BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14742_g3_i1 len=645 path=[623:0-644]

Length=645
                                                                      Score     E

ref|XP_011095216.1|  PREDICTED: chlorophyll a-b binding protein C...    256   1e-80   
ref|XP_004246325.1|  PREDICTED: chlorophyll a-b binding protein C...    253   3e-80   
ref|XP_009588563.1|  PREDICTED: chlorophyll a-b binding protein C...    253   3e-80   
ref|XP_004147887.1|  PREDICTED: chlorophyll a-b binding protein C...    252   9e-80   
gb|ABG73415.1|  chloroplast pigment-binding protein CP29                251   1e-79   Nicotiana tabacum [American tobacco]
ref|XP_009804550.1|  PREDICTED: chlorophyll a-b binding protein C...    251   1e-79   
ref|XP_006366348.1|  PREDICTED: chlorophyll a-b binding protein C...    251   2e-79   
ref|XP_008449241.1|  PREDICTED: chlorophyll a-b binding protein C...    249   1e-78   
ref|XP_002528105.1|  chlorophyll A/B binding protein, putative          248   2e-78   Ricinus communis
ref|XP_011047451.1|  PREDICTED: chlorophyll a-b binding protein C...    247   7e-78   
gb|ABK96503.1|  unknown                                                 246   8e-78   Populus trichocarpa x Populus deltoides
ref|XP_003604653.1|  Chlorophyll a-b binding protein                    248   1e-77   
ref|XP_011014743.1|  PREDICTED: chlorophyll a-b binding protein C...    246   1e-77   
gb|EPS68718.1|  hypothetical protein M569_06048                         246   1e-77   
ref|XP_002323575.1|  chlorophyll a/b binding protein CP29               246   1e-77   Populus trichocarpa [western balsam poplar]
gb|ACJ84724.1|  unknown                                                 246   2e-77   Medicago truncatula
ref|XP_011019131.1|  PREDICTED: chlorophyll a-b binding protein C...    244   6e-77   
ref|XP_007026729.1|  Light-harvesting complex II protein Lhcb4          244   7e-77   
ref|XP_002309134.1|  chlorophyll a/b binding protein CP29               244   1e-76   Populus trichocarpa [western balsam poplar]
gb|AAD27878.1|AF139466_1  chlorophyll a/b binding protein CP29          244   1e-76   Vigna radiata var. radiata [golden gram]
ref|XP_003520609.1|  PREDICTED: chlorophyll a-b binding protein C...    243   3e-76   
emb|CDP06495.1|  unnamed protein product                                242   4e-76   
ref|XP_009388349.1|  PREDICTED: chlorophyll a-b binding protein C...    242   7e-76   
ref|XP_004506774.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophyll ...    242   2e-75   
gb|ACO51068.1|  chloroplast chlorophyll A-B binding protein             240   2e-75   Gossypium hirsutum [American cotton]
gb|ACU19827.1|  unknown                                                 239   5e-75   Glycine max [soybeans]
ref|XP_006289419.1|  hypothetical protein CARUB_v10002918mg             239   7e-75   
gb|AEO51756.1|  chloroplast chlorophyll A/B binding protein             239   8e-75   
ref|XP_010262833.1|  PREDICTED: chlorophyll a-b binding protein C...    239   9e-75   
ref|XP_010037701.1|  PREDICTED: chlorophyll a-b binding protein C...    239   9e-75   
gb|KDP24461.1|  hypothetical protein JCGZ_25025                         239   9e-75   
ref|XP_007133907.1|  hypothetical protein PHAVU_010G002100g             238   3e-74   
ref|XP_003516950.1|  PREDICTED: chlorophyll a-b binding protein C...    238   3e-74   
gb|EYU26660.1|  hypothetical protein MIMGU_mgv1a011247mg                238   4e-74   
gb|KHG23195.1|  Uncharacterized protein F383_29279                      237   6e-74   
ref|XP_009412442.1|  PREDICTED: chlorophyll a-b binding protein C...    237   7e-74   
ref|XP_009416063.1|  PREDICTED: chlorophyll a-b binding protein C...    236   8e-74   
ref|XP_010109617.1|  hypothetical protein L484_015572                   236   1e-73   
ref|XP_009125404.1|  PREDICTED: chlorophyll a-b binding protein C...    236   2e-73   
ref|XP_008243837.1|  PREDICTED: chlorophyll a-b binding protein C...    236   2e-73   
ref|XP_006429357.1|  hypothetical protein CICLE_v10012370mg             235   3e-73   
ref|XP_006429356.1|  hypothetical protein CICLE_v10012370mg             235   3e-73   
ref|XP_010558381.1|  PREDICTED: chlorophyll a-b binding protein C...    235   3e-73   
ref|XP_002279834.1|  PREDICTED: chlorophyll a-b binding protein C...    235   4e-73   Vitis vinifera
ref|XP_010670717.1|  PREDICTED: chlorophyll a-b binding protein C...    234   4e-73   
gb|ACN25605.1|  unknown                                                 231   5e-73   Zea mays [maize]
emb|CDY04834.1|  BnaAnng00160D                                          234   5e-73   
gb|AAM12979.1|  chlorophyll a/b-binding protein CP29                    234   1e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAK82524.1|  AT5g01530/F7A7_50                                       233   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010253858.1|  PREDICTED: chlorophyll a-b binding protein C...    233   2e-72   
gb|KFK24655.1|  hypothetical protein AALP_AA8G007900                    233   2e-72   
ref|NP_001136606.1|  uncharacterized protein LOC100216729               233   2e-72   Zea mays [maize]
dbj|BAJ33665.1|  unnamed protein product                                233   2e-72   
gb|AAK43851.1|AF370474_1  chlorophyll a/b-binding protein CP29          233   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb|ABX47016.1|  chloroplast chlorophyll a/b binding protein cab-PhE7    233   2e-72   Phyllostachys edulis [kikko-chiku]
ref|NP_195773.1|  chlorophyll a-b binding protein CP29.1                233   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398606.1|  hypothetical protein EUTSA_v10014055mg             233   5e-72   
ref|XP_009377780.1|  PREDICTED: chlorophyll a-b binding protein C...    231   7e-72   
gb|AHM26635.1|  a-b binding protein                                     231   9e-72   
ref|XP_006848193.1|  hypothetical protein AMTR_s00029p00239610          231   9e-72   
ref|XP_002873005.1|  chlorophyll a/b-binding protein CP29               231   9e-72   
ref|NP_001105502.1|  photosystem II subunit29                           231   9e-72   Zea mays [maize]
ref|XP_010924043.1|  PREDICTED: chlorophyll a-b binding protein C...    231   1e-71   
ref|XP_004958012.1|  PREDICTED: chlorophyll a-b binding protein C...    231   1e-71   
ref|XP_009344712.1|  PREDICTED: chlorophyll a-b binding protein C...    231   1e-71   
prf||1908421A  light-harvesting complex IIa protein                     230   3e-71
ref|XP_008388205.1|  PREDICTED: chlorophyll a-b binding protein C...    230   4e-71   
gb|ABS11036.1|  chloroplast chlorophyll a/b-binding protein             225   4e-71   Brassica oleracea var. gemmifera
ref|XP_006407730.1|  hypothetical protein EUTSA_v10021263mg             229   4e-71   
ref|XP_009146970.1|  PREDICTED: chlorophyll a-b binding protein C...    229   5e-71   
emb|CDY53084.1|  BnaCnng24140D                                          229   6e-71   
ref|XP_008370077.1|  PREDICTED: chlorophyll a-b binding protein C...    229   9e-71   
ref|XP_002463016.1|  hypothetical protein SORBIDRAFT_02g036260          229   1e-70   Sorghum bicolor [broomcorn]
gb|ABW90990.1|  LHCB4                                                   228   1e-70   Bambusa oldhamii
ref|XP_008390707.1|  PREDICTED: chlorophyll a-b binding protein C...    226   2e-70   
gb|KFK38281.1|  hypothetical protein AALP_AA3G093700                    228   3e-70   
ref|XP_004302636.1|  PREDICTED: chlorophyll a-b binding protein C...    226   6e-70   
gb|EMT21651.1|  Chlorophyll a-b binding protein CP29.2, chloropla...    226   7e-70   
ref|XP_006300034.1|  hypothetical protein CARUB_v10016258mg             226   8e-70   
ref|XP_002882591.1|  LHCB4.2                                            226   2e-69   
ref|XP_011043542.1|  PREDICTED: chlorophyll a-b binding protein C...    225   2e-69   
ref|XP_010677168.1|  PREDICTED: chlorophyll a-b binding protein C...    224   6e-69   
ref|NP_850545.1|  light harvesting complex photosystem II interac...    222   6e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003562892.1|  PREDICTED: chlorophyll a-b binding protein C...    224   7e-69   
ref|XP_008800353.1|  PREDICTED: chlorophyll a-b binding protein C...    224   9e-69   
ref|XP_002312153.1|  Chlorophyll a-b binding protein CP29.3             223   9e-69   Populus trichocarpa [western balsam poplar]
ref|XP_010095100.1|  Chlorophyll a-b binding protein                    223   2e-68   
ref|XP_006657829.1|  PREDICTED: chlorophyll a-b binding protein C...    223   2e-68   
ref|NP_187506.1|  light harvesting complex photosystem II interac...    223   2e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AFK42501.1|  unknown                                                 220   5e-68   
ref|XP_003552419.1|  PREDICTED: chlorophyll a-b binding protein C...    221   5e-68   
ref|XP_007163532.1|  hypothetical protein PHAVU_001G242100g             221   6e-68   
ref|XP_010466814.1|  PREDICTED: chlorophyll a-b binding protein C...    221   8e-68   
ref|XP_003600876.1|  Chlorophyll a-b binding protein CP29.3             221   9e-68   
ref|NP_001059975.1|  Os07g0558400                                       221   1e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010486443.1|  PREDICTED: chlorophyll a-b binding protein C...    221   1e-67   
gb|ABK96737.1|  unknown                                                 219   2e-67   Populus trichocarpa x Populus deltoides
ref|XP_004500683.1|  PREDICTED: chlorophyll a-b binding protein C...    216   5e-66   
pdb|3PL9|A  Chain A, Crystal Structure Of Spinach Minor Light-Har...    215   5e-66   
gb|KHF99476.1|  Chlorophyll a-b binding CP29.3, chloroplastic -li...    216   6e-66   
gb|AGP03463.1|  chloroplast chlorophyll a-b binding protein CP29        216   7e-66   
ref|XP_010067525.1|  PREDICTED: chlorophyll a-b binding protein C...    215   2e-65   
ref|XP_003538459.1|  PREDICTED: chlorophyll a-b binding protein C...    215   2e-65   
ref|XP_007218784.1|  hypothetical protein PRUPE_ppa009686mg             214   3e-65   
ref|XP_008233744.1|  PREDICTED: chlorophyll a-b binding protein C...    214   3e-65   
ref|XP_002526901.1|  chlorophyll A/B binding protein, putative          213   8e-65   Ricinus communis
ref|NP_001189719.1|  light harvesting complex photosystem II            210   8e-65   
gb|KDP44781.1|  hypothetical protein JCGZ_01281                         213   1e-64   
ref|XP_004307637.1|  PREDICTED: chlorophyll a-b binding protein C...    211   4e-64   
ref|NP_181539.1|  light harvesting complex photosystem II               210   1e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007009013.1|  Light-harvesting complex II protein Lhcb8          209   2e-63   
ref|XP_002879843.1|  LHCB4.3                                            209   4e-63   
ref|XP_010554987.1|  PREDICTED: chlorophyll a-b binding protein C...    208   6e-63   
ref|XP_006294771.1|  hypothetical protein CARUB_v10023823mg             207   1e-62   
gb|AAM65936.1|  putative chlorophyll a/b binding protein                206   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411258.1|  hypothetical protein EUTSA_v10017060mg             206   4e-62   
gb|KFK36898.1|  hypothetical protein AALP_AA4G187000                    206   5e-62   
gb|KHG03743.1|  Chlorophyll a-b binding CP29.3, chloroplastic -li...    204   2e-61   
emb|CDY20518.1|  BnaC04g05260D                                          203   5e-61   
gb|EMS60898.1|  Chlorophyll a-b binding protein CP29.2, chloropla...    201   6e-61   
ref|XP_010508915.1|  PREDICTED: chlorophyll a-b binding protein C...    204   9e-61   
ref|XP_001785452.1|  predicted protein                                  202   2e-60   
ref|XP_010517408.1|  PREDICTED: chlorophyll a-b binding protein C...    202   2e-60   
ref|XP_009143253.1|  PREDICTED: chlorophyll a-b binding protein C...    201   3e-60   
ref|XP_008373917.1|  PREDICTED: chlorophyll a-b binding protein C...    201   4e-60   
ref|XP_009345742.1|  PREDICTED: chlorophyll a-b binding protein C...    201   7e-60   
ref|XP_010505716.1|  PREDICTED: chlorophyll a-b binding protein C...    201   9e-60   
ref|XP_001772786.1|  predicted protein                                  196   4e-58   
ref|XP_006435720.1|  hypothetical protein CICLE_v10032377mg             189   1e-55   
ref|XP_002985629.1|  light-harvesting complex                           187   2e-54   
ref|XP_002974259.1|  light-harvesting complex                           187   2e-54   
gb|ABK26282.1|  unknown                                                 184   2e-53   Picea sitchensis
gb|ABK25779.1|  unknown                                                 184   2e-53   Picea sitchensis
gb|ABK21281.1|  unknown                                                 184   2e-53   Picea sitchensis
gb|KHN34729.1|  Chlorophyll a-b binding protein CP29.3, chloropla...    179   2e-52   
gb|EAZ40279.1|  hypothetical protein OsJ_24721                          171   1e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009369266.1|  PREDICTED: chlorophyll a-b binding protein C...    167   4e-47   
ref|XP_008373481.1|  PREDICTED: chlorophyll a-b binding protein C...    157   5e-45   
gb|KDO69014.1|  hypothetical protein CISIN_1g028743mg                   158   3e-44   
gb|AAP79139.1|  chlorophyll a/b-binding protein CP29                    149   8e-40   Bigelowiella natans
gb|KFM27428.1|  Chlorophyll a-b binding protein CP29                    149   2e-39   
ref|XP_007508675.1|  unknown                                            147   2e-39   
gb|ACF24530.1|  chlorophyll a/b binding protein CP29                    147   4e-39   Gymnochlora stellata
tpg|DAA05897.1|  TPA: chloroplast light-harvesting protein CP29 p...    144   4e-38   
ref|XP_003083704.1|  CP29-like light-harvesting chlorophyll a/b b...    140   7e-37   
emb|CEG00441.1|  Chlorophyll A-B binding protein, plant                 140   9e-37   
ref|XP_005646238.1|  hypothetical protein COCSUDRAFT_67011              139   6e-36   
gb|ABD37890.1|  light-harvesting chlorophyll-a/b binding protein ...    137   3e-35   Mesostigma viride
ref|XP_005845614.1|  hypothetical protein CHLNCDRAFT_56266              136   4e-35   
ref|XP_005646225.1|  chlorophyll a/b-binding protein CP29               135   9e-35   
ref|XP_002951424.1|  chlorophyll a/b-binding protein of photosyst...    135   2e-34   
ref|XP_001697193.1|  chlorophyll a-b binding protein of photosyst...    133   5e-34   Chlamydomonas reinhardtii
gb|ABD37915.1|  light-harvesting chlorophyll-a/b binding protein ...    132   7e-34   Chlamydomonas incerta
ref|XP_003063531.1|  chlorophyll a/b-binding protein CP29, chloro...    129   1e-32   
tpg|DAA05880.1|  TPA: chloroplast light-harvesting protein CP29 p...    129   1e-32   
ref|XP_002506291.1|  chlorophyll a/b-binding protein CP29, chloro...    128   3e-32   Micromonas commoda
gb|ACN40533.1|  unknown                                                 125   2e-31   Picea sitchensis
ref|XP_001421643.1|  possibly CP29, chlorophyll a/b binding             125   4e-31   Ostreococcus lucimarinus CCE9901
emb|CBL86548.1|  chlorophyll a/b binding protein                        113   2e-27   
gb|KCW65678.1|  hypothetical protein EUGRSUZ_G03060                     112   1e-26   
gb|AFD62761.1|  LHCB                                                    106   6e-25   
dbj|BAJ89825.1|  predicted protein                                      100   2e-23   
emb|CDY61708.1|  BnaC04g56710D                                          105   4e-23   
emb|CAA71758.1|  hypothetical protein                                 95.1    3e-21   Sporobolus stapfianus [resurrection grass]
gb|ACN34741.1|  unknown                                               82.0    2e-15   Zea mays [maize]
gb|ABK21651.1|  unknown                                               77.0    3e-14   Picea sitchensis
emb|CDY05360.1|  BnaC02g40680D                                        74.7    9e-14   
ref|XP_006474704.1|  PREDICTED: chlorophyll a-b binding protein, ...  71.6    8e-12   
ref|XP_006452839.1|  hypothetical protein CICLE_v10009205mg           71.2    1e-11   
ref|XP_006452840.1|  hypothetical protein CICLE_v10009205mg           71.2    1e-11   
ref|XP_006345258.1|  PREDICTED: chlorophyll a-b binding protein, ...  70.9    1e-11   
ref|XP_004251698.1|  PREDICTED: chlorophyll a-b binding protein, ...  70.5    2e-11   
gb|ABK96605.1|  unknown                                               70.5    2e-11   Populus trichocarpa x Populus deltoides
ref|XP_011039957.1|  PREDICTED: chlorophyll a-b binding protein, ...  70.1    2e-11   
ref|XP_006381597.1|  chlorophyll A-B binding family protein           70.1    2e-11   
ref|XP_010099098.1|  Chlorophyll a-b binding protein                  70.5    2e-11   
ref|XP_009627312.1|  PREDICTED: chlorophyll a-b binding protein, ...  70.1    3e-11   
emb|CDP03055.1|  unnamed protein product                              69.7    4e-11   
ref|XP_011093862.1|  PREDICTED: chlorophyll a-b binding protein, ...  69.3    4e-11   
ref|XP_009759850.1|  PREDICTED: chlorophyll a-b binding protein, ...  69.3    5e-11   
ref|XP_004288997.1|  PREDICTED: chlorophyll a-b binding protein, ...  68.9    7e-11   
ref|XP_007202451.1|  hypothetical protein PRUPE_ppa010035mg           68.6    9e-11   
gb|KDP33938.1|  hypothetical protein JCGZ_07509                       68.2    1e-10   
ref|XP_004161120.1|  PREDICTED: chlorophyll a-b binding protein, ...  68.2    1e-10   
ref|XP_004144043.1|  PREDICTED: chlorophyll a-b binding protein, ...  68.2    1e-10   
ref|XP_008450947.1|  PREDICTED: chlorophyll a-b binding protein, ...  68.2    1e-10   
ref|XP_010687546.1|  PREDICTED: chlorophyll a-b binding protein, ...  68.2    1e-10   
ref|XP_002516245.1|  chlorophyll A/B binding protein, putative        68.2    2e-10   Ricinus communis
ref|XP_003637475.1|  Chlorophyll a-b binding protein                  67.8    2e-10   
gb|EYU25834.1|  hypothetical protein MIMGU_mgv1a012037mg              67.4    2e-10   
gb|EYU25833.1|  hypothetical protein MIMGU_mgv1a012037mg              67.4    3e-10   
ref|XP_007138637.1|  hypothetical protein PHAVU_009G225500g           67.0    3e-10   
emb|CDX83783.1|  BnaC08g18620D                                        67.0    3e-10   
ref|XP_007205402.1|  hypothetical protein PRUPE_ppa007518mg           67.8    4e-10   
ref|XP_003546513.1|  PREDICTED: chlorophyll a-b binding protein, ...  66.6    5e-10   
gb|KHN42786.1|  Chlorophyll a-b binding protein, chloroplastic        66.6    5e-10   
ref|NP_001289223.1|  chlorophyll a-b binding protein, chloroplastic   66.2    6e-10   
gb|KHN12296.1|  Chlorophyll a-b binding protein, chloroplastic        66.2    6e-10   
ref|XP_008389009.1|  PREDICTED: chlorophyll a-b binding protein, ...  66.2    6e-10   
ref|XP_009110471.1|  PREDICTED: chlorophyll a-b binding protein C...  66.2    6e-10   
ref|NP_001276216.1|  chlorophyll a-b binding protein, chloroplast...  66.2    6e-10   
ref|XP_009110297.1|  PREDICTED: chlorophyll a-b binding protein, ...  65.9    8e-10   
ref|XP_010459573.1|  PREDICTED: chlorophyll a-b binding protein, ...  65.9    1e-09   
ref|XP_010932388.1|  PREDICTED: chlorophyll a-b binding protein, ...  65.5    1e-09   
ref|XP_010272798.1|  PREDICTED: chlorophyll a-b binding protein 7...  65.5    1e-09   
ref|XP_010477121.1|  PREDICTED: chlorophyll a-b binding protein, ...  65.5    1e-09   
gb|KHG29329.1|  Chlorophyll a-b binding, chloroplastic                65.1    2e-09   
ref|XP_001782439.1|  predicted protein                                63.9    2e-09   
ref|XP_007012597.1|  Photosystem I light harvesting complex gene ...  64.7    3e-09   
gb|KFK44053.1|  hypothetical protein AALP_AA1G210000                  64.7    3e-09   
ref|XP_009418009.1|  PREDICTED: chlorophyll a-b binding protein, ...  64.3    3e-09   
ref|XP_007012598.1|  Photosystem I light harvesting complex gene ...  64.3    3e-09   
emb|CDX96677.1|  BnaA08g22200D                                        64.3    3e-09   
emb|CAN69989.1|  hypothetical protein VITISV_024400                   63.9    3e-09   Vitis vinifera
ref|XP_010498326.1|  PREDICTED: chlorophyll a-b binding protein, ...  64.3    3e-09   
ref|XP_008242265.1|  PREDICTED: chlorophyll a-b binding protein, ...  64.3    3e-09   
ref|XP_002277280.1|  PREDICTED: chlorophyll a-b binding protein, ...  64.3    4e-09   Vitis vinifera
ref|XP_008242266.1|  PREDICTED: chlorophyll a-b binding protein, ...  64.3    4e-09   
ref|XP_009362479.1|  PREDICTED: chlorophyll a-b binding protein C...  63.9    4e-09   
ref|XP_008801837.1|  PREDICTED: chlorophyll a-b binding protein 7...  63.9    4e-09   
ref|XP_006416532.1|  hypothetical protein EUTSA_v10008493mg           63.9    4e-09   
sp|P36494.1|CB4_SPIOL  RecName: Full=Chlorophyll a-b binding prot...  63.9    4e-09   Spinacia oleracea
ref|XP_004488100.1|  PREDICTED: chlorophyll a-b binding protein 7...  63.9    5e-09   
gb|AAO22627.1|  putative light-harvesting chlorophyll a/b binding...  63.9    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004488099.1|  PREDICTED: chlorophyll a-b binding protein 7...  64.3    5e-09   
ref|NP_173349.1|  PSI type II chlorophyll a/b-binding protein (Lh...  63.9    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306445.1|  hypothetical protein CARUB_v10012387mg           63.9    5e-09   
ref|XP_004956925.1|  PREDICTED: chlorophyll a-b binding protein 7...  63.9    5e-09   
gb|AAF82226.1|AC069143_2  Contains similarity to a chlorophyll a/...  63.5    6e-09   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA40157.1|  TPA: hypothetical protein ZEAMMB73_160322            63.2    6e-09   
ref|XP_004956926.1|  PREDICTED: chlorophyll a-b binding protein 7...  63.5    6e-09   
ref|XP_008667517.1|  PREDICTED: uncharacterized protein LOC100273...  63.5    6e-09   
ref|NP_001141336.1|  hypothetical protein                             63.5    6e-09   Zea mays [maize]
ref|XP_002514914.1|  chlorophyll A/B binding protein, putative        63.5    6e-09   Ricinus communis
ref|XP_004956924.1|  PREDICTED: chlorophyll a-b binding protein 7...  63.9    6e-09   
gb|KDP26804.1|  hypothetical protein JCGZ_17962                       63.5    7e-09   
gb|EPS71951.1|  chlorophyll a-b binding protein 7, chloroplastic      62.8    1e-08   
ref|XP_007148423.1|  hypothetical protein PHAVU_006G207300g           62.8    1e-08   
ref|XP_008784474.1|  PREDICTED: chlorophyll a-b binding protein, ...  62.8    1e-08   
ref|XP_004510608.1|  PREDICTED: chlorophyll a-b binding protein 7...  63.2    1e-08   
ref|XP_010531966.1|  PREDICTED: chlorophyll a-b binding protein, ...  62.8    1e-08   
ref|XP_004510609.1|  PREDICTED: chlorophyll a-b binding protein 7...  62.8    1e-08   
gb|ABW06957.1|  chloroplast light-harvesting complex II protein p...  63.9    1e-08   Euglena gracilis
ref|XP_006474702.1|  PREDICTED: chlorophyll a-b binding protein, ...  62.8    1e-08   
ref|XP_009415902.1|  PREDICTED: chlorophyll a-b binding protein 7...  63.2    1e-08   
ref|XP_002890321.1|  hypothetical protein ARALYDRAFT_472139           62.8    1e-08   
emb|CCI55397.1|  PSI antenna protein Lhca2                            62.8    1e-08   
ref|XP_006351797.1|  PREDICTED: chlorophyll a-b binding protein C...  62.4    1e-08   
ref|XP_006474703.1|  PREDICTED: chlorophyll a-b binding protein, ...  62.8    1e-08   
emb|CDX96833.1|  BnaA08g23760D                                        62.4    2e-08   
ref|XP_001778557.1|  predicted protein                                62.4    2e-08   
gb|ABD37883.1|  light-harvesting chlorophyll-a/b binding protein ...  61.2    2e-08   Mesostigma viride
ref|XP_006848348.1|  hypothetical protein AMTR_s00013p00180670        62.0    2e-08   
gb|AFK40780.1|  unknown                                               61.6    2e-08   
ref|XP_002876615.1|  Lhca2 protein                                    61.6    3e-08   
gb|AES65592.2|  light-harvesting complex I chlorophyll A/B-bindin...  61.6    3e-08   
ref|XP_009795766.1|  PREDICTED: chlorophyll a-b binding protein C...  61.6    3e-08   
ref|XP_010917526.1|  PREDICTED: chlorophyll a-b binding protein, ...  61.6    3e-08   
ref|XP_009613268.1|  PREDICTED: chlorophyll a-b binding protein C...  61.6    3e-08   
sp|P13869.1|CB12_PETHY  RecName: Full=Chlorophyll a-b binding pro...  61.6    3e-08   Petunia x hybrida [garden petunia]
gb|AFK45037.1|  unknown                                               61.6    3e-08   
gb|ACU15016.1|  unknown                                               61.2    4e-08   Glycine max [soybeans]
ref|XP_010103822.1|  Chlorophyll a-b binding protein CP24 10A         61.2    4e-08   
ref|XP_010666865.1|  PREDICTED: chlorophyll a-b binding protein C...  61.2    4e-08   
ref|XP_003531552.1|  PREDICTED: chlorophyll a-b binding protein C...  61.2    4e-08   
gb|KHN33514.1|  Chlorophyll a-b binding protein CP24 10A, chlorop...  61.2    4e-08   
gb|EPS71396.1|  hypothetical protein M569_03363                       61.2    4e-08   
ref|XP_010049390.1|  PREDICTED: chlorophyll a-b binding protein, ...  61.2    4e-08   
ref|NP_001236415.1|  uncharacterized protein LOC100527463             61.2    4e-08   
ref|XP_008446035.1|  PREDICTED: chlorophyll a-b binding protein 7...  61.2    4e-08   
gb|AAD27882.2|AF139470_1  chlorophyll a/b-binding protein CP24 pr...  61.2    5e-08   Vigna radiata var. radiata [golden gram]
ref|XP_011005195.1|  PREDICTED: chlorophyll a-b binding protein C...  61.2    5e-08   
ref|NP_191706.2|  photosystem I light harvesting complex protein      60.8    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003548018.1|  PREDICTED: chlorophyll a-b binding protein 7...  61.2    5e-08   
emb|CAB71077.1|  Lhca2 protein                                        60.8    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010905185.1|  PREDICTED: chlorophyll a-b binding protein 7...  61.2    5e-08   
gb|EYU25891.1|  hypothetical protein MIMGU_mgv1a025195mg              60.8    5e-08   
emb|CDY51572.1|  BnaCnng21010D                                        60.8    5e-08   
ref|XP_008446036.1|  PREDICTED: chlorophyll a-b binding protein 7...  61.2    5e-08   
ref|XP_009104311.1|  PREDICTED: chlorophyll a-b binding protein, ...  60.8    5e-08   
ref|XP_001786080.1|  predicted protein                                61.2    5e-08   
gb|ABY63668.1|  chloroplast chlorophyll a/b binding protein           60.8    5e-08   
gb|KHN15861.1|  Chlorophyll a-b binding protein 7, chloroplastic      60.8    5e-08   
ref|XP_004485563.1|  PREDICTED: chlorophyll a-b binding protein C...  60.8    6e-08   
ref|XP_004135326.1|  PREDICTED: chlorophyll a-b binding protein 7...  60.8    6e-08   
ref|XP_010939618.1|  PREDICTED: chlorophyll a-b binding protein C...  60.8    6e-08   
ref|XP_006653476.1|  PREDICTED: chlorophyll a-b binding protein C...  60.8    6e-08   
ref|XP_009587026.1|  PREDICTED: chlorophyll a-b binding protein, ...  60.8    6e-08   
ref|XP_009787153.1|  PREDICTED: chlorophyll a-b binding protein, ...  60.8    6e-08   
emb|CDY53917.1|  BnaA07g38250D                                        62.0    6e-08   
gb|ABK95601.1|  unknown                                               60.8    6e-08   
ref|XP_006351799.1|  PREDICTED: chlorophyll a-b binding protein C...  60.5    7e-08   
ref|XP_002303791.1|  chlorophyll a/b-binding protein type II prec...  60.8    7e-08   
tpg|DAA05946.1|  TPA: chloroplast light-harvesting complex I prot...  60.1    7e-08   
gb|AHM26636.1|  a-b binding protein                                   59.3    7e-08   
emb|CDX83966.1|  BnaC08g16790D                                        60.1    7e-08   
gb|EEC84641.1|  hypothetical protein OsI_31519                        60.5    9e-08   
ref|XP_003595341.1|  Chlorophyll a-b binding protein                  60.5    9e-08   
ref|XP_010497422.1|  PREDICTED: chlorophyll a-b binding protein C...  60.1    1e-07   
ref|NP_001063275.1|  Os09g0439500                                     60.1    1e-07   
ref|NP_173034.1|  light harvesting complex photosystem II subunit 6   60.1    1e-07   
ref|XP_010512495.1|  PREDICTED: chlorophyll a-b binding protein, ...  60.1    1e-07   
ref|XP_010459118.1|  PREDICTED: chlorophyll a-b binding protein C...  60.1    1e-07   
gb|AAD28777.1|AF134130_1  Lhcb6 protein                               60.1    1e-07   
ref|XP_007223489.1|  hypothetical protein PRUPE_ppa010195mg           60.1    1e-07   
ref|XP_010469082.1|  PREDICTED: chlorophyll a-b binding protein, ...  60.1    1e-07   
gb|EAZ44873.1|  hypothetical protein OsJ_29513                        59.7    1e-07   
ref|XP_010476680.1|  PREDICTED: chlorophyll a-b binding protein C...  60.1    1e-07   
ref|XP_007135346.1|  hypothetical protein PHAVU_010G121400g           60.1    1e-07   
ref|XP_006291716.1|  hypothetical protein CARUB_v10017882mg           60.1    1e-07   
ref|XP_010413397.1|  PREDICTED: chlorophyll a-b binding protein, ...  60.1    1e-07   
gb|ACF23028.1|  ST49-6                                                59.3    1e-07   
gb|AGV54278.1|  light-harvesting complex I protein Lhca2              60.1    1e-07   
gb|AGV54335.1|  chlorophyll A/B binding protein 7 chloroplastic-l...  60.1    1e-07   
ref|NP_001148893.1|  chlorophyll a-b binding protein                  60.1    1e-07   
ref|XP_010531194.1|  PREDICTED: chlorophyll a-b binding protein 7...  60.1    1e-07   
ref|XP_010531186.1|  PREDICTED: chlorophyll a-b binding protein 7...  60.1    1e-07   
ref|XP_007043011.1|  Light harvesting complex photosystem II subu...  59.7    1e-07   
gb|AFK35880.1|  unknown                                               60.1    1e-07   
dbj|BAJ89706.1|  predicted protein                                    59.7    1e-07   
ref|XP_004248339.1|  PREDICTED: chlorophyll a-b binding protein 7...  60.1    1e-07   
ref|XP_003637339.1|  Chlorophyll a-b binding protein                  60.1    1e-07   
ref|XP_003593177.1|  Chloroplast chlorophyll a/b-binding protein ...  59.7    1e-07   
ref|NP_001147224.1|  chlorophyll a-b binding protein                  59.7    1e-07   
gb|EYU39149.1|  hypothetical protein MIMGU_mgv1a012260mg              59.7    1e-07   
emb|CBI20065.3|  unnamed protein product                              58.9    1e-07   
gb|EEC82322.1|  hypothetical protein OsI_26601                        60.5    1e-07   
ref|XP_009613269.1|  PREDICTED: chlorophyll a-b binding protein C...  59.7    1e-07   
ref|XP_006303285.1|  hypothetical protein CARUB_v10010058mg           59.7    1e-07   
gb|AFK45885.1|  unknown                                               59.7    1e-07   
ref|XP_002892885.1|  Lhcb6 protein                                    59.7    2e-07   
ref|XP_010315086.1|  PREDICTED: chlorophyll a-b binding protein C...  59.7    2e-07   
emb|CDY33376.1|  BnaC05g12070D                                        59.7    2e-07   
emb|CDY35042.1|  BnaA06g10520D                                        59.7    2e-07   
ref|XP_002299309.1|  chlorophyll a/b-binding protein type II prec...  59.7    2e-07   
ref|XP_008389866.1|  PREDICTED: chlorophyll a-b binding protein, ...  60.1    2e-07   
ref|XP_009770890.1|  PREDICTED: chlorophyll a-b binding protein C...  59.7    2e-07   
emb|CDX81735.1|  BnaC08g38660D                                        59.7    2e-07   
gb|AFK42470.1|  unknown                                               59.7    2e-07   
dbj|BAJ34383.1|  unnamed protein product                              59.3    2e-07   
ref|XP_009117802.1|  PREDICTED: chlorophyll a-b binding protein C...  59.3    2e-07   
ref|XP_009372280.1|  PREDICTED: chlorophyll a-b binding protein, ...  59.7    2e-07   
ref|XP_006657881.1|  PREDICTED: chlorophyll a-b binding protein 7...  59.7    2e-07   
gb|AFR32945.1|  light-harvesting complex photosystem II               58.9    2e-07   
ref|XP_009149012.1|  PREDICTED: chlorophyll a-b binding protein C...  59.3    2e-07   
ref|NP_001060090.1|  Os07g0577600                                     59.3    2e-07   
gb|AFK41475.1|  unknown                                               59.3    2e-07   
ref|XP_003528751.1|  PREDICTED: chlorophyll a-b binding protein 7...  59.3    2e-07   
gb|AAT74560.1|  Lhcb6 protein                                         59.3    2e-07   
ref|XP_008340223.1|  PREDICTED: chlorophyll a-b binding protein, ...  59.3    2e-07   
ref|XP_006416877.1|  hypothetical protein EUTSA_v10008533mg           59.3    2e-07   
ref|XP_006402477.1|  hypothetical protein EUTSA_v10006165mg           59.3    2e-07   
ref|XP_004140973.1|  PREDICTED: chlorophyll a-b binding protein C...  59.3    2e-07   
ref|XP_011086789.1|  PREDICTED: chlorophyll a-b binding protein, ...  59.3    2e-07   
gb|ABO71660.2|  LhCa2 protein                                         59.3    2e-07   
ref|XP_008805305.1|  PREDICTED: chlorophyll a-b binding protein 7...  59.3    2e-07   
gb|AHM26638.1|  a-b binding protein                                   59.3    2e-07   
ref|XP_011036086.1|  PREDICTED: chlorophyll a-b binding protein 7...  59.3    2e-07   
ref|XP_009138769.1|  PREDICTED: chlorophyll a-b binding protein, ...  59.3    2e-07   
ref|XP_006827820.1|  hypothetical protein AMTR_s00009p00268360        58.9    2e-07   
ref|XP_011020754.1|  PREDICTED: chlorophyll a-b binding protein 7...  59.3    2e-07   
ref|XP_011002123.1|  PREDICTED: chlorophyll a-b binding protein 7...  59.3    2e-07   
ref|XP_008441527.1|  PREDICTED: chlorophyll a-b binding protein C...  58.9    2e-07   
gb|ABK95596.1|  unknown                                               59.3    2e-07   
ref|XP_008222160.1|  PREDICTED: chlorophyll a-b binding protein, ...  59.3    2e-07   
pdb|2WSC|2  Chain 2, Improved Model Of Plant Photosystem I            59.3    2e-07   
emb|CAA57492.1|  Type II chlorophyll a/b binding protein from pho...  59.3    2e-07   
ref|XP_002263201.1|  PREDICTED: chlorophyll a-b binding protein C...  58.9    2e-07   
dbj|BAJ94030.1|  predicted protein                                    59.3    2e-07   
dbj|BAJ88556.1|  predicted protein                                    59.3    2e-07   
dbj|BAJ86784.1|  predicted protein                                    59.3    3e-07   
ref|XP_011007955.1|  PREDICTED: chlorophyll a-b binding protein C...  58.9    3e-07   
ref|XP_002298178.1|  chlorophyll A-B binding family protein           58.9    3e-07   
gb|KHG11922.1|  Chlorophyll a-b binding 7, chloroplastic              58.9    3e-07   
ref|XP_010250717.1|  PREDICTED: chlorophyll a-b binding protein, ...  58.9    3e-07   
ref|XP_007222715.1|  hypothetical protein PRUPE_ppa009903mg           58.9    3e-07   
ref|XP_010044808.1|  PREDICTED: chlorophyll a-b binding protein 7...  58.9    3e-07   
ref|XP_010100230.1|  Chlorophyll a-b binding protein                  58.9    3e-07   
tpg|DAA41205.1|  TPA: hypothetical protein ZEAMMB73_510089            57.8    3e-07   
ref|NP_001239987.1|  uncharacterized protein LOC100794944             58.9    3e-07   
ref|XP_008391511.1|  PREDICTED: chlorophyll a-b binding protein C...  58.5    4e-07   
tpg|DAA41204.1|  TPA: hypothetical protein ZEAMMB73_510089            57.8    4e-07   
ref|XP_009387775.1|  PREDICTED: chlorophyll a-b binding protein C...  58.5    4e-07   
ref|XP_004958124.1|  PREDICTED: chlorophyll a-b binding protein 7...  58.5    4e-07   
gb|KHN16392.1|  Chlorophyll a-b binding protein 7, chloroplastic      59.3    4e-07   
ref|XP_006438030.1|  hypothetical protein CICLE_v10031886mg           59.3    4e-07   
ref|XP_003531041.1|  PREDICTED: chlorophyll a-b binding protein C...  58.5    4e-07   
gb|AGT16124.1|  chlorophyll a-b binding protein                       58.5    4e-07   
ref|XP_010261229.1|  PREDICTED: chlorophyll a-b binding protein C...  58.5    4e-07   
emb|CDP13340.1|  unnamed protein product                              58.9    4e-07   
ref|XP_002533515.1|  chlorophyll A/B binding protein, putative        58.5    4e-07   
ref|XP_007159087.1|  hypothetical protein PHAVU_002G207500g           58.5    4e-07   
gb|ACU23773.1|  unknown                                               58.5    4e-07   
ref|XP_004300703.1|  PREDICTED: chlorophyll a-b binding protein C...  58.5    4e-07   
ref|XP_006423921.1|  hypothetical protein CICLE_v10029116mg           58.2    4e-07   
ref|XP_008790804.1|  PREDICTED: chlorophyll a-b binding protein C...  58.5    4e-07   
ref|XP_006494019.1|  PREDICTED: chlorophyll a-b binding protein C...  58.2    4e-07   
ref|XP_003576571.1|  PREDICTED: chlorophyll a-b binding protein 7...  58.5    5e-07   
gb|ABK23846.1|  unknown                                               56.6    5e-07   
gb|AAB65793.1|  photosystem I antenna protein                         58.2    5e-07   
ref|XP_008368146.1|  PREDICTED: chlorophyll a-b binding protein C...  58.5    5e-07   
gb|ACF05852.1|  chloroplast light-harvesting complex II protein       57.0    5e-07   
gb|ACF05842.1|  chloroplast light-harvesting complex II protein       57.0    5e-07   
gb|ACF05833.1|  chloroplast light-harvesting complex II protein       57.0    5e-07   
ref|XP_010238211.1|  PREDICTED: chlorophyll a-b binding protein 7...  58.5    5e-07   
gb|ACF05843.1|  chloroplast light-harvesting complex II protein       57.0    5e-07   
ref|XP_010532097.1|  PREDICTED: chlorophyll a-b binding protein C...  58.2    5e-07   
gb|AAL74385.1|AF359117_1  LHC I type II chlorophyll binding protein   56.2    5e-07   
ref|XP_006484100.1|  PREDICTED: chlorophyll a-b binding protein, ...  58.2    5e-07   
gb|KDO81901.1|  hypothetical protein CISIN_1g024422mg                 58.2    6e-07   
ref|XP_010065599.1|  PREDICTED: chlorophyll a-b binding protein C...  58.2    6e-07   
gb|ABK95437.1|  unknown                                               57.8    6e-07   
dbj|BAI52949.1|  light-harvesting complex II protein                  57.8    6e-07   
ref|XP_006385220.1|  hypothetical protein POPTR_0003s01450g           57.8    7e-07   
ref|XP_004310078.1|  PREDICTED: chlorophyll a-b binding protein, ...  58.2    7e-07   
gb|EYU18497.1|  hypothetical protein MIMGU_mgv1a012167mg              57.8    7e-07   
ref|XP_004310079.1|  PREDICTED: chlorophyll a-b binding protein, ...  57.8    8e-07   
ref|XP_002303160.2|  hypothetical protein POPTR_0003s01450g           58.2    8e-07   
ref|XP_007139044.1|  hypothetical protein PHAVU_009G260200g           57.8    8e-07   
ref|XP_009379581.1|  PREDICTED: chlorophyll a-b binding protein C...  57.8    8e-07   
ref|XP_002986118.1|  light-harvesting complex                         57.4    9e-07   
ref|XP_007139043.1|  hypothetical protein PHAVU_009G260200g           57.8    9e-07   
gb|KDP27379.1|  hypothetical protein JCGZ_20203                       57.4    9e-07   
ref|XP_006352516.1|  PREDICTED: chlorophyll a-b binding protein 7...  57.4    9e-07   
ref|NP_001130616.1|  chlorophyll a-b binding protein                  57.4    1e-06   
ref|XP_007044017.1|  Chlorophyll a-b binding protein 7, chloropla...  57.4    1e-06   
ref|XP_010655886.1|  PREDICTED: chlorophyll a-b binding protein, ...  57.4    1e-06   
ref|XP_009405484.1|  PREDICTED: chlorophyll a-b binding protein 7...  57.4    1e-06   
emb|CAA55864.1|  type II LHCI                                         57.0    1e-06   
ref|XP_002958611.1|  light-harvesting protein of photosystem I        56.6    2e-06   
ref|XP_003562834.1|  PREDICTED: chlorophyll a-b binding protein 7...  56.6    2e-06   
emb|CAA59049.1|  LHCI-680, photosystem I antenna protein              56.6    2e-06   
emb|CAN72005.1|  hypothetical protein VITISV_033663                   56.6    2e-06   
gb|EMT28434.1|  hypothetical protein F775_43774                       56.6    2e-06   
tpg|DAA05887.1|  TPA: chloroplast light-harvesting complex I prot...  57.4    2e-06   
ref|XP_008361903.1|  PREDICTED: chlorophyll a-b binding protein, ...  53.9    2e-06   
gb|ACF05832.1|  chloroplast light-harvesting complex II protein       55.1    2e-06   
gb|ABW06946.1|  chloroplast light-harvesting complex I protein pr...  57.4    2e-06   
ref|XP_004236014.1|  PREDICTED: chlorophyll a-b binding protein 4...  56.6    2e-06   
ref|XP_009415903.1|  PREDICTED: chlorophyll a-b binding protein 7...  56.6    2e-06   
gb|ACF05831.1|  chloroplast light-harvesting complex II protein       55.1    2e-06   
ref|NP_001275056.1|  chlorophyll a-b binding protein 4, chloropla...  56.2    2e-06   
gb|ABK22868.1|  unknown                                               55.8    3e-06   
emb|CAC81065.1|  putative chlorophyll A-B binding protein of LHCI...  56.2    3e-06   
gb|ACF05839.1|  chloroplast light-harvesting complex II protein       54.7    3e-06   
ref|XP_010669087.1|  PREDICTED: chlorophyll a-b binding protein, ...  56.2    3e-06   
ref|XP_007136682.1|  hypothetical protein PHAVU_009G064900g           56.2    3e-06   
ref|XP_009618704.1|  PREDICTED: chlorophyll a-b binding protein P...  55.8    3e-06   
ref|XP_009773617.1|  PREDICTED: chlorophyll a-b binding protein P...  55.8    3e-06   
gb|ABK21282.1|  unknown                                               56.2    3e-06   
ref|XP_005846780.1|  hypothetical protein CHLNCDRAFT_31627            55.8    4e-06   
ref|XP_009398171.1|  PREDICTED: chlorophyll a-b binding protein 4...  55.8    4e-06   
ref|XP_011087238.1|  PREDICTED: chlorophyll a-b binding protein 4...  55.8    4e-06   
ref|XP_001757538.1|  predicted protein                                55.1    4e-06   
ref|XP_011092414.1|  PREDICTED: chlorophyll a-b binding protein C...  55.5    4e-06   
gb|ABD37908.1|  light-harvesting chlorophyll-a/b binding protein ...  54.7    4e-06   
ref|XP_011087853.1|  PREDICTED: chlorophyll a-b binding protein C...  55.5    5e-06   
tpg|DAA05888.1|  TPA: chloroplast light-harvesting complex I prot...  56.2    5e-06   
ref|XP_002984998.1|  light-harvesting complex                         55.5    5e-06   
tpg|DAA05900.1|  TPA: chloroplast light-harvesting complex I prot...  54.3    6e-06   
ref|XP_003075322.1|  PSI-associated light-harvesting chlorophyll ...  54.7    6e-06   
ref|XP_002986188.1|  light-harvesting complex                         55.5    6e-06   
emb|CAA41406.1|  Type II chlorophyll a /b-binding protein             55.1    7e-06   
ref|XP_001698070.1|  light-harvesting protein of photosystem I        55.1    7e-06   
gb|ABD37907.1|  light-harvesting chlorophyll-a/b binding protein ...  55.1    7e-06   
ref|XP_010322569.1|  PREDICTED: chlorophyll a-b binding protein 4...  55.1    7e-06   
ref|XP_001758295.1|  predicted protein                                55.1    8e-06   
ref|XP_009587071.1|  PREDICTED: chlorophyll a-b binding protein P...  54.7    8e-06   
ref|XP_009804068.1|  PREDICTED: chlorophyll a-b binding protein 4...  54.7    8e-06   
ref|XP_005847168.1|  hypothetical protein CHLNCDRAFT_35848            54.3    9e-06   
ref|XP_002948151.1|  light-harvesting protein of photosystem I        54.3    1e-05   
ref|XP_001782441.1|  predicted protein                                54.3    1e-05   
ref|XP_001691031.1|  light-harvesting protein of photosystem I        54.3    1e-05   
gb|ACB05669.1|  chloroplast chlorophyll a/b binding protein           54.3    1e-05   
ref|XP_010546068.1|  PREDICTED: chlorophyll a-b binding protein 4...  54.3    1e-05   
gb|AAB34049.1|  chlorophyll a/b protein CP29, photosystem II subu...  50.4    1e-05   
ref|NP_190331.3|  chlorophyll a-b binding protein 4                   54.3    1e-05   
gb|ACF05841.1|  chloroplast light-harvesting complex II protein       53.1    1e-05   
gb|ACG35965.1|  chlorophyll a-b binding protein 4                     53.9    1e-05   
ref|XP_010426187.1|  PREDICTED: chlorophyll a-b binding protein 4...  53.9    1e-05   
ref|XP_010515052.1|  PREDICTED: chlorophyll a-b binding protein 4...  53.9    1e-05   
gb|ACF86037.1|  unknown                                               53.9    1e-05   
ref|XP_006291725.1|  hypothetical protein CARUB_v10017894mg           53.9    2e-05   
ref|NP_001105375.1|  light harvesting chlorophyll a/b binding pro...  53.9    2e-05   
tpg|DAA05920.1|  TPA: chloroplast light-harvesting complex I prot...  53.5    2e-05   
gb|KFM24541.1|  Chlorophyll a-b binding protein 7, chloroplastic      54.3    2e-05   
ref|XP_010479098.1|  PREDICTED: chlorophyll a-b binding protein 4...  53.5    2e-05   
ref|XP_004137413.1|  PREDICTED: chlorophyll a-b binding protein P...  53.5    2e-05   
gb|AEZ49173.1|  chlorophyll a/b binding protein 4                     53.5    2e-05   
gb|ABD37879.1|  light-harvesting chlorophyll-a/b binding protein ...  53.5    2e-05   
ref|XP_006374461.1|  hypothetical protein POPTR_0015s07340g           53.1    2e-05   
ref|XP_010500206.1|  PREDICTED: chlorophyll a-b binding protein 4...  53.5    2e-05   
ref|XP_009388762.1|  PREDICTED: chlorophyll a-b binding protein 4...  53.5    2e-05   
ref|XP_010257811.1|  PREDICTED: chlorophyll a-b binding protein 4...  53.1    3e-05   
ref|XP_002877563.1|  chlorophyll a/b-binding protein                  53.1    3e-05   
ref|XP_006305539.1|  hypothetical protein CARUB_v10010062mg           53.1    3e-05   
ref|XP_007512058.1|  light-harvesting protein of photosystem I        52.4    3e-05   
ref|XP_006374462.1|  hypothetical protein POPTR_0015s07340g           52.4    4e-05   
gb|AFW62279.1|  hypothetical protein ZEAMMB73_290736                  52.8    4e-05   
gb|AFK43193.1|  unknown                                               52.4    4e-05   



>ref|XP_011095216.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Sesamum indicum]
Length=360

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 143/181 (79%), Gaps = 7/181 (4%)
 Frame = -2

Query  545  LSYPHKHIAMAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQ  366
            LS PH     AA AA  SF+GTRLP+ ++G GRV+A  GFG                  +
Sbjct  67   LSLPHTLAMAAAAAAASSFIGTRLPEVRSGSGRVQARFGFG-------TKKSPPKKAAPK  119

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
             +SDRP WFPGAKAP++LDGSLVGD GFDPFGL KP EYLQF+LDSLDQNLAKNLAGDII
Sbjct  120  PTSDRPLWFPGAKAPDYLDGSLVGDYGFDPFGLGKPVEYLQFDLDSLDQNLAKNLAGDII  179

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGK  6
            GTR ESSDVK TPFQPYSEVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGK
Sbjct  180  GTRTESSDVKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGK  239

Query  5    V  3
            V
Sbjct  240  V  240



>ref|XP_004246325.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Solanum lycopersicum]
Length=285

 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 144/172 (84%), Gaps = 7/172 (4%)
 Frame = -2

Query  518  MAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWF  339
            MA  AAT SF+GTRLP+  +G GRV+A  GFG+KKAAP    KK          DRP W+
Sbjct  1    MATAAATSSFIGTRLPEIHSGSGRVQARFGFGQKKAAPKKAAKKQI-------PDRPLWY  53

Query  338  PGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDV  159
            PGAKAPE+LDGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKNLAGDIIGTR E +DV
Sbjct  54   PGAKAPEYLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLAGDIIGTRTEVADV  113

Query  158  KPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            K TPFQPYSEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTG+TWQDAGKV
Sbjct  114  KSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGITWQDAGKV  165



>ref|XP_009588563.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic 
[Nicotiana tomentosiformis]
Length=285

 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 139/172 (81%), Gaps = 7/172 (4%)
 Frame = -2

Query  518  MAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWF  339
            MA  AAT SF+GTRLP+  +G GRV+A  GFG                PK+   DRP WF
Sbjct  1    MATAAATSSFIGTRLPEIHSGAGRVQARFGFG-------TKKAAPKKAPKRQIPDRPLWF  53

Query  338  PGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDV  159
            PGAKAPE+LDGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKNLAGD+IGTR E+ DV
Sbjct  54   PGAKAPEYLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLAGDVIGTRTEAVDV  113

Query  158  KPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            K TPFQPYSEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTG+TWQDAGKV
Sbjct  114  KSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGITWQDAGKV  165



>ref|XP_004147887.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004165107.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Cucumis sativus]
 gb|KGN54365.1| Chlorophyll A/B binding protein [Cucumis sativus]
Length=284

 Score =   252 bits (643),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 143/172 (83%), Gaps = 6/172 (3%)
 Frame = -2

Query  518  MAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWF  339
            MA  AAT SFLGTRL +     GRV+A  GFG+KK+ P   P        +V SDRP WF
Sbjct  1    MATAAATSSFLGTRLAEIVPSSGRVQARFGFGKKKSPPKKSPSS------KVISDRPLWF  54

Query  338  PGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDV  159
            PGAKAPEWLDGSLVGD GFDPFGL KPAEYLQ++LDSLDQNLAKN+AGDIIGTR ES++V
Sbjct  55   PGAKAPEWLDGSLVGDYGFDPFGLGKPAEYLQYDLDSLDQNLAKNVAGDIIGTRFESAEV  114

Query  158  KPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            K TPFQPY+EVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  115  KSTPFQPYTEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  166



>gb|ABG73415.1| chloroplast pigment-binding protein CP29 [Nicotiana tabacum]
Length=285

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 142/172 (83%), Gaps = 8/172 (5%)
 Frame = -2

Query  518  MAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWF  339
            MA  AAT SF+GTRLP+  +G GRV+A  GFG+K A    P ++          DRP W+
Sbjct  1    MATAAATSSFIGTRLPEIHSGAGRVQARFGFGKKAAPKKAPKRQI--------PDRPLWY  52

Query  338  PGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDV  159
            PGAKAPE+LDGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKNLAGD+IGTR E +DV
Sbjct  53   PGAKAPEYLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLAGDVIGTRTELADV  112

Query  158  KPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            K TPFQPYSEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTG+TWQDAGKV
Sbjct  113  KSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGITWQDAGKV  164



>ref|XP_009804550.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Nicotiana sylvestris]
Length=284

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 142/172 (83%), Gaps = 8/172 (5%)
 Frame = -2

Query  518  MAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWF  339
            MA  AAT SF+GTRLP+  +G GRV+A  GFG+K A    P ++          DRP W+
Sbjct  1    MATAAATSSFIGTRLPEIHSGAGRVQARFGFGKKAAPKKAPKRQI--------PDRPLWY  52

Query  338  PGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDV  159
            PGAKAPE+LDGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKNLAGD+IGTR E +DV
Sbjct  53   PGAKAPEYLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLAGDVIGTRTELADV  112

Query  158  KPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            K TPFQPYSEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTG+TWQDAGKV
Sbjct  113  KSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGITWQDAGKV  164



>ref|XP_006366348.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Solanum tuberosum]
Length=285

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 144/172 (84%), Gaps = 7/172 (4%)
 Frame = -2

Query  518  MAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWF  339
            MA  AAT SF+GTRLP+  +G GRV+A  GFG+KKAAP    KK          DRP W+
Sbjct  1    MATAAATSSFIGTRLPEIHSGAGRVQARFGFGQKKAAPKKAAKKQI-------PDRPLWY  53

Query  338  PGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDV  159
            PGAK+PE+LDGSLVGD GFDPFGL KPAEYLQ++LDSLDQNLAKNLAGDIIGTR E +DV
Sbjct  54   PGAKSPEYLDGSLVGDYGFDPFGLGKPAEYLQYDLDSLDQNLAKNLAGDIIGTRTEVADV  113

Query  158  KPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            K TPFQPYSEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTG+TWQDAGKV
Sbjct  114  KSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGITWQDAGKV  165



>ref|XP_008449241.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Cucumis melo]
Length=284

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 141/172 (82%), Gaps = 6/172 (3%)
 Frame = -2

Query  518  MAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWF  339
            MA  AAT SF+GTRL +     GRV+A  GFG+KK+ P   P           SDRP WF
Sbjct  1    MATAAATSSFIGTRLAEIVPSSGRVQARFGFGKKKSPPKKSPSSKGI------SDRPLWF  54

Query  338  PGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDV  159
            PGAKAPEWLDGSLVGD GFDPFGL KPAEYLQ++LDSLDQNLAKN+AGDIIGTR ES++V
Sbjct  55   PGAKAPEWLDGSLVGDYGFDPFGLGKPAEYLQYDLDSLDQNLAKNVAGDIIGTRFESAEV  114

Query  158  KPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            K TPFQPY+EVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  115  KSTPFQPYTEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  166



>ref|XP_002528105.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF34284.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=285

 Score =   248 bits (633),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 134/163 (82%), Gaps = 8/163 (5%)
 Frame = -2

Query  491  FLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWL  312
            F+GTRLP   +  GRV+A  GFG          K +     + +SDRP W+PGAKAPEWL
Sbjct  13   FMGTRLPDVYSNSGRVQARFGFG--------TKKSAPKRSAKPTSDRPLWYPGAKAPEWL  64

Query  311  DGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYS  132
            DGSLVGD GFDPFGL KPAEYLQFELDSLDQNLAKN+AGDIIGTR E++DVK TPFQPYS
Sbjct  65   DGSLVGDYGFDPFGLGKPAEYLQFELDSLDQNLAKNIAGDIIGTRTEAADVKSTPFQPYS  124

Query  131  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            EVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  125  EVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  167



>ref|XP_011047451.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Populus euphratica]
 ref|XP_011014741.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=283

 Score =   247 bits (630),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 132/163 (81%), Gaps = 10/163 (6%)
 Frame = -2

Query  491  FLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWL  312
            F+GTRLP   +  GRV+A  GFG++                + + DRP W+PGAKAPE+L
Sbjct  13   FIGTRLPDVYSNAGRVQARFGFGKQAPNTSM----------KTTPDRPLWYPGAKAPEYL  62

Query  311  DGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYS  132
            DGSLVGD GFDPFGL +PAEYLQFELDSLDQNLAKNLAGDIIGTR E SDVK TPFQPYS
Sbjct  63   DGSLVGDYGFDPFGLGRPAEYLQFELDSLDQNLAKNLAGDIIGTRTEVSDVKSTPFQPYS  122

Query  131  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            EVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  123  EVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  165



>gb|ABK96503.1| unknown [Populus trichocarpa x Populus deltoides]
Length=283

 Score =   246 bits (629),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 132/164 (80%), Gaps = 10/164 (6%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SF+GTRLP   +  GR++A  GFG+K                +   DRP W+PGAKAPE+
Sbjct  12   SFIGTRLPDVYSNAGRIQARFGFGKKAPKKSI----------KTIPDRPLWYPGAKAPEY  61

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL +PAEYLQFELDSLDQNLAKNLAGDIIGTR E SDVK TPFQPY
Sbjct  62   LDGSLVGDYGFDPFGLGRPAEYLQFELDSLDQNLAKNLAGDIIGTRTEVSDVKSTPFQPY  121

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  122  SEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  165



>ref|XP_003604653.1| Chlorophyll a-b binding protein [Medicago truncatula]
Length=347

 Score =   248 bits (634),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 153/192 (80%), Gaps = 7/192 (4%)
 Frame = -2

Query  578  SSFTSQFP*FHLSYPHKHIAMAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaappp  399
            S F S  P  H+S      A A  AAT SF+GTRL + Q+  GR++A  GFG+KKAAP  
Sbjct  44   SIFYSHHP-AHISTNQMAAATATAAATSSFIGTRLREVQSNSGRIQARFGFGKKKAAPKK  102

Query  398  ppkksapppKQVSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQ  219
            P + S       S+DRP WFPGAK+PEWLDGSLVGD GFDPFGL KPAEYLQF+LDSLDQ
Sbjct  103  PSRSSP------STDRPLWFPGAKSPEWLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQ  156

Query  218  NLAKNLAGDIIGTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEW  39
            NLAKNLAGD+IGTR E +DVK TPFQPYSEVFG+QRFRECELIHGRWAMLATLGAL+VEW
Sbjct  157  NLAKNLAGDVIGTRTEFADVKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGALTVEW  216

Query  38   LTGVTWQDAGKV  3
            LTGVTWQDAGKV
Sbjct  217  LTGVTWQDAGKV  228



>ref|XP_011014743.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=283

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 132/163 (81%), Gaps = 10/163 (6%)
 Frame = -2

Query  491  FLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWL  312
            F+GTRLP   +  GR++A  GFG+K                + + DRP W+PGAKAPE+L
Sbjct  13   FIGTRLPDVYSNAGRIQARFGFGKKAPKKSM----------KTTPDRPLWYPGAKAPEYL  62

Query  311  DGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYS  132
            DGSLVGD GFDPFGL +PAEYLQFELDSLDQNLAKNLAGDIIGTR E SDVK TPFQPYS
Sbjct  63   DGSLVGDYGFDPFGLGRPAEYLQFELDSLDQNLAKNLAGDIIGTRTEVSDVKSTPFQPYS  122

Query  131  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            EVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  123  EVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  165



>gb|EPS68718.1| hypothetical protein M569_06048, partial [Genlisea aurea]
Length=283

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 137/171 (80%), Gaps = 8/171 (5%)
 Frame = -2

Query  515  AATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFP  336
            A  AA  SFLGTRLP+  +G GR+ A  GFG KKA      K           DRP W+P
Sbjct  1    ATAAAASSFLGTRLPEVHSGSGRIHARFGFGTKKAPKKAAKKSI--------PDRPLWYP  52

Query  335  GAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVK  156
            GAKAPE+LDG+LVGD GFDPFGL KPAEYLQ+E+DSLDQNLAKNLAGD+IGTR ES+ VK
Sbjct  53   GAKAPEYLDGTLVGDYGFDPFGLGKPAEYLQYEIDSLDQNLAKNLAGDVIGTRTESAAVK  112

Query  155  PTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
             TPFQPYSEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  113  STPFQPYSEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  163



>ref|XP_002323575.1| chlorophyll a/b binding protein CP29 [Populus trichocarpa]
 gb|EEF05336.1| chlorophyll a/b binding protein CP29 [Populus trichocarpa]
Length=283

 Score =   246 bits (628),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 132/164 (80%), Gaps = 10/164 (6%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SF+GTR+P   +  GR++A  GFG+K                +   DRP W+PGAKAPE+
Sbjct  12   SFIGTRVPDVYSNAGRIQARFGFGKKAPKKSI----------KTIPDRPLWYPGAKAPEY  61

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL +PAEYLQFELDSLDQNLAKNLAGDIIGTR E SDVK TPFQPY
Sbjct  62   LDGSLVGDYGFDPFGLGRPAEYLQFELDSLDQNLAKNLAGDIIGTRTEVSDVKSTPFQPY  121

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  122  SEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  165



>gb|ACJ84724.1| unknown [Medicago truncatula]
 gb|AFK38567.1| unknown [Medicago truncatula]
 gb|AES86850.2| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=289

 Score =   246 bits (627),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 141/164 (86%), Gaps = 6/164 (4%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SF+GTRL + Q+  GR++A  GFG+KKAAP  P + S       S+DRP WFPGAK+PEW
Sbjct  13   SFIGTRLREVQSNSGRIQARFGFGKKKAAPKKPSRSSP------STDRPLWFPGAKSPEW  66

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKNLAGD+IGTR E +DVK TPFQPY
Sbjct  67   LDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLAGDVIGTRTEFADVKSTPFQPY  126

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  127  SEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  170



>ref|XP_011019131.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic 
[Populus euphratica]
Length=284

 Score =   244 bits (624),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 134/164 (82%), Gaps = 9/164 (5%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SF+GTRLP   +  GR++A  GFG          KK+     + + DRP W+PGAKAPE+
Sbjct  12   SFMGTRLPDIYSNSGRIQARFGFG---------GKKAPKKSIKPTPDRPLWYPGAKAPEY  62

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQFELDSLDQNLAKNLAGDIIGTR E +DVK TPFQPY
Sbjct  63   LDGSLVGDYGFDPFGLGKPAEYLQFELDSLDQNLAKNLAGDIIGTRTEFADVKSTPFQPY  122

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  123  SEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  166



>ref|XP_007026729.1| Light-harvesting complex II protein Lhcb4 [Theobroma cacao]
 gb|EOY07231.1| Light-harvesting complex II protein Lhcb4 [Theobroma cacao]
Length=284

 Score =   244 bits (623),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 133/164 (81%), Gaps = 9/164 (5%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SF+GTRLP      GRV A  G GRKKAA             + +SDRP W+PGA APEW
Sbjct  12   SFMGTRLPDVYTSSGRVVARFGLGRKKAARKVS---------KPTSDRPLWYPGAVAPEW  62

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQ+ELDSLDQNLAKN+AG+IIGTR E SDVK TPFQPY
Sbjct  63   LDGSLVGDYGFDPFGLGKPAEYLQYELDSLDQNLAKNVAGEIIGTRTEVSDVKATPFQPY  122

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  123  SEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  166



>ref|XP_002309134.1| chlorophyll a/b binding protein CP29 [Populus trichocarpa]
 gb|ABK96345.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE92657.1| chlorophyll a/b binding protein CP29 [Populus trichocarpa]
Length=285

 Score =   244 bits (622),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 132/164 (80%), Gaps = 8/164 (5%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SF+GTRLP   +  GR++A  GFG          K      K  + DRP W+PGAKAPE+
Sbjct  12   SFMGTRLPDIYSNSGRIQARFGFG--------GKKAPKKSIKPSTPDRPLWYPGAKAPEY  63

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQFELDSLDQNLAKNLAGDIIGTR E +DVK TPFQPY
Sbjct  64   LDGSLVGDYGFDPFGLGKPAEYLQFELDSLDQNLAKNLAGDIIGTRTEFADVKSTPFQPY  123

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  124  SEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  167



>gb|AAD27878.1|AF139466_1 chlorophyll a/b binding protein CP29 [Vigna radiata]
Length=290

 Score =   244 bits (622),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 134/164 (82%), Gaps = 6/164 (4%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SF+GTRL    +G GR++A  GFG KK A P    K        S+DRP W+PGAKAPEW
Sbjct  13   SFMGTRLLDAHSGSGRIQARFGFGSKKKAAPKKVSKGP------STDRPLWYPGAKAPEW  66

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQFELDSLDQNLAKN AG IIGTR E +DVK TPFQPY
Sbjct  67   LDGSLVGDYGFDPFGLGKPAEYLQFELDSLDQNLAKNEAGIIIGTRTEVADVKSTPFQPY  126

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  127  SEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  170



>ref|XP_003520609.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Glycine max]
Length=290

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 136/164 (83%), Gaps = 4/164 (2%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SF+GTRL +  +G GRV A  GFG+KKA       + +       +DRP W+PGAKAPE+
Sbjct  11   SFMGTRLLEAHSGAGRVHARFGFGKKKAPAQKKASRGSGR----DTDRPLWYPGAKAPEY  66

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQFELDSLDQNLAKN+AGDIIGTR E +DVK TPFQPY
Sbjct  67   LDGSLVGDYGFDPFGLGKPAEYLQFELDSLDQNLAKNVAGDIIGTRTELADVKSTPFQPY  126

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  127  SEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  170



>emb|CDP06495.1| unnamed protein product [Coffea canephora]
Length=286

 Score =   242 bits (618),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 135/164 (82%), Gaps = 9/164 (5%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SFLGTRLP+  +  GRV+A  GFG KKA      +         +SDRP WFPGA AP++
Sbjct  12   SFLGTRLPEVHSSSGRVQARFGFGPKKAPKKIAKR---------TSDRPLWFPGATAPDY  62

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQFELDSLDQNLAKN+AGDIIGTR E +DVK TPFQPY
Sbjct  63   LDGSLVGDYGFDPFGLGKPAEYLQFELDSLDQNLAKNVAGDIIGTRTEVADVKSTPFQPY  122

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            +EVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  123  NEVFGLQRFRECELIHGRWAMLATLGALAVEWLTGVTWQDAGKV  166



>ref|XP_009388349.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=290

 Score =   242 bits (617),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 139/175 (79%), Gaps = 10/175 (6%)
 Frame = -2

Query  518  MAATAATPS-FLGTRLPKTQNGM--GRVRALLGFGRkkaapppppkksapppKQVSSDRP  348
            MA+TAA  S FLGTRLP+    M  GR +A  GFG KK       K         +SDRP
Sbjct  1    MASTAAATSPFLGTRLPERSVAMAAGRFQARFGFGTKKRPQSKKTKAP-------TSDRP  53

Query  347  TWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIES  168
             WFPGAKAPEWLDGSLVGD GFDP GL KPAEYLQ+ELDSLDQNLAKN AG++IGTR E+
Sbjct  54   LWFPGAKAPEWLDGSLVGDYGFDPLGLGKPAEYLQYELDSLDQNLAKNSAGELIGTRTEN  113

Query  167  SDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            +DVK TPFQPY+EVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  114  ADVKSTPFQPYAEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  168



>ref|XP_004506774.1| PREDICTED: LOW QUALITY PROTEIN: chlorophyll a-b binding protein 
CP29.1, chloroplastic-like [Cicer arietinum]
Length=343

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 135/164 (82%), Gaps = 6/164 (4%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SF+GTRL   +   GRV+A  GFG+KK AP    +         ++DRP WFPGAK+P+W
Sbjct  67   SFIGTRLRAVETVSGRVQARFGFGKKKTAPKKTSRPGP------TTDRPLWFPGAKSPDW  120

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKNLAGD+IGTR E  DVK TPFQPY
Sbjct  121  LDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLAGDVIGTRTEFDDVKSTPFQPY  180

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  181  SEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  224



>gb|ACO51068.1| chloroplast chlorophyll A-B binding protein [Gossypium hirsutum]
Length=285

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 138/173 (80%), Gaps = 8/173 (5%)
 Frame = -2

Query  521  AMAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTW  342
            A+   AAT SF+GTR P      GR  A  GFG KKAAP    K+        +SDRP W
Sbjct  3    AVTNAAATSSFMGTRFPDVYTSSGRFVARFGFGGKKAAPKKASKQ--------TSDRPLW  54

Query  341  FPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSD  162
            +PGA AP+WLDGSLVGD GFDPFGL KPAEYLQ++LDSLDQNLAKN+AG+IIGTR E +D
Sbjct  55   YPGAVAPDWLDGSLVGDYGFDPFGLGKPAEYLQYDLDSLDQNLAKNMAGEIIGTRTEVAD  114

Query  161  VKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            VK TPFQPYSEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  115  VKATPFQPYSEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  167



>gb|ACU19827.1| unknown [Glycine max]
Length=290

 Score =   239 bits (611),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 135/164 (82%), Gaps = 4/164 (2%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SF+GTRL +  +G GRV A  GFG+KKA       + +       + RP W+PGAKAPE+
Sbjct  11   SFMGTRLLEAHSGAGRVHARFGFGKKKAPAQKKASRGSGR----DTVRPLWYPGAKAPEY  66

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQFELDSLDQNLAKN+AGDIIGTR E +DVK TPFQPY
Sbjct  67   LDGSLVGDYGFDPFGLGKPAEYLQFELDSLDQNLAKNVAGDIIGTRTELADVKSTPFQPY  126

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  127  SEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  170



>ref|XP_006289419.1| hypothetical protein CARUB_v10002918mg [Capsella rubella]
 gb|EOA22317.1| hypothetical protein CARUB_v10002918mg [Capsella rubella]
Length=286

 Score =   239 bits (610),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 142/174 (82%), Gaps = 8/174 (5%)
 Frame = -2

Query  518  MAATA-ATPSFLGTRL-PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPT  345
            MAAT+ A  S +GTR+ P   +  GR  A   FG+KKAAP     K+      V++DRP 
Sbjct  1    MAATSTAASSIMGTRVAPGIHSSSGRFTARFSFGKKKAAPKKSAPKT------VTTDRPL  54

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            W+PGAK+PEWLDGSLVGD GFDPFGL KPAEYLQF++DSLDQNLAKNLAGD+IGTR E++
Sbjct  55   WYPGAKSPEWLDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEAA  114

Query  164  DVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            D K TPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  115  DAKSTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  168



>gb|AEO51756.1| chloroplast chlorophyll A/B binding protein [Dimocarpus longan]
Length=286

 Score =   239 bits (610),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 134/165 (81%), Gaps = 9/165 (5%)
 Frame = -2

Query  494  SFLGTRLP-KTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPE  318
            SFLGTRLP    +  GRV+A  GF           K +     + S+DRP W+PGAKAPE
Sbjct  12   SFLGTRLPADVYSKSGRVQARFGF--------RTKKAAPKKFSKPSADRPLWYPGAKAPE  63

Query  317  WLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQP  138
            +LDGSLVGD GFDPFGL KP EYLQ++LDSLDQNLAKN+AGDIIGTR+ESS+VK TPFQP
Sbjct  64   YLDGSLVGDYGFDPFGLGKPVEYLQYDLDSLDQNLAKNMAGDIIGTRVESSEVKSTPFQP  123

Query  137  YSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            Y+EVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  124  YTEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  168



>ref|XP_010262833.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Nelumbo nucifera]
Length=288

 Score =   239 bits (610),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 128/163 (79%), Gaps = 6/163 (4%)
 Frame = -2

Query  491  FLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWL  312
            FLG+RL    +  G+ +A  GFG                  + SSDRP W+PGAKAPEWL
Sbjct  12   FLGSRLHDGHSNTGKFQARFGFG------TKKSPPPKKTVSKPSSDRPLWYPGAKAPEWL  65

Query  311  DGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYS  132
            DGSLVGD GFDPFGL KPAEYLQFELDSLDQNLAKNLAGD+IGTR ESSDVK TPFQPY 
Sbjct  66   DGSLVGDYGFDPFGLGKPAEYLQFELDSLDQNLAKNLAGDVIGTRTESSDVKSTPFQPYR  125

Query  131  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            EVFG+QRFRECELIHGRWAMLATLGAL+VE LTGVTWQDAGKV
Sbjct  126  EVFGLQRFRECELIHGRWAMLATLGALAVEALTGVTWQDAGKV  168



>ref|XP_010037701.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW49456.1| hypothetical protein EUGRSUZ_K02983 [Eucalyptus grandis]
Length=284

 Score =   239 bits (609),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 138/164 (84%), Gaps = 9/164 (5%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SF+GTRLP+  +  GRV+A  GFG KKAAP    K+        +SDRP W+PGA APEW
Sbjct  12   SFIGTRLPEVPSS-GRVQARFGFGAKKAAPKKAAKR--------TSDRPLWYPGATAPEW  62

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKN AGDIIGTR E+SDVK TPFQPY
Sbjct  63   LDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNEAGDIIGTRFENSDVKSTPFQPY  122

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            +EVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  123  TEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  166



>gb|KDP24461.1| hypothetical protein JCGZ_25025 [Jatropha curcas]
Length=285

 Score =   239 bits (609),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 131/163 (80%), Gaps = 8/163 (5%)
 Frame = -2

Query  491  FLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWL  312
            F+GTRL       GR++A  GFG          K +     + SSDRP W+PGAKAPEWL
Sbjct  13   FMGTRLYDIYTNSGRIQARFGFG--------TKKSAPKKSSKPSSDRPLWYPGAKAPEWL  64

Query  311  DGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYS  132
            DGSLVGD GFDPFGL KPAEYLQFELDSLDQNLAKNLAGD+IGTR E +DVK TPFQPYS
Sbjct  65   DGSLVGDYGFDPFGLGKPAEYLQFELDSLDQNLAKNLAGDVIGTRTELADVKSTPFQPYS  124

Query  131  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            EVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  125  EVFGLQRFRECELIHGRWAMLATLGALAVEWLTGVTWQDAGKV  167



>ref|XP_007133907.1| hypothetical protein PHAVU_010G002100g [Phaseolus vulgaris]
 gb|ESW05901.1| hypothetical protein PHAVU_010G002100g [Phaseolus vulgaris]
Length=289

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 135/164 (82%), Gaps = 6/164 (4%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SF+GTRL +  +G GRV+A  GFG KK A P    K +       ++RP W+PGAK+PEW
Sbjct  13   SFMGTRLLEAHSGSGRVQARFGFGPKKKAAPKKVSKGS------GTERPLWYPGAKSPEW  66

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSL+GD GFDPFGL KPAEYLQFELDSLDQNLAKN AG IIGTR E +DVK TPFQPY
Sbjct  67   LDGSLIGDYGFDPFGLGKPAEYLQFELDSLDQNLAKNEAGLIIGTRTEVADVKSTPFQPY  126

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  127  SEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  170



>ref|XP_003516950.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Glycine max]
Length=290

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 140/164 (85%), Gaps = 4/164 (2%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SF+GTRL +  +G GRV+A  GFG+KKAA P    + +      SSDRP W+PGAKAPE+
Sbjct  11   SFMGTRLLEAHSGAGRVQARFGFGKKKAAAPKKVSRGS----GSSSDRPLWYPGAKAPEY  66

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQFELDSLDQNLAKN+AGDIIGTR E +DVK TPFQPY
Sbjct  67   LDGSLVGDYGFDPFGLGKPAEYLQFELDSLDQNLAKNVAGDIIGTRTELADVKSTPFQPY  126

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  127  SEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  170



>gb|EYU26660.1| hypothetical protein MIMGU_mgv1a011247mg [Erythranthe guttata]
Length=288

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 133/163 (82%), Gaps = 9/163 (6%)
 Frame = -2

Query  491  FLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWL  312
            F+GTRLP+  NG  RV+A  GFG          K +    K+V  DRP WFPGAK+PE+L
Sbjct  15   FMGTRLPEV-NGSSRVQARFGFG--------TKKAAPKKAKKVIPDRPLWFPGAKSPEYL  65

Query  311  DGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYS  132
            DG+LVGD GFDPFGL KPAEYLQF+LDSLDQNLAKNLAGDIIGTR E SDVK TPFQPYS
Sbjct  66   DGTLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLAGDIIGTRTELSDVKSTPFQPYS  125

Query  131  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            EVFG+QRFRECELIHGRWAMLA LG+L+VEWLTGVTWQDAGKV
Sbjct  126  EVFGLQRFRECELIHGRWAMLAVLGSLTVEWLTGVTWQDAGKV  168



>gb|KHG23195.1| Uncharacterized protein F383_29279 [Gossypium arboreum]
Length=285

 Score =   237 bits (604),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 137/173 (79%), Gaps = 8/173 (5%)
 Frame = -2

Query  521  AMAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTW  342
            A+   AAT SF+GTR P      GR  A  G G KKAAP    K+        +S+RP W
Sbjct  3    AVTNAAATSSFMGTRFPDVYTSSGRFVARFGLGGKKAAPKKASKQ--------TSNRPLW  54

Query  341  FPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSD  162
            +PGA AP+WLDGSLVGD GFDPFGL KPAEYLQ++LDSLDQNLAKN+AG+IIGTR E +D
Sbjct  55   YPGAVAPDWLDGSLVGDYGFDPFGLGKPAEYLQYDLDSLDQNLAKNMAGEIIGTRTEGAD  114

Query  161  VKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            VK TPFQPYSEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  115  VKATPFQPYSEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  167



>ref|XP_009412442.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=288

 Score =   237 bits (604),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 134/176 (76%), Gaps = 9/176 (5%)
 Frame = -2

Query  524  IAMAATAATPSFLGTRLPKTQ--NGMGRVRALLGFGRkkaapppppkksapppKQVSSDR  351
            +A +  AAT  FLGTRLP+      +GR +A  GFG KK+ P              +SDR
Sbjct  1    MASSTAAATSPFLGTRLPEHSLAKAVGRFQAQFGFGSKKSRPKKAKAPP-------TSDR  53

Query  350  PTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIE  171
            P WFPGAK PEWLDGSLVGD GFDPFGL +P EYLQF+ DSLDQNLAKN +GD+IGTR E
Sbjct  54   PLWFPGAKTPEWLDGSLVGDYGFDPFGLGRPVEYLQFDFDSLDQNLAKNPSGDVIGTRTE  113

Query  170  SSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
              DVK TPFQPYSEVFG+QRFRECELIHGRWAMLATLGAL VEWLTGVTWQDAGKV
Sbjct  114  RVDVKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGALVVEWLTGVTWQDAGKV  169



>ref|XP_009416063.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=287

 Score =   236 bits (603),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 138/176 (78%), Gaps = 12/176 (7%)
 Frame = -2

Query  518  MAATAATPS-FLGTRLPK---TQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDR  351
            MA+TAA  S FLG RL +       +GR +A  GFG+KK+                +SDR
Sbjct  1    MASTAAATSPFLGIRLRQHGVVARAVGRFQAQFGFGKKKSLRKKVKAP--------TSDR  52

Query  350  PTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIE  171
            P W+PGAKAPEWLDGSLVGD GFDPFGL KPAEYLQ++LDSLDQNLAKN AGD+IGTR E
Sbjct  53   PLWYPGAKAPEWLDGSLVGDYGFDPFGLGKPAEYLQYDLDSLDQNLAKNPAGDVIGTRTE  112

Query  170  SSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            S+DVK TPFQPYSEVFG+QRFRECELIHGRWAMLA LGALSVEWLTGVTWQDAGKV
Sbjct  113  SADVKSTPFQPYSEVFGLQRFRECELIHGRWAMLAILGALSVEWLTGVTWQDAGKV  168



>ref|XP_010109617.1| hypothetical protein L484_015572 [Morus notabilis]
 gb|EXC23662.1| hypothetical protein L484_015572 [Morus notabilis]
Length=287

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 132/165 (80%), Gaps = 9/165 (5%)
 Frame = -2

Query  494  SFLGTRLPK-TQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPE  318
            SF+GTRL +   +  GRV+A  GFG+KK+              + S DRP W+PGA APE
Sbjct  12   SFIGTRLHEACYSNAGRVQARFGFGKKKSPAKKSV--------KRSPDRPLWYPGATAPE  63

Query  317  WLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQP  138
            WLDGSLVGD GFDPFGL KPAEYLQFELDSLDQNLAKN AG IIGTR E SDVK TPFQP
Sbjct  64   WLDGSLVGDYGFDPFGLGKPAEYLQFELDSLDQNLAKNEAGIIIGTRTEFSDVKSTPFQP  123

Query  137  YSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            YSEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  124  YSEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  168



>ref|XP_009125404.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Brassica rapa]
Length=288

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 135/165 (82%), Gaps = 8/165 (5%)
 Frame = -2

Query  494  SFLGTRL-PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPE  318
            S +GTR+ P   +G GR+ A  GFG+KKAAP             V++DRP W+PGAK+PE
Sbjct  12   SIMGTRVVPDINSGSGRITARFGFGKKKAAPKKTKTV-------VTTDRPLWYPGAKSPE  64

Query  317  WLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQP  138
            WLDGSLVGD GFDPFGL KPAEYLQF++DSLDQNLAKNLAGD+IGTR E +  K TPFQP
Sbjct  65   WLDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEEAAPKSTPFQP  124

Query  137  YSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            YSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  125  YSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  169



>ref|XP_008243837.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic 
[Prunus mume]
Length=286

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 129/164 (79%), Gaps = 8/164 (5%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SF+GTR P   +  GRV+A  GFG          K         SSDRP W+PGAKAPEW
Sbjct  12   SFIGTRFPDVYSNSGRVQARFGFG--------TKKPKKAAKSTFSSDRPLWYPGAKAPEW  63

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQ++ D LDQNLAKNLAGD+IGTR E++DV+ TPFQPY
Sbjct  64   LDGSLVGDYGFDPFGLGKPAEYLQYDYDGLDQNLAKNLAGDVIGTRTETADVQSTPFQPY  123

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            +EVFG+QRFRECELIHGRWAMLATLGAL+VE +TG+TWQDAGKV
Sbjct  124  NEVFGLQRFRECELIHGRWAMLATLGALTVESVTGITWQDAGKV  167



>ref|XP_006429357.1| hypothetical protein CICLE_v10012370mg [Citrus clementina]
 ref|XP_006481019.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR42597.1| hypothetical protein CICLE_v10012370mg [Citrus clementina]
Length=288

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 135/163 (83%), Gaps = 6/163 (4%)
 Frame = -2

Query  491  FLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWL  312
            F+GTRLP   +  GR++A  GFG++K AP    +         SSDRP W+PGAKAPEWL
Sbjct  14   FIGTRLPDIYSNSGRIQARFGFGKRKTAPKKSKQS------SGSSDRPLWYPGAKAPEWL  67

Query  311  DGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYS  132
            DGSLVGD GFDPFGL KPAEYLQ++ DSLDQNLAKN AGDIIGTRIE+SD++ TP QPY+
Sbjct  68   DGSLVGDYGFDPFGLGKPAEYLQYDYDSLDQNLAKNPAGDIIGTRIEASDMQSTPLQPYT  127

Query  131  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            EVFG+QRFRECELIHGRWAMLATLGAL+VEWLTG+TWQDAGKV
Sbjct  128  EVFGLQRFRECELIHGRWAMLATLGALTVEWLTGITWQDAGKV  170



>ref|XP_006429356.1| hypothetical protein CICLE_v10012370mg [Citrus clementina]
 gb|ESR42596.1| hypothetical protein CICLE_v10012370mg [Citrus clementina]
Length=288

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 135/163 (83%), Gaps = 6/163 (4%)
 Frame = -2

Query  491  FLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWL  312
            F+GTRLP   +  GR++A  GFG++K AP    +         SSDRP W+PGAKAPEWL
Sbjct  14   FIGTRLPDIYSNSGRIQARFGFGKRKTAPKKSKQS------SGSSDRPLWYPGAKAPEWL  67

Query  311  DGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYS  132
            DGSLVGD GFDPFGL KPAEYLQ++ DSLDQNLAKN AGDIIGTRIE+SD++ TP QPY+
Sbjct  68   DGSLVGDYGFDPFGLGKPAEYLQYDYDSLDQNLAKNPAGDIIGTRIEASDMQSTPLQPYT  127

Query  131  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            EVFG+QRFRECELIHGRWAMLATLGAL+VEWLTG+TWQDAGKV
Sbjct  128  EVFGLQRFRECELIHGRWAMLATLGALTVEWLTGITWQDAGKV  170



>ref|XP_010558381.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Tarenaya hassleriana]
Length=286

 Score =   235 bits (599),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 128/164 (78%), Gaps = 7/164 (4%)
 Frame = -2

Query  491  FLGTRL-PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            F+GTR+ P  Q+G  R  A  GFG                 K + +DRP W+PGAKAPEW
Sbjct  11   FMGTRVVPDFQSGSSRFTARFGFG------TKKSAAPKKKSKPIGTDRPLWYPGAKAPEW  64

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQF+ D LDQNLAKNLAGD+IGTR E +DVK TPFQPY
Sbjct  65   LDGSLVGDYGFDPFGLGKPAEYLQFDYDGLDQNLAKNLAGDVIGTRTEDADVKSTPFQPY  124

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  125  SEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  168



>ref|XP_002279834.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Vitis vinifera]
 emb|CAN77492.1| hypothetical protein VITISV_010727 [Vitis vinifera]
Length=288

 Score =   235 bits (599),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 132/164 (80%), Gaps = 8/164 (5%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SF+GTRLP   +  GRV+A  GFGRKKA      K+         SDRP WFPGA APEW
Sbjct  14   SFMGTRLPDVHSNTGRVQARFGFGRKKAPAKKAAKRV--------SDRPLWFPGAVAPEW  65

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDG+LVGD GFDPFGL KPAEYLQ++ DSLDQNLAKN+AGD+IGTR E  +VK TPFQPY
Sbjct  66   LDGTLVGDYGFDPFGLGKPAEYLQYDYDSLDQNLAKNIAGDVIGTRFEGGEVKSTPFQPY  125

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            +EVFG+QRFRECELIHGRWAMLATLGAL+VE LTGVTWQDAGKV
Sbjct  126  TEVFGLQRFRECELIHGRWAMLATLGALAVESLTGVTWQDAGKV  169



>ref|XP_010670717.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=285

 Score =   234 bits (598),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 131/163 (80%), Gaps = 6/163 (4%)
 Frame = -2

Query  491  FLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWL  312
            F+GTRLP   +  GR+    GFG KK A    P+  +      S+DRP W+PGAKAPEWL
Sbjct  13   FIGTRLPDVPSNSGRITCRFGFGAKKVAKKAQPRSGS------STDRPLWYPGAKAPEWL  66

Query  311  DGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYS  132
            DGSLVGD GFDPFGL KPAEYLQ++ D LDQNLAKNLAGDIIGTR ES+DVK T  QPYS
Sbjct  67   DGSLVGDYGFDPFGLGKPAEYLQYDYDGLDQNLAKNLAGDIIGTRTESADVKATSLQPYS  126

Query  131  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            EVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  127  EVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  169



>gb|ACN25605.1| unknown [Zea mays]
 tpg|DAA63107.1| TPA: hypothetical protein ZEAMMB73_194761 [Zea mays]
Length=173

 Score =   231 bits (588),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 128/166 (77%), Gaps = 7/166 (4%)
 Frame = -2

Query  494  SFLGTRL--PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAP  321
            +FLGTRL  P  QNG  R+ A  GFG         P          SSDRP WFPGA AP
Sbjct  11   TFLGTRLADPAPQNG--RIVARFGFG---LGGKAKPAPKKVAKTSTSSDRPLWFPGAVAP  65

Query  320  EWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQ  141
            ++LDGSLVGD GFDPFGL KP EYLQFELDSLDQNLAKN AG IIGTR ESS+VK TP Q
Sbjct  66   DYLDGSLVGDYGFDPFGLGKPVEYLQFELDSLDQNLAKNEAGGIIGTRFESSEVKSTPLQ  125

Query  140  PYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            PYSEVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  126  PYSEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  171



>emb|CDY04834.1| BnaAnng00160D [Brassica napus]
Length=287

 Score =   234 bits (598),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 134/164 (82%), Gaps = 8/164 (5%)
 Frame = -2

Query  491  FLGTRL-PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
             +GTR+ P   +G GR+ A  GFG+KKAAP             V++DRP W+PGAK+PEW
Sbjct  12   IMGTRVVPDINSGSGRITARFGFGKKKAAPKKTKTV-------VTTDRPLWYPGAKSPEW  64

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQF++DSLDQNLAKNLAGD+IGTR E +  K TPFQPY
Sbjct  65   LDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEEAAPKSTPFQPY  124

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  125  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  168



>gb|AAM12979.1| chlorophyll a/b-binding protein CP29 [Arabidopsis thaliana]
Length=290

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 137/164 (84%), Gaps = 7/164 (4%)
 Frame = -2

Query  491  FLGTRL-PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
             +GTR+ P    G GR  A+ GFG+KKAAP    KK+      V++DRP W+PGA +P+W
Sbjct  14   IMGTRVAPGIHPGSGRFTAVFGFGKKKAAPKKSAKKT------VTTDRPVWYPGAISPDW  67

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQF++DSLDQNLAKNLAGD+IGTR E++D K TPFQPY
Sbjct  68   LDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEAADAKSTPFQPY  127

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  128  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  171



>gb|AAK82524.1| AT5g01530/F7A7_50 [Arabidopsis thaliana]
Length=290

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 138/164 (84%), Gaps = 7/164 (4%)
 Frame = -2

Query  491  FLGTRL-PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
             +GTR+ P    G GR  A++GFG+KKAAP    KK+      V++DRP W+PGA +P+W
Sbjct  14   IMGTRVAPGIHPGSGRFTAVVGFGKKKAAPKKSAKKT------VTTDRPLWYPGAISPDW  67

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQF++DSLDQNLAKNLAGD+IGTR E++D K TPFQPY
Sbjct  68   LDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEAADAKSTPFQPY  127

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  128  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  171



>ref|XP_010253858.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic 
[Nelumbo nucifera]
Length=291

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 129/166 (78%), Gaps = 7/166 (4%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLG--FGRkkaapppppkksapppKQVSSDRPTWFPGAKAP  321
            SFLGTRL       G+ +A  G  FG         P      P + +SDRP WFPGAKAP
Sbjct  11   SFLGTRLHDVHTNSGKFQARFGLPFG-----TKKSPPPKKTAPSKPTSDRPLWFPGAKAP  65

Query  320  EWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQ  141
            EWLDGS+VGD GFDPFGL KP EYLQF+LDSLDQNLAKNLAGDIIGTR ESSDVK TPFQ
Sbjct  66   EWLDGSMVGDFGFDPFGLGKPVEYLQFDLDSLDQNLAKNLAGDIIGTRTESSDVKSTPFQ  125

Query  140  PYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            PYSEVFG+QRFRECELIHGRWAML TLGA++VE LTGVTWQDAGKV
Sbjct  126  PYSEVFGLQRFRECELIHGRWAMLGTLGAIAVEALTGVTWQDAGKV  171



>gb|KFK24655.1| hypothetical protein AALP_AA8G007900 [Arabis alpina]
Length=287

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 133/165 (81%), Gaps = 10/165 (6%)
 Frame = -2

Query  491  FLGTRL--PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPE  318
             +GTR+  P   +G GR  A   FG+KKAAP             V++DRP WFPGA++PE
Sbjct  13   IMGTRVVAPGINSGSGRFTARFSFGKKKAAPKKKS--------PVTTDRPLWFPGAQSPE  64

Query  317  WLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQP  138
            WLDGSLVGD GFDPFGL KPAEYLQF++DSLDQNLAKNLAGD+IGTR E +D K TPFQP
Sbjct  65   WLDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEEADAKSTPFQP  124

Query  137  YSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            YSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  125  YSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  169



>ref|NP_001136606.1| uncharacterized protein LOC100216729 [Zea mays]
 gb|ACF82254.1| unknown [Zea mays]
Length=291

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 129/166 (78%), Gaps = 7/166 (4%)
 Frame = -2

Query  494  SFLGTRL--PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAP  321
            +FLGTRL  P  QNG  R+ A  GFG      P            +SSDRP WFPGA AP
Sbjct  11   TFLGTRLADPAPQNG--RIVARFGFG---GGKPKAAVPKKVAKTSISSDRPLWFPGAVAP  65

Query  320  EWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQ  141
            ++LDGSLVGD GFDPFGL KP EYLQFELDSLDQNLAKN AG IIGTR ESSDVK TP Q
Sbjct  66   DYLDGSLVGDYGFDPFGLGKPVEYLQFELDSLDQNLAKNEAGGIIGTRFESSDVKSTPLQ  125

Query  140  PYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            PYSEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  126  PYSEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  171



>dbj|BAJ33665.1| unnamed protein product [Thellungiella halophila]
Length=288

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 131/163 (80%), Gaps = 9/163 (6%)
 Frame = -2

Query  488  LGTRL-PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWL  312
            +GTR+ P   +G GR  A  GFG+K      P         +V+SDRP WFPGAK+P+WL
Sbjct  14   MGTRVAPGIHSGSGRFTARFGFGKKAPKKTAPK--------KVTSDRPLWFPGAKSPDWL  65

Query  311  DGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYS  132
            DGSLVGD GFDPFGL KPAEYLQF++DSLDQNLAKNLAGD+IGTR E +  K TPFQPYS
Sbjct  66   DGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEEAAPKSTPFQPYS  125

Query  131  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  126  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  168



>gb|AAK43851.1|AF370474_1 chlorophyll a/b-binding protein CP29 [Arabidopsis thaliana]
 gb|AAN15682.1| chlorophyll a/b-binding protein CP29 [Arabidopsis thaliana]
Length=290

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 137/164 (84%), Gaps = 7/164 (4%)
 Frame = -2

Query  491  FLGTRL-PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
             +GTR+ P    G GR  A+ GFG+KKAAP    KK+      V++DRP W+PGA +P+W
Sbjct  14   IMGTRVAPGIHPGSGRFTAVFGFGKKKAAPKKSAKKT------VTTDRPLWYPGAISPDW  67

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQF++DSLDQNLAKNLAGD+IGTR E++D K TPFQPY
Sbjct  68   LDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEAADAKSTPFQPY  127

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  128  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  171



>gb|ABX47016.1| chloroplast chlorophyll a/b binding protein cab-PhE7 [Phyllostachys 
edulis]
Length=287

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 136/166 (82%), Gaps = 11/166 (7%)
 Frame = -2

Query  494  SFLGTRL--PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAP  321
            +FLGTRL  P  QNG  R+ A  GFGRKKAAP    + S       +SDRP WFPGA AP
Sbjct  11   TFLGTRLADPAPQNG--RIVARFGFGRKKAAPKKAARTS-------TSDRPLWFPGAVAP  61

Query  320  EWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQ  141
            ++LDGSLVGD GFDPFGL KPAEYLQFELDSLDQNLAKN AGDIIGTR E  +VK TPFQ
Sbjct  62   DYLDGSLVGDYGFDPFGLGKPAEYLQFELDSLDQNLAKNDAGDIIGTRFEPGEVKSTPFQ  121

Query  140  PYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            PY+EVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  122  PYTEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  167



>ref|NP_195773.1| chlorophyll a-b binding protein CP29.1 [Arabidopsis thaliana]
 sp|Q07473.1|CB4A_ARATH RecName: Full=Chlorophyll a-b binding protein CP29.1, chloroplastic; 
AltName: Full=LHCB4.1; AltName: Full=LHCII protein 4.1; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA50712.1| CP29 [Arabidopsis thaliana]
 emb|CAB82269.1| chlorophyll a/b-binding protein CP29 [Arabidopsis thaliana]
 gb|AAK82562.1| AT5g01530/F7A7_50 [Arabidopsis thaliana]
 gb|AAL15272.1| AT5g01530/F7A7_50 [Arabidopsis thaliana]
 gb|AAL24343.1| chlorophyll a/b-binding protein CP29 [Arabidopsis thaliana]
 gb|AAM10242.1| chlorophyll a/b-binding protein CP29 [Arabidopsis thaliana]
 gb|AAM91396.1| At5g01530/F7A7_50 [Arabidopsis thaliana]
 dbj|BAE98601.1| Lhcb4- protein [Arabidopsis thaliana]
 gb|AED90357.1| chlorophyll a-b binding protein CP29.1 [Arabidopsis thaliana]
Length=290

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 137/164 (84%), Gaps = 7/164 (4%)
 Frame = -2

Query  491  FLGTRL-PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
             +GTR+ P    G GR  A+ GFG+KKAAP    KK+      V++DRP W+PGA +P+W
Sbjct  14   IMGTRVAPGIHPGSGRFTAVFGFGKKKAAPKKSAKKT------VTTDRPLWYPGAISPDW  67

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQF++DSLDQNLAKNLAGD+IGTR E++D K TPFQPY
Sbjct  68   LDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEAADAKSTPFQPY  127

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  128  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  171



>ref|XP_006398606.1| hypothetical protein EUTSA_v10014055mg [Eutrema salsugineum]
 gb|ESQ40059.1| hypothetical protein EUTSA_v10014055mg [Eutrema salsugineum]
Length=335

 Score =   233 bits (595),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 131/164 (80%), Gaps = 9/164 (5%)
 Frame = -2

Query  491  FLGTRL-PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
             +GTR+ P   +G GR  A  GFG+K      P         +V+SDRP WFPGAK+P+W
Sbjct  60   IMGTRVAPGIHSGSGRFTARFGFGKKAPKKTAPK--------KVTSDRPLWFPGAKSPDW  111

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQF++DSLDQNLAKNLAGD+IGTR E +  K TPFQPY
Sbjct  112  LDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEEAAPKSTPFQPY  171

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  172  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  215



>ref|XP_009377780.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Pyrus x bretschneideri]
Length=286

 Score =   231 bits (590),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 131/165 (79%), Gaps = 10/165 (6%)
 Frame = -2

Query  494  SFLGTRLP-KTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPE  318
            SF+GTRLP    +  GRV+A  GFG          KK        S+DRP W+PGAKAPE
Sbjct  13   SFIGTRLPTDAYSNSGRVQARFGFG---------AKKPKKTKPTFSTDRPLWYPGAKAPE  63

Query  317  WLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQP  138
            WLDGSLVGD GFDPFGL KPAEYLQ++ D LDQNLAKNLAGDIIGTR E++DV+ TPFQP
Sbjct  64   WLDGSLVGDYGFDPFGLGKPAEYLQYDYDGLDQNLAKNLAGDIIGTRTETADVQSTPFQP  123

Query  137  YSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            Y+EVFG+QRFRECELIHGRWAMLATLGAL+VE LTG+TWQDAGKV
Sbjct  124  YTEVFGLQRFRECELIHGRWAMLATLGALTVESLTGITWQDAGKV  168



>gb|AHM26635.1| a-b binding protein [Pyrus x bretschneideri]
Length=286

 Score =   231 bits (590),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 131/165 (79%), Gaps = 10/165 (6%)
 Frame = -2

Query  494  SFLGTRLP-KTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPE  318
            SF+GTRLP    +  GRV+A  GFG          KK        S+DRP W+PGAKAPE
Sbjct  13   SFIGTRLPTDAYSNSGRVQARFGFG---------AKKPKKTKPTFSTDRPLWYPGAKAPE  63

Query  317  WLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQP  138
            WLDGSLVGD GFDPFGL KPAEYLQ++ D LDQNLAKNLAGDIIGTR E++DV+ TPFQP
Sbjct  64   WLDGSLVGDYGFDPFGLGKPAEYLQYDYDGLDQNLAKNLAGDIIGTRTETADVQSTPFQP  123

Query  137  YSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            Y+EVFG+QRFRECELIHGRWAMLATLGAL+VE LTG+TWQDAGKV
Sbjct  124  YTEVFGLQRFRECELIHGRWAMLATLGALTVESLTGITWQDAGKV  168



>ref|XP_006848193.1| hypothetical protein AMTR_s00029p00239610 [Amborella trichopoda]
 gb|ERN09774.1| hypothetical protein AMTR_s00029p00239610 [Amborella trichopoda]
Length=291

 Score =   231 bits (590),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 137/172 (80%), Gaps = 5/172 (3%)
 Frame = -2

Query  515  AATAATPSFLGTRLPKTQNGMG-RVRALLGFGRkkaapppppkksapppKQVSSDRPTWF  339
            A +A T +FLG++L    N  G R RA  GFG       P  K    P ++ SSDRP WF
Sbjct  5    ATSATTSTFLGSQLQSLPNADGFRTRARFGFG----FKKPGSKPKPKPKQKQSSDRPLWF  60

Query  338  PGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDV  159
            PGAKAPE+LDGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKN AGD+IGTR E+SDV
Sbjct  61   PGAKAPEYLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNSAGDVIGTRFENSDV  120

Query  158  KPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            K TPFQPY+EVFG+QRFRECELIHGRWAMLATLGAL+VE LTGVTWQDAGKV
Sbjct  121  KSTPFQPYTEVFGLQRFRECELIHGRWAMLATLGALAVESLTGVTWQDAGKV  172



>ref|XP_002873005.1| chlorophyll a/b-binding protein CP29 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49264.1| chlorophyll a/b-binding protein CP29 [Arabidopsis lyrata subsp. 
lyrata]
Length=291

 Score =   231 bits (590),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 133/164 (81%), Gaps = 6/164 (4%)
 Frame = -2

Query  491  FLGTRL-PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
             +GTR+ P    G  R  AL  FG+KKAAP     K       V++DRP W+PGA +PEW
Sbjct  14   IMGTRVAPGIHPGSSRFTALFSFGKKKAAPKKSASKKT-----VTTDRPLWYPGAISPEW  68

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQF++DSLDQNLAKNLAGD+IGTR E++D K TPFQPY
Sbjct  69   LDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEAADAKSTPFQPY  128

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  129  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  172



>ref|NP_001105502.1| photosystem II subunit29 [Zea mays]
 emb|CAA90681.1| Chlorophyll a/b-binding protein CP29 precursor [Zea mays]
 gb|ACG39155.1| hypothetical protein [Zea mays]
 tpg|DAA63108.1| TPA: chlorophyll a/b-binding protein CP29 Precursor isoform 1 
[Zea mays]
 tpg|DAA63109.1| TPA: chlorophyll a/b-binding protein CP29 Precursor isoform 2 
[Zea mays]
Length=291

 Score =   231 bits (590),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 128/166 (77%), Gaps = 7/166 (4%)
 Frame = -2

Query  494  SFLGTRL--PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAP  321
            +FLGTRL  P  QNG  R+ A  GFG         P          SSDRP WFPGA AP
Sbjct  11   TFLGTRLADPAPQNG--RIVARFGFG---LGGKAKPAPKKVAKTSTSSDRPLWFPGAVAP  65

Query  320  EWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQ  141
            ++LDGSLVGD GFDPFGL KP EYLQFELDSLDQNLAKN AG IIGTR ESS+VK TP Q
Sbjct  66   DYLDGSLVGDYGFDPFGLGKPVEYLQFELDSLDQNLAKNEAGGIIGTRFESSEVKSTPLQ  125

Query  140  PYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            PYSEVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  126  PYSEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  171



>ref|XP_010924043.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Elaeis guineensis]
Length=287

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 137/175 (78%), Gaps = 11/175 (6%)
 Frame = -2

Query  518  MAATAATPS-FLGTRLPKTQNGM--GRVRALLGFGRkkaapppppkksapppKQVSSDRP  348
            MA+TAA  S FLG RLP +      GR +A  GFG          KK+A   K   SDRP
Sbjct  1    MASTAAATSPFLGARLPDSHPAKTGGRFQARFGFG--------GAKKTAAKKKSPGSDRP  52

Query  347  TWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIES  168
             WFPGAKAPEWLDGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKN AG++IGTR E+
Sbjct  53   LWFPGAKAPEWLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNQAGEVIGTRFEN  112

Query  167  SDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            +DVK TP QPY+EVFG+QRFRECELIHGRWAMLATLGAL+VE LTGVTWQDAGKV
Sbjct  113  ADVKSTPLQPYTEVFGLQRFRECELIHGRWAMLATLGALAVEGLTGVTWQDAGKV  167



>ref|XP_004958012.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Setaria italica]
Length=290

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 129/166 (78%), Gaps = 8/166 (5%)
 Frame = -2

Query  494  SFLGTRL--PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAP  321
            +FLGTRL  P  QNG  R+ A  GFG  K    P             SDRP WFPGA AP
Sbjct  11   TFLGTRLADPAPQNG--RIVARFGFGGGKKTAAPKKAAKTSSV----SDRPLWFPGAVAP  64

Query  320  EWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQ  141
            ++LDGSLVGD GFDPFGL KP EYLQFELDSLDQNLAKN AG IIGTR ESSDVK TPFQ
Sbjct  65   DYLDGSLVGDYGFDPFGLGKPVEYLQFELDSLDQNLAKNEAGGIIGTRFESSDVKSTPFQ  124

Query  140  PYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            PYSEVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  125  PYSEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  170



>ref|XP_009344712.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Pyrus x bretschneideri]
 gb|AHM26629.1| a-b binding protein [Pyrus x bretschneideri]
Length=289

 Score =   231 bits (588),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 134/165 (81%), Gaps = 7/165 (4%)
 Frame = -2

Query  494  SFLGTRLP-KTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPE  318
            SF+GTRLP +  +  GRV+A  GFG KK  P    K         S+DRP W+PGAKAPE
Sbjct  13   SFIGTRLPSEAYSNSGRVQARFGFGSKKTPPKKSTKP------TFSTDRPLWYPGAKAPE  66

Query  317  WLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQP  138
            WLDG+LVGD GFDPFGL KPAEYLQ++ D LDQNLAKNLAGDIIGTR E++DV+ TPFQP
Sbjct  67   WLDGTLVGDYGFDPFGLGKPAEYLQYDYDGLDQNLAKNLAGDIIGTRTETADVQSTPFQP  126

Query  137  YSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            Y+EVFG+QRFRECELIHGRWAMLATLGAL+VE LTG+TWQDAGKV
Sbjct  127  YTEVFGLQRFRECELIHGRWAMLATLGALTVESLTGITWQDAGKV  171



>prf||1908421A light-harvesting complex IIa protein
Length=286

 Score =   230 bits (586),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 137/166 (83%), Gaps = 11/166 (7%)
 Frame = -2

Query  494  SFLGTRL--PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAP  321
            +FLGTRL  P+ QNG  R+ A  GFG+KKA P              ++DRP WFPGA+AP
Sbjct  11   TFLGTRLADPRPQNG--RIVARFGFGKKKAPPKKAKA-------PPTTDRPLWFPGAQAP  61

Query  320  EWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQ  141
            E+LDG+LVGD GFDPFGL KPAEYLQ+++DSLDQNLA+NLAG+IIGTR E +DVK TPFQ
Sbjct  62   EYLDGTLVGDYGFDPFGLGKPAEYLQYDVDSLDQNLAQNLAGEIIGTRFEDADVKSTPFQ  121

Query  140  PYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            PY+EVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  122  PYAEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  167



>ref|XP_008388205.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Malus domestica]
Length=289

 Score =   230 bits (586),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 129/165 (78%), Gaps = 7/165 (4%)
 Frame = -2

Query  494  SFLGTRLP-KTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPE  318
            SF+GTRLP +  +  GRV+   GFG                    S+DRP W+PGAKAPE
Sbjct  13   SFIGTRLPSEAYSNSGRVQGRFGFG------TKKRPPKKSTKPTFSTDRPLWYPGAKAPE  66

Query  317  WLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQP  138
            WLDG+LVGD GFDPFGL KPAEYLQ++ D LDQNLAKNLAGDIIGTR E++DV+ TPFQP
Sbjct  67   WLDGTLVGDYGFDPFGLGKPAEYLQYDYDGLDQNLAKNLAGDIIGTRTETADVQSTPFQP  126

Query  137  YSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            Y+EVFG+QRFRECELIHGRWAMLATLGAL+VE LTG+TWQDAGKV
Sbjct  127  YTEVFGLQRFRECELIHGRWAMLATLGALTVESLTGITWQDAGKV  171



>gb|ABS11036.1| chloroplast chlorophyll a/b-binding protein [Brassica oleracea 
var. gemmifera]
Length=157

 Score =   225 bits (574),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            V+SDRP W+PGAK+PEWLDGSLVGD GFDPFGL KPAEYLQF++DSLDQNLAKNLAGD+I
Sbjct  20   VTSDRPLWYPGAKSPEWLDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVI  79

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGK  6
            GTR E +  K TPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGK
Sbjct  80   GTRTEEAAPKSTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGK  139

Query  5    V  3
            V
Sbjct  140  V  140



>ref|XP_006407730.1| hypothetical protein EUTSA_v10021263mg [Eutrema salsugineum]
 gb|ESQ49183.1| hypothetical protein EUTSA_v10021263mg [Eutrema salsugineum]
Length=287

 Score =   229 bits (585),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 128/164 (78%), Gaps = 9/164 (5%)
 Frame = -2

Query  491  FLGTRL-PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
             +GTR+     +G  R  A  GFG          K +    K V SDRP WFPGAK+PE+
Sbjct  13   LMGTRVVSDIHSGSSRFTARFGFG--------TKKAAPKKAKTVISDRPLWFPGAKSPEY  64

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKN+AGD+IGTR E+ D K TPFQPY
Sbjct  65   LDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNIAGDVIGTRTEAVDPKSTPFQPY  124

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  125  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  168



>ref|XP_009146970.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic 
[Brassica rapa]
 emb|CDY44667.1| BnaA05g29390D [Brassica napus]
Length=288

 Score =   229 bits (585),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 128/163 (79%), Gaps = 8/163 (5%)
 Frame = -2

Query  488  LGTRLPKTQN-GMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWL  312
            +GTR+    N G  R  A  GFG            +    K V SDRP WFPGAK+PE+L
Sbjct  14   MGTRVVSDINSGSSRFTARFGFG-------TKKAAAPKKAKTVISDRPLWFPGAKSPEYL  66

Query  311  DGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYS  132
            DGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKN+AGD+IGTR E++D K TPFQPYS
Sbjct  67   DGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNIAGDVIGTRTEAADPKSTPFQPYS  126

Query  131  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            EVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  127  EVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  169



>emb|CDY53084.1| BnaCnng24140D [Brassica napus]
Length=289

 Score =   229 bits (584),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 128/164 (78%), Gaps = 8/164 (5%)
 Frame = -2

Query  491  FLGTRLPKTQN-GMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
             +GTR+    N G GR  A  GFG            +    K V SDRP WFPGAK+PE+
Sbjct  14   IMGTRVVSDINSGSGRFIARFGFG-------TKKAAAPKKAKTVISDRPLWFPGAKSPEY  66

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKN+AGD+IGTR E+ D K TPFQPY
Sbjct  67   LDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNIAGDVIGTRTEAVDPKSTPFQPY  126

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  127  SEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  170



>ref|XP_008370077.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Malus domestica]
Length=286

 Score =   229 bits (583),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 132/165 (80%), Gaps = 10/165 (6%)
 Frame = -2

Query  494  SFLGTRLP-KTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPE  318
            SF+GTRLP    +  GRV+A  GFG KK     P           ++DRP W+PGAKAPE
Sbjct  13   SFIGTRLPTDAYSNSGRVQARFGFGTKKPKKTKP---------TFTTDRPLWYPGAKAPE  63

Query  317  WLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQP  138
            WLDGSLVGD GFDPFGL KPAEYLQ++ D LDQNLAKNLAGDIIGTR E++DV+ TPFQP
Sbjct  64   WLDGSLVGDYGFDPFGLGKPAEYLQYDYDGLDQNLAKNLAGDIIGTRTETADVQSTPFQP  123

Query  137  YSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            YSEVFG+QRFRECELIHGRWAMLATLGAL+VE +TG+TWQDAGKV
Sbjct  124  YSEVFGLQRFRECELIHGRWAMLATLGALTVESVTGITWQDAGKV  168



>ref|XP_002463016.1| hypothetical protein SORBIDRAFT_02g036260 [Sorghum bicolor]
 gb|EER99537.1| hypothetical protein SORBIDRAFT_02g036260 [Sorghum bicolor]
Length=288

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 132/166 (80%), Gaps = 10/166 (6%)
 Frame = -2

Query  494  SFLGTRL--PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAP  321
            +FLGTRL  P  QNG  R+ A  GFG+ K A  P          ++SSDRP WFPGA AP
Sbjct  11   TFLGTRLSDPAPQNG--RIVARFGFGKPKKAAAPKKVS------KISSDRPLWFPGAVAP  62

Query  320  EWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQ  141
            ++LDG+LVGD GFDPFGL KP EYLQF+LDSLDQNLAKN  G +IGTR ESSDVK TP Q
Sbjct  63   DYLDGTLVGDYGFDPFGLGKPVEYLQFDLDSLDQNLAKNEPGVVIGTRFESSDVKSTPLQ  122

Query  140  PYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            PYSEVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  123  PYSEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  168



>gb|ABW90990.1| LHCB4 [Bambusa oldhamii]
Length=287

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 135/166 (81%), Gaps = 11/166 (7%)
 Frame = -2

Query  494  SFLGTRL--PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAP  321
            +FLGTRL  P  QNG  R+ A  GFG KKAAP    + S       +SDRP WFPGA AP
Sbjct  11   TFLGTRLADPAPQNG--RIVARFGFGGKKAAPKKAARTS-------TSDRPLWFPGAVAP  61

Query  320  EWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQ  141
            E+LDGSLVGD GFDP GL KPAEYLQ++LDSLDQNLAKN+AGDIIGTR E  +VK TPFQ
Sbjct  62   EYLDGSLVGDYGFDPIGLGKPAEYLQYDLDSLDQNLAKNVAGDIIGTRFEPGEVKSTPFQ  121

Query  140  PYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            PY+EVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  122  PYTEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  167



>ref|XP_008390707.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Malus domestica]
Length=209

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 127/164 (77%), Gaps = 7/164 (4%)
 Frame = -2

Query  494  SFLGTRLP-KTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPE  318
            SF+GTRLP +  +  GRV+   GFG                    S+DRP W+PGAKAPE
Sbjct  13   SFIGTRLPSEAYSNSGRVQGRFGFG------TKKRPPKKSTKPTFSTDRPLWYPGAKAPE  66

Query  317  WLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQP  138
            WLDG+LVGD GFDPFGL KPAEYLQ++ D LDQNLAKNLAGDIIGTR E++DV+ TPFQP
Sbjct  67   WLDGTLVGDYGFDPFGLGKPAEYLQYDYDGLDQNLAKNLAGDIIGTRTETADVQSTPFQP  126

Query  137  YSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGK  6
            Y+EVFG+QRFRECELIHGRWAMLATLGAL+VE LTG+TWQDA +
Sbjct  127  YTEVFGLQRFRECELIHGRWAMLATLGALTVESLTGITWQDAER  170



>gb|KFK38281.1| hypothetical protein AALP_AA3G093700 [Arabis alpina]
Length=287

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            V SDRP WFPGAK+PE+LDGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKN+AGD+I
Sbjct  48   VISDRPLWFPGAKSPEYLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNIAGDVI  107

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGK  6
            GTR E+ D K TPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTG+TWQDAGK
Sbjct  108  GTRTEAVDPKSTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGITWQDAGK  167

Query  5    V  3
            V
Sbjct  168  V  168



>ref|XP_004302636.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=286

 Score =   226 bits (577),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 131/164 (80%), Gaps = 7/164 (4%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
            SF+GTR+P   +  GRV+A  GFG KKAAP    + +        +DRP W+PGAKAPEW
Sbjct  12   SFIGTRIPDVYSNSGRVQARFGFGAKKAAPKKSKQSTF-------TDRPLWYPGAKAPEW  64

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSLVGD GFDPFGL KPAEYLQ++ D LDQNLAKNLAG++IGTR E+SDV     QPY
Sbjct  65   LDGSLVGDYGFDPFGLGKPAEYLQYDYDGLDQNLAKNLAGEVIGTRTETSDVSSETLQPY  124

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFG+QRFRECELIHGRWAMLATLGAL+VE LTGVTWQDAGKV
Sbjct  125  SEVFGLQRFRECELIHGRWAMLATLGALTVESLTGVTWQDAGKV  168



>gb|EMT21651.1| Chlorophyll a-b binding protein CP29.2, chloroplastic [Aegilops 
tauschii]
Length=286

 Score =   226 bits (577),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 134/164 (82%), Gaps = 11/164 (7%)
 Frame = -2

Query  491  FLGTRL--PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPE  318
            FLGTRL  P  QNG  R+ A  GFG+KKA P              ++DRP WFPGA+APE
Sbjct  12   FLGTRLADPAPQNG--RIVARFGFGKKKAPPKKAKA-------PPTTDRPLWFPGAQAPE  62

Query  317  WLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQP  138
            +LDG+LVGD GFDPFGL KPAEYLQ+++DSLDQNLA+NLAG+IIGTR E +DVK TPFQP
Sbjct  63   YLDGTLVGDYGFDPFGLGKPAEYLQYDVDSLDQNLAQNLAGEIIGTRFEDADVKSTPFQP  122

Query  137  YSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGK  6
            Y+EVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGK
Sbjct  123  YAEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGK  166



>ref|XP_006300034.1| hypothetical protein CARUB_v10016258mg [Capsella rubella]
 gb|EOA32932.1| hypothetical protein CARUB_v10016258mg [Capsella rubella]
Length=287

 Score =   226 bits (577),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 127/163 (78%), Gaps = 9/163 (6%)
 Frame = -2

Query  488  LGTRL-PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWL  312
            +GTR+     +G GR  A   FG          K +    K V SDRP WFPGAK+PE+L
Sbjct  14   MGTRVVSDIHSGSGRFTARFAFG--------TKKAAPKKAKTVISDRPLWFPGAKSPEYL  65

Query  311  DGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYS  132
            DGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKNL GD+IGTR E+ D K TPFQPYS
Sbjct  66   DGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLYGDVIGTRTEAVDPKSTPFQPYS  125

Query  131  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            EVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  126  EVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  168



>ref|XP_002882591.1| LHCB4.2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58850.1| LHCB4.2 [Arabidopsis lyrata subsp. lyrata]
Length=287

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 128/163 (79%), Gaps = 9/163 (6%)
 Frame = -2

Query  488  LGTRL-PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWL  312
            +GTR+     +G  R  A  GFG          K +    K V SDRP WFPGAK+PE+L
Sbjct  14   MGTRVVSDISSGSTRFTAWFGFG--------TKKAAPKKAKTVISDRPLWFPGAKSPEYL  65

Query  311  DGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYS  132
            DGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKNLAGD+IGTR E+ D K TPFQPYS
Sbjct  66   DGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLAGDVIGTRTEAVDPKSTPFQPYS  125

Query  131  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            EVFG+QRFRECELIHGRWAMLATLGA++VEWLTGVTWQDAGKV
Sbjct  126  EVFGLQRFRECELIHGRWAMLATLGAITVEWLTGVTWQDAGKV  168



>ref|XP_011043542.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic 
[Populus euphratica]
Length=276

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 143/174 (82%), Gaps = 5/174 (3%)
 Frame = -2

Query  518  MAAT--AATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPT  345
            MAAT   AT  FLGTR   T+   G+++AL GFG KK+ PPPPPKKS+P   +   +R  
Sbjct  1    MAATTAVATSYFLGTRTQYTKQNPGKIQALFGFGTKKSPPPPPPKKSSPKQFE---ERLV  57

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            WFPGA  PEWLDG++VGD GFDPF L KPAEYLQF+LDSLDQNLAKNLAGD+IG R++++
Sbjct  58   WFPGATPPEWLDGTMVGDRGFDPFALGKPAEYLQFDLDSLDQNLAKNLAGDVIGVRVDAT  117

Query  164  DVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            +VKPTPFQPYSEVFG+QRFRECELIHGRWAML TLGA++VE LTGV WQDAGKV
Sbjct  118  EVKPTPFQPYSEVFGLQRFRECELIHGRWAMLGTLGAIAVEALTGVAWQDAGKV  171



>ref|XP_010677168.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=287

 Score =   224 bits (571),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 130/174 (75%), Gaps = 3/174 (2%)
 Frame = -2

Query  524  IAMAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPT  345
            +A AA A      GTR+     G  + +AL G G+K A       K      +   DR  
Sbjct  1    MATAAPATASYIFGTRIAGPNPGPAKFQALFGLGKKAAPAKKAAPKRPVVSDE---DRLV  57

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            WFPGA+ PEWLDGSLVGD GFDPFGLAKPAEYLQF+ D LDQNLAKNLAGDIIG RIE+ 
Sbjct  58   WFPGAQPPEWLDGSLVGDRGFDPFGLAKPAEYLQFDYDGLDQNLAKNLAGDIIGARIETE  117

Query  164  DVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            D++PTPFQPY+EVFGIQRFRECE+IHGRWAMLATLGALSVE LTGV+WQDAGKV
Sbjct  118  DIQPTPFQPYAEVFGIQRFRECEVIHGRWAMLATLGALSVEALTGVSWQDAGKV  171



>ref|NP_850545.1| light harvesting complex photosystem II interacting protein Lhcb4.2 
[Arabidopsis thaliana]
 gb|AEE74697.1| light harvesting complex photosystem II interacting protein Lhcb4.2 
[Arabidopsis thaliana]
Length=227

 Score =   222 bits (565),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            V SDRP WFPGAK+PE+LDGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKNL G++I
Sbjct  48   VISDRPLWFPGAKSPEYLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLYGEVI  107

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGK  6
            GTR E+ D K TPFQPYSEVFG+QRFRECELIHGRWAMLATLGA++VEWLTGVTWQDAGK
Sbjct  108  GTRTEAVDPKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGAITVEWLTGVTWQDAGK  167

Query  5    V  3
            V
Sbjct  168  V  168



>ref|XP_003562892.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Brachypodium distachyon]
Length=288

 Score =   224 bits (571),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 129/166 (78%), Gaps = 8/166 (5%)
 Frame = -2

Query  494  SFLGTRL--PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAP  321
            +FLGTRL  P  QNG  R+ A  GFG                    ++DRP WFPGA+AP
Sbjct  11   TFLGTRLADPAPQNG--RIVARFGFG----LGRKKAPAKKASRAPPTTDRPLWFPGAQAP  64

Query  320  EWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQ  141
            E+LDG+LVGD GFDPFGL KPAEYLQ++ DSLDQNLA+NLAG++IGTR E +D+K TP Q
Sbjct  65   EYLDGTLVGDYGFDPFGLGKPAEYLQYDPDSLDQNLAQNLAGEVIGTRFEDADIKSTPLQ  124

Query  140  PYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            PY+EVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  125  PYAEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  170



>ref|XP_008800353.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Phoenix dactylifera]
Length=289

 Score =   224 bits (570),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 131/175 (75%), Gaps = 9/175 (5%)
 Frame = -2

Query  518  MAATAA-TPSFLGTRLPKTQ--NGMGRVRALLGFGRkkaapppppkksapppKQVSSDRP  348
            MA+TAA T  FLG R+P +      GR +A  GFG            +    K    DRP
Sbjct  1    MASTAAATSPFLGARVPDSHPVKTGGRFQARFGFG------GRKKTAAKKTAKSPVPDRP  54

Query  347  TWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIES  168
             WFPGA APEWLDGSLVGD GFDP GL KPAEYLQF+LDSLDQNLAKNLAGD+IGTR E+
Sbjct  55   LWFPGATAPEWLDGSLVGDYGFDPLGLGKPAEYLQFDLDSLDQNLAKNLAGDVIGTRFEN  114

Query  167  SDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            +DVK TP QPY+EVFG+QRFRECELIHGRWAMLATLGAL+VE LTGV WQDAGKV
Sbjct  115  ADVKSTPLQPYTEVFGLQRFRECELIHGRWAMLATLGALAVEGLTGVPWQDAGKV  169



>ref|XP_002312153.1| Chlorophyll a-b binding protein CP29.3 [Populus trichocarpa]
 gb|EEE89520.1| Chlorophyll a-b binding protein CP29.3 [Populus trichocarpa]
Length=275

 Score =   223 bits (569),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 142/174 (82%), Gaps = 5/174 (3%)
 Frame = -2

Query  518  MAATAATPS--FLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPT  345
            MAAT A  +  F GTR   T+   G+++AL GFG KK+ PPPPPKKS+P   +   DR  
Sbjct  1    MAATTAVAASYFSGTRTQYTKQNPGKIQALFGFGTKKSPPPPPPKKSSPKQFE---DRLV  57

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            WFPGA  PEWLDG++VGD GFDPF L KPAEYLQF+LDSLDQNLAKNLAGD+IG R++++
Sbjct  58   WFPGASPPEWLDGTMVGDRGFDPFALGKPAEYLQFDLDSLDQNLAKNLAGDVIGVRVDAT  117

Query  164  DVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            +VKPTPFQPYSEVFG+QRFRECELIHGRWAML TLGA++VE LTGV WQDAGKV
Sbjct  118  EVKPTPFQPYSEVFGLQRFRECELIHGRWAMLGTLGAIAVEALTGVAWQDAGKV  171



>ref|XP_010095100.1| Chlorophyll a-b binding protein [Morus notabilis]
 gb|EXB58206.1| Chlorophyll a-b binding protein [Morus notabilis]
Length=278

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 130/170 (76%), Gaps = 0/170 (0%)
 Frame = -2

Query  512  ATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPG  333
            A AAT  F GTR+       GR +A  GFG  K +PPP        PK  S +R  WFPG
Sbjct  4    AAAATSRFFGTRIYNPSPNTGRFQARFGFGFGKKSPPPQTPPKKAQPKFSSGERLVWFPG  63

Query  332  AKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKP  153
             + PEWLDG++VGD GFDPFG AKPAEYLQFELDSLDQNLAKN+AG++IG R+E+++V P
Sbjct  64   TEPPEWLDGTMVGDRGFDPFGFAKPAEYLQFELDSLDQNLAKNVAGEVIGARVETAEVNP  123

Query  152  TPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            TPFQPYSEVFGIQRFRECELIHGRWAML  LGA++VE LTGV WQDAGKV
Sbjct  124  TPFQPYSEVFGIQRFRECELIHGRWAMLGALGAIAVEALTGVAWQDAGKV  173



>ref|XP_006657829.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Oryza brachyantha]
Length=288

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 127/166 (77%), Gaps = 9/166 (5%)
 Frame = -2

Query  494  SFLGTRL--PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAP  321
            +FLGTRL  P  QNG  R+ A     R                   ++DRP WFPGA AP
Sbjct  11   TFLGTRLADPAPQNG--RIVA-----RFGFGGGKKAAAKKVAKSPSTTDRPLWFPGAVAP  63

Query  320  EWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQ  141
            ++LDGS++GD GFDPFGL KPAEYLQFELDSLDQNLAKN AG+IIGTR E+ +VK TPFQ
Sbjct  64   DYLDGSMIGDYGFDPFGLGKPAEYLQFELDSLDQNLAKNNAGEIIGTRFETGEVKSTPFQ  123

Query  140  PYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            PYSEVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  124  PYSEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  169



>ref|NP_187506.1| light harvesting complex photosystem II interacting protein Lhcb4.2 
[Arabidopsis thaliana]
 sp|Q9XF88.1|CB4B_ARATH RecName: Full=Chlorophyll a-b binding protein CP29.2, chloroplastic; 
AltName: Full=LHCB4.2; AltName: Full=LHCII protein 4.2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD28774.1|AF134127_1 Lhcb4.2 protein [Arabidopsis thaliana]
 gb|AAF07831.1|AC010871_7 putative chlorophyll a/b-binding protein [Arabidopsis thaliana]
 gb|AAL38316.1| putative chlorophyll a/b-binding protein [Arabidopsis thaliana]
 gb|AAM10170.1| putative chlorophyll a/b-binding protein [Arabidopsis thaliana]
 gb|AEE74698.1| light harvesting complex photosystem II interacting protein Lhcb4.2 
[Arabidopsis thaliana]
Length=287

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            V SDRP WFPGAK+PE+LDGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKNL G++I
Sbjct  48   VISDRPLWFPGAKSPEYLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLYGEVI  107

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGK  6
            GTR E+ D K TPFQPYSEVFG+QRFRECELIHGRWAMLATLGA++VEWLTGVTWQDAGK
Sbjct  108  GTRTEAVDPKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGAITVEWLTGVTWQDAGK  167

Query  5    V  3
            V
Sbjct  168  V  168



>gb|AFK42501.1| unknown [Medicago truncatula]
Length=224

 Score =   220 bits (560),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 124/164 (76%), Gaps = 2/164 (1%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
             F GT L K  + MGRVRA    G K    P   +      ++  SD   WFPGA+ PEW
Sbjct  12   HFFGTSLCKPTSNMGRVRAFFNIGTKLKPAPKKKEVKKVRKQE--SDGLVWFPGAQPPEW  69

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDG+++GD GFDP GLAKP EYLQF+LDSLDQNLAKNLAGDIIGTR+ES+DV PTPFQPY
Sbjct  70   LDGTMIGDRGFDPLGLAKPVEYLQFDLDSLDQNLAKNLAGDIIGTRVESTDVNPTPFQPY  129

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            +EVFGIQRFRECE+IHGRWAML  LGAL+VE  TGV WQDAGKV
Sbjct  130  TEVFGIQRFRECEVIHGRWAMLGALGALAVEAFTGVAWQDAGKV  173



>ref|XP_003552419.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Glycine max]
Length=278

 Score =   221 bits (564),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 133/165 (81%), Gaps = 5/165 (3%)
 Frame = -2

Query  491  FLGTRL--PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPE  318
            F GTRL  P T N  GR  ALL FG+KKAA PPP KK      + S DR  WFP A+ PE
Sbjct  12   FFGTRLNNPTTLNN-GRFHALLNFGKKKAAAPPPKKKEVKV--KPSGDRLVWFPNAEPPE  68

Query  317  WLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQP  138
            WLDGS++GD GFDPFG AKPAEYLQF+LDSLDQNLAKN+AGD+IGTR+E +DVKPTPFQP
Sbjct  69   WLDGSMIGDRGFDPFGFAKPAEYLQFDLDSLDQNLAKNVAGDVIGTRVEVADVKPTPFQP  128

Query  137  YSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            YSEVFGIQRFRECELIHGRWAML  LGAL VE LTGV WQDAGKV
Sbjct  129  YSEVFGIQRFRECELIHGRWAMLGALGALVVEALTGVAWQDAGKV  173



>ref|XP_007163532.1| hypothetical protein PHAVU_001G242100g [Phaseolus vulgaris]
 gb|ESW35526.1| hypothetical protein PHAVU_001G242100g [Phaseolus vulgaris]
Length=277

 Score =   221 bits (563),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 137/175 (78%), Gaps = 6/175 (3%)
 Frame = -2

Query  518  MAATAATPSFL-GTRL--PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRP  348
            MAA AAT S+L GT+L  P T N  GR  AL  FG KK  PPP  K+       VS DR 
Sbjct  1    MAAIAATTSYLFGTQLYTPTTLN-TGRFHALFNFGTKKTPPPPKKKEVKVK--PVSGDRL  57

Query  347  TWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIES  168
             WFP A  PEWLDGS++GD GFDPFG A+PAEYLQF+LDSLDQNLAKNLAGD+IGTR+E 
Sbjct  58   VWFPKADPPEWLDGSMIGDRGFDPFGFARPAEYLQFDLDSLDQNLAKNLAGDVIGTRVEV  117

Query  167  SDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            ++VKPTPFQPY+EVFGIQRFRECE+IHGRWAML  LGAL+VE LTGV WQDAGKV
Sbjct  118  AEVKPTPFQPYTEVFGIQRFRECEVIHGRWAMLGALGALAVEALTGVAWQDAGKV  172



>ref|XP_010466814.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic 
[Camelina sativa]
 ref|XP_010464514.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic 
[Camelina sativa]
Length=289

 Score =   221 bits (564),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 127/163 (78%), Gaps = 9/163 (6%)
 Frame = -2

Query  488  LGTRL-PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWL  312
            +GTR+     +G  R  A  GFG          K +    K+V +DRP WFPGA++PE+L
Sbjct  16   MGTRVVSDIHSGSSRFTARFGFG--------TKKAAPKKAKKVITDRPLWFPGAQSPEYL  67

Query  311  DGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYS  132
            DGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKNL G++IGTR E  D K TPFQPYS
Sbjct  68   DGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLYGEVIGTRTEEVDPKSTPFQPYS  127

Query  131  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            EVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  128  EVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  170



>ref|XP_003600876.1| Chlorophyll a-b binding protein CP29.3 [Medicago truncatula]
 gb|AES71127.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=278

 Score =   221 bits (562),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 124/164 (76%), Gaps = 2/164 (1%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
             F GT L K  + MGRVRA    G K    P   +      ++  SD   WFPGA+ PEW
Sbjct  12   HFFGTSLCKPTSNMGRVRAFFNIGTKLKPAPKKKEVKKVRKQE--SDGLVWFPGAQPPEW  69

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDG+++GD GFDP GLAKP EYLQF+LDSLDQNLAKNLAGDIIGTR+ES+DV PTPFQPY
Sbjct  70   LDGTMIGDRGFDPLGLAKPVEYLQFDLDSLDQNLAKNLAGDIIGTRVESTDVNPTPFQPY  129

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            +EVFGIQRFRECE+IHGRWAML  LGAL+VE  TGV WQDAGKV
Sbjct  130  TEVFGIQRFRECEVIHGRWAMLGALGALAVEAFTGVAWQDAGKV  173



>ref|NP_001059975.1| Os07g0558400 [Oryza sativa Japonica Group]
 gb|AAC14566.1| chlorophyll a/b-binding protein [Oryza sativa Japonica Group]
 dbj|BAC84033.1| chlorophyll a/b-binding protein [Oryza sativa Japonica Group]
 dbj|BAF21889.1| Os07g0558400 [Oryza sativa Japonica Group]
 gb|EAZ04322.1| hypothetical protein OsI_26463 [Oryza sativa Indica Group]
 dbj|BAG93852.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96322.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96839.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86652.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99675.1| unnamed protein product [Oryza sativa Japonica Group]
Length=290

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  362  SSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIG  183
            ++DRP WFPGA AP++LDGSLVGD GFDPFGL KPAEYLQFELDSLDQNLAKN AG+IIG
Sbjct  51   TTDRPLWFPGAVAPDYLDGSLVGDYGFDPFGLGKPAEYLQFELDSLDQNLAKNNAGEIIG  110

Query  182  TRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            TR E+ +VK TPFQPY+EVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  111  TRFETGEVKSTPFQPYTEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  170



>ref|XP_010486443.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Camelina sativa]
Length=289

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 126/163 (77%), Gaps = 9/163 (6%)
 Frame = -2

Query  488  LGTRL-PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWL  312
            +GTR+     +G  R  A  GFG          K +    K+V +DRP WFPGA +PE+L
Sbjct  16   MGTRVVSDIHSGSSRFTARFGFG--------TKKAAPKKAKKVITDRPLWFPGATSPEYL  67

Query  311  DGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYS  132
            DGSLVGD GFDPFGL KPAEYLQF+LDSLDQNLAKNL G++IGTR E  D K TPFQPYS
Sbjct  68   DGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLYGEVIGTRTEEVDPKSTPFQPYS  127

Query  131  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            EVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  128  EVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  170



>gb|ABK96737.1| unknown [Populus trichocarpa x Populus deltoides]
Length=275

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 141/174 (81%), Gaps = 5/174 (3%)
 Frame = -2

Query  518  MAATAATPS--FLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPT  345
            MAAT A  +  F  TR   T+   G+++AL GFG KK+ PPPPPKKS+P   +   +R  
Sbjct  1    MAATIAVAASYFSATRTQYTKQNPGKIQALFGFGTKKSPPPPPPKKSSPKQFE---ERLV  57

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            WFPGA  PEWLDG++VGD GFDPF L KPAEYLQF+LDSLDQNLAKNLAGD+IG R++++
Sbjct  58   WFPGASPPEWLDGTMVGDRGFDPFALGKPAEYLQFDLDSLDQNLAKNLAGDVIGVRVDAT  117

Query  164  DVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            +VKPTPFQPYSEVFG+QRFRECELIHGRWAML TLGA++VE LTGV WQDAGKV
Sbjct  118  EVKPTPFQPYSEVFGLQRFRECELIHGRWAMLGTLGAIAVEALTGVAWQDAGKV  171



>ref|XP_004500683.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Cicer arietinum]
Length=276

 Score =   216 bits (551),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 123/164 (75%), Gaps = 4/164 (2%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
             F GTRL K  + +GR+R                KK    P+Q   +R  WFPGA +PEW
Sbjct  12   HFFGTRLSKPSSKIGRIRCFFNL----KPKKAAEKKKEVKPRQPEGERLVWFPGASSPEW  67

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDGSL+GD GFDP G AKPAEYLQ++LDSLDQNLAKNLAGDIIGTRIE ++VK TPFQPY
Sbjct  68   LDGSLIGDRGFDPLGFAKPAEYLQYDLDSLDQNLAKNLAGDIIGTRIEVAEVKATPFQPY  127

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            +EVFGIQRFRECELIHGRWAML  LGAL+VE  TGV+WQDAGKV
Sbjct  128  TEVFGIQRFRECELIHGRWAMLGALGALAVEAFTGVSWQDAGKV  171



>pdb|3PL9|A Chain A, Crystal Structure Of Spinach Minor Light-Harvesting 
Complex Cp29 At 2.80 Angstrom Resolution
Length=243

 Score =   215 bits (548),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  362  SSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIG  183
            S+DRP W+PGAKAPE+LDGSLVGD GFDPFGL KPAEYLQ++ D LDQNLAKNLAGDIIG
Sbjct  8    STDRPLWYPGAKAPEYLDGSLVGDYGFDPFGLGKPAEYLQYDYDGLDQNLAKNLAGDIIG  67

Query  182  TRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            TR ES+DVK T  QPYSEVFG+QRFRECELIHGRWAMLATLGAL+VE LTG+TWQDAGKV
Sbjct  68   TRTESADVKSTSLQPYSEVFGLQRFRECELIHGRWAMLATLGALTVEGLTGITWQDAGKV  127



>gb|KHF99476.1| Chlorophyll a-b binding CP29.3, chloroplastic -like protein [Gossypium 
arboreum]
 gb|KHG03854.1| Chlorophyll a-b binding CP29.3, chloroplastic -like protein [Gossypium 
arboreum]
Length=273

 Score =   216 bits (550),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 130/174 (75%), Gaps = 5/174 (3%)
 Frame = -2

Query  524  IAMAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPT  345
            +A    A    F GTR+  +    GR++A  GFG KKA PPP             SDR  
Sbjct  1    MATTTAATVSHFFGTRIQTSNPSSGRIQARFGFGTKKAPPPPKKAAPKR-----PSDRLV  55

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            WFPGA  PEWLDG+++GD GFDPFG AKPAEYLQ++LDSLDQNLAKN+AG+IIG   E++
Sbjct  56   WFPGANPPEWLDGTMIGDRGFDPFGFAKPAEYLQYDLDSLDQNLAKNVAGEIIGVISETA  115

Query  164  DVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            ++KPTPFQPY+EVFGIQRFRECELIHGRWAML TLGA++VE LTGV WQDAGKV
Sbjct  116  ELKPTPFQPYTEVFGIQRFRECELIHGRWAMLGTLGAIAVEALTGVAWQDAGKV  169



>gb|AGP03463.1| chloroplast chlorophyll a-b binding protein CP29 (chloroplast) 
[Ginkgo biloba]
Length=278

 Score =   216 bits (549),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            V S+RP W PGA+ PEWLDGSLVGD GFDP GL KPAEYLQF+LDSLDQNLAKN AG +I
Sbjct  51   VQSERPMWLPGAQPPEWLDGSLVGDYGFDPLGLGKPAEYLQFDLDSLDQNLAKNEAGQLI  110

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGK  6
            G RIE SD+KPTPFQPYSEVFG+QRFRECELIHGRWAML TLGAL+VE  TGVTWQDAGK
Sbjct  111  GIRIEDSDIKPTPFQPYSEVFGLQRFRECELIHGRWAMLGTLGALAVEAFTGVTWQDAGK  170

Query  5    V  3
            V
Sbjct  171  V  171



>ref|XP_010067525.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic 
[Eucalyptus grandis]
 gb|KCW65677.1| hypothetical protein EUGRSUZ_G03060 [Eucalyptus grandis]
Length=276

 Score =   215 bits (547),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 131/171 (77%), Gaps = 1/171 (1%)
 Frame = -2

Query  512  ATAATPSFLGTRLPKTQNGMGRVRA-LLGFGRkkaapppppkksapppKQVSSDRPTWFP  336
            A A++  F GTR+   +  +GR +A     G+K            P P+++  +R  WFP
Sbjct  2    AAASSSYFFGTRIADPKPSLGRFQARFGFGGKKFGFGGKKSPPPKPAPRKLDGERLVWFP  61

Query  335  GAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVK  156
            GA+ PEWLDG++VGD GFDPFGL KPAEYLQF+LDSLDQNLAKNLAGD+IG R+E ++VK
Sbjct  62   GAEPPEWLDGTMVGDRGFDPFGLGKPAEYLQFDLDSLDQNLAKNLAGDVIGVRVEQTEVK  121

Query  155  PTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            PTPFQPYSEVFG+QRFRECELIHGRWAML TLGAL+VE LTGV WQDAGKV
Sbjct  122  PTPFQPYSEVFGLQRFRECELIHGRWAMLGTLGALAVEALTGVAWQDAGKV  172



>ref|XP_003538459.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Glycine max]
Length=282

 Score =   215 bits (547),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 132/166 (80%), Gaps = 4/166 (2%)
 Frame = -2

Query  491  FLGTRLPKTQNGM---GRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAP  321
            F GTRL          GR  ALL FG+KK AP PPPKK      + S DR  WFP A+ P
Sbjct  13   FFGTRLNNVNTTTLNNGRFHALLNFGKKKTAPQPPPKKKEVKV-KPSGDRLVWFPNAEPP  71

Query  320  EWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQ  141
            EWLDGS++GD GFDPFG AKPAEYLQF+LDSLDQNLAKN+AGD+IGTR+E ++VKPTPFQ
Sbjct  72   EWLDGSMIGDRGFDPFGFAKPAEYLQFDLDSLDQNLAKNIAGDVIGTRVEVAEVKPTPFQ  131

Query  140  PYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            PYSEVFGIQRFRECELIHGRWAML +LGAL+VE LTGV WQDAGKV
Sbjct  132  PYSEVFGIQRFRECELIHGRWAMLGSLGALAVEALTGVAWQDAGKV  177



>ref|XP_007218784.1| hypothetical protein PRUPE_ppa009686mg [Prunus persica]
 gb|EMJ19983.1| hypothetical protein PRUPE_ppa009686mg [Prunus persica]
Length=282

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 123/166 (74%), Gaps = 3/166 (2%)
 Frame = -2

Query  491  FLGTRLPKTQNGMGRVRALLG-FGRkkaapppppkksapppKQVSSD--RPTWFPGAKAP  321
            F G RLP      GR +A  G FG         P    P  KQ   D  RP WFPGA+ P
Sbjct  12   FFGARLPNPGPSFGRFQARFGNFGGFSLGTKKSPPPPPPKQKQKFDDGERPVWFPGAEPP  71

Query  320  EWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQ  141
            EWLDGSLVGD GFDPFGL KPAEYLQF+ D LDQNLAKN+AGD+IGTRIE+++V PTPFQ
Sbjct  72   EWLDGSLVGDRGFDPFGLGKPAEYLQFDYDGLDQNLAKNVAGDVIGTRIETAEVNPTPFQ  131

Query  140  PYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            PYSEVFG+QRFRECELIHGRWAML  LGAL+VE LTGV WQDAGKV
Sbjct  132  PYSEVFGLQRFRECELIHGRWAMLGALGALAVEGLTGVAWQDAGKV  177



>ref|XP_008233744.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic 
[Prunus mume]
Length=282

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 123/166 (74%), Gaps = 3/166 (2%)
 Frame = -2

Query  491  FLGTRLPKTQNGMGRVRALLG-FGRkkaapppppkksapppKQVSSD--RPTWFPGAKAP  321
            F G RLP      GR +A  G FG         P    P  KQ   D  RP WFPGA+ P
Sbjct  12   FFGARLPNPGPSFGRFQARFGNFGGFSLGTKKSPPPPPPKQKQKFDDGERPVWFPGAEPP  71

Query  320  EWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQ  141
            EWLDGSLVGD GFDPFGL KPAEYLQF+ D LDQNLAKN+AGD+IGTRIE+++V PTPFQ
Sbjct  72   EWLDGSLVGDRGFDPFGLGKPAEYLQFDYDGLDQNLAKNVAGDVIGTRIETAEVNPTPFQ  131

Query  140  PYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            PYSEVFG+QRFRECELIHGRWAML  LGAL+VE LTGV WQDAGKV
Sbjct  132  PYSEVFGLQRFRECELIHGRWAMLGALGALAVEGLTGVAWQDAGKV  177



>ref|XP_002526901.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF35532.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=282

 Score =   213 bits (543),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  359  SDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGT  180
             DR  WFPGA  PEWLDG++VGD GFDPFGL KPAEYLQFELDSLDQNLAKN+AGDIIG 
Sbjct  60   EDRLVWFPGANPPEWLDGTMVGDRGFDPFGLGKPAEYLQFELDSLDQNLAKNVAGDIIGV  119

Query  179  RIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            R+E ++VKPTPFQPYSEVFG+QRFRECE+IHGRWAML TLGAL+VE LTGV WQDAGKV
Sbjct  120  RVEPNEVKPTPFQPYSEVFGLQRFRECEVIHGRWAMLGTLGALAVEALTGVAWQDAGKV  178



>ref|NP_001189719.1| light harvesting complex photosystem II [Arabidopsis thaliana]
 gb|AEC09779.1| light harvesting complex photosystem II [Arabidopsis thaliana]
Length=185

 Score =   210 bits (534),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 119/162 (73%), Gaps = 2/162 (1%)
 Frame = -2

Query  488  LGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWLD  309
             G R+   + G GRV+A  GF        P P        Q   DR  WFPGA  PEWLD
Sbjct  13   FGIRIQDPRPGTGRVQARFGF--SFGKKKPAPPPKKSRQVQDDGDRLVWFPGANPPEWLD  70

Query  308  GSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYSE  129
            GS++GD GFDPFGL KPAEYLQ++ D LDQNLAKN+AGDIIG   ESS++KPTPFQPY+E
Sbjct  71   GSMIGDRGFDPFGLGKPAEYLQYDFDGLDQNLAKNVAGDIIGIIQESSEIKPTPFQPYTE  130

Query  128  VFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            VFGIQRFRECELIHGRWAML TLGA++VE LTG+ WQDAGKV
Sbjct  131  VFGIQRFRECELIHGRWAMLGTLGAIAVEALTGIAWQDAGKV  172



>gb|KDP44781.1| hypothetical protein JCGZ_01281 [Jatropha curcas]
Length=279

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = -2

Query  494  SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEW  315
             F GTR+   + G+G+++A  GF        PPP     P  +   DR  WFPGA  PEW
Sbjct  12   HFFGTRILNPKPGVGKIQARFGFPGFGTKKSPPPPPKKAPVIKNDEDRLVWFPGATPPEW  71

Query  314  LDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPY  135
            LDG++VGD GFDPFGL KP EYLQFELDSLDQNLAKN AGD+IG RI+  +VK TPFQPY
Sbjct  72   LDGTMVGDRGFDPFGLGKPVEYLQFELDSLDQNLAKNEAGDVIGVRIDPGEVKSTPFQPY  131

Query  134  SEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            SEVFG+QRFRECE+IHGRWAML TLGA++VE LTGV WQDAGKV
Sbjct  132  SEVFGLQRFRECEVIHGRWAMLGTLGAIAVEALTGVAWQDAGKV  175



>ref|XP_004307637.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=274

 Score =   211 bits (537),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 124/174 (71%), Gaps = 5/174 (3%)
 Frame = -2

Query  524  IAMAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPT  345
            +A    A T  F G +L       G+ +AL  FG+K   PPP          +  +DR  
Sbjct  1    MATTTAAVTSHFFGAQLQNPSPSFGKFQALFSFGKKSPPPPPKKAPK-----KPDTDRLV  55

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            WFPGA+ PEWLDGS VGD GFDP GL KP EYLQ++ D LDQNLAKNLAGD+IGTRIE+S
Sbjct  56   WFPGAQPPEWLDGSYVGDRGFDPLGLGKPVEYLQYDYDGLDQNLAKNLAGDVIGTRIEAS  115

Query  164  DVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            D+ PTP QPY+EVFG+QRFRECELIHGRWAML  LGAL+VE LTGV WQDAGKV
Sbjct  116  DLNPTPLQPYTEVFGLQRFRECELIHGRWAMLGALGALAVEGLTGVAWQDAGKV  169



>ref|NP_181539.1| light harvesting complex photosystem II [Arabidopsis thaliana]
 sp|Q9S7W1.1|CB4C_ARATH RecName: Full=Chlorophyll a-b binding protein CP29.3, chloroplastic; 
AltName: Full=LHCB4.3; AltName: Full=LHCII protein 4.3; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD28775.1|AF134128_1 Lhcb4:3 protein [Arabidopsis thaliana]
 gb|AAL49888.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AAM20369.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AEC09778.1| light harvesting complex photosystem II [Arabidopsis thaliana]
Length=276

 Score =   210 bits (534),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 119/162 (73%), Gaps = 2/162 (1%)
 Frame = -2

Query  488  LGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWLD  309
             G R+   + G GRV+A  GF        P P        Q   DR  WFPGA  PEWLD
Sbjct  13   FGIRIQDPRPGTGRVQARFGF--SFGKKKPAPPPKKSRQVQDDGDRLVWFPGANPPEWLD  70

Query  308  GSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYSE  129
            GS++GD GFDPFGL KPAEYLQ++ D LDQNLAKN+AGDIIG   ESS++KPTPFQPY+E
Sbjct  71   GSMIGDRGFDPFGLGKPAEYLQYDFDGLDQNLAKNVAGDIIGIIQESSEIKPTPFQPYTE  130

Query  128  VFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            VFGIQRFRECELIHGRWAML TLGA++VE LTG+ WQDAGKV
Sbjct  131  VFGIQRFRECELIHGRWAMLGTLGAIAVEALTGIAWQDAGKV  172



>ref|XP_007009013.1| Light-harvesting complex II protein Lhcb8 [Theobroma cacao]
 gb|EOY17823.1| Light-harvesting complex II protein Lhcb8 [Theobroma cacao]
Length=277

 Score =   209 bits (533),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 130/163 (80%), Gaps = 3/163 (2%)
 Frame = -2

Query  491  FLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWL  312
            F GTR+     G GR+++  GF  +    PPPPKK+AP      SDR  WFPGA  PEWL
Sbjct  14   FFGTRINNLNLGSGRIQSRFGFNLRTKKAPPPPKKAAPKR---PSDRLVWFPGATPPEWL  70

Query  311  DGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYS  132
            DGS++GD GFDPFG  KPAEYLQF+LDSLDQNLAKN+AG++IG   E++++KPTPFQPY+
Sbjct  71   DGSMIGDRGFDPFGFGKPAEYLQFDLDSLDQNLAKNVAGEVIGVISETAELKPTPFQPYT  130

Query  131  EVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            EVFG+QRFRECELIHGRWAML +LGAL+VE LTGV+WQDAGKV
Sbjct  131  EVFGLQRFRECELIHGRWAMLGSLGALAVEALTGVSWQDAGKV  173



>ref|XP_002879843.1| LHCB4.3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56102.1| LHCB4.3 [Arabidopsis lyrata subsp. lyrata]
Length=276

 Score =   209 bits (531),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 119/162 (73%), Gaps = 2/162 (1%)
 Frame = -2

Query  488  LGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWLD  309
             G R+   + G GRV+A  GF        P P        Q   DR  WFPGA  PEWLD
Sbjct  13   FGIRIQDPRPGTGRVQARFGF--SFGKKKPAPPPKKSRQVQDDGDRLVWFPGANPPEWLD  70

Query  308  GSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYSE  129
            GS++GD GFDPFGL KPAEYLQ++ D LDQNLAKN+AGDIIG   +SS++KPTPFQPY+E
Sbjct  71   GSMIGDRGFDPFGLGKPAEYLQYDFDGLDQNLAKNVAGDIIGIIQDSSEIKPTPFQPYTE  130

Query  128  VFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            VFGIQRFRECELIHGRWAML TLGA++VE LTG+ WQDAGKV
Sbjct  131  VFGIQRFRECELIHGRWAMLGTLGAIAVEALTGIAWQDAGKV  172



>ref|XP_010554987.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic, 
partial [Tarenaya hassleriana]
Length=278

 Score =   208 bits (530),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 133/174 (76%), Gaps = 5/174 (3%)
 Frame = -2

Query  509  TAATPS-FLGTRLPKTQNGMGRVRALLGF----GRkkaapppppkksapppKQVSSDRPT  345
            TAAT S F GTR+   + G  RV+A  GF    G+K A PPPPPKK A      S DR  
Sbjct  1    TAATASGFFGTRIQDPRPGTARVQARFGFNFGIGKKSAPPPPPPKKPAKFTGGGSGDRLL  60

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            WFPGA  PEWLDGS++GD GFDPFGL KPAEYLQF+ D LDQNLAKN+AGD+IG   E  
Sbjct  61   WFPGATPPEWLDGSMIGDRGFDPFGLGKPAEYLQFDYDGLDQNLAKNVAGDVIGVIQEDK  120

Query  164  DVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            ++KPTPFQPY+EVFG+QRFRECELIHGRWAML TLGA++VE LTG+ WQDAGKV
Sbjct  121  EIKPTPFQPYTEVFGLQRFRECELIHGRWAMLGTLGAIAVEALTGIAWQDAGKV  174



>ref|XP_006294771.1| hypothetical protein CARUB_v10023823mg [Capsella rubella]
 gb|EOA27669.1| hypothetical protein CARUB_v10023823mg [Capsella rubella]
Length=276

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 120/162 (74%), Gaps = 2/162 (1%)
 Frame = -2

Query  488  LGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWLD  309
             G R+   + G GRV+A+ GF        P P        Q   DR  WFPGA  PEWLD
Sbjct  13   FGIRIQDPRPGTGRVQAIGGF--SFGKKKPAPPPKKSKQVQNDGDRLVWFPGANPPEWLD  70

Query  308  GSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYSE  129
            GS++GD GFDPFGL KPAEYLQ++ D LDQNLAKN+AGDIIG   +SS+++PTPFQPY+E
Sbjct  71   GSMIGDRGFDPFGLGKPAEYLQYDFDGLDQNLAKNVAGDIIGVIQDSSEIQPTPFQPYTE  130

Query  128  VFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            VFGIQRFRECELIHGRWAML TLGA++VE LTG+ WQDAGKV
Sbjct  131  VFGIQRFRECELIHGRWAMLGTLGAIAVEALTGIAWQDAGKV  172



>gb|AAM65936.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
Length=276

 Score =   206 bits (525),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 118/162 (73%), Gaps = 2/162 (1%)
 Frame = -2

Query  488  LGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWLD  309
             G R+   + G GRV+A  GF        P P        Q   DR  WFPGA  PEWLD
Sbjct  13   FGIRIQDPRPGTGRVQARFGF--SFGKKKPAPPPKKSRQVQDDGDRLVWFPGANPPEWLD  70

Query  308  GSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYSE  129
            GS++GD GFDPFGL KPAEYLQ++   LDQNLAKN+AGDIIG   ESS++KPTPFQPY+E
Sbjct  71   GSMIGDRGFDPFGLGKPAEYLQYDXXGLDQNLAKNVAGDIIGIIQESSEIKPTPFQPYTE  130

Query  128  VFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            VFGIQRFRECELIHGRWAML TLGA++VE LTG+ WQDAGKV
Sbjct  131  VFGIQRFRECELIHGRWAMLGTLGAIAVEALTGIAWQDAGKV  172



>ref|XP_006411258.1| hypothetical protein EUTSA_v10017060mg [Eutrema salsugineum]
 dbj|BAJ33709.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52711.1| hypothetical protein EUTSA_v10017060mg [Eutrema salsugineum]
Length=276

 Score =   206 bits (525),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 119/162 (73%), Gaps = 2/162 (1%)
 Frame = -2

Query  488  LGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWLD  309
             G R+   + G GRV+A  GF        P P        Q   DR  WFPGAK PEWLD
Sbjct  13   FGIRIQDPRPGTGRVQARFGF--SFGKKKPAPPPKKSRQVQDDGDRLVWFPGAKPPEWLD  70

Query  308  GSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYSE  129
            GS++GD GFDPFGL KPAEYLQ++ D LDQNLAKN+AG++IG   +SS++ PTPFQPY+E
Sbjct  71   GSMIGDRGFDPFGLGKPAEYLQYDFDGLDQNLAKNVAGEVIGIIQDSSEINPTPFQPYTE  130

Query  128  VFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            VFGIQRFRECELIHGRWAML TLGA++VE LTG+ WQDAGKV
Sbjct  131  VFGIQRFRECELIHGRWAMLGTLGAIAVEALTGIAWQDAGKV  172



>gb|KFK36898.1| hypothetical protein AALP_AA4G187000 [Arabis alpina]
Length=277

 Score =   206 bits (524),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 119/162 (73%), Gaps = 2/162 (1%)
 Frame = -2

Query  488  LGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWLD  309
             G R+   ++G GRV+A   F        P P        Q   DR  WFPGA  PEWLD
Sbjct  14   FGIRIQDPRSGTGRVQARFSF--SFGKKKPAPPPKKSRQVQDDGDRLVWFPGANPPEWLD  71

Query  308  GSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYSE  129
            GS++GD GFDPFGL KPAEYLQ++ D LDQNLAKN+AG++IG   +SS++KPTPFQPY+E
Sbjct  72   GSMIGDRGFDPFGLGKPAEYLQYDFDGLDQNLAKNVAGEVIGIIQDSSEIKPTPFQPYTE  131

Query  128  VFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            VFGIQRFRECELIHGRWAML TLGA++VE LTGV WQDAGKV
Sbjct  132  VFGIQRFRECELIHGRWAMLGTLGAIAVEALTGVAWQDAGKV  173



>gb|KHG03743.1| Chlorophyll a-b binding CP29.3, chloroplastic -like protein [Gossypium 
arboreum]
Length=282

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -2

Query  359  SDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGT  180
            SDR  WFP A APEWLDG+++GD GFDPFG AKPAEYLQF+LDSLDQNLAKN AG+IIG 
Sbjct  60   SDRLVWFPNASAPEWLDGTMIGDRGFDPFGFAKPAEYLQFDLDSLDQNLAKNEAGEIIGV  119

Query  179  RIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
              E++++KPTPFQPY+EVFG+QRFRECELIHGRWAML TLGA++VE LTGV WQDAGKV
Sbjct  120  IKETAELKPTPFQPYTEVFGLQRFRECELIHGRWAMLGTLGAIAVEALTGVAWQDAGKV  178



>emb|CDY20518.1| BnaC04g05260D [Brassica napus]
Length=276

 Score =   203 bits (517),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 116/162 (72%), Gaps = 2/162 (1%)
 Frame = -2

Query  488  LGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWLD  309
             G R+    +G GRV+A   F        P P        Q   DR  WFPGA  PEWLD
Sbjct  13   FGIRIQDPSSGAGRVQAKFNF--SFGKKKPAPPPKKTKQIQNDGDRLVWFPGANPPEWLD  70

Query  308  GSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYSE  129
            GS++GD GFDPFGL KPAEYLQ++ D LDQNLAKN+AG ++G R ES ++ PTPFQPY+E
Sbjct  71   GSMIGDRGFDPFGLGKPAEYLQYDFDGLDQNLAKNVAGGLLGVRQESKEINPTPFQPYTE  130

Query  128  VFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            VFGI+RFRECELIHGRWAML TLGAL+VE LTG+ WQDAGKV
Sbjct  131  VFGIERFRECELIHGRWAMLGTLGALAVEGLTGIAWQDAGKV  172



>gb|EMS60898.1| Chlorophyll a-b binding protein CP29.2, chloroplastic [Triticum 
urartu]
Length=206

 Score =   201 bits (510),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -2

Query  335  GAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVK  156
             + APE+LDG+LVGD GFDPFGL KPAEYLQ+++DSLDQNLA+NLAG+IIGTR E +DVK
Sbjct  2    ASSAPEYLDGTLVGDYGFDPFGLGKPAEYLQYDVDSLDQNLAQNLAGEIIGTRFEDADVK  61

Query  155  PTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
             TPFQPY+EVFG+QRFRECELIHGRWAMLATLGAL+VEWLTGVTWQDAGKV
Sbjct  62   STPFQPYAEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKV  112



>ref|XP_010508915.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic 
[Camelina sativa]
Length=303

 Score =   204 bits (518),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -2

Query  368  QVSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDI  189
            Q   DR  WFPGA  PEWLDGS++GD GFDPFGL KPAEYLQF+ D LDQNLAKN+AGD+
Sbjct  78   QDDGDRLVWFPGANPPEWLDGSMIGDRGFDPFGLGKPAEYLQFDFDELDQNLAKNVAGDV  137

Query  188  IGTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAG  9
            IG   ESS++ PTPFQPY+EVFGIQRFRECELIHGRWAML TLGAL+VE LTG+ WQDAG
Sbjct  138  IGVIRESSEINPTPFQPYTEVFGIQRFRECELIHGRWAMLGTLGALAVEGLTGIAWQDAG  197

Query  8    KV  3
            KV
Sbjct  198  KV  199



>ref|XP_001785452.1| predicted protein [Physcomitrella patens]
 ref|XP_001785457.1| predicted protein [Physcomitrella patens]
 gb|EDQ49732.1| predicted protein [Physcomitrella patens]
 gb|EDQ49737.1| predicted protein [Physcomitrella patens]
Length=296

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 122/173 (71%), Gaps = 3/173 (2%)
 Frame = -2

Query  515  AATAATPSFLGT-RLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWF  339
            +A+ A  SF+G+      +NG  RV A    G K         K+        +DRP WF
Sbjct  7    SASIAASSFVGSVECFGVKNG-ARVVARSSLGGKAKQVAKQASKTLKKSSGAGADRPLWF  65

Query  338  PGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRI-ESSD  162
            PGA+APEWLDGSL GD GFDP  L K  EYLQ ELDSL+QNLAKN AGD+IGTRI +  +
Sbjct  66   PGARAPEWLDGSLPGDYGFDPLSLGKSPEYLQIELDSLNQNLAKNEAGDVIGTRISKKEE  125

Query  161  VKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            + PTPFQPYSEVFG+QRFRECELIHGRWAMLA LGALSVE  TGVTWQDAGKV
Sbjct  126  IAPTPFQPYSEVFGLQRFRECELIHGRWAMLAILGALSVEAFTGVTWQDAGKV  178



>ref|XP_010517408.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Camelina sativa]
Length=301

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -2

Query  368  QVSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDI  189
            Q   DR  WFPGA  PEWLDGS++GD GFDPFGL KPAEYLQF+ D LDQNLAKN+AGD+
Sbjct  76   QDDGDRLVWFPGANPPEWLDGSMIGDRGFDPFGLGKPAEYLQFDFDELDQNLAKNVAGDV  135

Query  188  IGTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAG  9
            IG   ESS++K TPFQPY+EVFGIQRFRECELIHGRWAML TLGAL+VE LTG+ WQDAG
Sbjct  136  IGVIQESSEIKATPFQPYTEVFGIQRFRECELIHGRWAMLGTLGALAVEGLTGIAWQDAG  195

Query  8    KV  3
            KV
Sbjct  196  KV  197



>ref|XP_009143253.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic 
[Brassica rapa]
 emb|CDX74808.1| BnaA05g05540D [Brassica napus]
Length=276

 Score =   201 bits (512),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 116/162 (72%), Gaps = 2/162 (1%)
 Frame = -2

Query  488  LGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPEWLD  309
             G R+    +G GRV+A   F        P P        Q   DR  WFPGA  PEWLD
Sbjct  13   FGIRIQDPSSGAGRVQAKFNF--SFGKKKPAPPPKKTKQVQNDGDRLVWFPGANPPEWLD  70

Query  308  GSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYSE  129
            GS++GD GFDPFGL KPAEYLQ++ D LDQNLAKN+AG+++G R +S ++ PTPFQPY+E
Sbjct  71   GSMIGDRGFDPFGLGKPAEYLQYDFDGLDQNLAKNVAGELLGVRQDSKEINPTPFQPYTE  130

Query  128  VFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            VFGI+RFRECELIHGRWAML  LGAL+VE LTG+ WQDAGKV
Sbjct  131  VFGIERFRECELIHGRWAMLGVLGALAVEGLTGIAWQDAGKV  172



>ref|XP_008373917.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Malus domestica]
Length=286

 Score =   201 bits (512),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = -2

Query  515  AATA-ATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSS----DR  351
            AATA  T  F G++L   +   GR +A LG     +       + APP ++       +R
Sbjct  3    AATATVTSHFFGSQLRTPEPSFGRFQARLGGFGGFSFGTKKSPQPAPPKQKQKKFDDGER  62

Query  350  PTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIE  171
              WFPG + PEWLDGSL GD GFDPFGL KPAEYLQ++ D LDQNLAKN+AGDIIGTRIE
Sbjct  63   LVWFPGVEPPEWLDGSLPGDRGFDPFGLGKPAEYLQYDYDGLDQNLAKNVAGDIIGTRIE  122

Query  170  SSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            + +V PTPFQPY+EVFG+QRFRECELIHGRWAML  LGAL+VE LTGV WQDAGKV
Sbjct  123  TVEVNPTPFQPYTEVFGLQRFRECELIHGRWAMLGALGALAVEGLTGVAWQDAGKV  178



>ref|XP_009345742.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Pyrus x bretschneideri]
Length=302

 Score =   201 bits (512),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            +R  WFPG + PEWLDGSL GD GFDPFGL KPAEYLQF+ D LDQNLAKN+AGDIIGTR
Sbjct  80   ERLVWFPGVEPPEWLDGSLPGDRGFDPFGLGKPAEYLQFDYDGLDQNLAKNVAGDIIGTR  139

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            IE+ +V PTPFQPY+EVFG+QRFRECELIHGRWAML  LGAL+VE LTGV WQDAGKV
Sbjct  140  IETVEVNPTPFQPYTEVFGLQRFRECELIHGRWAMLGALGALAVEGLTGVAWQDAGKV  197



>ref|XP_010505716.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Camelina sativa]
Length=301

 Score =   201 bits (511),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -2

Query  368  QVSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDI  189
            Q   DR  WFPGA  PEWLDGS++GD GFDPFGL KPAEYLQF+ D LDQNLAKN+AGD+
Sbjct  76   QDDGDRLVWFPGANPPEWLDGSMIGDRGFDPFGLGKPAEYLQFDFDELDQNLAKNVAGDV  135

Query  188  IGTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAG  9
            IG   ESS++K TPFQPY+EVFGIQRFRECELIHGRWAML  LGAL+VE LTG+ WQDAG
Sbjct  136  IGVIQESSEIKATPFQPYTEVFGIQRFRECELIHGRWAMLGVLGALAVEGLTGIAWQDAG  195

Query  8    KV  3
            KV
Sbjct  196  KV  197



>ref|XP_001772786.1| predicted protein [Physcomitrella patens]
 ref|XP_001772821.1| predicted protein [Physcomitrella patens]
 gb|EDQ62353.1| predicted protein [Physcomitrella patens]
 gb|EDQ62388.1| predicted protein [Physcomitrella patens]
Length=296

 Score =   196 bits (499),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 101/118 (86%), Gaps = 1/118 (1%)
 Frame = -2

Query  353  RPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRI  174
            RP WFPGA+APEWLDGSL GD GFDP  L K  EYLQ ELDSL+QNLAKN AGD+IGTRI
Sbjct  61   RPLWFPGAQAPEWLDGSLPGDYGFDPLSLGKSPEYLQIELDSLNQNLAKNEAGDVIGTRI  120

Query  173  -ESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
             +  ++ PTPFQPYSEVFG+QRFRECELIHGRWAMLA LGALSVE  TGVTWQDAGKV
Sbjct  121  SKKEEIAPTPFQPYSEVFGLQRFRECELIHGRWAMLAILGALSVEAFTGVTWQDAGKV  178



>ref|XP_006435720.1| hypothetical protein CICLE_v10032377mg [Citrus clementina]
 ref|XP_006486329.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic 
[Citrus sinensis]
 gb|ESR48960.1| hypothetical protein CICLE_v10032377mg [Citrus clementina]
Length=274

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -2

Query  359  SDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGT  180
            SDR  WFPGA  PEWLDG++VGD GFDP GL KP EYLQ++ DSLDQNLAKN  G+++G 
Sbjct  52   SDRLVWFPGATPPEWLDGTMVGDRGFDPLGLGKPTEYLQYDFDSLDQNLAKNDVGELLGV  111

Query  179  RIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
              +S +++PTP QPY+EVFG+QRFRECELIHGRWAML TLGA++VE LTGV WQDAGKV
Sbjct  112  ITDSGELQPTPLQPYTEVFGLQRFRECELIHGRWAMLGTLGAIAVEALTGVAWQDAGKV  170



>ref|XP_002985629.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ13207.1| light-harvesting complex [Selaginella moellendorffii]
Length=299

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = -2

Query  359  SDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGT  180
            ++RP WFPGAK P++LDGSLVGD GFDP GL KP  YLQF++DSLD +LAKN+ G+++G 
Sbjct  62   ANRPLWFPGAKCPDYLDGSLVGDYGFDPLGLGKPPTYLQFDVDSLDSSLAKNMPGELLGE  121

Query  179  RIES-SDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            R+E  S ++ TP QPY+E+FG+QRFRECELIHGRWAMLATLGA++VE  TGVTWQDAGKV
Sbjct  122  RVEDLSTIRATPLQPYTEIFGLQRFRECELIHGRWAMLATLGAIAVETFTGVTWQDAGKV  181



>ref|XP_002974259.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ24481.1| light-harvesting complex [Selaginella moellendorffii]
Length=299

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = -2

Query  359  SDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGT  180
            ++RP WFPGAK P++LDGSLVGD GFDP GL KP  YLQF++DSLD +LAKN+ G+++G 
Sbjct  62   ANRPLWFPGAKCPDYLDGSLVGDYGFDPLGLGKPPTYLQFDVDSLDSSLAKNMPGELLGE  121

Query  179  RIES-SDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            R+E  S ++ TP QPY+E+FG+QRFRECELIHGRWAMLATLGA++VE  TGVTWQDAGKV
Sbjct  122  RVEDLSTIRATPLQPYTEIFGLQRFRECELIHGRWAMLATLGAIAVETFTGVTWQDAGKV  181



>gb|ABK26282.1| unknown [Picea sitchensis]
Length=288

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 97/117 (83%), Gaps = 1/117 (1%)
 Frame = -2

Query  353  RPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRI  174
            RP W PGAKAPEWLDGSLVGD GFDP GL KP+EYLQ+++DSLDQNL  NL GD++G  +
Sbjct  66   RPLWLPGAKAPEWLDGSLVGDYGFDPLGLGKPSEYLQYDVDSLDQNLDLNLPGDLLGDFV  125

Query  173  ESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
               D+KP+  QPYSEVFG+QRFRECELIHGRWAML  LGAL+VE  TG+ WQDAGKV
Sbjct  126  GDPDIKPS-IQPYSEVFGLQRFRECELIHGRWAMLGVLGALAVEGFTGIYWQDAGKV  181



>gb|ABK25779.1| unknown [Picea sitchensis]
Length=288

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 97/117 (83%), Gaps = 1/117 (1%)
 Frame = -2

Query  353  RPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRI  174
            RP W PGAKAPEWLDGSLVGD GFDP GL KP+EYLQ+++DSLDQNL  NL GD++G  +
Sbjct  66   RPLWLPGAKAPEWLDGSLVGDYGFDPLGLGKPSEYLQYDVDSLDQNLDLNLPGDLLGDFV  125

Query  173  ESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
               D+KP+  QPYSEVFG+QRFRECELIHGRWAML  LGAL+VE  TG+ WQDAGKV
Sbjct  126  GDPDIKPS-IQPYSEVFGLQRFRECELIHGRWAMLGVLGALAVEGFTGIYWQDAGKV  181



>gb|ABK21281.1| unknown [Picea sitchensis]
 gb|ABK21880.1| unknown [Picea sitchensis]
 gb|ABK23915.1| unknown [Picea sitchensis]
 gb|ABK26276.1| unknown [Picea sitchensis]
 gb|ACN39760.1| unknown [Picea sitchensis]
 gb|ACN40276.1| unknown [Picea sitchensis]
Length=288

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 97/117 (83%), Gaps = 1/117 (1%)
 Frame = -2

Query  353  RPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRI  174
            RP W PGAKAPEWLDGSLVGD GFDP GL KP+EYLQ+++DSLDQNL  NL GD++G  +
Sbjct  66   RPLWLPGAKAPEWLDGSLVGDYGFDPLGLGKPSEYLQYDVDSLDQNLDLNLPGDLLGDFV  125

Query  173  ESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
               D+KP+  QPYSEVFG+QRFRECELIHGRWAML  LGAL+VE  TG+ WQDAGKV
Sbjct  126  GDPDIKPS-IQPYSEVFGLQRFRECELIHGRWAMLGVLGALAVEGFTGIYWQDAGKV  181



>gb|KHN34729.1| Chlorophyll a-b binding protein CP29.3, chloroplastic, partial 
[Glycine soja]
Length=200

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = -2

Query  287  GFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYSEVFGIQRF  108
            GFDPFG AKPAEYLQF+LDSLDQNLAKN+AGD+IGTR+E ++VKPTPFQPYSEVFGIQRF
Sbjct  1    GFDPFGFAKPAEYLQFDLDSLDQNLAKNIAGDVIGTRVEVAEVKPTPFQPYSEVFGIQRF  60

Query  107  RECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            RECELIHGRWAML +LGAL+VE LTGV WQDAGKV
Sbjct  61   RECELIHGRWAMLGSLGALAVEALTGVAWQDAGKV  95



>gb|EAZ40279.1| hypothetical protein OsJ_24721 [Oryza sativa Japonica Group]
Length=267

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 92/120 (77%), Gaps = 23/120 (19%)
 Frame = -2

Query  362  SSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIG  183
            ++DRP WFPGA                       PAEYLQFELDSLDQNLAKN AG+IIG
Sbjct  51   TTDRPLWFPGA-----------------------PAEYLQFELDSLDQNLAKNNAGEIIG  87

Query  182  TRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            TR E+ +VK TPFQPY+EVFG+QRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV
Sbjct  88   TRFETGEVKSTPFQPYTEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  147



>ref|XP_009369266.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Pyrus x bretschneideri]
Length=246

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = -2

Query  329  KAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPT  150
            K P WLDGSL  D GFDPFGL KPAEYLQF+ D LDQNLAKN+AGDIIGTR E++ V PT
Sbjct  33   KRPWWLDGSLPWDRGFDPFGLGKPAEYLQFDYDGLDQNLAKNVAGDIIGTRTETAKVNPT  92

Query  149  PFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            P QP++EVFG+ RFRECELI GRWAML  LGAL+VE LTGV WQ  GKV
Sbjct  93   PLQPHTEVFGLLRFRECELIQGRWAMLGALGALAVEGLTGVAWQRKGKV  141



>ref|XP_008373481.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Malus domestica]
Length=120

 Score =   157 bits (397),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = -2

Query  341  FPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSD  162
            +PGA APEWLD +LVGD GFDPFGL KP EYLQ++ D LDQNLAKNLAGDIIGTR E+ D
Sbjct  23   YPGANAPEWLDRTLVGDYGFDPFGLGKPVEYLQYDYDGLDQNLAKNLAGDIIGTRTETPD  82

Query  161  VKPTPFQPYSEVFGIQRFRECELIHGRWAMLATL  60
            V+ T FQPY+EVFG+Q+F+ECELIH RWAMLATL
Sbjct  83   VQSTLFQPYTEVFGLQKFKECELIHRRWAMLATL  116



>gb|KDO69014.1| hypothetical protein CISIN_1g028743mg [Citrus sinensis]
Length=204

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -2

Query  302  LVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYSEVF  123
            +VGD GFDP GL KP EYLQ++ DSLDQNLAKN  G+++G   +S +++PTP QPY+EVF
Sbjct  1    MVGDRGFDPLGLGKPTEYLQYDFDSLDQNLAKNDVGELLGVITDSGELQPTPLQPYTEVF  60

Query  122  GIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            G+QRFRECELIHGRWAML TLGA++VE LTGV WQDAGKV
Sbjct  61   GLQRFRECELIHGRWAMLGTLGAIAVEALTGVAWQDAGKV  100



>gb|AAP79139.1| chlorophyll a/b-binding protein CP29 [Bigelowiella natans]
Length=291

 Score =   149 bits (376),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 86/122 (70%), Gaps = 2/122 (2%)
 Frame = -2

Query  362  SSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIG  183
            +++ P W P  + P WLDGSL GD GFDP GL+KPAEYLQF++D LDQN A N AG +IG
Sbjct  67   NNEDPLWLPNTERPGWLDGSLPGDRGFDPLGLSKPAEYLQFDVDQLDQNAAVNRAGRVIG  126

Query  182  TRIESSDVKPT--PFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAG  9
                  D   T     PYS++FG++RFRECELIHGRWAMLATLGA+  E  TGV W  AG
Sbjct  127  QYDGGIDEVNTENSLSPYSDIFGLRRFRECELIHGRWAMLATLGAIVAELSTGVPWDQAG  186

Query  8    KV  3
            KV
Sbjct  187  KV  188



>gb|KFM27428.1| Chlorophyll a-b binding protein CP29 [Auxenochlorella protothecoides]
Length=320

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = -2

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            W P    PEWLDGSL GD GFDP GL+KP  Y+Q +LD+LDQN A N AG ++G+   ++
Sbjct  98   WLPNTPRPEWLDGSLPGDRGFDPLGLSKPTSYIQMDLDALDQNSAVNKAGGVVGSFASNA  157

Query  164  D-VKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            D V P    PYSEVFG+ RFRE E+IHGRWAMLATLG +  E  TGV WQDAGKV
Sbjct  158  DEVSPDALAPYSEVFGLARFRENEVIHGRWAMLATLGVIVAEASTGVAWQDAGKV  212



>ref|XP_007508675.1| unknown [Bathycoccus prasinos]
 emb|CCO20292.1| unknown [Bathycoccus prasinos]
Length=277

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -2

Query  362  SSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIG  183
            S +R  W+P A+AP WLDGS+ GD GFDPFGL+KP EYLQF+LD LD + AKN +G++IG
Sbjct  50   SGERDLWYPNAEAPAWLDGSMPGDRGFDPFGLSKPTEYLQFDLDRLDGSAAKNPSGNVIG  109

Query  182  TRIESSDVKPTP--FQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAG  9
             +++ +D KPT     P++E F I RFRECEL+H RWAML  +G +  E  TGV WQDAG
Sbjct  110  -KLKKTDNKPTERTIVPFNEAFDINRFRECELLHSRWAMLGLVGVIFGEAGTGVAWQDAG  168

Query  8    KV  3
            KV
Sbjct  169  KV  170



>gb|ACF24530.1| chlorophyll a/b binding protein CP29 [Gymnochlora stellata]
Length=290

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 84/119 (71%), Gaps = 4/119 (3%)
 Frame = -2

Query  350  PTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGT---  180
            P W P    P WLDGSL GD GFDP GL+KPAEYLQ+++D LDQN A N AG +IG    
Sbjct  70   PLWLPNTVRPTWLDGSLPGDRGFDPLGLSKPAEYLQYDVDQLDQNQAVNFAGKVIGKFDG  129

Query  179  RIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
             I+  D   T   PYS++FG++RFRECELIHGRWAMLATLGA+  E  TGV W  AGKV
Sbjct  130  GIDEVDGGNT-LSPYSDIFGLRRFRECELIHGRWAMLATLGAVVAELSTGVPWDQAGKV  187



>tpg|DAA05897.1| TPA_inf: chloroplast light-harvesting protein CP29 precursor 
Lhcb4 [Acetabularia acetabulum]
Length=275

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 82/116 (71%), Gaps = 2/116 (2%)
 Frame = -2

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            W P    P WLDGSL GD GFDP GLAKP EYLQ ELD  + N+  N AG IIG+  ES+
Sbjct  53   WLPNTTRPVWLDGSLPGDRGFDPLGLAKPTEYLQVELDEQNINMGVNKAGGIIGSYQESA  112

Query  164  DVKPTP--FQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            ++  +    QPY EVFG++RFRECELIHGRWAMLA LG +  E  TGV+W +AGKV
Sbjct  113  ELVSSEKRLQPYKEVFGLERFRECELIHGRWAMLACLGCIVAEGATGVSWVEAGKV  168



>ref|XP_003083704.1| CP29-like light-harvesting chlorophyll a/b binding protein chlor 
(IC) [Ostreococcus tauri]
 gb|AAY27543.1| chloroplast chlorophyll a/b-binding protein CP29 precursor Lhcb4 
[Ostreococcus tauri]
Length=257

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 87/122 (71%), Gaps = 3/122 (2%)
 Frame = -2

Query  362  SSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIG  183
            + D   W PGA  P WLDGSL GD GFDPFGL KPAEYLQF+LD+LD + A+N +G++IG
Sbjct  37   AGDECLWRPGAVRPAWLDGSLPGDRGFDPFGLGKPAEYLQFDLDALDGSAARNPSGNVIG  96

Query  182  TRIESSDVKPTP--FQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAG  9
             +++ +D KP      PY E F I RFRECEL+H RWAML  +GA + E  TG+TW DAG
Sbjct  97   -KLKKADSKPKARTIVPYDEAFDIMRFRECELLHSRWAMLGLVGAAAAEAATGITWADAG  155

Query  8    KV  3
            K+
Sbjct  156  KI  157



>emb|CEG00441.1| Chlorophyll A-B binding protein, plant [Ostreococcus tauri]
Length=257

 Score =   140 bits (352),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 87/122 (71%), Gaps = 3/122 (2%)
 Frame = -2

Query  362  SSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIG  183
            + D   W PGA  P WLDGSL GD GFDPFGL KPAEYLQF+LD+LD + A+N +G++IG
Sbjct  37   AGDDELWRPGAVRPAWLDGSLPGDRGFDPFGLGKPAEYLQFDLDALDGSAARNPSGNVIG  96

Query  182  TRIESSDVKPTP--FQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAG  9
             +++ +D KP      PY E F I RFRECEL+H RWAML  +GA + E  TG+TW DAG
Sbjct  97   -KLKKADSKPKARTIVPYDEAFDIMRFRECELLHSRWAMLGLVGAAAAEAATGITWADAG  155

Query  8    KV  3
            K+
Sbjct  156  KI  157



>ref|XP_005646238.1| hypothetical protein COCSUDRAFT_67011 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21694.1| hypothetical protein COCSUDRAFT_67011 [Coccomyxa subellipsoidea 
C-169]
Length=316

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 77/115 (67%), Gaps = 1/115 (1%)
 Frame = -2

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGT-RIES  168
            W P  + P WLDGSL GD GFDP GL+ P +YLQ  +D LDQN A N AG I+G      
Sbjct  81   WLPNTERPAWLDGSLPGDRGFDPLGLSSPQDYLQVGIDQLDQNKAVNKAGAIVGKFAAPK  140

Query  167  SDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            + +  T  QPY EVFG+QRFRE ELIHGRWAML  LG L  E  TGV+W DAGKV
Sbjct  141  TKISDTALQPYDEVFGLQRFRETELIHGRWAMLGALGVLVAEASTGVSWVDAGKV  195



>gb|ABD37890.1| light-harvesting chlorophyll-a/b binding protein Lhcb4 [Mesostigma 
viride]
 tpg|DAA05922.1| TPA_inf: chloroplast light-harvesting complex protein CP29 precursor 
Lhcb4 [Mesostigma viride]
Length=306

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 84/123 (68%), Gaps = 1/123 (1%)
 Frame = -2

Query  368  QVSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDI  189
            Q   DRP + PG   P +LDGS++GD G+D  GLA P E+LQ+++D  D N A +  G+I
Sbjct  71   QSGPDRPKFLPGITPPAYLDGSMIGDYGYDILGLAAPKEFLQYDVDGNDINAAVSAPGEI  130

Query  188  IGT-RIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDA  12
            IGT +    +V  TPFQPY+EVF I+RFRE ELI+GRWAML   GAL+ E  TG+ W D 
Sbjct  131  IGTIKKTGPEVDATPFQPYAEVFSIERFRETELINGRWAMLGVAGALAGEMQTGINWVDI  190

Query  11   GKV  3
            GKV
Sbjct  191  GKV  193



>ref|XP_005845614.1| hypothetical protein CHLNCDRAFT_56266 [Chlorella variabilis]
 gb|EFN53512.1| hypothetical protein CHLNCDRAFT_56266 [Chlorella variabilis]
Length=276

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = -2

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            W P    P WLDGSL GD GFDP GL+KP EYLQ +LD L+QN A N AG ++G+     
Sbjct  56   WLPNTSRPAWLDGSLPGDRGFDPLGLSKPVEYLQVDLDQLEQNNAVNKAGSVVGSFTPVI  115

Query  164  D-VKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTW  21
            D V   P  PYSEVFG+QRFRE ELIHGRWAMLA LGAL  E +TG +W
Sbjct  116  DEVSAVPLAPYSEVFGLQRFRENELIHGRWAMLACLGALVQEGVTGDSW  164



>ref|XP_005646225.1| chlorophyll a/b-binding protein CP29 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21681.1| chlorophyll a/b-binding protein CP29 [Coccomyxa subellipsoidea 
C-169]
Length=267

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 80/116 (69%), Gaps = 3/116 (3%)
 Frame = -2

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            W P  + P WLDGSL GD GFDP  L+KP+E+LQ +LD  D N + N AG I+G +  SS
Sbjct  54   WLPNTQRPAWLDGSLPGDRGFDPLELSKPSEFLQVDLDQSDINKSVNKAGGIVG-KYSSS  112

Query  164  DVKPT--PFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
             V+ T     PYSEVFG+QRFRE ELIHGRWAML  LG +  E  TGV+W DAGKV
Sbjct  113  KVQATGAALSPYSEVFGLQRFRETELIHGRWAMLGALGVVIAEATTGVSWVDAGKV  168



>ref|XP_002951424.1| chlorophyll a/b-binding protein of photosystem II [Volvox carteri 
f. nagariensis]
 gb|EFJ47600.1| chlorophyll a/b-binding protein of photosystem II [Volvox carteri 
f. nagariensis]
Length=317

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 75/116 (65%), Gaps = 2/116 (2%)
 Frame = -2

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            W P    PEWLDGSL GD GFDP GLAKP+E++   +D  DQN AKN  G +      + 
Sbjct  90   WLPNTVRPEWLDGSLPGDRGFDPLGLAKPSEFVVIGVDENDQNAAKNNKGSVEAVVTATP  149

Query  164  D--VKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            D         PYSEVFG+ RFRECELIHGRWAMLA LG L  E  TGV+W DAGKV
Sbjct  150  DEVSAENRLAPYSEVFGLARFRECELIHGRWAMLACLGCLVAEATTGVSWVDAGKV  205



>ref|XP_001697193.1| chlorophyll a-b binding protein of photosystem II [Chlamydomonas 
reinhardtii]
 sp|Q93WD2.3|CB29_CHLRE RecName: Full=Chlorophyll a-b binding protein CP29; AltName: 
Full=Lhcbm4 [Chlamydomonas reinhardtii]
 dbj|BAB64415.1| light-harvesting chlorophyll-a/b binding protein Lhcb4 [Chlamydomonas 
reinhardtii]
 dbj|BAB64419.1| light-harvesting chlorophyll-a/b binding protein Lhcb4 [Chlamydomonas 
reinhardtii]
 gb|AAO16494.1| CP29-like protein [Chlamydomonas reinhardtii]
 gb|EDP00448.1| chlorophyll a-b binding protein of photosystem II [Chlamydomonas 
reinhardtii]
Length=280

 Score =   133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 76/116 (66%), Gaps = 2/116 (2%)
 Frame = -2

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            W P    PEWLDGSL GD GFDP GL+KP+E++   +D  DQN AKN  G +      + 
Sbjct  53   WLPNTTRPEWLDGSLPGDRGFDPLGLSKPSEFVVIGVDENDQNAAKNNKGSVEAIVQATP  112

Query  164  D--VKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            D         PYSEVFG+ RFRECELIHGRWAMLA LGAL  E  TGV+W +AGKV
Sbjct  113  DEVSSENRLAPYSEVFGLARFRECELIHGRWAMLACLGALVAEATTGVSWVEAGKV  168



>gb|ABD37915.1| light-harvesting chlorophyll-a/b binding protein Lhcb4 [Chlamydomonas 
incerta]
Length=259

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 76/116 (66%), Gaps = 2/116 (2%)
 Frame = -2

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            W P    PEWLDGSL GD GFDP GL+KP+E++   +D  DQN+ KN  G +      S 
Sbjct  59   WLPNTARPEWLDGSLPGDRGFDPLGLSKPSEFVVIGVDENDQNVGKNNKGTVEAIVQASP  118

Query  164  D--VKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            D         PYSEVFG+ RFRECELIHGRWAMLA LGAL  E  TGV+W +AGKV
Sbjct  119  DEVSSENRLAPYSEVFGLARFRECELIHGRWAMLACLGALVAEATTGVSWVEAGKV  174



>ref|XP_003063531.1| chlorophyll a/b-binding protein CP29, chloroplast precursor [Micromonas 
pusilla CCMP1545]
 gb|EEH52667.1| chlorophyll a/b-binding protein CP29, chloroplast precursor [Micromonas 
pusilla CCMP1545]
Length=274

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 83/116 (72%), Gaps = 3/116 (3%)
 Frame = -2

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            W    + P +LDG+L GD GFDPFGL+KP EYLQF+LD+L+Q+ A N +G++IG +++  
Sbjct  56   WESNPEPPAYLDGTLPGDAGFDPFGLSKPVEYLQFDLDALNQSAAINPSGNVIG-KLKKV  114

Query  164  DVKPT--PFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            D KPT     P++E F I RFRECEL H RWAML  +GA+  E  TG++W DAGKV
Sbjct  115  DNKPTERTIVPFNEAFDIVRFRECELQHSRWAMLGLVGAVVAESETGISWVDAGKV  170



>tpg|DAA05880.1| TPA_inf: chloroplast light-harvesting protein CP29 precursor 
Lhcb4 [Euglena gracilis]
Length=263

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 79/118 (67%), Gaps = 1/118 (1%)
 Frame = -2

Query  353  RPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRI  174
            RP WFP A AP++LDGSL GD GFDP+G AKP E LQ+   + D  L+KN   + +G   
Sbjct  37   RPLWFPSAVAPDYLDGSLPGDRGFDPWGFAKPEELLQYTTGTADITLSKNKDEEYVGKVK  96

Query  173  ESSDV-KPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            E  DV    P  P+S  FG++R RECELIHGRWAML  LGAL  E +TGV WQ+AG V
Sbjct  97   EERDVLTGEPLVPWSSAFGLKRLRECELIHGRWAMLFVLGALVGEAVTGVAWQNAGLV  154



>ref|XP_002506291.1| chlorophyll a/b-binding protein CP29, chloroplast precursor [Micromonas 
sp. RCC299]
 gb|ACO67549.1| chlorophyll a/b-binding protein CP29, chloroplast precursor [Micromonas 
sp. RCC299]
Length=271

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 81/116 (70%), Gaps = 3/116 (3%)
 Frame = -2

Query  344  WFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESS  165
            W    + P +LDG+L GD GFDPFGL+ P EYLQFELDSL+ + A N +G++IG +++  
Sbjct  52   WEANPEPPAYLDGTLPGDAGFDPFGLSAPTEYLQFELDSLNGSAAVNKSGNVIG-KLKKV  110

Query  164  DVKPT--PFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            D KPT     P++E F I RFRECEL H RWAML  LGA+  E  TG++W DAGKV
Sbjct  111  DNKPTERTIVPFNEAFDIVRFRECELQHSRWAMLGLLGAVVAEGQTGISWVDAGKV  166



>gb|ACN40533.1| unknown [Picea sitchensis]
Length=249

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  257  AEYLQFELDSLDQNLAKNLAGDIIGTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRW  78
            +EYLQ+++DSLDQNL  NL GD++G  +   D+KP+  QPYSEVFG+QRFRECELIHGRW
Sbjct  59   SEYLQYDVDSLDQNLDLNLPGDLLGDFVGDPDIKPS-IQPYSEVFGLQRFRECELIHGRW  117

Query  77   AMLATLGALSVEWLTGVTWQDAGKV  3
            AML  LGAL+VE  TG+ WQDAGKV
Sbjct  118  AMLGVLGALAVEGFTGIYWQDAGKV  142



>ref|XP_001421643.1| possibly CP29, chlorophyll a/b binding [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO99936.1| possibly CP29, chlorophyll a/b binding [Ostreococcus lucimarinus 
CCE9901]
Length=260

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 84/122 (69%), Gaps = 3/122 (2%)
 Frame = -2

Query  362  SSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIG  183
            + D   W PGA  P WLDGSL GD GFDPF L+KP EY+QF+LD+LD + A N AG +IG
Sbjct  42   AGDDELWRPGAVRPAWLDGSLPGDRGFDPFNLSKPIEYVQFDLDALDGSAATNPAGRVIG  101

Query  182  TRIESSDVKPT--PFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAG  9
             +++ +D KP      PY E F I RFRECEL+H RWAML  +GA + E  TG++W DAG
Sbjct  102  -KLKKTDNKPKARAIVPYDESFDIMRFRECELLHSRWAMLGLVGATAAEAATGISWADAG  160

Query  8    KV  3
            KV
Sbjct  161  KV  162



>emb|CBL86548.1| chlorophyll a/b binding protein [Olea europaea]
Length=179

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  173  ESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            E++DVK TPFQPYSEVFG+QRFRECELIHGRW MLATLGAL+VEWLTGVTWQDAGKV
Sbjct  3    EAADVKSTPFQPYSEVFGLQRFRECELIHGRWGMLATLGALTVEWLTGVTWQDAGKV  59



>gb|KCW65678.1| hypothetical protein EUGRSUZ_G03060 [Eucalyptus grandis]
Length=219

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = -2

Query  512  ATAATPSFLGTRLPKTQNGMGRVRA-LLGFGRkkaapppppkksapppKQVSSDRPTWFP  336
            A A++  F GTR+   +  +GR +A     G+K            P P+++  +R  WFP
Sbjct  2    AAASSSYFFGTRIADPKPSLGRFQARFGFGGKKFGFGGKKSPPPKPAPRKLDGERLVWFP  61

Query  335  GAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIE  171
            GA+ PEWLDG++VGD GFDPFGL KPAEYLQF+LDSLDQNLAKNLAGD+IG R+E
Sbjct  62   GAEPPEWLDGTMVGDRGFDPFGLGKPAEYLQFDLDSLDQNLAKNLAGDVIGVRVE  116



>gb|AFD62761.1| LHCB, partial [Citrus sinensis]
Length=169

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  GDIIGTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQ  18
            G+++G   +S +++PTP QPY+EVFG+QRFRECELIHGRWAML TLGA++VE LTGV WQ
Sbjct  1    GELLGVITDSGELQPTPLQPYTEVFGLQRFRECELIHGRWAMLGTLGAIAVEALTGVAWQ  60

Query  17   DAGKV  3
            DAGKV
Sbjct  61   DAGKV  65



>dbj|BAJ89825.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=102

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 71/99 (72%), Gaps = 11/99 (11%)
 Frame = -2

Query  494  SFLGTRL--PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAP  321
            +FLGTRL  P  QNG  R+ A  GFG+KKA P              ++DRP WFPGA+AP
Sbjct  11   TFLGTRLADPAPQNG--RIVARFGFGKKKAPPKKAKA-------PPTTDRPLWFPGAQAP  61

Query  320  EWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKN  204
            E+LDG+LVGD GFDPFGL KPAEYLQ+++DSLDQNLA+ 
Sbjct  62   EYLDGTLVGDYGFDPFGLGKPAEYLQYDVDSLDQNLAQK  100



>emb|CDY61708.1| BnaC04g56710D [Brassica napus]
Length=350

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  182  TRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKV  3
            +R +S +++PTPFQPY+EVFGIQRFRECELIHGRWAML TLGA++VE LTG+ WQDAGKV
Sbjct  47   SRQDSWEIQPTPFQPYTEVFGIQRFRECELIHGRWAMLGTLGAIAVEGLTGIAWQDAGKV  106



>emb|CAA71758.1| hypothetical protein [Sporobolus stapfianus]
Length=99

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 68/95 (72%), Gaps = 9/95 (9%)
 Frame = -2

Query  491  FLGTRL--PKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFPGAKAPE  318
            FLGTRL  P  QNG  R+ A   FG+K AA   P K++       +SDRP WFPGAKAP+
Sbjct  12   FLGTRLADPAPQNG--RIVARFPFGKKPAAQKKPAKQNTN-----NSDRPLWFPGAKAPD  64

Query  317  WLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNL  213
            +LDG+ VGD GFDP+GL KP EYLQF+LDSLDQNL
Sbjct  65   YLDGTYVGDYGFDPWGLGKPVEYLQFDLDSLDQNL  99



>gb|ACN34741.1| unknown [Zea mays]
 gb|ACN35825.1| unknown [Zea mays]
Length=292

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    NLSGVLPSNAGEPLDRQGTESSQHGPPAMNELTFPEPLDPEHLTVRLKRSRFNVGALYPG  182
            +L+GVLP +AGEPLD +G E  +HGP A++EL   EPL+ EHL V L+R   + G L PG
Sbjct  125  HLAGVLPGDAGEPLDGEGAEGGEHGPAAVDELALAEPLEAEHLAVGLQRGGLDFGGLEPG  184

Query  183  PDDVSGqilgqvlvqrvqlklqvlSGLCQPERVEPNVTHQTSVQPFRSLRSREPRRPV  356
             DD +G ILGQVLVQRVQL+LQVL GL + ERVEP V  Q +VQ      + EP+RPV
Sbjct  185  ADDAAGLILGQVLVQRVQLELQVLHGLPETERVEPVVADQRAVQVVGRHGAGEPQRPV  242



>gb|ABK21651.1| unknown [Picea sitchensis]
Length=150

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  359  SDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAK  207
            + RP W PGAKAPEWLDGSLVGD GFDP GL KP+EYLQ+E+      LA+
Sbjct  64   TGRPLWLPGAKAPEWLDGSLVGDYGFDPLGLGKPSEYLQYEIKKDRLKLAE  114



>emb|CDY05360.1| BnaC02g40680D [Brassica napus]
Length=100

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  320  EWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAG  195
            EWLDGSLVGD  FDPFGL KPAEYLQF++DSLDQNLAKN  G
Sbjct  18   EWLDGSLVGDYVFDPFGLGKPAEYLQFDVDSLDQNLAKNPYG  59



>ref|XP_006474704.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
isoform X3 [Citrus sinensis]
Length=265

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 51/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  P WLDGSL GD GFDP GL    E L++                     
Sbjct  59   DRPLWFPGSTPPSWLDGSLPGDYGFDPLGLGSDPELLKW---------------------  97

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                  F + ELIHGRWAMLA  G L  EWL  +      +W D
Sbjct  98   ----------------------FAQAELIHGRWAMLAVAGILIPEWLESIGLIENFSWYD  135

Query  14   AGK  6
            AG 
Sbjct  136  AGS  138



>ref|XP_006452839.1| hypothetical protein CICLE_v10009205mg [Citrus clementina]
 gb|ESR66079.1| hypothetical protein CICLE_v10009205mg [Citrus clementina]
Length=265

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 51/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  P WLDGSL GD GFDP GL    E L++                     
Sbjct  59   DRPLWFPGSTPPSWLDGSLPGDYGFDPLGLGSDPELLKW---------------------  97

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                  F + ELIHGRWAMLA  G L  EWL  +      +W D
Sbjct  98   ----------------------FAQAELIHGRWAMLAVAGILIPEWLESIGLIENFSWYD  135

Query  14   AGK  6
            AG 
Sbjct  136  AGS  138



>ref|XP_006452840.1| hypothetical protein CICLE_v10009205mg [Citrus clementina]
 gb|ESR66080.1| hypothetical protein CICLE_v10009205mg [Citrus clementina]
Length=264

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 51/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  P WLDGSL GD GFDP GL    E L++                     
Sbjct  58   DRPLWFPGSTPPSWLDGSLPGDYGFDPLGLGSDPELLKW---------------------  96

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                  F + ELIHGRWAMLA  G L  EWL  +      +W D
Sbjct  97   ----------------------FAQAELIHGRWAMLAVAGILIPEWLESIGLIENFSWYD  134

Query  14   AGK  6
            AG 
Sbjct  135  AGS  137



>ref|XP_006345258.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Solanum tuberosum]
Length=260

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 52/123 (42%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  54   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW---------------------  92

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                  F + ELIH RWAMLA  G L  EWL  +      +W D
Sbjct  93   ----------------------FAQAELIHSRWAMLAVAGILIPEWLESLGFIDNFSWYD  130

Query  14   AGK  6
            AG+
Sbjct  131  AGE  133



>ref|XP_004251698.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Solanum 
lycopersicum]
Length=260

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 52/123 (42%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  54   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPESLKW---------------------  92

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                  F + ELIH RWAMLA  G L  EWL  +      +W D
Sbjct  93   ----------------------FAQAELIHSRWAMLAVSGILIPEWLESLGFIDNFSWYD  130

Query  14   AGK  6
            AG+
Sbjct  131  AGE  133



>gb|ABK96605.1| unknown [Populus trichocarpa x Populus deltoides]
Length=261

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 50/122 (41%), Gaps = 49/122 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  55   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPESLKW---------------------  93

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLT------GVTWQD  15
                                  F + ELIHGRWAMLA  G L  EWL          W D
Sbjct  94   ----------------------FAQAELIHGRWAMLAAAGILIPEWLERLGFIDNFNWFD  131

Query  14   AG  9
            AG
Sbjct  132  AG  133



>ref|XP_011039957.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Populus 
euphratica]
Length=261

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 51/125 (41%), Gaps = 49/125 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  52   LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW------------------  93

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLT------GVT  24
                                     F + ELIHGRWAMLA  G L  EWL          
Sbjct  94   -------------------------FAQAELIHGRWAMLAAAGILIPEWLERLGFIDNFN  128

Query  23   WQDAG  9
            W DAG
Sbjct  129  WFDAG  133



>ref|XP_006381597.1| chlorophyll A-B binding family protein [Populus trichocarpa]
 gb|ERP59394.1| chlorophyll A-B binding family protein [Populus trichocarpa]
Length=261

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 50/122 (41%), Gaps = 49/122 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  55   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPESLKW---------------------  93

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLT------GVTWQD  15
                                  F + ELIHGRWAMLA  G L  EWL          W D
Sbjct  94   ----------------------FAQAELIHGRWAMLAAAGILIPEWLERLGFIDNFNWFD  131

Query  14   AG  9
            AG
Sbjct  132  AG  133



>ref|XP_010099098.1| Chlorophyll a-b binding protein [Morus notabilis]
 gb|EXB76746.1| Chlorophyll a-b binding protein [Morus notabilis]
Length=294

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 68/176 (39%), Gaps = 56/176 (32%)
 Frame = -2

Query  512  ATAATPSFLGTRLPKTQNGMGRVR--ALLGFGRkkaapppppkksapppKQVSSDRPTWF  339
            A+ A  S     LP   N  G++   +LLG  R  A               +  DRP WF
Sbjct  6    ASTALSSVPNRELPLKLNSSGKISKCSLLGKTRVNATKGVSTVCE-----PLPPDRPLWF  60

Query  338  PGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDV  159
            PG+  PEWLDGSL GD GFDP GL    E L++                           
Sbjct  61   PGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW---------------------------  93

Query  158  KPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQDAG  9
                            F + ELIHGRWAMLA  G L  EWL  +       W +AG
Sbjct  94   ----------------FAQAELIHGRWAMLAVSGILIPEWLERLGFIDDFNWYNAG  133



>ref|XP_009627312.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Nicotiana 
tomentosiformis]
Length=260

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 52/123 (42%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  54   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPETLKW---------------------  92

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                  F + EL+H RWAMLA  G L  EWL  +      +W D
Sbjct  93   ----------------------FAQAELMHSRWAMLAVAGILIPEWLESLGFIDNFSWYD  130

Query  14   AGK  6
            AG+
Sbjct  131  AGE  133



>emb|CDP03055.1| unnamed protein product [Coffea canephora]
Length=260

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 51/122 (42%), Gaps = 49/122 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  54   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW---------------------  92

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                  F + EL+H RWAMLA  G L  EWL  +      +W D
Sbjct  93   ----------------------FAQAELMHSRWAMLAVAGILIPEWLESLGFIENFSWYD  130

Query  14   AG  9
            AG
Sbjct  131  AG  132



>ref|XP_011093862.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Sesamum 
indicum]
Length=259

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 52/125 (42%), Gaps = 49/125 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  50   LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW------------------  91

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------T  24
                                     F + EL+H RWAMLA  G L  EWL  +      +
Sbjct  92   -------------------------FAQAELMHARWAMLAVAGILIPEWLESLGFIENFS  126

Query  23   WQDAG  9
            W DAG
Sbjct  127  WYDAG  131



>ref|XP_009759850.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Nicotiana 
sylvestris]
Length=260

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 52/123 (42%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  54   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPETLKW---------------------  92

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                  F + EL+H RWAMLA  G L  EWL  +      +W D
Sbjct  93   ----------------------FAQAELMHSRWAMLAVAGILIPEWLESLGFIDNFSWYD  130

Query  14   AGK  6
            AG+
Sbjct  131  AGE  133



>ref|XP_004288997.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=263

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 52/123 (42%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  56   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW---------------------  94

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEW------LTGVTWQD  15
                                  F + EL+HGRWAMLA  G L  EW      L   +W +
Sbjct  95   ----------------------FAQAELMHGRWAMLAVAGILIPEWAERLGFLENFSWFE  132

Query  14   AGK  6
            AG+
Sbjct  133  AGE  135



>ref|XP_007202451.1| hypothetical protein PRUPE_ppa010035mg [Prunus persica]
 gb|EMJ03650.1| hypothetical protein PRUPE_ppa010035mg [Prunus persica]
Length=267

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 53/126 (42%), Gaps = 49/126 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  57   LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW------------------  98

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWL------TGVT  24
                                     F + EL+HGRWAMLA  G L  EWL         +
Sbjct  99   -------------------------FAQAELMHGRWAMLAVSGILIPEWLERLGFIENFS  133

Query  23   WQDAGK  6
            W +AG+
Sbjct  134  WFEAGE  139



>gb|KDP33938.1| hypothetical protein JCGZ_07509 [Jatropha curcas]
Length=263

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 50/122 (41%), Gaps = 49/122 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  57   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW---------------------  95

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                  F + EL+H RWAMLA  G L  EWL  +       W D
Sbjct  96   ----------------------FAQAELMHSRWAMLAVAGILIPEWLESLGFIENYNWFD  133

Query  14   AG  9
            AG
Sbjct  134  AG  135



>ref|XP_004161120.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
Length=267

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 50/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  59   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPETLKW---------------------  97

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEW------LTGVTWQD  15
                                  F + EL+H RWAMLA  G L  EW      +   +W D
Sbjct  98   ----------------------FAQAELMHARWAMLAVAGILLPEWFESLGLIQNFSWYD  135

Query  14   AGK  6
            AG 
Sbjct  136  AGS  138



>ref|XP_004144043.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 gb|KGN66318.1| hypothetical protein Csa_1G597160 [Cucumis sativus]
Length=267

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 50/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  59   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPETLKW---------------------  97

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                  F + EL+H RWAMLA  G L  EW   +      +W D
Sbjct  98   ----------------------FAQAELMHARWAMLAVAGILLPEWFESLGLIQNFSWYD  135

Query  14   AGK  6
            AG 
Sbjct  136  AGS  138



>ref|XP_008450947.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Cucumis 
melo]
Length=265

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 50/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  57   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPETLKW---------------------  95

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEW------LTGVTWQD  15
                                  F + EL+H RWAMLA  G L  EW      +   +W D
Sbjct  96   ----------------------FAQAELMHARWAMLAVAGILLPEWFESLGLIQNFSWYD  133

Query  14   AGK  6
            AG 
Sbjct  134  AGS  136



>ref|XP_010687546.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=264

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 50/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  P+WLDGSL GD GFDP GL    E L++                     
Sbjct  58   DRPLWFPGSTPPQWLDGSLPGDFGFDPLGLGSDPETLKW---------------------  96

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                  F + EL+H RWAMLA  G L  EWL  +       W D
Sbjct  97   ----------------------FAQAELMHSRWAMLAVAGILIPEWLESIGLIENFDWYD  134

Query  14   AGK  6
            AG 
Sbjct  135  AGS  137



>ref|XP_002516245.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF46247.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=297

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 51/125 (41%), Gaps = 49/125 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  88   LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW------------------  129

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------T  24
                                     F + EL+H RWAMLA  G L  EWL  +       
Sbjct  130  -------------------------FAQAELMHSRWAMLAVAGILIPEWLESLGFIENYN  164

Query  23   WQDAG  9
            W DAG
Sbjct  165  WFDAG  169



>ref|XP_003637475.1| Chlorophyll a-b binding protein [Medicago truncatula]
Length=294

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 58/123 (47%), Gaps = 23/123 (19%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  P WLDGSL GD GFDP GL      +    ++ D N+ ++   D   + 
Sbjct  62   DRPLWFPGSTPPPWLDGSLPGDFGFDPLGLYN-GGLIILAGNTNDHNINQSFGCDSTASD  120

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
             ES                ++   + EL+H RWAML   G    E+LT +      +W  
Sbjct  121  PES----------------LKWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYT  164

Query  14   AGK  6
            AG+
Sbjct  165  AGE  167



>gb|EYU25834.1| hypothetical protein MIMGU_mgv1a012037mg [Erythranthe guttata]
Length=263

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 72/180 (40%), Gaps = 52/180 (29%)
 Frame = -2

Query  524  IAMAATAATP-SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRP  348
            +A +A AA+P S   TRL       G+  +  G    K       K  +   + +  DRP
Sbjct  1    MAASAIAASPFSSFPTRLHSFPQAAGK--SFTGICLSKRGRLSAGKGPSSVCQPLPPDRP  58

Query  347  TWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIES  168
             WFPG+  P+WLDGSL GD GFDP GL    E L++                        
Sbjct  59   IWFPGSSPPQWLDGSLPGDFGFDPLGLGSDPELLKW------------------------  94

Query  167  SDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQDAGK  6
                               F + EL+H RWAMLA  G L  EWL  +      +W DAG 
Sbjct  95   -------------------FAQAELMHSRWAMLAVSGILVPEWLGSLGFIDNYSWFDAGS  135



>gb|EYU25833.1| hypothetical protein MIMGU_mgv1a012037mg [Erythranthe guttata]
Length=263

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 72/180 (40%), Gaps = 52/180 (29%)
 Frame = -2

Query  524  IAMAATAATP-SFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRP  348
            +A +A AA+P S   TRL       G+  +  G    K       K  +   + +  DRP
Sbjct  1    MAASAIAASPFSSFPTRLHSFPQAAGK--SFTGICLSKRGRLSAGKGPSSVCQPLPPDRP  58

Query  347  TWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIES  168
             WFPG+  P+WLDGSL GD GFDP GL    E L++                        
Sbjct  59   IWFPGSSPPQWLDGSLPGDFGFDPLGLGSDPELLKW------------------------  94

Query  167  SDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQDAGK  6
                               F + EL+H RWAMLA  G L  EWL  +      +W DAG 
Sbjct  95   -------------------FAQAELMHSRWAMLAVSGILVPEWLGSLGFIDNYSWFDAGS  135



>ref|XP_007138637.1| hypothetical protein PHAVU_009G225500g [Phaseolus vulgaris]
 gb|ESW10631.1| hypothetical protein PHAVU_009G225500g [Phaseolus vulgaris]
Length=261

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 51/125 (41%), Gaps = 49/125 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  53   LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW------------------  94

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------T  24
                                     F + EL+HGRWAMLA  G L  E L  +       
Sbjct  95   -------------------------FAQAELMHGRWAMLAVFGILIPELLERIGYVENFN  129

Query  23   WQDAG  9
            W DAG
Sbjct  130  WYDAG  134



>emb|CDX83783.1| BnaC08g18620D [Brassica napus]
Length=266

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 69/177 (39%), Gaps = 52/177 (29%)
 Frame = -2

Query  512  ATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppk--ksapppKQVSSDRPTWF  339
            A+A T + L     + QN  G   + +G GR            + +   + ++ DRP WF
Sbjct  6    ASALTSTTLALSTSRVQNARGAFSSRVG-GRTSERLVVVRAGKEVSSVCEPLTPDRPMWF  64

Query  338  PGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIESSDV  159
            PG   PEWLDGSL GD GFDP GL    E L++                           
Sbjct  65   PGTSPPEWLDGSLPGDFGFDPLGLGSDPETLRW---------------------------  97

Query  158  KPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQDAGK  6
                            F + ELIH RWAMLA  G L  E      ++   +W DAG 
Sbjct  98   ----------------FAQAELIHSRWAMLAVTGILIPECLERLGFIENYSWYDAGS  138



>ref|XP_007205402.1| hypothetical protein PRUPE_ppa007518mg [Prunus persica]
 gb|EMJ06601.1| hypothetical protein PRUPE_ppa007518mg [Prunus persica]
Length=365

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = +3

Query  87   MNELTFPEPLDPEHLTVRLKRSRFNVGALYPGPDDVSGqilgqvlvqrvqlklqvlSGLC  266
            M+EL   +PL P+H  V LKR R +V     GPD+++ Q+LGQVLVQ V + L++L G  
Sbjct  1    MDELALAKPLQPKHFIVWLKRRRLDVRGFGSGPDNITRQVLGQVLVQPVVVVLEILRGFA  60

Query  267  QPERVEPNVTHQTSVQPFRSLRSREPRRPV  356
            QPERVEP V +Q  VQPFR L SR P+  V
Sbjct  61   QPERVEPVVANQAPVQPFRGLGSRVPKWAV  90



>ref|XP_003546513.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Glycine max]
Length=260

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 51/125 (41%), Gaps = 49/125 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  52   LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW------------------  93

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------T  24
                                     F + EL+H RWAMLA  G L  E L  +      +
Sbjct  94   -------------------------FAQAELMHARWAMLAVFGILVPELLEKIGYIENFS  128

Query  23   WQDAG  9
            W DAG
Sbjct  129  WYDAG  133



>gb|KHN42786.1| Chlorophyll a-b binding protein, chloroplastic [Glycine soja]
Length=256

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 51/125 (41%), Gaps = 49/125 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  52   LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW------------------  93

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------T  24
                                     F + EL+H RWAMLA  G L  E L  +      +
Sbjct  94   -------------------------FAQAELMHARWAMLAVFGILVPELLEKIGYIENFS  128

Query  23   WQDAG  9
            W DAG
Sbjct  129  WYDAG  133



>ref|NP_001289223.1| chlorophyll a-b binding protein, chloroplastic [Pyrus x bretschneideri]
 gb|AHM26634.1| a-b binding protein [Pyrus x bretschneideri]
Length=266

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 52/126 (41%), Gaps = 49/126 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  56   LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWN-----------------  98

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWL------TGVT  24
                                       + EL+HGRWAMLA  G L  EWL         +
Sbjct  99   --------------------------AQAELMHGRWAMLAVAGILIPEWLERLGFIENFS  132

Query  23   WQDAGK  6
            W +AG+
Sbjct  133  WFEAGE  138



>gb|KHN12296.1| Chlorophyll a-b binding protein, chloroplastic [Glycine soja]
Length=260

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 50/122 (41%), Gaps = 49/122 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  55   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW---------------------  93

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQD  15
                                  F + EL+H RWAMLA  G L  E      ++   +W D
Sbjct  94   ----------------------FAQAELMHSRWAMLAVFGILVPELLERIGYIENFSWYD  131

Query  14   AG  9
            AG
Sbjct  132  AG  133



>ref|XP_008389009.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Malus 
domestica]
Length=267

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 52/126 (41%), Gaps = 49/126 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  57   LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWN-----------------  99

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWL------TGVT  24
                                       + EL+HGRWAMLA  G L  EWL         +
Sbjct  100  --------------------------AQAELMHGRWAMLAVAGILIPEWLERLGFIENFS  133

Query  23   WQDAGK  6
            W +AG+
Sbjct  134  WFEAGE  139



>ref|XP_009110471.1| PREDICTED: chlorophyll a-b binding protein CP24 10B, chloroplastic-like 
[Brassica rapa]
Length=259

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 69/178 (39%), Gaps = 52/178 (29%)
 Frame = -2

Query  524  IAMAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPT  345
            +AMA + A  S LG   P   +G  +  A LG G    A     K         S  + +
Sbjct  1    MAMAVSGAVLSGLG---PSFLSGSKKSAAALGSGVGSTAARVGRKTLIVAAAAASQPKKS  57

Query  344  WFPGAKA------PEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIG  183
            W P  K       PEWLDGSL GD GFDP GL K   +L++                   
Sbjct  58   WIPAVKGGGNFLDPEWLDGSLPGDFGFDPLGLGKDPAFLKW-------------------  98

Query  182  TRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAG  9
                                    +RE ELIHGRWAM A LG    +  +GV W +AG
Sbjct  99   ------------------------YREAELIHGRWAMAAVLGIFVGQAWSGVPWFEAG  132



>ref|NP_001276216.1| chlorophyll a-b binding protein, chloroplastic-like [Glycine 
max]
 gb|ACU23891.1| unknown [Glycine max]
Length=260

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 50/122 (41%), Gaps = 49/122 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  55   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW---------------------  93

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQD  15
                                  F + EL+H RWAMLA  G L  E      ++   +W D
Sbjct  94   ----------------------FAQAELMHSRWAMLAVFGILVPELLERIGYIENFSWYD  131

Query  14   AG  9
            AG
Sbjct  132  AG  133



>ref|XP_009110297.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Brassica 
rapa]
Length=266

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 49/123 (40%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG   PEWLDGSL GD GFDP GL    E L++                     
Sbjct  59   DRPMWFPGTSPPEWLDGSLPGDFGFDPLGLGSDPETLRW---------------------  97

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQD  15
                                  F + ELIH RWAMLA  G L  E      ++   +W D
Sbjct  98   ----------------------FAQAELIHSRWAMLAVTGILIPECLERLGFIENYSWYD  135

Query  14   AGK  6
            AG 
Sbjct  136  AGS  138



>ref|XP_010459573.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Camelina sativa]
Length=270

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 50/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  63   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPETLKW---------------------  101

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQD  15
                                  F + ELIH RWAMLA  G L  E      ++   +W D
Sbjct  102  ----------------------FAQAELIHSRWAMLAVTGILIPECLERLGFIENFSWYD  139

Query  14   AGK  6
            AG 
Sbjct  140  AGS  142



>ref|XP_010932388.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Elaeis 
guineensis]
Length=259

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 52/125 (42%), Gaps = 49/125 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  50   LPPDRPLWFPGSTPPEWLDGSLPGDYGFDPLGLGSDPELLRW------------------  91

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVT  24
                                     F + EL+HGRWAMLA  G L  E      +L   +
Sbjct  92   -------------------------FAQAELMHGRWAMLAVAGILVPECLEKFGFLENFS  126

Query  23   WQDAG  9
            W +AG
Sbjct  127  WYEAG  131



>ref|XP_010272798.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Nelumbo 
nucifera]
Length=261

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 50/122 (41%), Gaps = 49/122 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  55   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLRW---------------------  93

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQD  15
                                  F + ELIH RWAMLA  G L  E      ++   +W D
Sbjct  94   ----------------------FAQAELIHSRWAMLAVAGILIPECLERLGFIENFSWYD  131

Query  14   AG  9
            AG
Sbjct  132  AG  133



>ref|XP_010477121.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Camelina sativa]
Length=269

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 50/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    + L++                     
Sbjct  62   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPDTLKW---------------------  100

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQD  15
                                  F + ELIH RWAMLA  G L  E      +L   +W D
Sbjct  101  ----------------------FAQAELIHSRWAMLAVTGILIPECLERLGFLENFSWYD  138

Query  14   AGK  6
            AG 
Sbjct  139  AGS  141



>gb|KHG29329.1| Chlorophyll a-b binding, chloroplastic [Gossypium arboreum]
Length=261

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 52/125 (42%), Gaps = 49/125 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  52   LPPDRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLKW------------------  93

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGAL------SVEWLTGVT  24
                                     F + EL+H RWAMLA  G L      S+ ++   +
Sbjct  94   -------------------------FAQAELMHARWAMLAVAGILIPELLESLGFIDNFS  128

Query  23   WQDAG  9
            W DAG
Sbjct  129  WYDAG  133



>ref|XP_001782439.1| predicted protein [Physcomitrella patens]
 gb|EDQ52774.1| predicted protein [Physcomitrella patens]
Length=210

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 45/108 (42%), Gaps = 43/108 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+KAPEWLDGSL GD GFDP GL    E L++                     
Sbjct  1    DRPLWFPGSKAPEWLDGSLPGDFGFDPLGLGSDPELLKW---------------------  39

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLT  33
                                  F + EL+H RWAML   G    E LT
Sbjct  40   ----------------------FVQAELVHCRWAMLGAAGIFIPEALT  65



>ref|XP_007012597.1| Photosystem I light harvesting complex gene 6 isoform 1 [Theobroma 
cacao]
 gb|EOY30216.1| Photosystem I light harvesting complex gene 6 isoform 1 [Theobroma 
cacao]
Length=259

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 51/125 (41%), Gaps = 49/125 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  50   LPPDRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLKW------------------  91

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVT  24
                                     F + EL+H RWAMLA  G L  E      ++   +
Sbjct  92   -------------------------FAQAELMHARWAMLAVAGILIPECLERLGFIENFS  126

Query  23   WQDAG  9
            W DAG
Sbjct  127  WYDAG  131



>gb|KFK44053.1| hypothetical protein AALP_AA1G210000 [Arabis alpina]
Length=265

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 50/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    + L++                     
Sbjct  58   DRPIWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPDLLKW---------------------  96

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQD  15
                                  F + EL+H RWAMLA  G L  E      ++   +W D
Sbjct  97   ----------------------FAQAELVHSRWAMLAVTGILIPECLERLGFIENFSWYD  134

Query  14   AGK  6
            AG 
Sbjct  135  AGS  137



>ref|XP_009418009.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=259

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 50/122 (41%), Gaps = 49/122 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  53   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLRW---------------------  91

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                  F + EL+H RWAMLA  G L  E L  +      +W D
Sbjct  92   ----------------------FAQAELMHSRWAMLAVAGILIPECLEKLGFIENFSWYD  129

Query  14   AG  9
            AG
Sbjct  130  AG  131



>ref|XP_007012598.1| Photosystem I light harvesting complex gene 6 isoform 2 [Theobroma 
cacao]
 gb|EOY30217.1| Photosystem I light harvesting complex gene 6 isoform 2 [Theobroma 
cacao]
Length=263

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 51/125 (41%), Gaps = 49/125 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  50   LPPDRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLKW------------------  91

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVT  24
                                     F + EL+H RWAMLA  G L  E      ++   +
Sbjct  92   -------------------------FAQAELMHARWAMLAVAGILIPECLERLGFIENFS  126

Query  23   WQDAG  9
            W DAG
Sbjct  127  WYDAG  131



>emb|CDX96677.1| BnaA08g22200D [Brassica napus]
Length=266

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 49/123 (40%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG   P+WLDGSL GD GFDP GL    E L++                     
Sbjct  59   DRPMWFPGTSPPKWLDGSLPGDFGFDPLGLGSDPETLRW---------------------  97

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQD  15
                                  F + ELIH RWAMLA  G L  E      ++   +W D
Sbjct  98   ----------------------FAQAELIHSRWAMLAVTGILIPECLERLGFIENYSWYD  135

Query  14   AGK  6
            AG 
Sbjct  136  AGS  138



>emb|CAN69989.1| hypothetical protein VITISV_024400 [Vitis vinifera]
Length=229

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 51/125 (41%), Gaps = 49/125 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  20   LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLRW------------------  61

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVT  24
                                     F + EL+H RWAMLA  G L  E      ++   +
Sbjct  62   -------------------------FAQAELMHSRWAMLAVAGILIPECLERLGFIENFS  96

Query  23   WQDAG  9
            W DAG
Sbjct  97   WYDAG  101



>ref|XP_010498326.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Camelina sativa]
Length=273

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 50/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    + L++                     
Sbjct  66   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPDTLKW---------------------  104

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQD  15
                                  F + ELIH RWAMLA  G L  E      ++   +W D
Sbjct  105  ----------------------FAQAELIHSRWAMLAVTGILIPECLERLGFIENFSWYD  142

Query  14   AGK  6
            AG 
Sbjct  143  AGS  145



>ref|XP_008242265.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic isoform 
X1 [Prunus mume]
Length=267

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 53/126 (42%), Gaps = 49/126 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  57   LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW------------------  98

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVT  24
                                     F + EL+HGRWAMLA  G L  E      ++   +
Sbjct  99   -------------------------FAQAELMHGRWAMLAVSGILIPECLERLGFIENFS  133

Query  23   WQDAGK  6
            W +AG+
Sbjct  134  WFEAGE  139



>ref|XP_002277280.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Vitis 
vinifera]
 emb|CBI27778.3| unnamed protein product [Vitis vinifera]
Length=259

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 50/122 (41%), Gaps = 49/122 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  53   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLRW---------------------  91

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQD  15
                                  F + EL+H RWAMLA  G L  E      ++   +W D
Sbjct  92   ----------------------FAQAELMHSRWAMLAVAGILIPECLERLGFIENFSWYD  129

Query  14   AG  9
            AG
Sbjct  130  AG  131



>ref|XP_008242266.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic isoform 
X2 [Prunus mume]
Length=261

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 53/126 (42%), Gaps = 49/126 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  51   LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW------------------  92

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVT  24
                                     F + EL+HGRWAMLA  G L  E      ++   +
Sbjct  93   -------------------------FAQAELMHGRWAMLAVSGILIPECLERLGFIENFS  127

Query  23   WQDAGK  6
            W +AG+
Sbjct  128  WFEAGE  133



>ref|XP_009362479.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009362480.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Pyrus x bretschneideri]
Length=257

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 54/125 (43%), Gaps = 49/125 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKA------PEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKN  204
             ++ + +W PG KA      PEWLDGSL GD GFDP GL K   +L++            
Sbjct  49   AAAAKKSWIPGVKAGGNFINPEWLDGSLPGDYGFDPLGLGKDPAFLKW------------  96

Query  203  LAGDIIGTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVT  24
                                           +RE ELIHGRWAM A +G L  +  +GV 
Sbjct  97   -------------------------------YREAELIHGRWAMTAVVGILVGQAWSGVP  125

Query  23   WQDAG  9
            W +AG
Sbjct  126  WFEAG  130



>ref|XP_008801837.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Phoenix dactylifera]
Length=262

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 78/181 (43%), Gaps = 53/181 (29%)
 Frame = -2

Query  518  MAATAATPSFLGTRLPKTQNGMGRVRALLGFG---RkkaapppppkksapppKQVSSDRP  348
            MA+  A+ S + +   KT NG+G ++A    G   R+K +  P  +++     + +S+RP
Sbjct  1    MASVCASTSAVASSQ-KTGNGLGAMKASFLGGTKLRQKKSTAPTARRALSVSAEATSERP  59

Query  347  TWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRIES  168
             WFPG+  P WLDGSL GD GFDP GL    E L++                        
Sbjct  60   LWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWN-----------------------  96

Query  167  SDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQDAGK  6
                                ++ EL+H RWAML   G    E LT +      +W  AG+
Sbjct  97   --------------------QQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGE  136

Query  5    V  3
            +
Sbjct  137  L  137



>ref|XP_006416532.1| hypothetical protein EUTSA_v10008493mg [Eutrema salsugineum]
 gb|ESQ34885.1| hypothetical protein EUTSA_v10008493mg [Eutrema salsugineum]
Length=265

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 50/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    + L++                     
Sbjct  58   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPDLLKW---------------------  96

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQD  15
                                  F + EL+H RWAMLA  G L  E      ++   +W D
Sbjct  97   ----------------------FAQAELVHSRWAMLAVTGILIPECLERLGFIENYSWYD  134

Query  14   AGK  6
            AG 
Sbjct  135  AGS  137



>sp|P36494.1|CB4_SPIOL RecName: Full=Chlorophyll a-b binding protein CP24, chloroplastic; 
Flags: Precursor [Spinacia oleracea]
 emb|CAA81105.1| 20 kDa protein of CP24 precursor protein [Spinacia oleracea]
Length=261

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 68/175 (39%), Gaps = 49/175 (28%)
 Frame = -2

Query  515  AATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPTWFP  336
            AAT+AT    G   P    G    ++LL    K  A      +        ++ + +W P
Sbjct  3    AATSATAIVNGFTSPFLSGGKKSSQSLLFVNSKVGAGVSTTSRKLVVVAAAAAPKKSWIP  62

Query  335  GAKA------PEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRI  174
              K       PEWLDGSL GD GFDP GL K   +L++                      
Sbjct  63   AVKGGGNFLDPEWLDGSLPGDFGFDPLGLGKDPAFLKW----------------------  100

Query  173  ESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAG  9
                                 +RE ELIHGRWAMLA LG    +  TG+ W +AG
Sbjct  101  ---------------------YREAELIHGRWAMLAVLGIFVGQAWTGIPWFEAG  134



>ref|XP_004488100.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=264

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 50/124 (40%), Gaps = 49/124 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  58   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW---------------------  96

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                  F + EL+H RWAML   G L  E L  +      +W +
Sbjct  97   ----------------------FAQAELMHSRWAMLGVSGILVPELLQNIGYVENFSWFN  134

Query  14   AGKV  3
            AG V
Sbjct  135  AGSV  138



>gb|AAO22627.1| putative light-harvesting chlorophyll a/b binding protein [Arabidopsis 
thaliana]
Length=270

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 50/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    + L++                     
Sbjct  64   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPDTLKW---------------------  102

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQD  15
                                  F + ELIH RWAMLA  G +  E      ++   +W D
Sbjct  103  ----------------------FAQAELIHSRWAMLAVTGIIIPECLERLGFIENFSWYD  140

Query  14   AGK  6
            AG 
Sbjct  141  AGS  143



>ref|XP_004488099.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=293

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 50/124 (40%), Gaps = 49/124 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                     
Sbjct  58   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW---------------------  96

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                  F + EL+H RWAML   G L  E L  +      +W +
Sbjct  97   ----------------------FAQAELMHSRWAMLGVSGILVPELLQNIGYVENFSWFN  134

Query  14   AGKV  3
            AG V
Sbjct  135  AGSV  138



>ref|NP_173349.1| PSI type II chlorophyll a/b-binding protein (Lhca2*1) [Arabidopsis 
thaliana]
 gb|AAM63464.1| PSI type II chlorophyll a/b-binding protein, putative [Arabidopsis 
thaliana]
 gb|AAV85677.1| At1g19150 [Arabidopsis thaliana]
 gb|AAW70400.1| At1g19150 [Arabidopsis thaliana]
 gb|AEE29811.1| PSI type II chlorophyll a/b-binding protein (Lhca2*1) [Arabidopsis 
thaliana]
Length=270

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 50/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    + L++                     
Sbjct  64   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPDTLKW---------------------  102

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQD  15
                                  F + ELIH RWAMLA  G +  E      ++   +W D
Sbjct  103  ----------------------FAQAELIHSRWAMLAVTGIIIPECLERLGFIENFSWYD  140

Query  14   AGK  6
            AG 
Sbjct  141  AGS  143



>ref|XP_006306445.1| hypothetical protein CARUB_v10012387mg [Capsella rubella]
 gb|EOA39343.1| hypothetical protein CARUB_v10012387mg [Capsella rubella]
Length=273

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 50/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    + L++                     
Sbjct  66   DRPLWFPGSYPPEWLDGSLPGDFGFDPLGLGSDPDTLKW---------------------  104

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQD  15
                                  F + ELIH RWAMLA  G L  E      ++   +W D
Sbjct  105  ----------------------FAQAELIHSRWAMLAVTGILIPECLERLGFIENFSWYD  142

Query  14   AGK  6
            AG 
Sbjct  143  AGS  145



>ref|XP_004956925.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X2 [Setaria italica]
Length=273

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 52/127 (41%), Gaps = 50/127 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  P WLDGSL GD GFDP GL    E L++                  
Sbjct  63   LGPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSEPELLRW------------------  104

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWL-------TGV  27
                                     F + EL+HGRWAMLA +G L  + L        G 
Sbjct  105  -------------------------FAQAELMHGRWAMLAAVGILIPDLLARWGFIDAGF  139

Query  26   TWQDAGK  6
            +W DAG 
Sbjct  140  SWFDAGS  146



>gb|AAF82226.1|AC069143_2 Contains similarity to a chlorophyll a/b-binding protein type 
II from Arabidopsis thaliana gi|S46295 and contains a chlorophyll 
A-B binding proteins PF|00504 domain [Arabidopsis thaliana]
Length=267

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 50/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    + L++                     
Sbjct  64   DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPDTLKW---------------------  102

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQD  15
                                  F + ELIH RWAMLA  G +  E      ++   +W D
Sbjct  103  ----------------------FAQAELIHSRWAMLAVTGIIIPECLERLGFIENFSWYD  140

Query  14   AGK  6
            AG 
Sbjct  141  AGS  143



>tpg|DAA40157.1| TPA: hypothetical protein ZEAMMB73_160322 [Zea mays]
Length=232

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 51/127 (40%), Gaps = 50/127 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  P WLDGSL GD GFDP GL    E L++                  
Sbjct  22   LGPDRPIWFPGSSPPPWLDGSLPGDFGFDPLGLGSEPELLRW------------------  63

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWL-------TGV  27
                                     F + EL+HGRWAMLA  G L  + L        G 
Sbjct  64   -------------------------FAQAELMHGRWAMLAAAGILVPDLLARWGFIDAGF  98

Query  26   TWQDAGK  6
            +W DAG 
Sbjct  99   SWFDAGS  105



>ref|XP_004956926.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X3 [Setaria italica]
Length=272

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 52/127 (41%), Gaps = 50/127 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  P WLDGSL GD GFDP GL    E L++                  
Sbjct  62   LGPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSEPELLRW------------------  103

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWL-------TGV  27
                                     F + EL+HGRWAMLA +G L  + L        G 
Sbjct  104  -------------------------FAQAELMHGRWAMLAAVGILIPDLLARWGFIDAGF  138

Query  26   TWQDAGK  6
            +W DAG 
Sbjct  139  SWFDAGS  145



>ref|XP_008667517.1| PREDICTED: uncharacterized protein LOC100273427 isoform X1 [Zea 
mays]
 tpg|DAA40154.1| TPA: hypothetical protein ZEAMMB73_160322 [Zea mays]
 tpg|DAA40155.1| TPA: hypothetical protein ZEAMMB73_160322 [Zea mays]
Length=271

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 50/124 (40%), Gaps = 50/124 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  P WLDGSL GD GFDP GL    E L++                     
Sbjct  64   DRPIWFPGSSPPPWLDGSLPGDFGFDPLGLGSEPELLRW---------------------  102

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWL-------TGVTWQ  18
                                  F + EL+HGRWAMLA  G L  + L        G +W 
Sbjct  103  ----------------------FAQAELMHGRWAMLAAAGILVPDLLARWGFIDAGFSWF  140

Query  17   DAGK  6
            DAG 
Sbjct  141  DAGS  144



>ref|NP_001141336.1| hypothetical protein [Zea mays]
 gb|ACF86112.1| unknown [Zea mays]
Length=271

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 50/124 (40%), Gaps = 50/124 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  P WLDGSL GD GFDP GL    E L++                     
Sbjct  64   DRPIWFPGSSPPPWLDGSLPGDFGFDPLGLGSEPELLRW---------------------  102

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWL-------TGVTWQ  18
                                  F + EL+HGRWAMLA  G L  + L        G +W 
Sbjct  103  ----------------------FAQAELMHGRWAMLAAAGILVPDLLARWGFIDAGFSWF  140

Query  17   DAGK  6
            DAG 
Sbjct  141  DAGS  144



>ref|XP_002514914.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF47468.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=270

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 51/124 (41%), Gaps = 49/124 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  P WLDGSL GD GFDP GL    E L++ +                   
Sbjct  64   DRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPETLRWNV-------------------  104

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                    + EL+H RWAML   G    E+LT +      +W D
Sbjct  105  ------------------------QAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYD  140

Query  14   AGKV  3
            AGK+
Sbjct  141  AGKL  144



>ref|XP_004956924.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X1 [Setaria italica]
Length=283

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 52/127 (41%), Gaps = 50/127 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  P WLDGSL GD GFDP GL    E L++                  
Sbjct  73   LGPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSEPELLRW------------------  114

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWL-------TGV  27
                                     F + EL+HGRWAMLA +G L  + L        G 
Sbjct  115  -------------------------FAQAELMHGRWAMLAAVGILIPDLLARWGFIDAGF  149

Query  26   TWQDAGK  6
            +W DAG 
Sbjct  150  SWFDAGS  156



>gb|KDP26804.1| hypothetical protein JCGZ_17962 [Jatropha curcas]
Length=270

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 51/124 (41%), Gaps = 49/124 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  P WLDGSL GD GFDP GL    E L++ +                   
Sbjct  64   DRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPETLRWNV-------------------  104

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                    + EL+H RWAML   G    E+LT +      +W D
Sbjct  105  ------------------------QAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYD  140

Query  14   AGKV  3
            AGK+
Sbjct  141  AGKL  144



>gb|EPS71951.1| chlorophyll a-b binding protein 7, chloroplastic, partial [Genlisea 
aurea]
Length=259

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 52/123 (42%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  P WLDGSL GD GFDP GLA        + DSL  N             
Sbjct  53   DRPLWFPGSTPPAWLDGSLPGDFGFDPLGLAS-------DPDSLKWN-------------  92

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                   ++ EL+HGRWAML   G    E+LT +      +W  
Sbjct  93   -----------------------QQSELVHGRWAMLGAAGIFIPEFLTKIGILNTPSWYT  129

Query  14   AGK  6
            AG+
Sbjct  130  AGE  132



>ref|XP_007148423.1| hypothetical protein PHAVU_006G207300g [Phaseolus vulgaris]
 gb|AGV54678.1| chlorophyll A/B binding protein CP24 10A chloroplastic [Phaseolus 
vulgaris]
 gb|ESW20417.1| hypothetical protein PHAVU_006G207300g [Phaseolus vulgaris]
Length=258

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 53/125 (42%), Gaps = 49/125 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKA------PEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKN  204
             ++ + +W PG +A      PEWLDGSL GD GFDP GL K   +L++            
Sbjct  50   AAAPKKSWLPGVRAGGNLVDPEWLDGSLPGDFGFDPLGLGKDPSFLKW------------  97

Query  203  LAGDIIGTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVT  24
                                           +RE ELIHGRWAM A LG    +  +GV 
Sbjct  98   -------------------------------YREAELIHGRWAMAAVLGIFVGQAWSGVP  126

Query  23   WQDAG  9
            W +AG
Sbjct  127  WFEAG  131



>ref|XP_008784474.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Phoenix 
dactylifera]
Length=259

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 51/125 (41%), Gaps = 49/125 (39%)
 Frame = -2

Query  365  VSSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDII  186
            +  DRP WFPG+  PEWLDGSL GD GFDP GL    E L++                  
Sbjct  50   LPPDRPLWFPGSSPPEWLDGSLPGDYGFDPLGLGSDPELLRW------------------  91

Query  185  GTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------T  24
                                     F + EL+H RWAMLA  G L  E L  +      +
Sbjct  92   -------------------------FAQAELMHSRWAMLAAAGILVPECLEKLGFIENFS  126

Query  23   WQDAG  9
            W +AG
Sbjct  127  WYEAG  131



>ref|XP_004510608.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=273

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 65/183 (36%), Gaps = 65/183 (36%)
 Frame = -2

Query  536  PHKHIAMAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSS  357
            P      +A   T +FLG +L    N   RVR+                 +         
Sbjct  18   PSSQKNGSALGITKAFLGRKLKVNNNTSVRVRS----------------AATTKCAVAEP  61

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  P WLDGSL GD GFDP GL    E L++ +                   
Sbjct  62   DRPIWFPGSTPPAWLDGSLPGDFGFDPLGLGSDPESLRWNV-------------------  102

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                    + EL+H RWAML   G    E+LT +      +W  
Sbjct  103  ------------------------QAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYT  138

Query  14   AGK  6
            AG+
Sbjct  139  AGE  141



>ref|XP_010531966.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Tarenaya 
hassleriana]
Length=267

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 50/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  P+WLDGSL GD GFDP GL    E L++                     
Sbjct  61   DRPLWFPGSTPPQWLDGSLPGDFGFDPLGLGSDPELLKW---------------------  99

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                  F + EL+H RWAMLA  G L  E L  +      +W D
Sbjct  100  ----------------------FAQAELMHSRWAMLAVAGILIPECLERLGFIEDFSWYD  137

Query  14   AGK  6
            AG 
Sbjct  138  AGS  140



>ref|XP_004510609.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=268

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 65/183 (36%), Gaps = 65/183 (36%)
 Frame = -2

Query  536  PHKHIAMAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSS  357
            P      +A   T +FLG +L    N   RVR+                 +         
Sbjct  18   PSSQKNGSALGITKAFLGRKLKVNNNTSVRVRS----------------AATTKCAVAEP  61

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  P WLDGSL GD GFDP GL    E L++ +                   
Sbjct  62   DRPIWFPGSTPPAWLDGSLPGDFGFDPLGLGSDPESLRWNV-------------------  102

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                    + EL+H RWAML   G    E+LT +      +W  
Sbjct  103  ------------------------QAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYT  138

Query  14   AGK  6
            AG+
Sbjct  139  AGE  141



>gb|ABW06957.1| chloroplast light-harvesting complex II protein precursor [Euglena 
gracilis]
Length=562

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 51/124 (41%), Gaps = 51/124 (41%)
 Frame = -2

Query  353  RPTWFPGAKAPEWLDGSLVGDVGFDPFGLAK-PAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            RPTWFPGA+AP WL G   GD GFDPFGLAK PA++                        
Sbjct  151  RPTWFPGAEAPTWLTGEYPGDRGFDPFGLAKDPADF------------------------  186

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQD  15
                                 +FR+ E+ HGRWAML  +G L  E    +       W D
Sbjct  187  --------------------AKFRDSEVFHGRWAMLGLVGCLVPEVFGNLGIAQLPAWYD  226

Query  14   AGKV  3
            A  V
Sbjct  227  AATV  230


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 50/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  353  RPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTRI  174
            RPTWFPGA+AP WL G   GD GFDP GLAK  E           + AKN          
Sbjct  360  RPTWFPGAEAPAWLTGEYPGDRGFDPLGLAKDPE-----------DFAKN----------  398

Query  173  ESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TWQDA  12
                                  R+ E+ HGRWAML  +G L  E    +       W +A
Sbjct  399  ----------------------RDSEVYHGRWAMLGLVGCLVPEVFGNLGIAQLPAWYEA  436

Query  11   GKV  3
            G V
Sbjct  437  GAV  439



>ref|XP_006474702.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=272

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 50/130 (38%), Gaps = 56/130 (43%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDG-------SLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLA  198
            DRP WFPG+  P WLDG        L GD GFDP GL    E L++              
Sbjct  59   DRPLWFPGSTPPSWLDGRHSLFLIPLPGDYGFDPLGLGSDPELLKW--------------  104

Query  197  GDIIGTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV---  27
                                         F + ELIHGRWAMLA  G L  EWL  +   
Sbjct  105  -----------------------------FAQAELIHGRWAMLAVAGILIPEWLESIGLI  135

Query  26   ---TWQDAGK  6
               +W DAG 
Sbjct  136  ENFSWYDAGS  145



>ref|XP_009415902.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=300

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 62/126 (49%), Gaps = 18/126 (14%)
 Frame = -2

Query  362  SSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIG  183
            + +RP WFPG+  P WLDGSL GD GFDP GL K +E ++    ++   L +    + + 
Sbjct  61   APERPLWFPGSTPPPWLDGSLPGDFGFDPLGLGK-SELVEPLQTTMSWCLRQQKMNEWVF  119

Query  182  TRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TW  21
                 SD +            ++  ++ E++H RWAML   G    E LT +      +W
Sbjct  120  FTRAGSDPE-----------SLRWNQQAEIVHCRWAMLGAAGIFIPELLTKIGILNTPSW  168

Query  20   QDAGKV  3
              AG++
Sbjct  169  YTAGQL  174



>ref|XP_002890321.1| hypothetical protein ARALYDRAFT_472139 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66580.1| hypothetical protein ARALYDRAFT_472139 [Arabidopsis lyrata subsp. 
lyrata]
Length=269

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 50/123 (41%), Gaps = 49/123 (40%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIGTR  177
            DRP WFPG+  PEWLDGSL GD GFDP GL    + L++                     
Sbjct  63   DRPLWFPGSAPPEWLDGSLPGDFGFDPLGLGSDPDTLKW---------------------  101

Query  176  IESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVE------WLTGVTWQD  15
                                  F + ELIH RWAMLA  G L  E      ++   +W +
Sbjct  102  ----------------------FAQAELIHSRWAMLAVTGILIPECLERLGFIENFSWYE  139

Query  14   AGK  6
            AG 
Sbjct  140  AGS  142



>emb|CCI55397.1| PSI antenna protein Lhca2 [Marchantia polymorpha]
Length=267

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 52/125 (42%), Gaps = 49/125 (39%)
 Frame = -2

Query  362  SSDRPTWFPGAKAPEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIG  183
            +++RP WFPG+ APEWLDGSL GD GFDP GL    E L++                   
Sbjct  58   ATERPLWFPGSTAPEWLDGSLPGDFGFDPLGLGSEPELLKW-------------------  98

Query  182  TRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV------TW  21
                                    F + E++H RWAML   G    E LT +      +W
Sbjct  99   ------------------------FVQAEIVHCRWAMLGAAGIFIPELLTKIGILNTPSW  134

Query  20   QDAGK  6
              AG+
Sbjct  135  YTAGE  139



>ref|XP_006351797.1| PREDICTED: chlorophyll a-b binding protein CP24 10B, chloroplastic-like 
[Solanum tuberosum]
Length=256

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 51/121 (42%), Gaps = 49/121 (40%)
 Frame = -2

Query  353  RPTWFPGAKA------PEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGD  192
            + +W PG KA      PEWLDGSL GD GFDP GL K   +L++                
Sbjct  52   KKSWIPGVKAGGNLVDPEWLDGSLPGDFGFDPLGLGKDPAFLKW----------------  95

Query  191  IIGTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDA  12
                                       +RE ELIHGRWAM A LG    +  +G+ W +A
Sbjct  96   ---------------------------YREAELIHGRWAMAAVLGIFVGQAWSGIPWFEA  128

Query  11   G  9
            G
Sbjct  129  G  129



>ref|XP_006474703.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=271

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 50/130 (38%), Gaps = 56/130 (43%)
 Frame = -2

Query  356  DRPTWFPGAKAPEWLDG-------SLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLA  198
            DRP WFPG+  P WLDG        L GD GFDP GL    E L++              
Sbjct  58   DRPLWFPGSTPPSWLDGRHSLFLIPLPGDYGFDPLGLGSDPELLKW--------------  103

Query  197  GDIIGTRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV---  27
                                         F + ELIHGRWAMLA  G L  EWL  +   
Sbjct  104  -----------------------------FAQAELIHGRWAMLAVAGILIPEWLESIGLI  134

Query  26   ---TWQDAGK  6
               +W DAG 
Sbjct  135  ENFSWYDAGS  144



>emb|CDX96833.1| BnaA08g23760D [Brassica napus]
Length=259

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 68/178 (38%), Gaps = 52/178 (29%)
 Frame = -2

Query  524  IAMAATAATPSFLGTRLPKTQNGMGRVRALLGFGRkkaapppppkksapppKQVSSDRPT  345
            +AMA + A  S LG   P   +G     + LG G    A     K         S  + +
Sbjct  1    MAMAVSGAVLSGLG---PSFLSGGKISASALGSGVGAGAARVGRKTLIVAAAAASQPKKS  57

Query  344  WFPGAKA------PEWLDGSLVGDVGFDPFGLAKPAEYLQFELDSLDQNLAKNLAGDIIG  183
            W P  K       PEWLDGSL GD GFDP GL K   +L++                   
Sbjct  58   WIPAVKGGGNFLDPEWLDGSLPGDFGFDPLGLGKDPAFLKW-------------------  98

Query  182  TRIESSDVKPTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAG  9
                                    +RE ELIHGRWAM A LG    +  +GV W +AG
Sbjct  99   ------------------------YREAELIHGRWAMAAVLGIFVGQAWSGVPWFEAG  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897646128048