICTED: transcription factor bHLH112 isoform X1 [Sesamum indicum]
Length=463

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 64/137 (47%), Gaps = 30/137 (22%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWWNPTRNMFGSYLCSASMNDIGSFVAW----------PPSHHDGEV  652
            MA E     VCGG WWNP+RN+FGS  CS   NDIGSF  W           P  +D  V
Sbjct  1    MASEEFQGGVCGGNWWNPSRNLFGSP-CSLPTNDIGSF-GWSNYDLIMDMKAPRSNDESV  58

Query  651  TAEVNGRPPSTDHSPTATAAAT----------------DDWNQVLMQDNERGDRSYGSML  520
             +  +GR P  + +   T +                  DDWNQ  + D+ R D +Y ++L
Sbjct  59   GSAADGRKPQQESAANGTMSVDSTLQMMGINLSSSTTPDDWNQDFLHDSGRSDGNYTNIL  118

Query  519  QE-DLNYGVQETLTVIP  472
            Q+  +NY  QET    P
Sbjct  119  QDSSMNY-RQETRVDYP  134



>ref|XP_011096172.1| PREDICTED: transcription factor bHLH112 isoform X2 [Sesamum indicum]
Length=461

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 64/137 (47%), Gaps = 30/137 (22%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWWNPTRNMFGSYLCSASMNDIGSFVAW----------PPSHHDGEV  652
            MA E     VCGG WWNP+RN+FGS  CS   NDIGSF  W           P  +D  V
Sbjct  1    MASEEFQGGVCGGNWWNPSRNLFGSP-CSLPTNDIGSF-GWSNYDLIMDMKAPRSNDESV  58

Query  651  TAEVNGRPPSTDHSPTATAAAT----------------DDWNQVLMQDNERGDRSYGSML  520
             +  +GR P  + +   T +                  DDWNQ  + D+ R D +Y ++L
Sbjct  59   GSAADGRKPQQESAANGTMSVDSTLQMMGINLSSSTTPDDWNQDFLHDSGRSDGNYTNIL  118

Query  519  QE-DLNYGVQETLTVIP  472
            Q+  +NY  QET    P
Sbjct  119  QDSSMNY-RQETRVDYP  134



>ref|XP_006383985.1| hypothetical protein POPTR_0004s02870g [Populus trichocarpa]
 gb|ERP61782.1| hypothetical protein POPTR_0004s02870g [Populus trichocarpa]
Length=480

 Score = 66.6 bits (161),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 78/245 (32%), Positives = 107/245 (44%), Gaps = 56/245 (23%)
 Frame = -3

Query  582  DWNQVLMQDNERGDRSYGSMLQEDLNYGV-------------------------QETLTV  478
            DWNQ L+  N R + SY SM+QE++N G                          Q+ L  
Sbjct  118  DWNQALLPGNGRTE-SYNSMMQEEMNSGGLNSSQIQKDWSPKSYTSTAEDFSLDQQRLNP  176

Query  477  IPSSS------QELSTSF---PITSYNNYPPNLLKSMFDADPHQPHQQCLISSQPVISYA  325
            + SS       Q  ST F   P  SY  YP  L++S+F+ +  QP Q   + +   ++Y 
Sbjct  177  VNSSGNSPPTCQGFSTGFSMEPSASYG-YPSTLIQSLFEPEYPQPQQAQSLFNNRFMNYL  235

Query  324  PATTAAMTNYGPNlsdfspsppkfss--------llsPTNHHLQ---FPssislwdsslt  178
              T     NYG N+++ S       S            T H      + ++     + + 
Sbjct  236  SPTAP---NYGTNMTELSSPSWPKVSPLIKPLPKQQPSTLHFTNNTPYWNASPTGINDIR  292

Query  177  scSFPSPTFTDKKPAITAKLNGSN-----NKELRDSSCVANK-TKPDFKRPRIETPSPLP  16
            +   PS       PA   K N SN     +KE+RDS  V  K ++P FKRPRIETPSPLP
Sbjct  293  ANLLPSSQSQFLVPAFEEKSNCSNLTTKPSKEVRDSVSVVKKGSEPAFKRPRIETPSPLP  352

Query  15   TFKVR  1
            TFKVR
Sbjct  353  TFKVR  357



>gb|KDP20840.1| hypothetical protein JCGZ_21311 [Jatropha curcas]
Length=480

 Score = 63.5 bits (153),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 70/242 (29%), Positives = 104/242 (43%), Gaps = 57/242 (24%)
 Frame = -3

Query  573  QVLMQDNERGDRSYGSMLQEDL---------------------------------NYGVQ  493
            Q L++ N R + SY S+LQED+                                 ++ + 
Sbjct  121  QTLLRGNGRSE-SYNSILQEDMSSSQIQKDWCPKSFTTSTGEDSSINAFKTINNQDFSLN  179

Query  492  ETLTVIPSSSQELSTSFPITSYN-NYPPNLLKSMFDADPHQPHQQCLISSQPVISYAPAT  316
             +     ++ Q+LS  FP+ S +  YP  L++S+FD+DP QP QQ L +++ +    P  
Sbjct  180  SSGNSTTTTCQDLSGGFPMGSASYGYPSTLIQSLFDSDP-QP-QQSLFNNRTINYSCPPN  237

Query  315  TAAMTNYGPNlsdfspsppkfssllsPTNHHLQFPssi-------------slwdsslts  175
              ++ N             K S         L F ++                   + + 
Sbjct  238  HGSILNELSPSWPKLAPFLKASLPKQQLASGLHFSNNAPFWNATATALTDIKASFVTSSQ  297

Query  174  cSFPSPTFTDK--KPAITAKLNGSNNKELRDS--SCVANKTKPDFKRPRIETPSPLPTFK  7
              +  P F +K   P +T K    NN+E+RDS  S V   T+P FKRPRIETPSPLPTFK
Sbjct  298  PQYLLPAFEEKPNCPNLTTK---HNNEEVRDSGSSVVKKGTEPAFKRPRIETPSPLPTFK  354

Query  6    VR  1
            VR
Sbjct  355  VR  356



>ref|XP_006449161.1| hypothetical protein CICLE_v10015039mg [Citrus clementina]
 gb|ESR62401.1| hypothetical protein CICLE_v10015039mg [Citrus clementina]
Length=461

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 4/48 (8%)
 Frame = -3

Query  138  PAITAKLNGSNNKELRDSSCVANK--TKPDFKRPRIETPSPLPTFKVR  1
            P  TAK N  NN+E+RDS   A K  ++P FKRPRIETPSPLPTFKVR
Sbjct  335  PTFTAKYN--NNEEVRDSGSAAKKGSSEPAFKRPRIETPSPLPTFKVR  380



>ref|XP_006467939.1| PREDICTED: transcription factor bHLH112-like isoform X2 [Citrus 
sinensis]
Length=448

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 4/48 (8%)
 Frame = -3

Query  138  PAITAKLNGSNNKELRDSSCVANK--TKPDFKRPRIETPSPLPTFKVR  1
            P  TAK N  NN+E+RDS   A K  ++P FKRPRIETPSPLPTFKVR
Sbjct  333  PTFTAKYN--NNEEVRDSGSAAKKGSSEPAFKRPRIETPSPLPTFKVR  378



>gb|KDO75640.1| hypothetical protein CISIN_1g011373mg [Citrus sinensis]
Length=459

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 4/48 (8%)
 Frame = -3

Query  138  PAITAKLNGSNNKELRDSSCVANK--TKPDFKRPRIETPSPLPTFKVR  1
            P  TAK N  NN+E+RDS   A K  ++P FKRPRIETPSPLPTFKVR
Sbjct  333  PTFTAKYN--NNEEVRDSGSAAKKGSSEPAFKRPRIETPSPLPTFKVR  378



>gb|KDO75641.1| hypothetical protein CISIN_1g011373mg [Citrus sinensis]
Length=412

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 4/48 (8%)
 Frame = -3

Query  138  PAITAKLNGSNNKELRDSSCVANK--TKPDFKRPRIETPSPLPTFKVR  1
            P  TAK N  NN+E+RDS   A K  ++P FKRPRIETPSPLPTFKVR
Sbjct  333  PTFTAKYN--NNEEVRDSGSAAKKGSSEPAFKRPRIETPSPLPTFKVR  378



>ref|XP_006449162.1| hypothetical protein CICLE_v10015039mg [Citrus clementina]
 gb|ESR62402.1| hypothetical protein CICLE_v10015039mg [Citrus clementina]
Length=489

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 4/48 (8%)
 Frame = -3

Query  138  PAITAKLNGSNNKELRDSSCVANK--TKPDFKRPRIETPSPLPTFKVR  1
            P  TAK N  NN+E+RDS   A K  ++P FKRPRIETPSPLPTFKVR
Sbjct  335  PTFTAKYN--NNEEVRDSGSAAKKGSSEPAFKRPRIETPSPLPTFKVR  380



>ref|XP_006467938.1| PREDICTED: transcription factor bHLH112-like isoform X1 [Citrus 
sinensis]
 gb|KDO75639.1| hypothetical protein CISIN_1g011373mg [Citrus sinensis]
Length=487

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 4/48 (8%)
 Frame = -3

Query  138  PAITAKLNGSNNKELRDSSCVANK--TKPDFKRPRIETPSPLPTFKVR  1
            P  TAK N  NN+E+RDS   A K  ++P FKRPRIETPSPLPTFKVR
Sbjct  333  PTFTAKYN--NNEEVRDSGSAAKKGSSEPAFKRPRIETPSPLPTFKVR  378



>ref|XP_011003381.1| PREDICTED: transcription factor bHLH112 isoform X3 [Populus euphratica]
Length=467

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 109/247 (44%), Gaps = 59/247 (24%)
 Frame = -3

Query  582  DWNQVLMQDNERGDRSYGSMLQEDLNYGV-------------------------QETLTV  478
            DWN   +  N R + SY SM+QE++N                            Q  L  
Sbjct  118  DWNPAFLPGNGRTE-SYNSMMQEEMNSAGLNSSQIQKDWSPKSYTSTAEDFSLDQRRLNP  176

Query  477  IPSSS------QELSTSF---PITSYNNYPPNLLKSMFDADPHQPHQQCLISSQPVISYA  325
            + SS       Q  ST F   P  SY  YP  L++S+F+ +  QP Q   + +   ++Y 
Sbjct  177  VNSSGNSPPTCQGFSTGFSMEPSASYG-YPSTLIQSLFEPEHPQPQQAQSLFNNRFMNYL  235

Query  324  PATTAAMTNYGPNlsdfspsppkfssllsPTNHHLQFPssislwdssltscSFPSPTFTD  145
              T     NYG N+++ S       S L  ++   Q PS++   +++    + P+    D
Sbjct  236  SPTAP---NYGTNMTELSSPSWPKVSPLIKSSLPKQQPSTLHFTNNTPYWNASPT-RIND  291

Query  144  KK-------------PAITAKLNGSN-----NKELRDSSCVANK-TKPDFKRPRIETPSP  22
             +             PA   K N SN     +KE+RDS  V  K ++P FKRPRIETPSP
Sbjct  292  IRANLLPPSQSQFLVPAFEEKSNCSNLTTKPSKEVRDSVSVVKKGSEPAFKRPRIETPSP  351

Query  21   LPTFKVR  1
            LPTFKVR
Sbjct  352  LPTFKVR  358



>ref|XP_011003380.1| PREDICTED: transcription factor bHLH112 isoform X2 [Populus euphratica]
Length=481

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 109/247 (44%), Gaps = 59/247 (24%)
 Frame = -3

Query  582  DWNQVLMQDNERGDRSYGSMLQEDLNYGV-------------------------QETLTV  478
            DWN   +  N R + SY SM+QE++N                            Q  L  
Sbjct  118  DWNPAFLPGNGRTE-SYNSMMQEEMNSAGLNSSQIQKDWSPKSYTSTAEDFSLDQRRLNP  176

Query  477  IPSSS------QELSTSF---PITSYNNYPPNLLKSMFDADPHQPHQQCLISSQPVISYA  325
            + SS       Q  ST F   P  SY  YP  L++S+F+ +  QP Q   + +   ++Y 
Sbjct  177  VNSSGNSPPTCQGFSTGFSMEPSASYG-YPSTLIQSLFEPEHPQPQQAQSLFNNRFMNYL  235

Query  324  PATTAAMTNYGPNlsdfspsppkfssllsPTNHHLQFPssislwdssltscSFPSPTFTD  145
              T     NYG N+++ S       S L  ++   Q PS++   +++    + P+    D
Sbjct  236  SPTAP---NYGTNMTELSSPSWPKVSPLIKSSLPKQQPSTLHFTNNTPYWNASPT-RIND  291

Query  144  KK-------------PAITAKLNGSN-----NKELRDSSCVANK-TKPDFKRPRIETPSP  22
             +             PA   K N SN     +KE+RDS  V  K ++P FKRPRIETPSP
Sbjct  292  IRANLLPPSQSQFLVPAFEEKSNCSNLTTKPSKEVRDSVSVVKKGSEPAFKRPRIETPSP  351

Query  21   LPTFKVR  1
            LPTFKVR
Sbjct  352  LPTFKVR  358



>ref|XP_011003379.1| PREDICTED: transcription factor bHLH112 isoform X1 [Populus euphratica]
Length=483

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 109/247 (44%), Gaps = 59/247 (24%)
 Frame = -3

Query  582  DWNQVLMQDNERGDRSYGSMLQEDLNYGV-------------------------QETLTV  478
            DWN   +  N R + SY SM+QE++N                            Q  L  
Sbjct  118  DWNPAFLPGNGRTE-SYNSMMQEEMNSAGLNSSQIQKDWSPKSYTSTAEDFSLDQRRLNP  176

Query  477  IPSSS------QELSTSF---PITSYNNYPPNLLKSMFDADPHQPHQQCLISSQPVISYA  325
            + SS       Q  ST F   P  SY  YP  L++S+F+ +  QP Q   + +   ++Y 
Sbjct  177  VNSSGNSPPTCQGFSTGFSMEPSASYG-YPSTLIQSLFEPEHPQPQQAQSLFNNRFMNYL  235

Query  324  PATTAAMTNYGPNlsdfspsppkfssllsPTNHHLQFPssislwdssltscSFPSPTFTD  145
              T     NYG N+++ S       S L  ++   Q PS++   +++    + P+    D
Sbjct  236  SPTAP---NYGTNMTELSSPSWPKVSPLIKSSLPKQQPSTLHFTNNTPYWNASPT-RIND  291

Query  144  KK-------------PAITAKLNGSN-----NKELRDSSCVANK-TKPDFKRPRIETPSP  22
             +             PA   K N SN     +KE+RDS  V  K ++P FKRPRIETPSP
Sbjct  292  IRANLLPPSQSQFLVPAFEEKSNCSNLTTKPSKEVRDSVSVVKKGSEPAFKRPRIETPSP  351

Query  21   LPTFKVR  1
            LPTFKVR
Sbjct  352  LPTFKVR  358



>ref|XP_008224896.1| PREDICTED: transcription factor bHLH112 isoform X3 [Prunus mume]
Length=431

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 85/178 (48%), Gaps = 40/178 (22%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWWNPTRNMFGSYLCSASMND-IGSFVAWPPSHHDGEVTAEVNGRPP  625
            MA+EF  A +CG  WWN +R+   +  CS   ND +GSF   P    D + +    G   
Sbjct  1    MAEEFQ-AGICGSSWWNTSRHALVASPCSVGFNDHMGSF-GCPNDMVDIKASRSSCG---  55

Query  624  STDHSPTATAAATDDWNQVLMQDNERGDRS----YGSMLQEDLNYGVQE-----------  490
              DHS ++++  + D NQ L+     G R+    + SMLQE +  GV E           
Sbjct  56   -FDHSSSSSSTPS-DLNQALLLSRSGGGRAESNFHNSMLQEGV--GVDEDSSSLIDGFKP  111

Query  489  -----TLTVIPSSSQELSTSFPITSYNN------YPPNLLKSMFDADPHQPH-QQCLI  352
                 +L  + SSS   S+ FPITS ++      +P   L+S+FD++  QP  QQ L 
Sbjct  112  MSQDFSLDQLGSSS---SSGFPITSSSSAANSYGFPSTFLQSIFDSEVSQPQPQQSLF  166



>ref|XP_010057695.1| PREDICTED: transcription factor bHLH112-like [Eucalyptus grandis]
 gb|KCW74873.1| hypothetical protein EUGRSUZ_E03614 [Eucalyptus grandis]
Length=461

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = -3

Query  159  PTFTDKKPAITA---KLNGSNNKELRDSSCVANKTKPDFKRPRIETPSPLPTFKVR  1
            PT  DKKP+      K N  + +E+  +   ++ T+P FKRPRIETPSPLPTFKVR
Sbjct  296  PTIYDKKPSCATPNTKRNCDDAREVNSAVKKSSSTEPGFKRPRIETPSPLPTFKVR  351



>gb|AFK38358.1| unknown [Lotus japonicus]
Length=444

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 96/189 (51%), Gaps = 13/189 (7%)
 Frame = -3

Query  543  DRSYGSMLQEDLNYGV-QETLTVIPSSSQELSTSF-PITSYNNY--PPNLLKSMFDADPH  376
            D ++ +M Q+   +G+ Q+ L  + +SS  LS    PI    +Y  P NL++S++D+ P 
Sbjct  150  DANFKAMNQD---FGLDQQGLNSVITSSGNLSGGLIPINGSGSYGYPSNLVQSLYDSQP-  205

Query  375  QPHQQCLISSQPVISYAPATTAAMT---NYGPNlsdfspsppkfssllsPTNHHLQFPss  205
            QP    L ++ P +S++ +   + T      P +     S   FS+     N   +    
Sbjct  206  QPQNSSLFTN-PSMSFSSSNELSPTFSSILKPAMPKQQLSGLHFSNSTPFWNASAEALHD  264

Query  204  islwdssltscSFPSPTFTDKKPAI-TAKLNGSNNKELRDSSCVANKTKPDFKRPRIETP  28
            I     + +   + +P+F +KK    +A LN    +E  D++  +  T+P  KRPRIETP
Sbjct  265  IRAGVFASSQTQYQTPSFEEKKQNPPSALLNKLKREESPDAAKKSTSTEPALKRPRIETP  324

Query  27   SPLPTFKVR  1
            SPLPTFKVR
Sbjct  325  SPLPTFKVR  333



>ref|XP_007211684.1| hypothetical protein PRUPE_ppa005924mg [Prunus persica]
 gb|EMJ12883.1| hypothetical protein PRUPE_ppa005924mg [Prunus persica]
Length=437

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 86/204 (42%), Gaps = 61/204 (30%)
 Frame = -3

Query  801  MADEFSTAAVCGGGWWNPTRNMFGSYLCSASMND-IGSFVAWPPSHHD--------GEVT  649
            MA+EF  A +CG  WWN +R+   +  CS   ND IGSF   P    D        GE+ 
Sbjct  1    MAEEFQ-AGICGSSWWNTSRHALVASPCSVGFNDHIGSF-GCPNDMVDIKASRSSCGEIN  58

Query  648  AEVNGRPPSTDHSPTAT------------------AAATDDWNQVLMQDNERGDRS----  535
              V+       H+ + +                  ++   D NQ L+     G R+    
Sbjct  59   NSVSDHDDDHQHTNSGSFLIDSTLQMIGFDHSSSPSSTPSDLNQALLLSRSGGGRAESNF  118

Query  534  YGSMLQEDLNYGVQE----------------TLTVIPSSSQELSTSFPITSYNN------  421
            + SMLQE +  GV E                +L  + SSS   S+ FPITS ++      
Sbjct  119  HNSMLQEGV--GVDEDSSSLIDGFKPMSQDFSLDQLGSSS---SSGFPITSSSSAANSYG  173

Query  420  YPPNLLKSMFDADPHQPH-QQCLI  352
            +P  LL+S+FD++  QP  QQ L 
Sbjct  174  FPSTLLQSIFDSEVSQPQPQQSLF  197



>ref|XP_002518591.1| transcription factor, putative [Ricinus communis]
 gb|EEF43978.1| transcription factor, putative [Ricinus communis]
Length=494

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 6/56 (11%)
 Frame = -3

Query  159  PTFTDK--KPAITAKLNGSNNKELRDSSCVANK-TKPDFKRPRIETPSPLPTFKVR  1
            PTF +K   P +T K    NN+++RDS  V  K ++P  KR RIETPSPLPTFKVR
Sbjct  335  PTFEEKPNCPNVTLK---PNNEQVRDSGSVVKKGSEPAIKRARIETPSPLPTFKVR  387



>ref|XP_003528420.1| PREDICTED: transcription factor bHLH123-like [Glycine max]
 gb|KHN07692.1| Transcription factor bHLH123 [Glycine soja]
Length=495

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 4/60 (7%)
 Frame = -3

Query  168  FPSPTFTDK-KPAI-TAKLNGSNNKELRDSSCVANK--TKPDFKRPRIETPSPLPTFKVR  1
            +  PTF D+ KP      LN  N++E+ +S+ +A K   +P  KRPRIETPSPLPTFKVR
Sbjct  325  YQRPTFDDEEKPNFPITLLNRLNSEEILESASMAKKNVCEPALKRPRIETPSPLPTFKVR  384



>ref|XP_007159223.1| hypothetical protein PHAVU_002G2196001g, partial [Phaseolus vulgaris]
 gb|ESW31217.1| hypothetical protein PHAVU_002G2196001g, partial [Phaseolus vulgaris]
Length=377

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 9/62 (15%)
 Frame = -3

Query  168  FPSPTFTDKKP----AITAKLNGSNNKELRDSSCVANK--TKPDFKRPRIETPSPLPTFK  7
            + +PTF  +KP     I  KLN   ++E  DS+ +  K   +P  KRPRIETPSPLPTFK
Sbjct  305  YQTPTFDQEKPNCPSTILIKLN---SEETLDSATITKKDACEPALKRPRIETPSPLPTFK  361

Query  6    VR  1
            VR
Sbjct  362  VR  363



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2230116990256