BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14742_g1_i1 len=382 path=[1896:0-381]

Length=382
                                                                      Score     E

ref|XP_011095216.1|  PREDICTED: chlorophyll a-b binding protein C...    159   4e-44   
gb|KHN13315.1|  Chlorophyll a-b binding protein CP29.2, chloropla...    150   3e-43   
emb|CBL86548.1|  chlorophyll a/b binding protein                        151   3e-43   
ref|XP_009388349.1|  PREDICTED: chlorophyll a-b binding protein C...    153   1e-42   
gb|EYU26660.1|  hypothetical protein MIMGU_mgv1a011247mg                152   2e-42   
ref|XP_008800353.1|  PREDICTED: chlorophyll a-b binding protein C...    152   2e-42   
gb|AHM26630.1|  a-b binding protein                                     147   4e-42   
ref|XP_002463016.1|  hypothetical protein SORBIDRAFT_02g036260          151   5e-42   Sorghum bicolor [broomcorn]
gb|EAZ40279.1|  hypothetical protein OsJ_24721                          150   5e-42   Oryza sativa Japonica Group [Japonica rice]
gb|EMS60898.1|  Chlorophyll a-b binding protein CP29.2, chloropla...    149   5e-42   
ref|XP_004246325.1|  PREDICTED: chlorophyll a-b binding protein C...    151   6e-42   
gb|ACO51068.1|  chloroplast chlorophyll A-B binding protein             151   6e-42   Gossypium hirsutum [American cotton]
gb|ABK95186.1|  unknown                                                 147   6e-42   Populus trichocarpa [western balsam poplar]
gb|KHG23195.1|  Uncharacterized protein F383_29279                      151   6e-42   
ref|XP_009588563.1|  PREDICTED: chlorophyll a-b binding protein C...    151   6e-42   
ref|XP_009804550.1|  PREDICTED: chlorophyll a-b binding protein C...    150   7e-42   
gb|ABG73415.1|  chloroplast pigment-binding protein CP29                150   7e-42   Nicotiana tabacum [American tobacco]
ref|NP_001105502.1|  photosystem II subunit29                           151   7e-42   Zea mays [maize]
ref|XP_007026729.1|  Light-harvesting complex II protein Lhcb4          150   7e-42   
ref|XP_004958012.1|  PREDICTED: chlorophyll a-b binding protein C...    150   8e-42   
ref|NP_001059975.1|  Os07g0558400                                       150   1e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008350546.1|  PREDICTED: chlorophyll a-b binding protein C...    145   2e-41   
ref|XP_006657829.1|  PREDICTED: chlorophyll a-b binding protein C...    150   2e-41   
ref|XP_003562892.1|  PREDICTED: chlorophyll a-b binding protein C...    150   2e-41   
ref|XP_009416063.1|  PREDICTED: chlorophyll a-b binding protein C...    149   2e-41   
ref|XP_010109617.1|  hypothetical protein L484_015572                   149   3e-41   
gb|EPS68718.1|  hypothetical protein M569_06048                         149   3e-41   
gb|AAD27878.1|AF139466_1  chlorophyll a/b binding protein CP29          149   3e-41   Vigna radiata var. radiata [golden gram]
ref|XP_009146970.1|  PREDICTED: chlorophyll a-b binding protein C...    149   4e-41   
emb|CDY53084.1|  BnaCnng24140D                                          149   4e-41   
ref|XP_007133907.1|  hypothetical protein PHAVU_010G002100g             149   4e-41   
ref|XP_003516950.1|  PREDICTED: chlorophyll a-b binding protein C...    149   4e-41   
ref|XP_006407730.1|  hypothetical protein EUTSA_v10021263mg             149   4e-41   
emb|CDP06495.1|  unnamed protein product                                149   4e-41   
ref|XP_010486443.1|  PREDICTED: chlorophyll a-b binding protein C...    149   4e-41   
ref|XP_010466814.1|  PREDICTED: chlorophyll a-b binding protein C...    149   4e-41   
gb|ABW90990.1|  LHCB4                                                   149   5e-41   Bambusa oldhamii
ref|XP_006300034.1|  hypothetical protein CARUB_v10016258mg             149   5e-41   
ref|NP_001136606.1|  uncharacterized protein LOC100216729               149   5e-41   Zea mays [maize]
ref|XP_003520609.1|  PREDICTED: chlorophyll a-b binding protein C...    149   5e-41   
ref|XP_006366348.1|  PREDICTED: chlorophyll a-b binding protein C...    148   8e-41   
gb|ACJ84724.1|  unknown                                                 148   8e-41   Medicago truncatula
gb|EMT21651.1|  Chlorophyll a-b binding protein CP29.2, chloropla...    148   9e-41   
gb|AEO51756.1|  chloroplast chlorophyll A/B binding protein             148   9e-41   
ref|XP_002873005.1|  chlorophyll a/b-binding protein CP29               148   1e-40   
ref|XP_009412442.1|  PREDICTED: chlorophyll a-b binding protein C...    148   1e-40   
ref|XP_002882591.1|  LHCB4.2                                            147   1e-40   
ref|XP_010037701.1|  PREDICTED: chlorophyll a-b binding protein C...    147   1e-40   
ref|XP_010253858.1|  PREDICTED: chlorophyll a-b binding protein C...    147   1e-40   
gb|ACU19827.1|  unknown                                                 147   2e-40   Glycine max [soybeans]
ref|XP_006848193.1|  hypothetical protein AMTR_s00029p00239610          147   2e-40   
ref|XP_004506774.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophyll ...    149   2e-40   
ref|XP_006289419.1|  hypothetical protein CARUB_v10002918mg             147   2e-40   
ref|XP_010558381.1|  PREDICTED: chlorophyll a-b binding protein C...    147   2e-40   
gb|KFK24655.1|  hypothetical protein AALP_AA8G007900                    147   2e-40   
ref|XP_009125404.1|  PREDICTED: chlorophyll a-b binding protein C...    146   3e-40   
emb|CDY04834.1|  BnaAnng00160D                                          146   3e-40   
dbj|BAJ33665.1|  unnamed protein product                                146   3e-40   
ref|XP_003604653.1|  Chlorophyll a-b binding protein                    147   4e-40   
ref|XP_006429356.1|  hypothetical protein CICLE_v10012370mg             145   6e-40   
ref|XP_006429357.1|  hypothetical protein CICLE_v10012370mg             145   6e-40   
gb|ABX47016.1|  chloroplast chlorophyll a/b binding protein cab-PhE7    145   6e-40   Phyllostachys edulis [kikko-chiku]
gb|KFK38281.1|  hypothetical protein AALP_AA3G093700                    145   7e-40   
ref|XP_009377780.1|  PREDICTED: chlorophyll a-b binding protein C...    145   7e-40   
ref|XP_008370077.1|  PREDICTED: chlorophyll a-b binding protein C...    145   7e-40   
ref|XP_008449241.1|  PREDICTED: chlorophyll a-b binding protein C...    145   8e-40   
ref|XP_004147887.1|  PREDICTED: chlorophyll a-b binding protein C...    145   8e-40   
ref|XP_010262833.1|  PREDICTED: chlorophyll a-b binding protein C...    145   8e-40   
gb|KDP24461.1|  hypothetical protein JCGZ_25025                         145   8e-40   
ref|XP_002323575.1|  chlorophyll a/b binding protein CP29               145   9e-40   Populus trichocarpa [western balsam poplar]
gb|ABK96503.1|  unknown                                                 145   1e-39   Populus trichocarpa x Populus deltoides
ref|XP_008243837.1|  PREDICTED: chlorophyll a-b binding protein C...    145   1e-39   
ref|XP_011014743.1|  PREDICTED: chlorophyll a-b binding protein C...    145   1e-39   
ref|XP_011047451.1|  PREDICTED: chlorophyll a-b binding protein C...    145   1e-39   
gb|AAM12979.1|  chlorophyll a/b-binding protein CP29                    145   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011019131.1|  PREDICTED: chlorophyll a-b binding protein C...    145   1e-39   
ref|NP_187506.1|  light harvesting complex photosystem II interac...    145   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002309134.1|  chlorophyll a/b binding protein CP29               145   1e-39   Populus trichocarpa [western balsam poplar]
ref|NP_195773.1|  chlorophyll a-b binding protein CP29.1                145   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398606.1|  hypothetical protein EUTSA_v10014055mg             146   1e-39   
ref|XP_010924043.1|  PREDICTED: chlorophyll a-b binding protein C...    144   2e-39   
ref|XP_002528105.1|  chlorophyll A/B binding protein, putative          144   2e-39   Ricinus communis
gb|AHM26635.1|  a-b binding protein                                     144   2e-39   
ref|XP_009344712.1|  PREDICTED: chlorophyll a-b binding protein C...    144   3e-39   
ref|XP_002279834.1|  PREDICTED: chlorophyll a-b binding protein C...    144   4e-39   Vitis vinifera
prf||1908421A  light-harvesting complex IIa protein                     143   4e-39
gb|AAK43851.1|AF370474_1  chlorophyll a/b-binding protein CP29          143   8e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004302636.1|  PREDICTED: chlorophyll a-b binding protein C...    142   2e-38   
ref|XP_008388205.1|  PREDICTED: chlorophyll a-b binding protein C...    141   5e-38   
gb|AAK82524.1|  AT5g01530/F7A7_50                                       139   1e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CAA06961.1|  chlorophyll a/b-binding protein                        132   3e-37   Hordeum vulgare [barley]
ref|XP_010670717.1|  PREDICTED: chlorophyll a-b binding protein C...    137   1e-36   
ref|XP_002974259.1|  light-harvesting complex                           135   6e-36   
ref|XP_002985629.1|  light-harvesting complex                           135   6e-36   
pdb|3PL9|A  Chain A, Crystal Structure Of Spinach Minor Light-Har...    131   7e-35   
ref|XP_010677168.1|  PREDICTED: chlorophyll a-b binding protein C...    123   3e-31   
gb|ACU23805.1|  unknown                                                 113   4e-29   Glycine max [soybeans]
gb|KHN34729.1|  Chlorophyll a-b binding protein CP29.3, chloropla...    112   5e-28   
ref|XP_001785452.1|  predicted protein                                  112   3e-27   
ref|XP_003600876.1|  Chlorophyll a-b binding protein CP29.3             112   4e-27   
ref|XP_003552419.1|  PREDICTED: chlorophyll a-b binding protein C...    112   4e-27   
ref|XP_003538459.1|  PREDICTED: chlorophyll a-b binding protein C...    112   5e-27   
ref|XP_008233744.1|  PREDICTED: chlorophyll a-b binding protein C...    111   6e-27   
ref|XP_007218784.1|  hypothetical protein PRUPE_ppa009686mg             111   8e-27   
ref|XP_010095100.1|  Chlorophyll a-b binding protein                    110   1e-26   
ref|XP_004500683.1|  PREDICTED: chlorophyll a-b binding protein C...    110   2e-26   
ref|XP_001772786.1|  predicted protein                                  110   2e-26   
ref|XP_007163532.1|  hypothetical protein PHAVU_001G242100g             109   3e-26   
ref|XP_004307637.1|  PREDICTED: chlorophyll a-b binding protein C...    107   1e-25   
gb|AGP03463.1|  chloroplast chlorophyll a-b binding protein CP29        107   3e-25   
ref|XP_009369266.1|  PREDICTED: chlorophyll a-b binding protein C...    105   5e-25   
ref|XP_009345742.1|  PREDICTED: chlorophyll a-b binding protein C...    106   5e-25   
ref|XP_008373917.1|  PREDICTED: chlorophyll a-b binding protein C...    106   6e-25   
gb|AEW08530.1|  hypothetical protein CL265Contig2_04                  99.8    2e-24   
gb|KCW65678.1|  hypothetical protein EUGRSUZ_G03060                     102   8e-24   
ref|XP_002526901.1|  chlorophyll A/B binding protein, putative          102   1e-23   Ricinus communis
ref|XP_010067525.1|  PREDICTED: chlorophyll a-b binding protein C...    102   2e-23   
gb|ABK96737.1|  unknown                                                 101   3e-23   Populus trichocarpa x Populus deltoides
ref|XP_011043542.1|  PREDICTED: chlorophyll a-b binding protein C...    101   3e-23   
ref|XP_002312153.1|  Chlorophyll a-b binding protein CP29.3             101   3e-23   Populus trichocarpa [western balsam poplar]
gb|ACN40533.1|  unknown                                                 100   3e-23   Picea sitchensis
gb|KDP44781.1|  hypothetical protein JCGZ_01281                         100   7e-23   
gb|ABK21281.1|  unknown                                               99.4    2e-22   Picea sitchensis
gb|ABK25779.1|  unknown                                               99.0    3e-22   Picea sitchensis
gb|AFD62761.1|  LHCB                                                  96.7    3e-22   
emb|CDY20518.1|  BnaC04g05260D                                        98.2    5e-22   
ref|XP_010505716.1|  PREDICTED: chlorophyll a-b binding protein C...  97.8    8e-22   
gb|KDO69014.1|  hypothetical protein CISIN_1g028743mg                 96.3    9e-22   
ref|XP_007009013.1|  Light-harvesting complex II protein Lhcb8        97.4    9e-22   
gb|ABK26282.1|  unknown                                               97.4    1e-21   Picea sitchensis
ref|XP_010517408.1|  PREDICTED: chlorophyll a-b binding protein C...  97.4    1e-21   
ref|XP_010554987.1|  PREDICTED: chlorophyll a-b binding protein C...  97.1    1e-21   
gb|KHF99476.1|  Chlorophyll a-b binding CP29.3, chloroplastic -li...  97.1    2e-21   
ref|XP_006411258.1|  hypothetical protein EUTSA_v10017060mg           96.7    2e-21   
ref|XP_010508915.1|  PREDICTED: chlorophyll a-b binding protein C...  96.7    2e-21   
ref|XP_009143253.1|  PREDICTED: chlorophyll a-b binding protein C...  96.3    2e-21   
ref|XP_002879843.1|  LHCB4.3                                          96.3    2e-21   
gb|AAM65936.1|  putative chlorophyll a/b binding protein              96.3    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181539.1|  light harvesting complex photosystem II             96.3    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006435720.1|  hypothetical protein CICLE_v10032377mg           95.9    4e-21   
emb|CDY61708.1|  BnaC04g56710D                                        96.3    4e-21   
gb|ABD37891.1|  light-harvesting chlorophyll-a/b binding protein ...  94.7    8e-21   Mesostigma viride
gb|EPS71850.1|  hypothetical protein M569_02908                       96.3    1e-20   
gb|KFK36898.1|  hypothetical protein AALP_AA4G187000                  94.0    2e-20   
tpg|DAA05928.1|  TPA: chloroplast light-harvesting complex protei...  94.0    2e-20   
ref|XP_006294771.1|  hypothetical protein CARUB_v10023823mg           93.6    3e-20   
ref|XP_007160589.1|  hypothetical protein PHAVU_001G000400g           93.6    3e-20   
ref|XP_005847149.1|  hypothetical protein CHLNCDRAFT_35818            92.0    1e-19   
ref|XP_011074048.1|  PREDICTED: chlorophyll a-b binding protein o...  91.7    1e-19   
ref|XP_006660507.1|  PREDICTED: chlorophyll a-b binding protein E...  89.7    1e-19   
ref|NP_001240088.1|  uncharacterized protein LOC100786260             91.7    2e-19   
gb|KHN48517.1|  Chlorophyll a-b binding protein 4, chloroplastic      91.7    2e-19   
gb|KHG03743.1|  Chlorophyll a-b binding CP29.3, chloroplastic -li...  90.1    4e-19   
gb|EMT30378.1|  hypothetical protein F775_43807                       88.2    5e-19   
gb|EAZ44119.1|  hypothetical protein OsJ_28744                        89.0    7e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EMS45291.1|  Chlorophyll a-b binding protein 1B-21, chloroplastic  88.6    8e-19   
ref|XP_010664037.1|  PREDICTED: chlorophyll a-b binding protein o...  89.0    1e-18   
gb|AFA36569.1|  putative chlorophyll a/b-binding protein              87.8    1e-18   
ref|XP_006357455.1|  PREDICTED: chlorophyll a-b binding protein C...  89.0    1e-18   
gb|AAB29485.1|  light-harvesting complex I                            87.8    1e-18   Hordeum vulgare [barley]
sp|Q9SDM1.1|CB121_HORVU  RecName: Full=Chlorophyll a-b binding pr...  88.2    1e-18   Hordeum vulgare [barley]
gb|EAZ08502.1|  hypothetical protein OsI_30775                        89.0    2e-18   Oryza sativa Indica Group [Indian rice]
gb|KFM24075.1|  Chlorophyll a-b binding protein CP26, chloroplastic   91.7    2e-18   
ref|NP_001062801.1|  Os09g0296800                                     88.6    2e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004956497.1|  PREDICTED: chlorophyll a-b binding protein 1...  88.6    2e-18   
dbj|BAG96979.1|  unnamed protein product                              86.7    2e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EYU39821.1|  hypothetical protein MIMGU_mgv1a012662mg              88.2    2e-18   
ref|XP_002459987.1|  hypothetical protein SORBIDRAFT_02g020290        88.2    2e-18   Sorghum bicolor [broomcorn]
emb|CBI40786.3|  unnamed protein product                              88.2    3e-18   
ref|XP_011041127.1|  PREDICTED: chlorophyll a-b binding protein 5...  88.2    3e-18   
dbj|BAK01456.1|  predicted protein                                    84.0    3e-18   
dbj|BAH20219.1|  AT3G54890                                            85.9    3e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CAA43590.1|  Type I (26 kD) CP29 polypeptide                      87.4    3e-18   Solanum lycopersicum
gb|ACX71300.1|  chloroplast pigment-binding protein CP26              87.4    3e-18   Capsicum annuum
ref|XP_004241877.1|  PREDICTED: chlorophyll a-b binding protein C...  87.4    4e-18   
emb|CDP11537.1|  unnamed protein product                              87.4    4e-18   
ref|XP_002307004.1|  chlorophyll A-B binding family protein           87.8    4e-18   Populus trichocarpa [western balsam poplar]
ref|XP_009781366.1|  PREDICTED: chlorophyll a-b binding protein C...  87.4    4e-18   
ref|XP_002451621.1|  hypothetical protein SORBIDRAFT_04g004770        87.0    4e-18   Sorghum bicolor [broomcorn]
ref|XP_011041125.1|  PREDICTED: chlorophyll a-b binding protein 5...  87.8    4e-18   
gb|ABK23427.1|  unknown                                               87.0    4e-18   Picea sitchensis
ref|XP_009769851.1|  PREDICTED: chlorophyll a-b binding protein 6...  87.0    4e-18   
ref|NP_192772.1|  chlorophyll a-b binding protein CP26                87.4    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009609516.1|  PREDICTED: chlorophyll a-b binding protein 6...  87.0    4e-18   
gb|AAM65487.1|  chlorophyll a/b-binding protein-like                  87.4    4e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AFW70295.1|  hypothetical protein ZEAMMB73_802965                  85.5    4e-18   
ref|XP_011041126.1|  PREDICTED: chlorophyll a-b binding protein 5...  87.8    4e-18   
ref|XP_009616313.1|  PREDICTED: chlorophyll a-b binding protein C...  87.4    4e-18   
ref|XP_006403518.1|  hypothetical protein EUTSA_v10010669mg           85.5    4e-18   
gb|ABK26977.1|  unknown                                               87.0    4e-18   Picea sitchensis
gb|ACO06087.1|  chlorophyll a-b binding protein                       87.4    4e-18   Triticum aestivum [Canadian hard winter wheat]
gb|KFM24280.1|  Chlorophyll a-b binding protein 3C, chloroplastic     87.0    4e-18   
ref|XP_006288402.1|  hypothetical protein CARUB_v10001659mg           87.0    5e-18   
ref|XP_010246736.1|  PREDICTED: chlorophyll a-b binding protein o...  87.4    5e-18   
ref|XP_010455433.1|  PREDICTED: chlorophyll a-b binding protein C...  87.0    5e-18   
ref|XP_011095097.1|  PREDICTED: chlorophyll a-b binding protein C...  87.0    5e-18   
ref|XP_004499329.1|  PREDICTED: chlorophyll a-b binding protein t...  87.0    5e-18   
ref|XP_010437187.1|  PREDICTED: chlorophyll a-b binding protein C...  87.0    5e-18   
ref|XP_002872508.1|  hypothetical protein ARALYDRAFT_489877           87.0    5e-18   
ref|XP_003577951.1|  PREDICTED: chlorophyll a-b binding protein o...  87.4    5e-18   
dbj|BAK02397.1|  predicted protein                                    87.4    5e-18   
ref|XP_008453995.1|  PREDICTED: chlorophyll a-b binding protein 6...  86.7    5e-18   
ref|XP_004499328.1|  PREDICTED: chlorophyll a-b binding protein t...  87.4    5e-18   
ref|XP_002264295.1|  PREDICTED: chlorophyll a-b binding protein C...  87.0    5e-18   Vitis vinifera
emb|CAA45523.1|  photosystem I light-harvesting chlorophyll a/b-b...  86.7    5e-18   Nicotiana tabacum [American tobacco]
ref|XP_010246735.1|  PREDICTED: chlorophyll a-b binding protein o...  87.8    5e-18   
gb|ABK55743.1|  chloroplast type III LHCII CAB precursor protein      83.6    5e-18   Cucumis sativus [cucumbers]
ref|XP_009792367.1|  PREDICTED: chlorophyll a-b binding protein 6...  86.7    5e-18   
gb|ACA66263.1|  chloroplast chlorophyll a/b binding protein precu...  87.0    6e-18   
gb|ABR25552.1|  chloroplast chlorophyll a-b binding proteinr          86.3    6e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_004143800.1|  PREDICTED: chlorophyll a-b binding protein 6...  86.7    6e-18   
gb|ABX47017.1|  chloroplast chlorophyll a/b binding protein cab-PhE9  87.0    6e-18   Phyllostachys edulis [kikko-chiku]
gb|KHN30537.1|  Chlorophyll a-b binding protein CP26, chloroplastic   85.1    6e-18   
gb|ABK21181.1|  unknown                                               87.0    6e-18   Picea sitchensis
gb|ACN40433.1|  unknown                                               87.0    6e-18   Picea sitchensis
gb|ABK23158.1|  unknown                                               87.0    6e-18   Picea sitchensis
gb|AAX95979.1|  chlorophyll a/b-binding protein CP26 precursor - ...  86.3    6e-18   Oryza sativa Japonica Group [Japonica rice]
emb|CAA41405.1|  Type 1 chlorophyll a /b-binding protein              85.9    6e-18   Pinus sylvestris [Scotch pine]
gb|ACN40554.1|  unknown                                               86.7    6e-18   Picea sitchensis
ref|XP_004965344.1|  PREDICTED: chlorophyll a-b binding protein 1...  87.0    6e-18   
ref|XP_010542365.1|  PREDICTED: chlorophyll a-b binding protein C...  86.7    6e-18   
gb|ABK23587.1|  unknown                                               87.0    6e-18   Picea sitchensis
gb|EPS58306.1|  hypothetical protein M569_16509                       85.5    7e-18   
ref|XP_010032204.1|  PREDICTED: chlorophyll a-b binding protein 6...  86.3    8e-18   
gb|AFW70293.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...  86.7    8e-18   
gb|ABG22426.1|  Chlorophyll A-B binding protein, expressed            85.9    8e-18   
gb|KCW51604.1|  hypothetical protein EUGRSUZ_J01096                   86.3    8e-18   
ref|XP_006403519.1|  hypothetical protein EUTSA_v10010669mg           85.1    8e-18   
emb|CAA41404.1|  Type 1 chlorophyll a /b-binding protein              86.3    8e-18   Pinus sylvestris [Scotch pine]
ref|XP_009590581.1|  PREDICTED: chlorophyll a-b binding protein 6...  86.3    8e-18   
gb|KDO48421.1|  hypothetical protein CISIN_1g025577mg                 86.3    8e-18   
ref|XP_009134190.1|  PREDICTED: chlorophyll a-b binding protein C...  86.3    9e-18   
ref|XP_003577654.1|  PREDICTED: chlorophyll a-b binding protein C...  86.3    9e-18   
emb|CDY05098.1|  BnaC03g28960D                                        86.3    9e-18   
ref|XP_006291772.1|  hypothetical protein CARUB_v10017942mg           85.9    9e-18   
ref|XP_002878004.1|  hypothetical protein ARALYDRAFT_485905           85.9    9e-18   
ref|XP_006342200.1|  PREDICTED: chlorophyll a-b binding protein o...  86.7    9e-18   
ref|XP_006656037.1|  PREDICTED: chlorophyll a-b binding protein 1...  85.9    9e-18   
gb|AAG40043.2|AF324692_1  AT3g54890                                   85.9    9e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009379890.1|  PREDICTED: chlorophyll a-b binding protein C...  84.3    9e-18   
emb|CDX90755.1|  BnaA03g24350D                                        86.3    9e-18   
ref|XP_010554984.1|  PREDICTED: chlorophyll a-b binding protein 6...  85.5    9e-18   
ref|NP_001141936.1|  uncharacterized protein LOC100274085             84.7    1e-17   Zea mays [maize]
ref|XP_006436282.1|  hypothetical protein CICLE_v10032568mg           85.9    1e-17   
gb|EAY80485.1|  hypothetical protein OsI_35663                        86.3    1e-17   Oryza sativa Indica Group [Indian rice]
pdb|2O01|1  Chain 1, The Structure Of A Plant Photosystem I Super...  85.1    1e-17   
emb|CDY60092.1|  BnaC02g46810D                                        86.3    1e-17   
ref|XP_006397075.1|  hypothetical protein EUTSA_v10028871mg           86.3    1e-17   
gb|KDO42915.1|  hypothetical protein CISIN_1g0225291mg                85.1    1e-17   
ref|XP_004238472.1|  PREDICTED: chlorophyll a-b binding protein o...  86.7    1e-17   
ref|XP_009404292.1|  PREDICTED: chlorophyll a-b binding protein C...  86.3    1e-17   
ref|XP_010504318.1|  PREDICTED: chlorophyll a-b binding protein 6...  85.9    1e-17   
ref|NP_191049.1|  chlorophyll a-b binding protein 6                   85.9    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007201856.1|  hypothetical protein PRUPE_ppa009496mg           86.3    1e-17   
gb|ACN30800.1|  unknown                                               85.1    1e-17   Zea mays [maize]
ref|NP_001148183.1|  chlorophyll a-b binding protein 6A               85.9    1e-17   Zea mays [maize]
ref|NP_001067593.1|  Os11g0242800                                     85.9    1e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010099628.1|  Chlorophyll a-b binding protein 6A               85.9    1e-17   
ref|XP_009404293.1|  PREDICTED: chlorophyll a-b binding protein C...  85.9    1e-17   
gb|ABV82714.1|  chloroplast chlorophyll a/b binding protein precu...  85.9    1e-17   Phyllostachys edulis [kikko-chiku]
ref|XP_008237804.1|  PREDICTED: chlorophyll a-b binding protein C...  85.9    1e-17   
gb|KFK34731.1|  hypothetical protein AALP_AA5G185400                  85.5    1e-17   
ref|XP_001695927.1|  minor chlorophyll a-b binding protein of pho...  85.9    1e-17   Chlamydomonas reinhardtii
ref|XP_009116169.1|  PREDICTED: chlorophyll a-b binding protein 6...  85.5    1e-17   
ref|XP_010264706.1|  PREDICTED: chlorophyll a-b binding protein 6...  85.5    1e-17   
gb|KDP37799.1|  hypothetical protein JCGZ_06701                       85.9    1e-17   
gb|EYU22686.1|  hypothetical protein MIMGU_mgv1a011290mg              85.9    1e-17   
emb|CDX78277.1|  BnaA09g34720D                                        85.5    1e-17   
gb|AHA84131.1|  chloroplast pigment-binding protein CP26              85.9    1e-17   
emb|CDX73435.1|  BnaC08g25680D                                        85.5    1e-17   
gb|KFK31990.1|  hypothetical protein AALP_AA6G185900                  85.9    1e-17   
gb|ACN28940.1|  unknown                                               84.3    1e-17   Zea mays [maize]
gb|ABD37916.1|  light-harvesting chlorophyll-a/b binding protein ...  85.5    1e-17   Chlamydomonas incerta
emb|CDY07517.1|  BnaC06g15470D                                        85.5    1e-17   
ref|XP_010928786.1|  PREDICTED: chlorophyll a-b binding protein o...  85.9    2e-17   
ref|NP_001057513.1|  Os06g0320500                                     85.5    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008246201.1|  PREDICTED: chlorophyll a-b binding protein 6...  84.0    2e-17   
ref|XP_006836916.1|  hypothetical protein AMTR_s00099p00139960        85.9    2e-17   
ref|XP_009103939.1|  PREDICTED: chlorophyll a-b binding protein 6...  85.5    2e-17   
ref|XP_006403520.1|  hypothetical protein EUTSA_v10010669mg           85.5    2e-17   
ref|XP_008781977.1|  PREDICTED: chlorophyll a-b binding protein C...  85.5    2e-17   
gb|ABW90989.1|  LHCB5                                                 85.5    2e-17   
ref|XP_007143915.1|  hypothetical protein PHAVU_007G113000g           85.5    2e-17   
ref|XP_006662849.1|  PREDICTED: chlorophyll a-b binding protein C...  85.5    2e-17   
ref|XP_005651078.1|  chlorophyll a/b-binding protein P25              85.1    2e-17   
ref|XP_002519950.1|  chlorophyll A/B binding protein, putative        85.5    2e-17   
ref|XP_010529700.1|  PREDICTED: chlorophyll a-b binding protein C...  85.5    2e-17   
gb|AFK41379.1|  unknown                                               83.6    2e-17   
ref|WP_039310936.1|  hypothetical protein                             85.1    2e-17   
ref|XP_003563900.1|  PREDICTED: chlorophyll a-b binding protein 1...  85.1    2e-17   
ref|XP_002312019.1|  putative chlorophyll a/b-binding family protein  85.1    2e-17   
ref|XP_009379892.1|  PREDICTED: chlorophyll a-b binding protein C...  83.6    2e-17   
gb|AEX55237.1|  chloroplast chlorophyll a/b binding protein cab-BO3   85.1    2e-17   
ref|XP_007019741.1|  Light harvesting complex of photosystem II 5...  84.7    2e-17   
ref|XP_010063732.1|  PREDICTED: chlorophyll a-b binding protein C...  85.1    3e-17   
ref|XP_007019740.1|  Light harvesting complex of photosystem II 5...  85.1    3e-17   
gb|KHN05032.1|  Chlorophyll a-b binding protein CP26, chloroplastic   85.1    3e-17   
gb|KEH40269.1|  light-harvesting complex I chlorophyll A/B-bindin...  85.1    3e-17   
ref|XP_003536189.1|  PREDICTED: chlorophyll a-b binding protein C...  85.1    3e-17   
ref|XP_010669870.1|  PREDICTED: chlorophyll a-b binding protein C...  85.1    3e-17   
ref|XP_002450563.1|  hypothetical protein SORBIDRAFT_05g007070        84.7    3e-17   
gb|KDO42914.1|  hypothetical protein CISIN_1g0225291mg                84.7    3e-17   
gb|ACU19528.1|  unknown                                               84.7    3e-17   
ref|NP_001149586.1|  chlorophyll a-b binding protein 6A               84.3    3e-17   
ref|XP_003556402.2|  PREDICTED: chlorophyll a-b binding protein C...  84.7    4e-17   
gb|KDO42913.1|  hypothetical protein CISIN_1g0225291mg                84.7    4e-17   
ref|XP_007201239.1|  hypothetical protein PRUPE_ppa010511mg           84.3    4e-17   
gb|KDO42910.1|  hypothetical protein CISIN_1g0225291mg                84.7    4e-17   
ref|XP_004300672.1|  PREDICTED: chlorophyll a-b binding protein C...  84.7    4e-17   
gb|AEJ88274.1|  putative chlorophyll a/b binding protein              84.7    4e-17   
ref|XP_006478298.1|  PREDICTED: chlorophyll a-b binding protein C...  84.7    4e-17   
ref|XP_006441835.1|  hypothetical protein CICLE_v10021452mg           84.7    4e-17   
ref|XP_009386318.1|  PREDICTED: chlorophyll a-b binding protein 6...  84.3    4e-17   
gb|AAF44702.1|AF241524_1  chlorophyll a/b-binding protein type I      83.2    4e-17   
ref|XP_005651891.1|  chlorophyll a/b-binding protein                  84.7    4e-17   
gb|ACO06083.1|  chlorophyll a-b binding protein                       84.3    4e-17   
gb|KDO42911.1|  hypothetical protein CISIN_1g0225291mg                84.7    4e-17   
ref|XP_008236448.1|  PREDICTED: chlorophyll a-b binding protein 6...  84.3    4e-17   
ref|XP_008782824.1|  PREDICTED: chlorophyll a-b binding protein o...  84.3    4e-17   
tpg|DAA05899.1|  TPA: chloroplast light-harvesting complex II pro...  84.0    5e-17   
gb|KDO42909.1|  hypothetical protein CISIN_1g0225291mg                84.3    5e-17   
ref|XP_002980072.1|  light-harvesting complex                         84.3    5e-17   
tpg|DAA05896.1|  TPA: chloroplast light-harvesting complex II pro...  84.3    5e-17   
gb|KCW68163.1|  hypothetical protein EUGRSUZ_F01826                   84.0    5e-17   
ref|XP_004512591.1|  PREDICTED: chlorophyll a-b binding protein C...  84.3    5e-17   
ref|XP_010693392.1|  PREDICTED: chlorophyll a-b binding protein 6...  84.0    5e-17   
emb|CAA43633.1|  light harvesting chlorophyll a /b binding protei...  87.4    5e-17   
gb|KDP36725.1|  hypothetical protein JCGZ_08016                       84.7    5e-17   
ref|XP_008651122.1|  PREDICTED: uncharacterized protein LOC100274...  84.3    5e-17   
ref|XP_010061245.1|  PREDICTED: chlorophyll a-b binding protein o...  84.3    6e-17   
gb|AFK48966.1|  unknown                                               84.0    6e-17   
ref|XP_010910942.1|  PREDICTED: chlorophyll a-b binding protein C...  84.0    6e-17   
ref|XP_002949400.1|  hypothetical protein VOLCADRAFT_104309           84.0    6e-17   
ref|XP_009378087.1|  PREDICTED: chlorophyll a-b binding protein 6...  84.0    6e-17   
dbj|BAO50255.1|  chloroplast chlorophyll AB-binding protein CP26      82.8    6e-17   
gb|AFK33642.1|  unknown                                               83.6    6e-17   
gb|AGV54683.1|  chlorophyll A/B binding protein CP26 chloroplasti...  84.0    6e-17   
ref|XP_010112070.1|  Chlorophyll a-b binding protein CP26             84.7    6e-17   
ref|XP_010930383.1|  PREDICTED: chlorophyll a-b binding protein C...  84.0    7e-17   
ref|XP_008808974.1|  PREDICTED: chlorophyll a-b binding protein C...  84.0    7e-17   
ref|XP_010939425.1|  PREDICTED: chlorophyll a-b binding protein 4...  84.0    7e-17   
gb|KHG19902.1|  Chlorophyll a-b binding CP26, chloroplastic -like...  84.0    7e-17   
gb|KEH26439.1|  light-harvesting complex I chlorophyll A/B-bindin...  84.0    7e-17   
emb|CAA78900.1|  Lhcb5 protein                                        84.0    7e-17   
gb|KEH26440.1|  light-harvesting complex I chlorophyll A/B-bindin...  84.0    7e-17   
emb|CDY43197.1|  BnaA07g07570D                                        80.9    7e-17   
ref|XP_008807305.1|  PREDICTED: chlorophyll a-b binding protein 6...  83.6    7e-17   
gb|ACD13267.1|  chlorophyll a/b binding protein precursor             83.2    7e-17   
gb|KDO42912.1|  hypothetical protein CISIN_1g0225291mg                84.0    7e-17   
emb|CDP07244.1|  unnamed protein product                              84.0    8e-17   
ref|XP_004307395.1|  PREDICTED: chlorophyll a-b binding protein 6...  83.6    8e-17   
ref|XP_010906487.1|  PREDICTED: chlorophyll a-b binding protein 6...  83.6    8e-17   
ref|XP_008356411.1|  PREDICTED: chlorophyll a-b binding protein 1...  82.4    8e-17   
gb|AGV54517.1|  chlorophyll a-b binding protein CP26, chloroplast...  83.6    8e-17   
ref|XP_011031762.1|  PREDICTED: chlorophyll a-b binding protein 6...  83.6    8e-17   
gb|AAL00919.1|AF398741_1  ASCAB9-C                                    82.4    8e-17   
ref|NP_001289224.1|  chlorophyll a-b binding protein CP26, chloro...  83.6    8e-17   
gb|AAL00907.1|AF398729_1  ASCAB9-A                                    82.4    8e-17   
ref|XP_006490397.1|  PREDICTED: chlorophyll a-b binding protein 1...  83.6    8e-17   
gb|AAL00912.1|AF398734_1  ASCAB9-C                                    82.4    9e-17   
gb|AAL00901.1|AF398723_1  ASCAB9-A                                    82.4    9e-17   
ref|XP_009370660.1|  PREDICTED: chlorophyll a-b binding protein C...  83.6    9e-17   
gb|ABU42593.1|  ASCAB9                                                82.4    9e-17   
gb|AAL00920.1|AF398742_1  ASCAB9                                      82.4    9e-17   
gb|KDO52039.1|  hypothetical protein CISIN_1g016235mg                 84.0    9e-17   
ref|XP_003548249.1|  PREDICTED: chlorophyll a-b binding protein C...  83.6    9e-17   
gb|ACU23386.1|  unknown                                               83.6    9e-17   
gb|KDO52042.1|  hypothetical protein CISIN_1g016235mg                 83.6    9e-17   
ref|XP_007152414.1|  hypothetical protein PHAVU_004G128200g           83.6    9e-17   
ref|XP_004978995.1|  PREDICTED: chlorophyll a-b binding protein C...  83.6    9e-17   
gb|AAB34068.1|  light-harvesting complex b type 3, Lhcb3              81.3    9e-17   
gb|KHN27863.1|  Chlorophyll a-b binding protein CP26, chloroplastic   83.6    9e-17   
ref|XP_008356405.1|  PREDICTED: chlorophyll a-b binding protein C...  83.6    9e-17   
ref|XP_010252321.1|  PREDICTED: chlorophyll a-b binding protein C...  83.6    9e-17   
ref|NP_001105698.1|  light harvesting chlorophyll a/b binding pro...  83.6    1e-16   
ref|XP_008237889.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophyll ...  84.0    1e-16   
ref|XP_007209349.1|  hypothetical protein PRUPE_ppa008546mg           84.0    1e-16   
gb|EAZ00730.1|  hypothetical protein OsI_22755                        83.2    1e-16   
ref|XP_008391856.1|  PREDICTED: chlorophyll a-b binding protein C...  83.6    1e-16   
gb|ACF82848.1|  unknown                                               83.6    1e-16   
gb|AAA34140.1|  chlorophyll a/b-binding protein                       83.2    1e-16   
ref|NP_001105374.1|  chlorophyll a/b-binding apoprotein CP26 prec...  83.6    1e-16   
gb|KFK27185.1|  hypothetical protein AALP_AA8G347200                  82.0    1e-16   
ref|XP_008368787.1|  PREDICTED: chlorophyll a-b binding protein 6...  83.6    1e-16   
emb|CDY30369.1|  BnaA09g09080D                                        81.6    1e-16   
ref|XP_004239673.1|  PREDICTED: chlorophyll a-b binding protein 6...  83.2    1e-16   
ref|XP_002984009.1|  light-harvesting complex                         83.2    1e-16   
ref|XP_001779229.1|  predicted protein                                83.2    1e-16   
ref|XP_007028794.1|  Light-harvesting complex II protein Lhcb7        84.0    1e-16   
ref|XP_010537249.1|  PREDICTED: chlorophyll a-b binding protein o...  83.6    1e-16   
ref|XP_006854492.1|  hypothetical protein AMTR_s00175p00040360        82.8    1e-16   
ref|XP_008782823.1|  PREDICTED: chlorophyll a-b binding protein o...  83.6    1e-16   
gb|KDO52040.1|  hypothetical protein CISIN_1g016235mg                 83.6    1e-16   
ref|XP_002510744.1|  chlorophyll A/B binding protein, putative        83.6    1e-16   
ref|XP_011077002.1|  PREDICTED: chlorophyll a-b binding protein 6...  82.8    1e-16   
ref|XP_009419140.1|  PREDICTED: chlorophyll a-b binding protein o...  83.6    1e-16   
ref|XP_006490396.1|  PREDICTED: chlorophyll a-b binding protein 1...  83.6    1e-16   
ref|XP_009406797.1|  PREDICTED: chlorophyll a-b binding protein 6...  82.8    1e-16   
tpg|DAA05907.1|  TPA: chloroplast light-harvesting complex II pro...  82.8    1e-16   
ref|XP_010253634.1|  PREDICTED: chlorophyll a-b binding protein 6...  82.8    1e-16   
tpg|DAA05905.1|  TPA: chloroplast light-harvesting complex II pro...  82.8    1e-16   
ref|XP_006345801.1|  PREDICTED: chlorophyll a-b binding protein 6...  82.8    1e-16   
ref|XP_009419141.1|  PREDICTED: chlorophyll a-b binding protein o...  83.2    1e-16   
ref|XP_006345799.1|  PREDICTED: chlorophyll a-b binding protein 6...  82.8    1e-16   
ref|XP_009390779.1|  PREDICTED: chlorophyll a-b binding protein C...  83.2    1e-16   
pdb|3LW5|1  Chain 1, Improved Model Of Plant Photosystem I            81.6    1e-16   
gb|ABU42594.1|  ASCAB9                                                81.6    1e-16   
gb|KFK42074.1|  hypothetical protein AALP_AA2G207800                  84.0    1e-16   
gb|KDP25717.1|  hypothetical protein JCGZ_23938                       82.8    1e-16   
gb|KDO52037.1|  hypothetical protein CISIN_1g016235mg                 84.0    2e-16   
gb|AHA84265.1|  chlorophyll a-b binding protein CP26                  82.8    2e-16   
ref|XP_006490395.1|  PREDICTED: chlorophyll a-b binding protein 1...  84.0    2e-16   
ref|XP_003534048.2|  PREDICTED: chlorophyll a-b binding protein C...  83.2    2e-16   
ref|XP_004141516.1|  PREDICTED: chlorophyll a-b binding protein C...  82.8    2e-16   
gb|ABK23400.1|  unknown                                               82.4    2e-16   
ref|XP_006390178.1|  hypothetical protein EUTSA_v10018862mg           83.2    2e-16   
ref|XP_008459494.1|  PREDICTED: chlorophyll a-b binding protein C...  82.8    2e-16   
gb|EMT31406.1|  Chlorophyll a-b binding protein E, chloroplastic      81.6    2e-16   
gb|AEZ52400.1|  LHCII type III chlorophyll a/b binding protein        82.4    2e-16   
ref|XP_001778909.1|  predicted protein                                82.0    2e-16   
gb|AAC79711.1|  chlorophyll a/b binding protein                       82.4    2e-16   
ref|XP_006849920.1|  hypothetical protein AMTR_s00022p00112770        82.8    2e-16   
tpg|DAA05898.1|  TPA: chloroplast light-harvesting complex II pro...  81.6    2e-16   
ref|XP_006390176.1|  hypothetical protein EUTSA_v10018862mg           82.4    2e-16   
ref|XP_004169873.1|  PREDICTED: chlorophyll a-b binding protein o...  82.8    2e-16   
ref|XP_011069518.1|  PREDICTED: chlorophyll a-b binding protein 1D    79.7    2e-16   
gb|AFW73580.1|  hypothetical protein ZEAMMB73_964613                  80.9    2e-16   
gb|EEC74057.1|  hypothetical protein OsI_09055                        82.4    2e-16   
ref|NP_001048216.1|  Os02g0764500                                     82.4    2e-16   
ref|XP_010094495.1|  Chlorophyll a-b binding protein of LHCII typ...  82.4    2e-16   
dbj|BAD52991.1|  a/b-binding protein precursor-like                   79.3    2e-16   
ref|XP_010243712.1|  PREDICTED: chlorophyll a-b binding protein 1D    79.3    2e-16   
ref|XP_004170569.1|  PREDICTED: chlorophyll a-b binding protein 8...  79.0    2e-16   
tpg|DAA05914.1|  TPA: chloroplast light-harvesting complex II pro...  82.0    2e-16   
dbj|BAJ98426.1|  predicted protein                                    82.0    3e-16   
gb|KDO78113.1|  hypothetical protein CISIN_1g034317mg                 79.3    3e-16   
ref|XP_006587015.1|  PREDICTED: chlorophyll a-b binding protein o...  79.3    3e-16   
ref|XP_008377758.1|  PREDICTED: chlorophyll a-b binding protein 6...  81.6    3e-16   
gb|KHF98823.1|  Chlorophyll a-b binding 6A, chloroplastic             82.0    3e-16   
ref|XP_007151995.1|  hypothetical protein PHAVU_004G0929000g          79.3    3e-16   
ref|XP_009788731.1|  PREDICTED: chlorophyll a-b binding protein o...  82.4    3e-16   
gb|AAA33704.1|  Major Cab protein                                     80.1    3e-16   
ref|XP_009595950.1|  PREDICTED: chlorophyll a-b binding protein o...  82.4    3e-16   
ref|XP_006657834.1|  PREDICTED: chlorophyll a-b binding protein o...  82.0    3e-16   
sp|P10707.1|CB2D_SOLLC  RecName: Full=Chlorophyll a-b binding pro...  79.7    3e-16   
gb|KFK27045.1|  hypothetical protein AALP_AA8G327200                  82.0    3e-16   
ref|XP_009788730.1|  PREDICTED: chlorophyll a-b binding protein o...  82.4    3e-16   
gb|AHM26628.1|  a-b binding protein                                   81.6    3e-16   
ref|NP_001059991.1|  Os07g0562700                                     82.0    3e-16   
ref|XP_008381981.1|  PREDICTED: chlorophyll a-b binding protein 6...  81.6    3e-16   
gb|EMT23001.1|  putative Chlorophyll a-b binding protein 1C, chlo...  79.7    3e-16   
gb|EAZ04342.1|  hypothetical protein OsI_26482                        82.0    3e-16   
ref|XP_004958023.1|  PREDICTED: chlorophyll a-b binding protein o...  82.0    3e-16   
gb|AFW90594.1|  chloroplast chlorophyll a/b binding protein           82.0    3e-16   
emb|CDY45980.1|  BnaA02g18160D                                        82.4    3e-16   
ref|XP_002460856.1|  hypothetical protein SORBIDRAFT_02g036380        82.0    3e-16   
gb|AAL00902.1|AF398724_1  ASCAB9-A                                    80.9    3e-16   
gb|AAA34150.1|  chlorophyll a/b-binding protein Cab-1A                79.3    4e-16   
ref|XP_004954021.1|  PREDICTED: chlorophyll a-b binding protein P...  82.0    4e-16   
ref|WP_039311891.1|  hypothetical protein                             79.3    4e-16   
gb|AAL00905.1|AF398727_1  ASCAB9-A                                    80.9    4e-16   
tpg|DAA63127.1|  TPA: chlorophyll a-b binding protein of LHCII ty...  81.6    4e-16   
dbj|BAH56768.1|  AT5G54270                                            80.5    4e-16   
gb|AAA33702.1|  Major Cab protein                                     79.7    4e-16   
ref|XP_009128183.1|  PREDICTED: chlorophyll a-b binding protein o...  82.0    4e-16   
ref|XP_008373346.1|  PREDICTED: chlorophyll a-b binding protein o...  82.4    4e-16   
ref|NP_001150523.1|  chlorophyll a-b binding protein of LHCII typ...  81.6    4e-16   
ref|XP_001786046.1|  predicted protein                                81.6    4e-16   
ref|XP_004149296.1|  PREDICTED: chlorophyll a-b binding protein 1...  81.6    4e-16   
ref|XP_009113607.1|  PREDICTED: chlorophyll a-b binding protein C...  81.6    4e-16   
gb|KHG25903.1|  Chlorophyll a-b binding 6A, chloroplastic             81.6    4e-16   
gb|ACU23974.1|  unknown                                               81.6    4e-16   
gb|AIB55756.1|  chlorophyll a-b binding protein 1C, partial (chlo...  80.5    4e-16   
ref|XP_002951424.1|  chlorophyll a/b-binding protein of photosyst...  82.0    4e-16   
ref|XP_010275544.1|  PREDICTED: chlorophyll a-b binding protein o...  81.6    4e-16   
ref|NP_001289245.1|  chlorophyll a-b binding protein of LHCII type 1  82.0    4e-16   
ref|XP_009409310.1|  PREDICTED: chlorophyll a-b binding protein 4...  81.6    4e-16   
gb|AAL00924.1|AF398746_1  ASCAB9                                      80.5    4e-16   
sp|P27523.1|CB23_HORVU  RecName: Full=Chlorophyll a-b binding pro...  81.6    5e-16   
gb|EMT03206.1|  Chlorophyll a-b binding protein CP26, chloroplastic   81.6    5e-16   
gb|ABN46977.1|  chlorophyll a/b-binding protein                       81.6    5e-16   
ref|XP_002966149.1|  light-harvesting complex                         81.3    5e-16   
gb|AGZ15394.1|  photosystem I light-harvesting chlorophyll a/b-bi...  81.3    5e-16   
gb|EMS52019.1|  Chlorophyll a-b binding protein P4, chloroplastic     81.3    5e-16   
gb|EMT32357.1|  Chlorophyll a-b binding protein of LHCII type III...  81.3    5e-16   
gb|EMS46762.1|  Chlorophyll a-b binding protein of LHCII type III...  81.3    5e-16   
gb|ABU42592.1|  ASCAB9                                                80.5    5e-16   
ref|XP_009609717.1|  PREDICTED: chlorophyll a-b binding protein 1D    79.3    5e-16   
ref|XP_002982144.1|  light-harvesting complex                         81.3    5e-16   
gb|AAT42191.1|  chloroplast chlorophyll a-b binding protein           80.9    5e-16   
emb|CAA44777.1|  Precursor of CP29, core chlorophyll a/b binding ...  81.3    5e-16   
ref|XP_009102801.1|  PREDICTED: chlorophyll a-b binding protein 1...  81.3    5e-16   
ref|XP_006302513.1|  hypothetical protein CARUB_v10020611mg           81.6    5e-16   
ref|XP_003562898.1|  PREDICTED: chlorophyll a-b binding protein o...  81.3    5e-16   
ref|XP_006410587.1|  hypothetical protein EUTSA_v10017088mg           81.3    5e-16   
ref|XP_001773300.1|  predicted protein                                80.5    5e-16   
gb|ACD13266.1|  chlorophyll a/b binding protein precursor             80.9    5e-16   
ref|XP_006401590.1|  hypothetical protein EUTSA_v10014406mg           81.3    6e-16   
ref|XP_002945875.1|  light harvesting complex a protein               80.9    6e-16   
dbj|BAJ15879.1|  chlorophyll a/b binding protein-like protein         79.3    6e-16   



>ref|XP_011095216.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Sesamum indicum]
Length=360

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKRIYPGG YFDPLGLA+DPE+KARLQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  277  AELDPEKRIYPGGSYFDPLGLAADPEKKARLQLAEIKHARLAMVAFLGFAVQAAATGKGP  336

Query  181  LNNWATHLGDPFHTTILDTLGLIS  252
            LNNWATHL DP HTTILDT GL S
Sbjct  337  LNNWATHLSDPLHTTILDTFGLFS  360



>gb|KHN13315.1| Chlorophyll a-b binding protein CP29.2, chloroplastic [Glycine 
soja]
Length=144

 Score =   150 bits (379),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDPE+KA LQLAEIKHARLAMV FLGF++QAAATGKGP
Sbjct  61   AELDPEKRLYPGGSYFDPLGLASDPEKKATLQLAEIKHARLAMVGFLGFAVQAAATGKGP  120

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  121  LNNWATHLSDPLHTTIIDTF  140



>emb|CBL86548.1| chlorophyll a/b binding protein [Olea europaea]
Length=179

 Score =   151 bits (381),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AE+DPEKR YPGG +FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  96   AEVDPEKRXYPGGSFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAAATGKGP  155

Query  181  LNNWATHLGDPFHTTILDTLGLIS  252
            LNNWATHL DP HTTILDT G  S
Sbjct  156  LNNWATHLSDPLHTTILDTFGFFS  179



>ref|XP_009388349.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=290

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGKYFDPLGLASDPE+KA LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  205  AELDPEKRLYPGGKYFDPLGLASDPEKKATLQLAEIKHARLAMVAFLGFAVQAAATGKGP  264

Query  181  LNNWATHLGDPFHTTILDTLGLISS  255
            LNNWATHL DP HTTI+D +   SS
Sbjct  265  LNNWATHLSDPLHTTIIDNVFFASS  289



>gb|EYU26660.1| hypothetical protein MIMGU_mgv1a011247mg [Erythranthe guttata]
Length=288

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPE+R+YPGG YFDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  205  AELDPEQRLYPGGSYFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAAATGKGP  264

Query  181  LNNWATHLGDPFHTTILDTLGLIS  252
            LNNWATHL DP HTTILDT G  S
Sbjct  265  LNNWATHLSDPLHTTILDTFGFFS  288



>ref|XP_008800353.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Phoenix dactylifera]
Length=289

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLASDPE+KA LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  206  AELDPEKRLYPGGKFFDPLGLASDPEKKATLQLAEIKHARLAMVAFLGFAVQAAATGKGP  265

Query  181  LNNWATHLGDPFHTTILDTLGLIS  252
            LNNW THL DP HTTILDT  L S
Sbjct  266  LNNWVTHLSDPLHTTILDTFSLFS  289



>gb|AHM26630.1| a-b binding protein [Pyrus x bretschneideri]
Length=142

 Score =   147 bits (371),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QAA TGKGP
Sbjct  61   AELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAAVTGKGP  120

Query  181  LNNWATHLGDPFHTTILD  234
            LNNWATHL DP HTTI+D
Sbjct  121  LNNWATHLSDPLHTTIID  138



>ref|XP_002463016.1| hypothetical protein SORBIDRAFT_02g036260 [Sorghum bicolor]
 gb|EER99537.1| hypothetical protein SORBIDRAFT_02g036260 [Sorghum bicolor]
Length=288

 Score =   151 bits (382),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLA+DPE+K RLQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  205  AELDPEKRLYPGGSYFDPLGLAADPEKKERLQLAEIKHARLAMVAFLGFAVQAAATGKGP  264

Query  181  LNNWATHLGDPFHTTILDTLGLIS  252
            LNNWATHL DP HTTI DT G  S
Sbjct  265  LNNWATHLSDPLHTTIFDTFGASS  288



>gb|EAZ40279.1| hypothetical protein OsJ_24721 [Oryza sativa Japonica Group]
Length=267

 Score =   150 bits (380),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDPE+K RLQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  184  AELDPEKRLYPGGSYFDPLGLASDPEKKERLQLAEIKHARLAMVAFLGFAVQAAATGKGP  243

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI DT 
Sbjct  244  LNNWATHLSDPLHTTIFDTF  263



>gb|EMS60898.1| Chlorophyll a-b binding protein CP29.2, chloroplastic [Triticum 
urartu]
Length=206

 Score =   149 bits (375),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPE+R+YPGG YFDPLGLA+DPE+K  LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  124  AELDPERRLYPGGSYFDPLGLAADPEKKETLQLAEIKHARLAMVAFLGFAVQAAATGKGP  183

Query  181  LNNWATHLGDPFHTTILDTLG  243
            LNNWATHL DP HTTI DTLG
Sbjct  184  LNNWATHLSDPLHTTIFDTLG  204



>ref|XP_004246325.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Solanum lycopersicum]
Length=285

 Score =   151 bits (381),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG +FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  202  AELDPEKRLYPGGSFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAAATGKGP  261

Query  181  LNNWATHLGDPFHTTILDTLGLIS  252
            LNNWATHL DP HTTI DT G  S
Sbjct  262  LNNWATHLSDPLHTTIFDTFGFFS  285



>gb|ACO51068.1| chloroplast chlorophyll A-B binding protein [Gossypium hirsutum]
Length=285

 Score =   151 bits (381),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGKYFDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  204  AELDPEKRLYPGGKYFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAAATGKGP  263

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  264  LNNWATHLSDPLHTTIIDTF  283



>gb|ABK95186.1| unknown [Populus trichocarpa]
Length=142

 Score =   147 bits (370),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG +FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QA  TGKGP
Sbjct  61   AELDPEKRLYPGGNFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAWVTGKGP  120

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DTL
Sbjct  121  LNNWATHLSDPLHTTIIDTL  140



>gb|KHG23195.1| Uncharacterized protein F383_29279 [Gossypium arboreum]
Length=285

 Score =   151 bits (381),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGKYFDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  204  AELDPEKRLYPGGKYFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAAATGKGP  263

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  264  LNNWATHLSDPLHTTIIDTF  283



>ref|XP_009588563.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic 
[Nicotiana tomentosiformis]
Length=285

 Score =   151 bits (381),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG +FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  202  AELDPEKRLYPGGSFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAAATGKGP  261

Query  181  LNNWATHLGDPFHTTILDTLGLIS  252
            LNNWATHL DP HTTI DT G  S
Sbjct  262  LNNWATHLSDPLHTTIFDTFGFFS  285



>ref|XP_009804550.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Nicotiana sylvestris]
Length=284

 Score =   150 bits (380),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG +FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  201  AELDPEKRLYPGGSFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAAATGKGP  260

Query  181  LNNWATHLGDPFHTTILDTLGLIS  252
            LNNWATHL DP HTTI DT G  S
Sbjct  261  LNNWATHLSDPLHTTIFDTFGFFS  284



>gb|ABG73415.1| chloroplast pigment-binding protein CP29 [Nicotiana tabacum]
Length=285

 Score =   150 bits (380),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG +FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  202  AELDPEKRLYPGGSFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAAATGKGP  261

Query  181  LNNWATHLGDPFHTTILDTLGLIS  252
            LNNWATHL DP HTTI DT G  S
Sbjct  262  LNNWATHLSDPLHTTIFDTFGFFS  285



>ref|NP_001105502.1| photosystem II subunit29 [Zea mays]
 emb|CAA90681.1| Chlorophyll a/b-binding protein CP29 precursor [Zea mays]
 gb|ACG39155.1| hypothetical protein [Zea mays]
 tpg|DAA63108.1| TPA: chlorophyll a/b-binding protein CP29 Precursor isoform 1 
[Zea mays]
 tpg|DAA63109.1| TPA: chlorophyll a/b-binding protein CP29 Precursor isoform 2 
[Zea mays]
Length=291

 Score =   151 bits (381),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLA+DPE+K RLQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  208  AELDPEKRLYPGGSYFDPLGLAADPEKKERLQLAEIKHARLAMVAFLGFAVQAAATGKGP  267

Query  181  LNNWATHLGDPFHTTILDTLG  243
            LNNWATHL DP HTTI DT G
Sbjct  268  LNNWATHLSDPLHTTIFDTFG  288



>ref|XP_007026729.1| Light-harvesting complex II protein Lhcb4 [Theobroma cacao]
 gb|EOY07231.1| Light-harvesting complex II protein Lhcb4 [Theobroma cacao]
Length=284

 Score =   150 bits (380),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLASDPE+KA LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  203  AELDPEKRLYPGGKFFDPLGLASDPEKKATLQLAEIKHARLAMVAFLGFAVQAAATGKGP  262

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  263  LNNWATHLSDPLHTTIIDTF  282



>ref|XP_004958012.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Setaria italica]
Length=290

 Score =   150 bits (380),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLA+DPE+K RLQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  207  AELDPEKRLYPGGSYFDPLGLAADPEKKERLQLAEIKHARLAMVAFLGFAVQAAATGKGP  266

Query  181  LNNWATHLGDPFHTTILDTLG  243
            LNNWATHL DP HTTI DT G
Sbjct  267  LNNWATHLSDPLHTTIFDTFG  287



>ref|NP_001059975.1| Os07g0558400 [Oryza sativa Japonica Group]
 gb|AAC14566.1| chlorophyll a/b-binding protein [Oryza sativa Japonica Group]
 dbj|BAC84033.1| chlorophyll a/b-binding protein [Oryza sativa Japonica Group]
 dbj|BAF21889.1| Os07g0558400 [Oryza sativa Japonica Group]
 gb|EAZ04322.1| hypothetical protein OsI_26463 [Oryza sativa Indica Group]
 dbj|BAG93852.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96322.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96839.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86652.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99675.1| unnamed protein product [Oryza sativa Japonica Group]
Length=290

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDPE+K RLQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  207  AELDPEKRLYPGGSYFDPLGLASDPEKKERLQLAEIKHARLAMVAFLGFAVQAAATGKGP  266

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI DT 
Sbjct  267  LNNWATHLSDPLHTTIFDTF  286



>ref|XP_008350546.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Malus domestica]
Length=131

 Score =   145 bits (366),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLA+DPE+KA LQLAEIKHARLAMV FLGF++QAA TGKGP
Sbjct  50   AELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVGFLGFAVQAAVTGKGP  109

Query  181  LNNWATHLGDPFHTTILD  234
            LNNWATHL DP HTTI+D
Sbjct  110  LNNWATHLSDPLHTTIID  127



>ref|XP_006657829.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Oryza brachyantha]
Length=288

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPE+R+YPGG YFDPLGLASDPE+K RLQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  206  AELDPERRLYPGGSYFDPLGLASDPEKKERLQLAEIKHARLAMVAFLGFAVQAAATGKGP  265

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  266  LNNWATHLSDPLHTTIIDTF  285



>ref|XP_003562892.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Brachypodium distachyon]
Length=288

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLA+DPE+K RLQLAEIKHARLAMV FLGF++QAAATGKGP
Sbjct  207  AELDPEKRLYPGGSYFDPLGLAADPEKKERLQLAEIKHARLAMVGFLGFAVQAAATGKGP  266

Query  181  LNNWATHLGDPFHTTILDTLG  243
            LNNWATHL DP HTTI DTLG
Sbjct  267  LNNWATHLSDPLHTTIFDTLG  287



>ref|XP_009416063.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=287

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGKYFDPLGLA DPE+KA LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  205  AELDPEKRLYPGGKYFDPLGLADDPEKKASLQLAEIKHARLAMVAFLGFAVQAAATGKGP  264

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI DT 
Sbjct  265  LNNWATHLSDPLHTTIFDTF  284



>ref|XP_010109617.1| hypothetical protein L484_015572 [Morus notabilis]
 gb|EXC23662.1| hypothetical protein L484_015572 [Morus notabilis]
Length=287

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLASDPE+KA LQLAEIKHARLAMVAFLGF++QAA TGKGP
Sbjct  205  AELDPEKRLYPGGKFFDPLGLASDPEKKATLQLAEIKHARLAMVAFLGFAVQAAVTGKGP  264

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  265  LNNWATHLSDPLHTTIIDTF  284



>gb|EPS68718.1| hypothetical protein M569_06048, partial [Genlisea aurea]
Length=283

 Score =   149 bits (376),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG +FDPLGLA+DPE+K  LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  200  AELDPEKRLYPGGSFFDPLGLAADPEKKETLQLAEIKHARLAMVAFLGFAVQAAATGKGP  259

Query  181  LNNWATHLGDPFHTTILDTLGLIS  252
            LNNWATHL DP HTTI DT G  S
Sbjct  260  LNNWATHLSDPLHTTIFDTFGFFS  283



>gb|AAD27878.1|AF139466_1 chlorophyll a/b binding protein CP29 [Vigna radiata]
Length=290

 Score =   149 bits (376),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDPE+KA LQLAEIKHARLAMV FLGF++QAAATGKGP
Sbjct  207  AELDPEKRLYPGGSYFDPLGLASDPEKKATLQLAEIKHARLAMVGFLGFAVQAAATGKGP  266

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  267  LNNWATHLSDPLHTTIIDTF  286



>ref|XP_009146970.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic 
[Brassica rapa]
 emb|CDY44667.1| BnaA05g29390D [Brassica napus]
Length=288

 Score =   149 bits (376),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLASDPE+KA+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  206  AELDSEKRLYPGGKFFDPLGLASDPEKKAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  265

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  266  LNNWATHLSDPLHTTIIDTF  285



>emb|CDY53084.1| BnaCnng24140D [Brassica napus]
Length=289

 Score =   149 bits (375),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLASDPE+KA+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  207  AELDSEKRLYPGGKFFDPLGLASDPEKKAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  266

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  267  LNNWATHLSDPLHTTIIDTF  286



>ref|XP_007133907.1| hypothetical protein PHAVU_010G002100g [Phaseolus vulgaris]
 gb|ESW05901.1| hypothetical protein PHAVU_010G002100g [Phaseolus vulgaris]
Length=289

 Score =   149 bits (375),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDPE+KA LQLAEIKHARLAMV FLGF++QAAATGKGP
Sbjct  207  AELDPEKRLYPGGSYFDPLGLASDPEKKATLQLAEIKHARLAMVGFLGFAVQAAATGKGP  266

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  267  LNNWATHLSDPLHTTIIDTF  286



>ref|XP_003516950.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Glycine max]
Length=290

 Score =   149 bits (375),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDPE+KA LQLAEIKHARLAMV FLGF++QAAATGKGP
Sbjct  207  AELDPEKRLYPGGSYFDPLGLASDPEKKATLQLAEIKHARLAMVGFLGFAVQAAATGKGP  266

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  267  LNNWATHLSDPLHTTIIDTF  286



>ref|XP_006407730.1| hypothetical protein EUTSA_v10021263mg [Eutrema salsugineum]
 gb|ESQ49183.1| hypothetical protein EUTSA_v10021263mg [Eutrema salsugineum]
Length=287

 Score =   149 bits (375),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLASDPE+KA+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  205  AELDSEKRLYPGGKFFDPLGLASDPEKKAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  264

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  265  LNNWATHLSDPLHTTIIDTF  284



>emb|CDP06495.1| unnamed protein product [Coffea canephora]
Length=286

 Score =   149 bits (375),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG +FDPLGLA+DPE+KA LQLAEIKHARLAMVA LGF++QAAATGKGP
Sbjct  203  AELDPEKRLYPGGSFFDPLGLAADPEKKATLQLAEIKHARLAMVAALGFAVQAAATGKGP  262

Query  181  LNNWATHLGDPFHTTILDTLGLIS  252
            LNNWATHL DP HTTI DT GL S
Sbjct  263  LNNWATHLSDPLHTTIFDTFGLFS  286



>ref|XP_010486443.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Camelina sativa]
Length=289

 Score =   149 bits (375),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLASDPE+KA+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  207  AELDSEKRLYPGGKFFDPLGLASDPEKKAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  266

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  267  LNNWATHLSDPLHTTIIDTF  286



>ref|XP_010466814.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic 
[Camelina sativa]
 ref|XP_010464514.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic 
[Camelina sativa]
Length=289

 Score =   149 bits (375),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLASDPE+KA+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  207  AELDSEKRLYPGGKFFDPLGLASDPEKKAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  266

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  267  LNNWATHLSDPLHTTIIDTF  286



>gb|ABW90990.1| LHCB4 [Bambusa oldhamii]
Length=287

 Score =   149 bits (375),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDPE+K RLQLAEIKHARLAMV FLGF++QAAATGKGP
Sbjct  204  AELDPEKRLYPGGSYFDPLGLASDPEKKERLQLAEIKHARLAMVGFLGFAVQAAATGKGP  263

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI DT 
Sbjct  264  LNNWATHLSDPLHTTIFDTF  283



>ref|XP_006300034.1| hypothetical protein CARUB_v10016258mg [Capsella rubella]
 gb|EOA32932.1| hypothetical protein CARUB_v10016258mg [Capsella rubella]
Length=287

 Score =   149 bits (375),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLASDPE+KA+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  205  AELDSEKRLYPGGKFFDPLGLASDPEKKAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  264

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  265  LNNWATHLSDPLHTTIIDTF  284



>ref|NP_001136606.1| uncharacterized protein LOC100216729 [Zea mays]
 gb|ACF82254.1| unknown [Zea mays]
Length=291

 Score =   149 bits (375),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPL LA+DPE+K RLQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  208  AELDPEKRLYPGGSYFDPLALAADPEKKERLQLAEIKHARLAMVAFLGFAVQAAATGKGP  267

Query  181  LNNWATHLGDPFHTTILDTLG  243
            LNNWATHL DP HTTI DT G
Sbjct  268  LNNWATHLSDPLHTTIFDTFG  288



>ref|XP_003520609.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Glycine max]
Length=290

 Score =   149 bits (375),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDPE+KA LQLAEIKHARLAMV FLGF++QAAATGKGP
Sbjct  207  AELDPEKRLYPGGSYFDPLGLASDPEKKATLQLAEIKHARLAMVGFLGFAVQAAATGKGP  266

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  267  LNNWATHLSDPLHTTIIDTF  286



>ref|XP_006366348.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Solanum tuberosum]
Length=285

 Score =   148 bits (373),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
             ELDPEKR+YPGG +FDPLGLA+DPE+KA LQLAEIKHARLAMV FLGF++QAAATGKGP
Sbjct  202  GELDPEKRLYPGGSFFDPLGLAADPEKKATLQLAEIKHARLAMVGFLGFAVQAAATGKGP  261

Query  181  LNNWATHLGDPFHTTILDTLGLIS  252
            LNNWATHL DP HTTI DT G  S
Sbjct  262  LNNWATHLSDPLHTTIFDTFGFFS  285



>gb|ACJ84724.1| unknown [Medicago truncatula]
 gb|AFK38567.1| unknown [Medicago truncatula]
 gb|AES86850.2| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=289

 Score =   148 bits (373),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLASDPE+KA LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  207  AELDSEKRLYPGGKFFDPLGLASDPEKKATLQLAEIKHARLAMVAFLGFAVQAAATGKGP  266

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  267  LNNWATHLSDPLHTTIIDTF  286



>gb|EMT21651.1| Chlorophyll a-b binding protein CP29.2, chloroplastic [Aegilops 
tauschii]
Length=286

 Score =   148 bits (373),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPE+R+YPGG YFDPLGLA+DPE+K  LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  204  AELDPERRLYPGGSYFDPLGLAADPEKKETLQLAEIKHARLAMVAFLGFAVQAAATGKGP  263

Query  181  LNNWATHLGDPFHTTILDTLG  243
            LNNWATHL DP HTTI DTLG
Sbjct  264  LNNWATHLSDPLHTTIFDTLG  284



>gb|AEO51756.1| chloroplast chlorophyll A/B binding protein [Dimocarpus longan]
Length=286

 Score =   148 bits (373),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLA+DPE+KA LQLAEIKHARLAMV FLGF++QAA TGKGP
Sbjct  205  AELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVGFLGFAVQAAVTGKGP  264

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DTL
Sbjct  265  LNNWATHLSDPLHTTIIDTL  284



>ref|XP_002873005.1| chlorophyll a/b-binding protein CP29 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49264.1| chlorophyll a/b-binding protein CP29 [Arabidopsis lyrata subsp. 
lyrata]
Length=291

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGKYFDPLGLA+DPE++A+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  209  AELDSEKRLYPGGKYFDPLGLAADPEKRAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  268

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  269  LNNWATHLSDPLHTTIIDTF  288



>ref|XP_009412442.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=288

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGKYFDPLGLA+DPE+KA LQLAEIKH RLAMVAFLGF++QAA TGKGP
Sbjct  206  AELDPEKRLYPGGKYFDPLGLAADPEKKASLQLAEIKHGRLAMVAFLGFAVQAAVTGKGP  265

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  266  LNNWATHLSDPLHTTIIDTF  285



>ref|XP_002882591.1| LHCB4.2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58850.1| LHCB4.2 [Arabidopsis lyrata subsp. lyrata]
Length=287

 Score =   147 bits (372),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLASDPE+KA+LQLAEIKHARLAMV FLGF++QAAATGKGP
Sbjct  205  AELDSEKRLYPGGKFFDPLGLASDPEKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGP  264

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  265  LNNWATHLSDPLHTTIIDTF  284



>ref|XP_010037701.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW49456.1| hypothetical protein EUGRSUZ_K02983 [Eucalyptus grandis]
Length=284

 Score =   147 bits (372),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
             ELDPEKR+YPGGK+FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  203  GELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAAATGKGP  262

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  263  LNNWATHLSDPLHTTIIDTF  282



>ref|XP_010253858.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic 
[Nelumbo nucifera]
Length=291

 Score =   147 bits (372),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGKYFDPLGLA+DPE+K+RLQLAEIKHARLAMVAFLGF++QAA TGKGP
Sbjct  208  AELDPEKRLYPGGKYFDPLGLAADPEKKSRLQLAEIKHARLAMVAFLGFAVQAAVTGKGP  267

Query  181  LNNWATHLGDPFHTTILD  234
            +NNWATHL DP HTTI+D
Sbjct  268  VNNWATHLSDPLHTTIID  285



>gb|ACU19827.1| unknown [Glycine max]
Length=290

 Score =   147 bits (371),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDPE+KA LQLAEIKHARLAMV FLGF++QAA TGKGP
Sbjct  207  AELDPEKRLYPGGSYFDPLGLASDPEKKATLQLAEIKHARLAMVGFLGFAVQAAVTGKGP  266

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  267  LNNWATHLSDPLHTTIIDTF  286



>ref|XP_006848193.1| hypothetical protein AMTR_s00029p00239610 [Amborella trichopoda]
 gb|ERN09774.1| hypothetical protein AMTR_s00029p00239610 [Amborella trichopoda]
Length=291

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG++FDPLGLASDPE+KA LQLAEIKHARLAMV FLGF++QAAATGKGP
Sbjct  209  AELDPEKRLYPGGQFFDPLGLASDPEKKATLQLAEIKHARLAMVGFLGFAVQAAATGKGP  268

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI DT 
Sbjct  269  LNNWATHLSDPLHTTIFDTF  288



>ref|XP_004506774.1| PREDICTED: LOW QUALITY PROTEIN: chlorophyll a-b binding protein 
CP29.1, chloroplastic-like [Cicer arietinum]
Length=343

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  261  AELDPEKRLYPGGKFFDPLGLAADPEKKAVLQLAEIKHARLAMVAFLGFAVQAAATGKGP  320

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  321  LNNWATHLSDPLHTTIIDTF  340



>ref|XP_006289419.1| hypothetical protein CARUB_v10002918mg [Capsella rubella]
 gb|EOA22317.1| hypothetical protein CARUB_v10002918mg [Capsella rubella]
Length=286

 Score =   147 bits (371),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD +KR+YPGGKYFDPLGLA+DPE++A+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  205  AELDSDKRLYPGGKYFDPLGLAADPEKRAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  264

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  265  LNNWATHLSDPLHTTIIDTF  284



>ref|XP_010558381.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Tarenaya hassleriana]
Length=286

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            +ELDPEKR+YPGGK+FDPLGLA+DPE+KA+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  205  SELDPEKRLYPGGKFFDPLGLAADPEKKAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  264

Query  181  LNNWATHLGDPFHTTILDTL  240
            L+NWATHL DP HTTI+DT 
Sbjct  265  LDNWATHLSDPLHTTIIDTF  284



>gb|KFK24655.1| hypothetical protein AALP_AA8G007900 [Arabis alpina]
Length=287

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLASDPE+K +LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  206  AELDSEKRLYPGGKFFDPLGLASDPEKKEQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  265

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  266  LNNWATHLSDPLHTTIIDTF  285



>ref|XP_009125404.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Brassica rapa]
Length=288

 Score =   146 bits (369),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLASDPE+ A+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  206  AELDSEKRLYPGGKFFDPLGLASDPEKMAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  265

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  266  LNNWATHLSDPLHTTIIDTF  285



>emb|CDY04834.1| BnaAnng00160D [Brassica napus]
Length=287

 Score =   146 bits (369),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLASDPE+ A+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  205  AELDSEKRLYPGGKFFDPLGLASDPEKMAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  264

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  265  LNNWATHLSDPLHTTIIDTF  284



>dbj|BAJ33665.1| unnamed protein product [Thellungiella halophila]
Length=288

 Score =   146 bits (369),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLASDPE+ A+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  205  AELDSEKRLYPGGKFFDPLGLASDPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  264

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  265  LNNWATHLSDPLHTTIIDTF  284



>ref|XP_003604653.1| Chlorophyll a-b binding protein [Medicago truncatula]
Length=347

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLASDPE+KA LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  265  AELDSEKRLYPGGKFFDPLGLASDPEKKATLQLAEIKHARLAMVAFLGFAVQAAATGKGP  324

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  325  LNNWATHLSDPLHTTIIDTF  344



>ref|XP_006429356.1| hypothetical protein CICLE_v10012370mg [Citrus clementina]
 gb|ESR42596.1| hypothetical protein CICLE_v10012370mg [Citrus clementina]
Length=288

 Score =   145 bits (367),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            +ELDPEKR+YPGGK+FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QA  TGKGP
Sbjct  207  SELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAVVTGKGP  266

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTILDT 
Sbjct  267  LNNWATHLSDPLHTTILDTF  286



>ref|XP_006429357.1| hypothetical protein CICLE_v10012370mg [Citrus clementina]
 ref|XP_006481019.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR42597.1| hypothetical protein CICLE_v10012370mg [Citrus clementina]
Length=288

 Score =   145 bits (367),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            +ELDPEKR+YPGGK+FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QA  TGKGP
Sbjct  207  SELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAVVTGKGP  266

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTILDT 
Sbjct  267  LNNWATHLSDPLHTTILDTF  286



>gb|ABX47016.1| chloroplast chlorophyll a/b binding protein cab-PhE7 [Phyllostachys 
edulis]
Length=287

 Score =   145 bits (367),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGG YFDPLGLASDPE+K RLQLAEIKHARLAMV FLGF++QAAATGKGP
Sbjct  204  AELDSEKRLYPGGSYFDPLGLASDPEKKERLQLAEIKHARLAMVGFLGFAVQAAATGKGP  263

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI DT 
Sbjct  264  LNNWATHLSDPLHTTIFDTF  283



>gb|KFK38281.1| hypothetical protein AALP_AA3G093700 [Arabis alpina]
Length=287

 Score =   145 bits (367),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLA+DPE+ A+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  205  AELDSEKRLYPGGKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  264

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  265  LNNWATHLSDPLHTTIIDTF  284



>ref|XP_009377780.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Pyrus x bretschneideri]
Length=286

 Score =   145 bits (367),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QAA TGKGP
Sbjct  205  AELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAAVTGKGP  264

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+D  
Sbjct  265  LNNWATHLSDPLHTTIIDAF  284



>ref|XP_008370077.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Malus domestica]
Length=286

 Score =   145 bits (367),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QAA TGKGP
Sbjct  205  AELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAAVTGKGP  264

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+D  
Sbjct  265  LNNWATHLSDPLHTTIIDAF  284



>ref|XP_008449241.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Cucumis melo]
Length=284

 Score =   145 bits (366),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLA DPE+KA LQLAEIKHARLAMVAFLGF++QAA TGKGP
Sbjct  203  AELDPEKRLYPGGKFFDPLGLAEDPEKKAVLQLAEIKHARLAMVAFLGFAVQAAVTGKGP  262

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+D  
Sbjct  263  LNNWATHLSDPLHTTIIDNF  282



>ref|XP_004147887.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004165107.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Cucumis sativus]
 gb|KGN54365.1| Chlorophyll A/B binding protein [Cucumis sativus]
Length=284

 Score =   145 bits (366),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLA DPE+KA LQLAEIKHARLAMVAFLGF++QAA TGKGP
Sbjct  203  AELDPEKRLYPGGKFFDPLGLAEDPEKKAVLQLAEIKHARLAMVAFLGFAVQAAVTGKGP  262

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+D  
Sbjct  263  LNNWATHLSDPLHTTIIDNF  282



>ref|XP_010262833.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Nelumbo nucifera]
Length=288

 Score =   145 bits (366),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLA+DPE+K  LQLAEIKHARLAMVAFLGF+IQAA TGKGP
Sbjct  205  AELDPEKRLYPGGKFFDPLGLAADPEKKVTLQLAEIKHARLAMVAFLGFAIQAAVTGKGP  264

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNW THL DP HTTI+DT 
Sbjct  265  LNNWVTHLSDPLHTTIIDTF  284



>gb|KDP24461.1| hypothetical protein JCGZ_25025 [Jatropha curcas]
Length=285

 Score =   145 bits (366),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG +FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QAA TGKGP
Sbjct  204  AELDPEKRLYPGGSFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAAVTGKGP  263

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+D L
Sbjct  264  LNNWATHLSDPLHTTIIDNL  283



>ref|XP_002323575.1| chlorophyll a/b binding protein CP29 [Populus trichocarpa]
 gb|EEF05336.1| chlorophyll a/b binding protein CP29 [Populus trichocarpa]
Length=283

 Score =   145 bits (366),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG +FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QA  TGKGP
Sbjct  202  AELDPEKRLYPGGNFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAWVTGKGP  261

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DTL
Sbjct  262  LNNWATHLSDPLHTTIIDTL  281



>gb|ABK96503.1| unknown [Populus trichocarpa x Populus deltoides]
Length=283

 Score =   145 bits (366),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG +FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QA  TGKGP
Sbjct  202  AELDPEKRLYPGGNFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAWVTGKGP  261

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DTL
Sbjct  262  LNNWATHLSDPLHTTIIDTL  281



>ref|XP_008243837.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic 
[Prunus mume]
Length=286

 Score =   145 bits (366),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLASDPE+KA LQLAEIKHARLAM+ FLGF++QAA TGKGP
Sbjct  204  AELDPEKRLYPGGKFFDPLGLASDPEKKATLQLAEIKHARLAMIGFLGFAVQAAVTGKGP  263

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+D  
Sbjct  264  LNNWATHLSDPLHTTIIDAF  283



>ref|XP_011014743.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=283

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG +FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QA  TGKGP
Sbjct  202  AELDPEKRLYPGGSFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAWVTGKGP  261

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DTL
Sbjct  262  LNNWATHLSDPLHTTIIDTL  281



>ref|XP_011047451.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Populus euphratica]
 ref|XP_011014741.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=283

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG +FDPLGLA+DPE+KA LQLAEIKHARLAMVAFLGF++QA  TGKGP
Sbjct  202  AELDPEKRLYPGGSFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAWVTGKGP  261

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DTL
Sbjct  262  LNNWATHLSDPLHTTIIDTL  281



>gb|AAM12979.1| chlorophyll a/b-binding protein CP29 [Arabidopsis thaliana]
Length=290

 Score =   145 bits (366),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLA+DPE+ A+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  208  AELDSEKRLYPGGKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  267

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  268  LNNWATHLSDPLHTTIIDTF  287



>ref|XP_011019131.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic 
[Populus euphratica]
Length=284

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG++FDPLGLASDPE+KA LQLAEIKHARLAMVAFLGF++QA  TGKGP
Sbjct  203  AELDPEKRLYPGGQFFDPLGLASDPEKKATLQLAEIKHARLAMVAFLGFAVQAWVTGKGP  262

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+D L
Sbjct  263  LNNWATHLSDPLHTTIIDNL  282



>ref|NP_187506.1| light harvesting complex photosystem II interacting protein Lhcb4.2 
[Arabidopsis thaliana]
 sp|Q9XF88.1|CB4B_ARATH RecName: Full=Chlorophyll a-b binding protein CP29.2, chloroplastic; 
AltName: Full=LHCB4.2; AltName: Full=LHCII protein 4.2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD28774.1|AF134127_1 Lhcb4.2 protein [Arabidopsis thaliana]
 gb|AAF07831.1|AC010871_7 putative chlorophyll a/b-binding protein [Arabidopsis thaliana]
 gb|AAL38316.1| putative chlorophyll a/b-binding protein [Arabidopsis thaliana]
 gb|AAM10170.1| putative chlorophyll a/b-binding protein [Arabidopsis thaliana]
 gb|AEE74698.1| light harvesting complex photosystem II interacting protein Lhcb4.2 
[Arabidopsis thaliana]
Length=287

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLASDP +KA+LQLAEIKHARLAMV FLGF++QAAATGKGP
Sbjct  205  AELDSEKRLYPGGKFFDPLGLASDPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGP  264

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  265  LNNWATHLSDPLHTTIIDTF  284



>ref|XP_002309134.1| chlorophyll a/b binding protein CP29 [Populus trichocarpa]
 gb|ABK96345.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE92657.1| chlorophyll a/b binding protein CP29 [Populus trichocarpa]
Length=285

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG++FDPLGLASDPE+KA LQLAEIKHARLAMVAFLGF++QA  TGKGP
Sbjct  204  AELDPEKRLYPGGQFFDPLGLASDPEKKATLQLAEIKHARLAMVAFLGFAVQAWVTGKGP  263

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+D L
Sbjct  264  LNNWATHLSDPLHTTIIDNL  283



>ref|NP_195773.1| chlorophyll a-b binding protein CP29.1 [Arabidopsis thaliana]
 sp|Q07473.1|CB4A_ARATH RecName: Full=Chlorophyll a-b binding protein CP29.1, chloroplastic; 
AltName: Full=LHCB4.1; AltName: Full=LHCII protein 4.1; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA50712.1| CP29 [Arabidopsis thaliana]
 emb|CAB82269.1| chlorophyll a/b-binding protein CP29 [Arabidopsis thaliana]
 gb|AAK82562.1| AT5g01530/F7A7_50 [Arabidopsis thaliana]
 gb|AAL15272.1| AT5g01530/F7A7_50 [Arabidopsis thaliana]
 gb|AAL24343.1| chlorophyll a/b-binding protein CP29 [Arabidopsis thaliana]
 gb|AAM10242.1| chlorophyll a/b-binding protein CP29 [Arabidopsis thaliana]
 gb|AAM91396.1| At5g01530/F7A7_50 [Arabidopsis thaliana]
 dbj|BAE98601.1| Lhcb4- protein [Arabidopsis thaliana]
 gb|AED90357.1| chlorophyll a-b binding protein CP29.1 [Arabidopsis thaliana]
Length=290

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLA+DPE+ A+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  208  AELDSEKRLYPGGKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  267

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  268  LNNWATHLSDPLHTTIIDTF  287



>ref|XP_006398606.1| hypothetical protein EUTSA_v10014055mg [Eutrema salsugineum]
 gb|ESQ40059.1| hypothetical protein EUTSA_v10014055mg [Eutrema salsugineum]
Length=335

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLASDPE+ A+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  252  AELDSEKRLYPGGKFFDPLGLASDPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  311

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  312  LNNWATHLSDPLHTTIIDTF  331



>ref|XP_010924043.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Elaeis guineensis]
Length=287

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLASDPE+KA LQLAEIKHARLAMVA LGF++QAAATGKGP
Sbjct  204  AELDPEKRLYPGGKFFDPLGLASDPEKKATLQLAEIKHARLAMVAALGFAVQAAATGKGP  263

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNW THL DP HTTI DT 
Sbjct  264  LNNWVTHLNDPLHTTIFDTF  283



>ref|XP_002528105.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF34284.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=285

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            +ELDPEKR+YPGGK+FDPLGLA DPE+KA LQLAEIKHARLAMVAFLGF++QAA TGKGP
Sbjct  204  SELDPEKRLYPGGKFFDPLGLAEDPEKKATLQLAEIKHARLAMVAFLGFAVQAAVTGKGP  263

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+D  
Sbjct  264  LNNWATHLSDPLHTTIIDNF  283



>gb|AHM26635.1| a-b binding protein [Pyrus x bretschneideri]
Length=286

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLA+DPE+KA LQLAEIKHARLAMV FLGF++QAA TGKGP
Sbjct  205  AELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVGFLGFAVQAAVTGKGP  264

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+D  
Sbjct  265  LNNWATHLSDPLHTTIIDAF  284



>ref|XP_009344712.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Pyrus x bretschneideri]
 gb|AHM26629.1| a-b binding protein [Pyrus x bretschneideri]
Length=289

 Score =   144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLA+DPE+KA LQLAEIKHARLAMV FLGF++QAA TGKGP
Sbjct  208  AELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVGFLGFAVQAAVTGKGP  267

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+D  
Sbjct  268  LNNWATHLSDPLHTTIIDAF  287



>ref|XP_002279834.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Vitis vinifera]
 emb|CAN77492.1| hypothetical protein VITISV_010727 [Vitis vinifera]
Length=288

 Score =   144 bits (362),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLA+DPE+KA LQLAEIKHARLAM+ FLGF++QAA TGKGP
Sbjct  206  AELDPEKRLYPGGKFFDPLGLAADPEKKAVLQLAEIKHARLAMIGFLGFAVQAAVTGKGP  265

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+D +
Sbjct  266  LNNWATHLSDPLHTTIIDNV  285



>prf||1908421A light-harvesting complex IIa protein
Length=286

 Score =   143 bits (361),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPE+R+YPGG YFDPLGLA+DPE+K  LQLAEIKHARLAMVAFLGF++QAAATGKG 
Sbjct  204  AELDPERRLYPGGSYFDPLGLAADPEKKETLQLAEIKHARLAMVAFLGFAVQAAATGKGR  263

Query  181  LNNWATHLGDPFHTTILDTLG  243
            LNNWATHL DP HTTI DT G
Sbjct  264  LNNWATHLSDPLHTTIFDTFG  284



>gb|AAK43851.1|AF370474_1 chlorophyll a/b-binding protein CP29 [Arabidopsis thaliana]
 gb|AAN15682.1| chlorophyll a/b-binding protein CP29 [Arabidopsis thaliana]
Length=290

 Score =   143 bits (360),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPL LA+DPE+ A+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  208  AELDSEKRLYPGGKFFDPLSLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  267

Query  181  LNNWATHLGDPFHTTILDTL  240
            LNNWATHL DP HTTI+DT 
Sbjct  268  LNNWATHLSDPLHTTIIDTF  287



>ref|XP_004302636.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=286

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            +ELD EKR+YPGGK+FDPLGLASDPE+KA LQLAEIKHARLAMVAFLGF++QA  TGKGP
Sbjct  205  SELDLEKRLYPGGKFFDPLGLASDPEKKATLQLAEIKHARLAMVAFLGFAVQAVVTGKGP  264

Query  181  LNNWATHLGDPFHTTILD  234
            LNNWATHL DP HTTI+D
Sbjct  265  LNNWATHLSDPLHTTIID  282



>ref|XP_008388205.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Malus domestica]
Length=289

 Score =   141 bits (355),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLA+DPE+KA LQLAEIKHARLAMV FLGF++QAA TGKGP
Sbjct  208  AELDXEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVGFLGFAVQAAVTGKGP  267

Query  181  LNNWATHLGDPFHTTILD  234
            LNNWATHL DP HTTI+D
Sbjct  268  LNNWATHLSDPLHTTIID  285



>gb|AAK82524.1| AT5g01530/F7A7_50 [Arabidopsis thaliana]
Length=290

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGGK+FDPLGLA+DPE+ A+LQLAEIKHARLAMVAFLGF++QAAATGKGP
Sbjct  208  AELDSEKRLYPGGKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP  267

Query  181  LNNWATHLGDPFHTTILDTL  240
             N WATHL DP HTTI+DT 
Sbjct  268  RNYWATHLSDPLHTTIIDTF  287



>emb|CAA06961.1| chlorophyll a/b-binding protein [Hordeum vulgare subsp. vulgare]
Length=75

 Score =   132 bits (333),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  25   IYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHL  204
            +YPGG YFDPLGLA+DPE+K  LQLAEIKHARLAMVAFLGF++QAAATGKGPLNNWATHL
Sbjct  1    LYPGGSYFDPLGLAADPEKKETLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHL  60

Query  205  GDPFHTTILDTLG  243
             DP HTTI DT G
Sbjct  61   SDPLHTTIFDTFG  73



>ref|XP_010670717.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=285

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG  FDPLGLASDPE+K  LQLAEIKHARLAMVAFLGF++QAA TGKGP
Sbjct  206  AELDPEKRLYPGGS-FDPLGLASDPEKKPILQLAEIKHARLAMVAFLGFAVQAAVTGKGP  264

Query  181  LNNWATHLGDPFHTTILD  234
            LNNWATHL DP HTTILD
Sbjct  265  LNNWATHLSDPLHTTILD  282



>ref|XP_002974259.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ24481.1| light-harvesting complex [Selaginella moellendorffii]
Length=299

 Score =   135 bits (341),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPL  183
            ELDPEKR+YPGG YFDPLGLA+DPE K  L+LAEIKHARLAMVA  GF++QAAATGKGPL
Sbjct  219  ELDPEKRLYPGGSYFDPLGLAADPERKEVLKLAEIKHARLAMVAAFGFAVQAAATGKGPL  278

Query  184  NNWATHLGDPFHTTILDTL  240
            +NW THL DP HTTI+DT 
Sbjct  279  DNWVTHLSDPLHTTIIDTF  297



>ref|XP_002985629.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ13207.1| light-harvesting complex [Selaginella moellendorffii]
Length=299

 Score =   135 bits (341),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPL  183
            ELDPEKR+YPGG YFDPLGLA+DPE K  L+LAEIKHARLAMVA  GF++QAAATGKGPL
Sbjct  219  ELDPEKRLYPGGSYFDPLGLAADPERKEVLKLAEIKHARLAMVAAFGFAVQAAATGKGPL  278

Query  184  NNWATHLGDPFHTTILDTL  240
            +NW THL DP HTTI+DT 
Sbjct  279  DNWVTHLSDPLHTTIIDTF  297



>pdb|3PL9|A Chain A, Crystal Structure Of Spinach Minor Light-Harvesting 
Complex Cp29 At 2.80 Angstrom Resolution
Length=243

 Score =   131 bits (330),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 68/78 (87%), Gaps = 1/78 (1%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELD EKR+YPGG  FDPLGLASDPE+K  LQLAEIKHARLAMV FLGF++QAA TGKGP
Sbjct  164  AELDTEKRLYPGGT-FDPLGLASDPEKKPILQLAEIKHARLAMVGFLGFAVQAAVTGKGP  222

Query  181  LNNWATHLGDPFHTTILD  234
            LNNW THL DP HTTILD
Sbjct  223  LNNWVTHLSDPLHTTILD  240



>ref|XP_010677168.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=287

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG+YFDPLGLA+DPE+K RLQLAEIKH+RLAMVAFLGF+IQAAATGKGP
Sbjct  208  AELDPEKRLYPGGQYFDPLGLAADPEKKLRLQLAEIKHSRLAMVAFLGFAIQAAATGKGP  267

Query  181  LNNWATHLGDPFHTTILDTL  240
            L+N A  L DP    IL T 
Sbjct  268  LSNVAEFLSDP-SNNILKTF  286



>gb|ACU23805.1| unknown [Glycine max]
Length=129

 Score =   113 bits (283),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG++FDPLGLA+DPEEKARLQLAEIKH+RLAMV FL F+IQAA TGKGP
Sbjct  61   AELDPEKRLYPGGRFFDPLGLANDPEEKARLQLAEIKHSRLAMVVFLIFAIQAAVTGKGP  120

Query  181  LNNWAT  198
            ++  AT
Sbjct  121  ISFLAT  126



>gb|KHN34729.1| Chlorophyll a-b binding protein CP29.3, chloroplastic, partial 
[Glycine soja]
Length=200

 Score =   112 bits (281),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG++FDPLGLA+DPEEKARLQLAEIKH+RLAMV FL F+IQAA TGKGP
Sbjct  132  AELDPEKRLYPGGRFFDPLGLANDPEEKARLQLAEIKHSRLAMVVFLIFAIQAAVTGKGP  191

Query  181  LNNWAT  198
            ++  AT
Sbjct  192  ISFLAT  197



>ref|XP_001785452.1| predicted protein [Physcomitrella patens]
 ref|XP_001785457.1| predicted protein [Physcomitrella patens]
 gb|EDQ49732.1| predicted protein [Physcomitrella patens]
 gb|EDQ49737.1| predicted protein [Physcomitrella patens]
Length=296

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPL  A   E+K  L+LAEIKHARLAMVA LGF+ QAAATGKGP
Sbjct  215  AELDPEKRLYPGGKFFDPLNFADTEEKKETLKLAEIKHARLAMVAALGFAAQAAATGKGP  274

Query  181  LNNWATHLGDPFHTTILDTL  240
            L+NWATHL DP HTTI DT 
Sbjct  275  LDNWATHLADPLHTTIFDTF  294



>ref|XP_003600876.1| Chlorophyll a-b binding protein CP29.3 [Medicago truncatula]
 gb|AES71127.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=278

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLASDPEEK RLQLAEIKH+RLAMV FL F+IQAA TGKGP
Sbjct  210  AELDPEKRLYPGGKFFDPLGLASDPEEKERLQLAEIKHSRLAMVVFLIFAIQAAVTGKGP  269

Query  181  LNNWAT  198
            +   AT
Sbjct  270  IGFIAT  275



>ref|XP_003552419.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Glycine max]
Length=278

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG++FDPLGLA+DPEEKARLQLAEIKH+RLAMV FL F+IQAA TGKGP
Sbjct  210  AELDPEKRLYPGGRFFDPLGLANDPEEKARLQLAEIKHSRLAMVVFLIFAIQAAVTGKGP  269

Query  181  LNNWAT  198
            ++  AT
Sbjct  270  ISFLAT  275



>ref|XP_003538459.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Glycine max]
Length=282

 Score =   112 bits (279),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG++FDPLGLA+DPEEKARLQLAEIKH+RLAMV FL F+IQAA TGKGP
Sbjct  214  AELDPEKRLYPGGRFFDPLGLANDPEEKARLQLAEIKHSRLAMVVFLIFAIQAAVTGKGP  273

Query  181  LNNWAT  198
            ++  AT
Sbjct  274  ISFLAT  279



>ref|XP_008233744.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic 
[Prunus mume]
Length=282

 Score =   111 bits (278),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLASDPEEK RLQLAEIKHARLAMV FL F IQAA TGKGP
Sbjct  214  AELDPEKRLYPGGKFFDPLGLASDPEEKERLQLAEIKHARLAMVVFLIFGIQAAVTGKGP  273

Query  181  LNNWATH  201
            ++  AT 
Sbjct  274  VSFLATF  280



>ref|XP_007218784.1| hypothetical protein PRUPE_ppa009686mg [Prunus persica]
 gb|EMJ19983.1| hypothetical protein PRUPE_ppa009686mg [Prunus persica]
Length=282

 Score =   111 bits (277),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLASDPEEK RLQLAEIKHARLAMV FL F IQAA TGKGP
Sbjct  214  AELDPEKRLYPGGKFFDPLGLASDPEEKERLQLAEIKHARLAMVVFLIFGIQAAVTGKGP  273

Query  181  LNNWAT  198
            ++  AT
Sbjct  274  VSFVAT  279



>ref|XP_010095100.1| Chlorophyll a-b binding protein [Morus notabilis]
 gb|EXB58206.1| Chlorophyll a-b binding protein [Morus notabilis]
Length=278

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG++FDPLGLA+DPEEK RLQLAEIKHARLAMVAFL F IQAA TGKGP
Sbjct  210  AELDPEKRLYPGGQFFDPLGLANDPEEKERLQLAEIKHARLAMVAFLIFGIQAAVTGKGP  269

Query  181  LNNWAT  198
            ++  AT
Sbjct  270  ISFIAT  275



>ref|XP_004500683.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Cicer arietinum]
Length=276

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLASDP+EK RLQLAEIKH+RLAMV FL F+IQAA TGKGP
Sbjct  208  AELDPEKRLYPGGKFFDPLGLASDPQEKERLQLAEIKHSRLAMVVFLIFAIQAAVTGKGP  267

Query  181  LNNWAT  198
            +   AT
Sbjct  268  IAFIAT  273



>ref|XP_001772786.1| predicted protein [Physcomitrella patens]
 ref|XP_001772821.1| predicted protein [Physcomitrella patens]
 gb|EDQ62353.1| predicted protein [Physcomitrella patens]
 gb|EDQ62388.1| predicted protein [Physcomitrella patens]
Length=296

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPL  A   ++K  L+LAEIKHARLAMVA LGF+ QAAATGKGP
Sbjct  215  AELDPEKRLYPGGKFFDPLNFADTEDKKETLKLAEIKHARLAMVAALGFAAQAAATGKGP  274

Query  181  LNNWATHLGDPFHTTILDTL  240
            L+NWATHL DP HTTI DT 
Sbjct  275  LDNWATHLADPLHTTIFDTF  294



>ref|XP_007163532.1| hypothetical protein PHAVU_001G242100g [Phaseolus vulgaris]
 gb|ESW35526.1| hypothetical protein PHAVU_001G242100g [Phaseolus vulgaris]
Length=277

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLA DP+EKARLQLAEIKH+RLAM+ FL F+IQAA TGKGP
Sbjct  209  AELDPEKRLYPGGKFFDPLGLAVDPDEKARLQLAEIKHSRLAMLVFLIFAIQAAVTGKGP  268

Query  181  LNNWAT  198
            ++  AT
Sbjct  269  ISFIAT  274



>ref|XP_004307637.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=274

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPE R+YPGGK+FDPLGLA+DPEEK RLQLAEIKHARLAMV FL F IQAA TGKGP
Sbjct  206  AELDPEMRLYPGGKFFDPLGLAADPEEKERLQLAEIKHARLAMVVFLIFGIQAAVTGKGP  265

Query  181  LNNWAT  198
            +   AT
Sbjct  266  IAFIAT  271



>gb|AGP03463.1| chloroplast chlorophyll a-b binding protein CP29 (chloroplast) 
[Ginkgo biloba]
Length=278

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGKYFDP GLA DP+E+ RL+LAEIKH RLAMVAFL F+IQAA TGKGP
Sbjct  208  AELDPEKRLYPGGKYFDPFGLAVDPDEQNRLKLAEIKHGRLAMVAFLIFAIQAAITGKGP  267

Query  181  LNNWATHLGD  210
            +N +   L +
Sbjct  268  VNIFVDILSN  277



>ref|XP_009369266.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Pyrus x bretschneideri]
Length=246

 Score =   105 bits (263),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLA+DP+E  RLQLAEIKHARLAMV FL F IQAA TGKGP
Sbjct  178  AELDPEKRLYPGGKFFDPLGLAADPDEFERLQLAEIKHARLAMVVFLLFGIQAAVTGKGP  237

Query  181  LN  186
            ++
Sbjct  238  IS  239



>ref|XP_009345742.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Pyrus x bretschneideri]
Length=302

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLASDP+E  RLQLAEIKHARLAMV FL F IQAA TGKGP
Sbjct  234  AELDPEKRLYPGGKFFDPLGLASDPDEFERLQLAEIKHARLAMVVFLIFGIQAAVTGKGP  293

Query  181  LN  186
            ++
Sbjct  294  IS  295



>ref|XP_008373917.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Malus domestica]
Length=286

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGGK+FDPLGLASDP+E  RLQLAEIKHARLAMV FL F IQAA TGKGP
Sbjct  215  AELDPEKRLYPGGKFFDPLGLASDPDEFERLQLAEIKHARLAMVVFLIFGIQAAVTGKGP  274

Query  181  LN  186
            ++
Sbjct  275  IS  276



>gb|AEW08530.1| hypothetical protein CL265Contig2_04, partial [Pinus radiata]
 gb|AFG45764.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
 gb|AFG45765.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
 gb|AFG45766.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
 gb|AFG45767.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
 gb|AFG45768.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
 gb|AFG45769.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
 gb|AFG45770.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
 gb|AFG45771.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
 gb|AFG45772.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
 gb|AFG45773.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
 gb|AFG45774.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
 gb|AFG45775.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
 gb|AFG45776.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
 gb|AFG45777.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
 gb|AFG45778.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
 gb|AFG45779.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
 gb|AFG45780.1| hypothetical protein CL265Contig2_04, partial [Pinus taeda]
Length=68

 Score = 99.8 bits (247),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AE+DPE R+YPGGKYFDP GLA+D  +K RL+LAEIKHARLAMVAFL F+IQAA T KGP
Sbjct  4    AEVDPETRLYPGGKYFDPFGLAADETKKDRLKLAEIKHARLAMVAFLIFAIQAAVTSKGP  63

Query  181  LNNWA  195
            L  + 
Sbjct  64   LTLFV  68



>gb|KCW65678.1| hypothetical protein EUGRSUZ_G03060 [Eucalyptus grandis]
Length=219

 Score =   102 bits (253),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDPE+K  LQLAEIKHARLAM+AFL F IQAA TGKGP
Sbjct  152  AELDPEKRLYPGG-YFDPLGLASDPEKKENLQLAEIKHARLAMIAFLIFGIQAAYTGKGP  210

Query  181  LNNWAT  198
            +   AT
Sbjct  211  IAFVAT  216



>ref|XP_002526901.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF35532.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=282

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKRIYPGG YFDPLGLASDPE+K  LQLAEIKH+RLAMVAFL F IQAA TGKGP
Sbjct  215  AELDPEKRIYPGG-YFDPLGLASDPEKKENLQLAEIKHSRLAMVAFLIFGIQAAFTGKGP  273

Query  181  LNNWAT  198
            +   AT
Sbjct  274  IAFVAT  279



>ref|XP_010067525.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic 
[Eucalyptus grandis]
 gb|KCW65677.1| hypothetical protein EUGRSUZ_G03060 [Eucalyptus grandis]
Length=276

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDPE+K  LQLAEIKHARLAM+AFL F IQAA TGKGP
Sbjct  209  AELDPEKRLYPGG-YFDPLGLASDPEKKENLQLAEIKHARLAMIAFLIFGIQAAYTGKGP  267

Query  181  LNNWAT  198
            +   AT
Sbjct  268  IAFVAT  273



>gb|ABK96737.1| unknown [Populus trichocarpa x Populus deltoides]
Length=275

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDPE+   LQLAEIKHARLAMVAFL F IQAA TGKGP
Sbjct  208  AELDPEKRLYPGG-YFDPLGLASDPEKIENLQLAEIKHARLAMVAFLIFGIQAAFTGKGP  266

Query  181  LNNWAT  198
            ++  AT
Sbjct  267  ISFVAT  272



>ref|XP_011043542.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic 
[Populus euphratica]
Length=276

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDPE+   LQLAEIKHARLAMVAFL F IQAA TGKGP
Sbjct  208  AELDPEKRLYPGG-YFDPLGLASDPEKIENLQLAEIKHARLAMVAFLIFGIQAAFTGKGP  266

Query  181  LNNWAT  198
            ++  AT
Sbjct  267  ISFVAT  272



>ref|XP_002312153.1| Chlorophyll a-b binding protein CP29.3 [Populus trichocarpa]
 gb|EEE89520.1| Chlorophyll a-b binding protein CP29.3 [Populus trichocarpa]
Length=275

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDPE+   LQLAEIKHARLAMVAFL F IQAA TGKGP
Sbjct  208  AELDPEKRLYPGG-YFDPLGLASDPEKIENLQLAEIKHARLAMVAFLIFGIQAAFTGKGP  266

Query  181  LNNWAT  198
            ++  AT
Sbjct  267  ISFVAT  272



>gb|ACN40533.1| unknown [Picea sitchensis]
Length=249

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AE+DPE R+YPGGKYFDP GLA D  +K RL+LAEIKHARLAMVAFL F+IQAA T KGP
Sbjct  179  AEVDPETRLYPGGKYFDPFGLAVDEIKKDRLKLAEIKHARLAMVAFLIFAIQAAVTSKGP  238

Query  181  LNNWATHLG  207
            L  +   LG
Sbjct  239  LTLFVEFLG  247



>gb|KDP44781.1| hypothetical protein JCGZ_01281 [Jatropha curcas]
Length=279

 Score =   100 bits (249),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDPE+K  LQLAEIKH+RLAMVAFL F +QAA TGKGP
Sbjct  212  AELDPEKRLYPGG-YFDPLGLASDPEKKENLQLAEIKHSRLAMVAFLIFGLQAAFTGKGP  270

Query  181  LNNWAT  198
            +   AT
Sbjct  271  IAFLAT  276



>gb|ABK21281.1| unknown [Picea sitchensis]
 gb|ABK21880.1| unknown [Picea sitchensis]
 gb|ABK23915.1| unknown [Picea sitchensis]
 gb|ABK26276.1| unknown [Picea sitchensis]
 gb|ACN39760.1| unknown [Picea sitchensis]
 gb|ACN40276.1| unknown [Picea sitchensis]
Length=288

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AE+DPE R+YPGGKYFDP GLA D  +K RL+LAEIKHARLAMVAFL F+IQAA T KGP
Sbjct  218  AEVDPETRLYPGGKYFDPFGLAVDEIKKDRLKLAEIKHARLAMVAFLIFAIQAAVTSKGP  277

Query  181  LNNWATHLG  207
            L  +   LG
Sbjct  278  LTLFVEFLG  286



>gb|ABK25779.1| unknown [Picea sitchensis]
Length=288

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AE+DPE R+YPGGKYFDP GLA D  +K RL LAEIKHARLAMVAFL F+IQAA T KGP
Sbjct  218  AEVDPETRLYPGGKYFDPFGLAVDEIKKDRLNLAEIKHARLAMVAFLIFAIQAAVTSKGP  277

Query  181  LNNWATHLG  207
            L  +   LG
Sbjct  278  LTLFVEFLG  286



>gb|AFD62761.1| LHCB, partial [Citrus sinensis]
Length=169

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDP KR+YPGG YFDPLGLASDP +   LQLAEIKHARLAMVAFL F IQAA TGKGP
Sbjct  102  AELDPVKRLYPGG-YFDPLGLASDPGKLENLQLAEIKHARLAMVAFLIFGIQAAFTGKGP  160

Query  181  LNNWAT  198
            ++  AT
Sbjct  161  ISFVAT  166



>emb|CDY20518.1| BnaC04g05260D [Brassica napus]
Length=276

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKRIYPGG YFDPLGL SDPE+   L+LAEIKH+RLAM+AFL FS+QAA TGKGP
Sbjct  209  AELDPEKRIYPGG-YFDPLGLGSDPEKLDTLKLAEIKHSRLAMIAFLIFSLQAAFTGKGP  267

Query  181  LNNWAT  198
            ++  AT
Sbjct  268  ISFLAT  273



>ref|XP_010505716.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Camelina sativa]
Length=301

 Score = 97.8 bits (242),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AEL+PEKRIYPGG YFDPLGLASDPE+   L+LAEIKH+RLAMVAFL F++QAA TGKGP
Sbjct  234  AELEPEKRIYPGG-YFDPLGLASDPEKSDTLKLAEIKHSRLAMVAFLIFALQAAFTGKGP  292

Query  181  LNNWAT  198
            ++  AT
Sbjct  293  ISFLAT  298



>gb|KDO69014.1| hypothetical protein CISIN_1g028743mg [Citrus sinensis]
Length=204

 Score = 96.3 bits (238),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDP KR+YPGG YFDPLGLASDP +   LQLAEIKHARLAMVAFL F IQAA TGKGP
Sbjct  137  AELDPVKRLYPGG-YFDPLGLASDPGKLENLQLAEIKHARLAMVAFLIFGIQAAFTGKGP  195

Query  181  LNNWAT  198
            ++  AT
Sbjct  196  ISFVAT  201



>ref|XP_007009013.1| Light-harvesting complex II protein Lhcb8 [Theobroma cacao]
 gb|EOY17823.1| Light-harvesting complex II protein Lhcb8 [Theobroma cacao]
Length=277

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDP++   L+LAEIKH+RLAMVAFL F IQAA TGKGP
Sbjct  210  AELDPEKRLYPGG-YFDPLGLASDPQKIDNLKLAEIKHSRLAMVAFLIFGIQAAVTGKGP  268

Query  181  LN  186
            L+
Sbjct  269  LS  270



>gb|ABK26282.1| unknown [Picea sitchensis]
Length=288

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AE+DPE R+YPGGKYFDP GLA +  +K RL+LAEIKHARLAMVAFL F+IQAA T KGP
Sbjct  218  AEVDPETRLYPGGKYFDPFGLAVEEIKKDRLKLAEIKHARLAMVAFLIFAIQAAVTSKGP  277

Query  181  LNNWATHLG  207
            L  +   LG
Sbjct  278  LTLFVEFLG  286



>ref|XP_010517408.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like 
[Camelina sativa]
Length=301

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AEL+PEKRIYPGG YFDPLGLASDPE+   L+LAEIKH+RLAMVAFL F++QAA TGKGP
Sbjct  234  AELEPEKRIYPGG-YFDPLGLASDPEKSDALKLAEIKHSRLAMVAFLIFALQAAFTGKGP  292

Query  181  LNNWAT  198
            ++  AT
Sbjct  293  ISFLAT  298



>ref|XP_010554987.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic, 
partial [Tarenaya hassleriana]
Length=278

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKRIYPGG YFDPLGLASDPE+   L+LAEIKH+RLAM+AFL F  QAA TGKGP
Sbjct  211  AELDPEKRIYPGG-YFDPLGLASDPEKLENLKLAEIKHSRLAMIAFLIFGFQAAFTGKGP  269

Query  181  LNNWAT  198
            ++  AT
Sbjct  270  ISFVAT  275



>gb|KHF99476.1| Chlorophyll a-b binding CP29.3, chloroplastic -like protein [Gossypium 
arboreum]
 gb|KHG03854.1| Chlorophyll a-b binding CP29.3, chloroplastic -like protein [Gossypium 
arboreum]
Length=273

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKR+YPGG YFDPLGLASDPE+   L+LAEIKH+RLAM+AFL F IQAA TGKGP
Sbjct  206  AELDPEKRLYPGG-YFDPLGLASDPEKIDNLKLAEIKHSRLAMIAFLIFGIQAAYTGKGP  264

Query  181  LN  186
            ++
Sbjct  265  IS  266



>ref|XP_006411258.1| hypothetical protein EUTSA_v10017060mg [Eutrema salsugineum]
 dbj|BAJ33709.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52711.1| hypothetical protein EUTSA_v10017060mg [Eutrema salsugineum]
Length=276

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKRIYPGG YFDPLGL SDPE+   L+LAEIKH+RLAMVAFL F +QAA TGKGP
Sbjct  209  AELDPEKRIYPGG-YFDPLGLGSDPEKLDTLKLAEIKHSRLAMVAFLIFGLQAAFTGKGP  267

Query  181  LNNWAT  198
            ++  AT
Sbjct  268  ISFIAT  273



>ref|XP_010508915.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic 
[Camelina sativa]
Length=303

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AEL+PEKRIYPGG YFDPLGLASDPE+   L+LAEIKH+RLAMVAFL F++QAA TGKGP
Sbjct  236  AELEPEKRIYPGG-YFDPLGLASDPEKADTLKLAEIKHSRLAMVAFLIFALQAAFTGKGP  294

Query  181  LNNWAT  198
            ++  AT
Sbjct  295  ISFLAT  300



>ref|XP_009143253.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic 
[Brassica rapa]
 emb|CDX74808.1| BnaA05g05540D [Brassica napus]
Length=276

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKRIYPGG YFDPLGLA+DPE+   L+LAEIKH+RLAM+AFL F +QAA TGKGP
Sbjct  209  AELDPEKRIYPGG-YFDPLGLAADPEKLDTLKLAEIKHSRLAMIAFLIFGLQAAFTGKGP  267

Query  181  LNNWAT  198
            ++  AT
Sbjct  268  ISFLAT  273



>ref|XP_002879843.1| LHCB4.3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56102.1| LHCB4.3 [Arabidopsis lyrata subsp. lyrata]
Length=276

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            +ELDPEKRIYPGG YFDPLGLA+DPE+   L+LAEIKH+RLAMVAFL F++QAA TGKGP
Sbjct  209  SELDPEKRIYPGG-YFDPLGLAADPEKLDTLKLAEIKHSRLAMVAFLIFALQAAFTGKGP  267

Query  181  LNNWAT  198
            ++  AT
Sbjct  268  ISFLAT  273



>gb|AAM65936.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
Length=276

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            +ELDPEKRIYPGG YFDPLGLA+DPE+   L+LAEIKH+RLAMVAFL F++QAA TGKGP
Sbjct  209  SELDPEKRIYPGG-YFDPLGLAADPEKLDTLKLAEIKHSRLAMVAFLIFALQAAFTGKGP  267

Query  181  LNNWAT  198
            ++  AT
Sbjct  268  VSFLAT  273



>ref|NP_181539.1| light harvesting complex photosystem II [Arabidopsis thaliana]
 sp|Q9S7W1.1|CB4C_ARATH RecName: Full=Chlorophyll a-b binding protein CP29.3, chloroplastic; 
AltName: Full=LHCB4.3; AltName: Full=LHCII protein 4.3; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD28775.1|AF134128_1 Lhcb4:3 protein [Arabidopsis thaliana]
 gb|AAL49888.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AAM20369.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AEC09778.1| light harvesting complex photosystem II [Arabidopsis thaliana]
Length=276

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            +ELDPEKRIYPGG YFDPLGLA+DPE+   L+LAEIKH+RLAMVAFL F++QAA TGKGP
Sbjct  209  SELDPEKRIYPGG-YFDPLGLAADPEKLDTLKLAEIKHSRLAMVAFLIFALQAAFTGKGP  267

Query  181  LNNWAT  198
            ++  AT
Sbjct  268  VSFLAT  273



>ref|XP_006435720.1| hypothetical protein CICLE_v10032377mg [Citrus clementina]
 ref|XP_006486329.1| PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic 
[Citrus sinensis]
 gb|ESR48960.1| hypothetical protein CICLE_v10032377mg [Citrus clementina]
Length=274

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDP KR+YPGG YFDPLGLASDP +   LQLAEIKHARLAMVAFL F IQAA TGKGP
Sbjct  207  AELDPVKRLYPGG-YFDPLGLASDPGKLENLQLAEIKHARLAMVAFLIFGIQAAFTGKGP  265

Query  181  LNNWAT  198
            ++  AT
Sbjct  266  ISFVAT  271



>emb|CDY61708.1| BnaC04g56710D [Brassica napus]
Length=350

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AELDPEKRIYPGG  FDPLGL SDPE+   L+LAEIKH+RLAMVAFL F +QAA TGKGP
Sbjct  143  AELDPEKRIYPGGS-FDPLGLGSDPEKLDTLKLAEIKHSRLAMVAFLIFGLQAAITGKGP  201

Query  181  LNNWAT-HLGDPFHTTILD  234
            ++  AT  + +P +  +++
Sbjct  202  ISFLATLTISEPLYLWVIE  220



>gb|ABD37891.1| light-harvesting chlorophyll-a/b binding protein Lhcb5 [Mesostigma 
viride]
Length=280

 Score = 94.7 bits (234),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 55/79 (70%), Gaps = 3/79 (4%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LDP   +YPGGKYFDPLGLASDP +   L++ EIK+ RLAM+AFLGF +Q   T +GP  
Sbjct  196  LDP---LYPGGKYFDPLGLASDPSKADELKVKEIKNGRLAMMAFLGFVVQYFVTKEGPYA  252

Query  187  NWATHLGDPFHTTILDTLG  243
            NW+ HL DPF    L  LG
Sbjct  253  NWSKHLADPFGYNFLTILG  271



>gb|EPS71850.1| hypothetical protein M569_02908 [Genlisea aurea]
Length=473

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E R++PGG  FDPLGLASDP++ A L++ EIK+ RLAM A LGF IQA  TGKGP++
Sbjct  387  LDLEDRLHPGGP-FDPLGLASDPDQAALLKVKEIKNGRLAMFAMLGFFIQAYVTGKGPVD  445

Query  187  NWATHLGDPFHTTILDTLG  243
            N A+HL DPF   +L  +G
Sbjct  446  NLASHLSDPFGNNLLTVIG  464



>gb|KFK36898.1| hypothetical protein AALP_AA4G187000 [Arabis alpina]
Length=277

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            +ELDPE RIYPGG YFDPLGL SDPE+   L+LAEIKH+RLAMVAFL F++QAA TGKGP
Sbjct  210  SELDPEIRIYPGG-YFDPLGLGSDPEKLDTLKLAEIKHSRLAMVAFLIFALQAAFTGKGP  268

Query  181  LNNWAT  198
            ++  AT
Sbjct  269  ISFLAT  274



>tpg|DAA05928.1| TPA_inf: chloroplast light-harvesting complex protein CP26 precursor 
Lhcb5 [Mesostigma viride]
Length=287

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 55/79 (70%), Gaps = 3/79 (4%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LDP   +YPGGKYFDPLGLASDP +   L++ EIK+ RLAM+AFLGF +Q   T +GP  
Sbjct  203  LDP---LYPGGKYFDPLGLASDPSKADELKVKEIKNGRLAMMAFLGFVVQYFVTKEGPYA  259

Query  187  NWATHLGDPFHTTILDTLG  243
            NW+ HL DPF    L  LG
Sbjct  260  NWSKHLADPFGYNFLTILG  278



>ref|XP_006294771.1| hypothetical protein CARUB_v10023823mg [Capsella rubella]
 gb|EOA27669.1| hypothetical protein CARUB_v10023823mg [Capsella rubella]
Length=276

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGP  180
            AEL+PEKRIYPGG YFDPLGLA+DPE+   L+LAEIKH+RLAMVAFL F +QAA TGKGP
Sbjct  209  AELEPEKRIYPGG-YFDPLGLAADPEKLDTLKLAEIKHSRLAMVAFLIFGLQAAFTGKGP  267

Query  181  LNNWAT  198
            ++  A+
Sbjct  268  ISFLAS  273



>ref|XP_007160589.1| hypothetical protein PHAVU_001G000400g [Phaseolus vulgaris]
 gb|ESW32583.1| hypothetical protein PHAVU_001G000400g [Phaseolus vulgaris]
Length=329

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPL L++DPE    L++ EIK+ RLAMVA+LGF +QAA TGKGP+ N   H+ 
Sbjct  252  YPGGALFDPLNLSNDPEAFEELKVKEIKNGRLAMVAWLGFYVQAALTGKGPVQNLIDHIS  311

Query  208  DPFHTTILDTLGLI  249
            DPFH   LD+L ++
Sbjct  312  DPFHNNFLDSLNMM  325



>ref|XP_005847149.1| hypothetical protein CHLNCDRAFT_35818 [Chlorella variabilis]
 gb|EFN55047.1| hypothetical protein CHLNCDRAFT_35818 [Chlorella variabilis]
Length=285

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = +1

Query  10   DPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNN  189
            D    +YPGG  FDPLGLA DPE  A L++ EIK+ RLAMV+FLGF++QAA TG+GP  N
Sbjct  201  DSMDSLYPGGP-FDPLGLADDPEVLAELKVKEIKNGRLAMVSFLGFAVQAAVTGEGPYAN  259

Query  190  WATHLGDPFHTTILDTL  240
            W+ H+ DPF   +L  L
Sbjct  260  WSKHVADPFGYNLLTIL  276



>ref|XP_011074048.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Sesamum 
indicum]
Length=317

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPL L+SDPE    L++ EIK+ RLAMVA+LGF IQAA TGKGP+ N   H+ 
Sbjct  244  YPGGALFDPLNLSSDPESFEELKVKEIKNGRLAMVAWLGFYIQAALTGKGPVQNLLDHIA  303

Query  208  DPFHTTILDTL  240
            DP H  +L TL
Sbjct  304  DPLHNNLLSTL  314



>ref|XP_006660507.1| PREDICTED: chlorophyll a-b binding protein E, chloroplastic-like 
[Oryza brachyantha]
Length=164

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPLGL+ DP     L++ EIK+ RLAMVA+LGF IQAA TGKGP+ N   HL 
Sbjct  93   YPGGALFDPLGLSKDPAAFEDLKVKEIKNGRLAMVAWLGFYIQAAVTGKGPIQNLVEHLS  152

Query  208  DPFHTTILDTL  240
            DP H  IL + 
Sbjct  153  DPLHNNILSSF  163



>ref|NP_001240088.1| uncharacterized protein LOC100786260 [Glycine max]
 gb|ACU18774.1| unknown [Glycine max]
Length=331

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPL L++DPE    L++ EIK+ RLAMVA+LGF +QAA TGKGP+ N   H+ 
Sbjct  254  YPGGALFDPLNLSNDPEAFEELKVKEIKNGRLAMVAWLGFYVQAALTGKGPVQNLIDHIS  313

Query  208  DPFHTTILDTLGLI  249
            DPFH  +L +L  I
Sbjct  314  DPFHNNLLGSLNFI  327



>gb|KHN48517.1| Chlorophyll a-b binding protein 4, chloroplastic [Glycine soja]
Length=332

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPL L++DPE    L++ EIK+ RLAMVA+LGF +QAA TGKGP+ N   H+ 
Sbjct  255  YPGGALFDPLNLSNDPEAFEELKVKEIKNGRLAMVAWLGFYVQAALTGKGPVQNLIDHIS  314

Query  208  DPFHTTILDTLGLI  249
            DPFH  +L +L  I
Sbjct  315  DPFHNNLLGSLNFI  328



>gb|KHG03743.1| Chlorophyll a-b binding CP29.3, chloroplastic -like protein [Gossypium 
arboreum]
Length=282

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 1/60 (2%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            L+PEKR+YPGG YFDPLGLASDP++   L+LAEIKH+RLAMVAFL F +QAA TGKGP++
Sbjct  217  LEPEKRLYPGG-YFDPLGLASDPDKIDNLKLAEIKHSRLAMVAFLIFGLQAAITGKGPIS  275



>gb|EMT30378.1| hypothetical protein F775_43807 [Aegilops tauschii]
Length=168

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP +   L+L EIK+ RLAM+AF+GF +Q +A  G GP
Sbjct  82   EKDPEKKKYPGGA-FDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGP  140

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  141  LENLATHLADPWHNNIGDIV  160



>gb|EAZ44119.1| hypothetical protein OsJ_28744 [Oryza sativa Japonica Group]
Length=245

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPLGL+ DP     L++ EIK+ RLAMVA+LGF IQAA TGKGP+ N   HL 
Sbjct  174  YPGGALFDPLGLSKDPVAFEDLKVKEIKNGRLAMVAWLGFYIQAAVTGKGPIQNLVEHLS  233

Query  208  DPFHTTILDTL  240
            DP H  IL + 
Sbjct  234  DPLHNNILSSF  244



>gb|EMS45291.1| Chlorophyll a-b binding protein 1B-21, chloroplastic [Triticum 
urartu]
Length=202

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP +   L+L EIK+ RLAM+AF+GF +Q +A  G GP
Sbjct  116  EKDPEKKKYPGGA-FDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGP  174

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  175  LENLATHLADPWHNNIGDIV  194



>ref|XP_010664037.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 isoform 
X5 [Vitis vinifera]
Length=282

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPL L+ DP     L++ EIK+ RLAMVA+LGF IQAAATGKGP+ N   HL 
Sbjct  209  YPGGALFDPLNLSKDPVAFEELKVKEIKNGRLAMVAWLGFYIQAAATGKGPVQNLLDHLA  268

Query  208  DPFHTTILDTL  240
            DPFH  +L   
Sbjct  269  DPFHNNLLSIF  279



>gb|AFA36569.1| putative chlorophyll a/b-binding protein, partial [Lolium perenne]
Length=206

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPLGL+ DP     L++ EIK+ RLAMVA+LGF +QAA TGKGP+ N   HL 
Sbjct  135  YPGGALFDPLGLSKDPVAFEELKVKEIKNGRLAMVAWLGFYVQAAVTGKGPVQNLIEHLS  194

Query  208  DPFHTTILDTL  240
            DP H  IL + 
Sbjct  195  DPLHNNILSSF  205



>ref|XP_006357455.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic-like 
[Solanum tuberosum]
Length=285

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DP++ A L++ EIK+ RLAM + LGF IQA  TGKGP+ 
Sbjct  199  LDLEDKLHPGGP-FDPLGLAKDPDQAAILKVKEIKNGRLAMFSMLGFFIQAYVTGKGPVE  257

Query  187  NWATHLGDPFHTTILDTLG  243
            N A HL DPF   +L  +G
Sbjct  258  NLAAHLSDPFGNNLLTVIG  276



>gb|AAB29485.1| light-harvesting complex I, partial (chloroplast) [Hordeum vulgare]
Length=221

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP +   L+L EIK+ RLAM+AF+GF +Q +A  G GP
Sbjct  135  EKDPEKKKYPGGA-FDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGP  193

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  194  LENLATHLADPWHNNIGDIV  213



>sp|Q9SDM1.1|CB121_HORVU RecName: Full=Chlorophyll a-b binding protein 1B-21, chloroplastic; 
AltName: Full=LHCI type I CAB-1B-21; AltName: Full=LHCI-730 
chlorophyll a/b binding protein; AltName: Full=Light-harvesting 
complex I 21 kDa protein; Flags: Precursor [Hordeum 
vulgare]
 gb|AAF23819.1|AF218305_2 chlorophyll a/b binding protein precursor [Hordeum vulgare]
Length=245

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP +   L+L EIK+ RLAM+AF+GF +Q +A  G GP
Sbjct  159  EKDPEKKKYPGGA-FDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGP  217

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  218  LENLATHLADPWHNNIGDIV  237



>gb|EAZ08502.1| hypothetical protein OsI_30775 [Oryza sativa Indica Group]
Length=321

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPLGL+ DP     L++ EIK+ RLAMVA+LGF IQAA TGKGP+ N   HL 
Sbjct  250  YPGGALFDPLGLSKDPVAFEDLKVKEIKNGRLAMVAWLGFYIQAAVTGKGPIQNLVEHLS  309

Query  208  DPFHTTILDTL  240
            DP H  IL + 
Sbjct  310  DPLHNNILSSF  320



>gb|KFM24075.1| Chlorophyll a-b binding protein CP26, chloroplastic [Auxenochlorella 
protothecoides]
Length=912

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 56/78 (72%), Gaps = 4/78 (5%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LDP   +YPGG  FDPLGLA DPE  A L++ EIK+ RLAMVAFLGF++QA  TG+GP  
Sbjct  830  LDP---LYPGGP-FDPLGLADDPETFAELKVKEIKNGRLAMVAFLGFAVQAGVTGEGPFA  885

Query  187  NWATHLGDPFHTTILDTL  240
            NW+ H+ DPF   +L  L
Sbjct  886  NWSKHVADPFGYNLLTIL  903



>ref|NP_001062801.1| Os09g0296800 [Oryza sativa Japonica Group]
 dbj|BAD33211.1| putative chlorophyll a/b-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAF24715.1| Os09g0296800 [Oryza sativa Japonica Group]
Length=321

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPLGL+ DP     L++ EIK+ RLAMVA+LGF IQAA TGKGP+ N   HL 
Sbjct  250  YPGGALFDPLGLSKDPVAFEDLKVKEIKNGRLAMVAWLGFYIQAAVTGKGPIQNLVEHLS  309

Query  208  DPFHTTILDTL  240
            DP H  IL + 
Sbjct  310  DPLHNNILSSF  320



>ref|XP_004956497.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Setaria italica]
Length=317

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPLGL+ DP     L++ EIK+ RLAMVA+LGF IQAA TGKGP+ N   HL 
Sbjct  246  YPGGALFDPLGLSKDPVAFEELKVKEIKNGRLAMVAWLGFYIQAAVTGKGPVQNLVEHLS  305

Query  208  DPFHTTILDTL  240
            DP H  IL + 
Sbjct  306  DPVHNNILSSF  316



>dbj|BAG96979.1| unnamed protein product [Oryza sativa Japonica Group]
Length=159

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLASDP++ A L++ EIK+ RLAM + LGF IQA  TG+GP+ 
Sbjct  73   LDLEDKLHPGGP-FDPLGLASDPDQAALLKVKEIKNGRLAMFSMLGFFIQAYVTGEGPVE  131

Query  187  NWATHLGDPFHTTILDTL  240
            N + HL DPF   +L  +
Sbjct  132  NLSKHLSDPFGNNLLTVI  149



>gb|EYU39821.1| hypothetical protein MIMGU_mgv1a012662mg [Erythranthe guttata]
Length=244

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP++   L++ EIK+ RLA++AF+GF IQ  A  G GP
Sbjct  163  EKDPEKKKYPGGA-FDPLGYSKDPKKLQELKVKEIKNGRLALLAFVGFCIQQTAYPGTGP  221

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D L
Sbjct  222  LENLATHLADPWHNNIGDVL  241



>ref|XP_002459987.1| hypothetical protein SORBIDRAFT_02g020290 [Sorghum bicolor]
 gb|EER96508.1| hypothetical protein SORBIDRAFT_02g020290 [Sorghum bicolor]
Length=314

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPLGL+ DP     L++ EIK+ RLAMVA+LGF IQAA TGKGP+ N   HL 
Sbjct  243  YPGGALFDPLGLSKDPVAFEDLKVKEIKNGRLAMVAWLGFYIQAAVTGKGPVQNLVEHLS  302

Query  208  DPFHTTILDTL  240
            DP H  IL + 
Sbjct  303  DPLHNNILSSF  313



>emb|CBI40786.3| unnamed protein product [Vitis vinifera]
Length=331

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPL L+ DP     L++ EIK+ RLAMVA+LGF IQAAATGKGP+ N   HL 
Sbjct  258  YPGGALFDPLNLSKDPVAFEELKVKEIKNGRLAMVAWLGFYIQAAATGKGPVQNLLDHLA  317

Query  208  DPFHTTILDTL  240
            DPFH  +L   
Sbjct  318  DPFHNNLLSIF  328



>ref|XP_011041127.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic isoform 
X3 [Populus euphratica]
Length=314

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPL L+ DP     L++ EIK+ RLAMVA+LGF IQAA TGKGP+ N   H+ 
Sbjct  241  YPGGILFDPLNLSKDPVSFEELKVKEIKNGRLAMVAWLGFYIQAALTGKGPVENLVEHIS  300

Query  208  DPFHTTILDTLGLI  249
            DP H  +  TL L+
Sbjct  301  DPLHNNLFSTLKLV  314



>dbj|BAK01456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=78

 Score = 84.0 bits (206),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  F+P+GLA D E    ++L EIK+ RLAMVA LGF +QA+ T  GP++N  THL 
Sbjct  5    YPGGPLFNPMGLAKDIENANEVKLKEIKNGRLAMVAMLGFIVQASVTHAGPIDNLLTHLS  64

Query  208  DPFHTTILDTLGL  246
            DPF+  I+  L L
Sbjct  65   DPFNKNIIHALTL  77



>dbj|BAH20219.1| AT3G54890 [Arabidopsis thaliana]
Length=159

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAAT-GKGP  180
            E DPEK+ YPGG  FDPLG + DP++   L++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  77   EKDPEKKKYPGGA-FDPLGYSKDPKKLEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGP  135

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  136  LENLATHLADPWHNNIGDIV  155



>emb|CAA43590.1| Type I (26 kD) CP29 polypeptide [Solanum lycopersicum]
Length=286

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DP++ A L++ EIK+ RLAM + LGF IQA  TG+GP+ 
Sbjct  200  LDLEDKLHPGGP-FDPLGLAKDPDQAAILKVKEIKNGRLAMFSMLGFFIQAYVTGQGPVE  258

Query  187  NWATHLGDPFHTTILDTLG  243
            N A HL DPF   +L  +G
Sbjct  259  NLAAHLSDPFGNNLLTVIG  277



>gb|ACX71300.1| chloroplast pigment-binding protein CP26 [Capsicum annuum]
Length=287

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DP++ A L++ EIK+ RLAM + LGF IQA  TG+GP+ 
Sbjct  201  LDLEDKLHPGGP-FDPLGLAKDPDQAAILKVKEIKNGRLAMFSMLGFFIQAYVTGQGPVE  259

Query  187  NWATHLGDPFHTTILDTLG  243
            N A HL DPF   +L  +G
Sbjct  260  NLAAHLSDPFGNNLLTVIG  278



>ref|XP_004241877.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic 
[Solanum lycopersicum]
Length=286

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DP++ A L++ EIK+ RLAM + LGF IQA  TG+GP+ 
Sbjct  200  LDLEDKLHPGGP-FDPLGLAKDPDQAAILKVKEIKNGRLAMFSMLGFFIQAYVTGQGPVE  258

Query  187  NWATHLGDPFHTTILDTLG  243
            N A HL DPF   +L  +G
Sbjct  259  NLAAHLSDPFGNNLLTVIG  277



>emb|CDP11537.1| unnamed protein product [Coffea canephora]
Length=289

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E R++PGG  FDPLGLA DP++ A L++ EIK+ RLAM A LGF IQA  TG+GP+ 
Sbjct  203  LDLEDRLHPGGP-FDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFIQAYVTGQGPVE  261

Query  187  NWATHLGDPFHTTILDTL  240
            N A HL DPF   +L  +
Sbjct  262  NLAAHLSDPFGNNLLTVI  279



>ref|XP_002307004.1| chlorophyll A-B binding family protein [Populus trichocarpa]
 gb|EEE94000.1| chlorophyll A-B binding family protein [Populus trichocarpa]
Length=338

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPL L+ DP     L++ EIK+ RLAMVA+LGF IQAA TGKGP+ N   H+ 
Sbjct  265  YPGGILFDPLNLSKDPVSFEELKVKEIKNGRLAMVAWLGFYIQAALTGKGPVENLVEHIS  324

Query  208  DPFHTTILDTLGLI  249
            DP H  +  TL L+
Sbjct  325  DPLHNNLFSTLKLV  338



>ref|XP_009781366.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic 
[Nicotiana sylvestris]
Length=285

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DP++ A L++ EIK+ RLAM A LGF IQA  TGKGP+ 
Sbjct  199  LDLEDKLHPGGP-FDPLGLAKDPDQAAILKVKEIKNGRLAMFAMLGFFIQAYVTGKGPVE  257

Query  187  NWATHLGDPFHTTILDTL  240
            N A HL DPF   +L  +
Sbjct  258  NLAAHLSDPFGNNLLTVI  275



>ref|XP_002451621.1| hypothetical protein SORBIDRAFT_04g004770 [Sorghum bicolor]
 gb|EES04597.1| hypothetical protein SORBIDRAFT_04g004770 [Sorghum bicolor]
Length=245

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP +    +L EIK+ RLAM+AF+GF +Q +A  G GP
Sbjct  160  EKDPEKKKYPGGA-FDPLGFSKDPAKFEEYKLKEIKNGRLAMLAFVGFCVQQSAYPGTGP  218

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  219  LENLATHLADPWHNNIGDII  238



>ref|XP_011041125.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic isoform 
X1 [Populus euphratica]
Length=345

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPL L+ DP     L++ EIK+ RLAMVA+LGF IQAA TGKGP+ N   H+ 
Sbjct  272  YPGGILFDPLNLSKDPVSFEELKVKEIKNGRLAMVAWLGFYIQAALTGKGPVENLVEHIS  331

Query  208  DPFHTTILDTLGLI  249
            DP H  +  TL L+
Sbjct  332  DPLHNNLFSTLKLV  345



>gb|ABK23427.1| unknown [Picea sitchensis]
 gb|ABK23601.1| unknown [Picea sitchensis]
Length=247

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAAT-GKGP  180
            E DPEKR YPGG  FDPLG + DP +    ++ EIK+ RLA++AF+GF +QA+A  G GP
Sbjct  161  EPDPEKRKYPGGA-FDPLGFSKDPAKFKEYKVKEIKNGRLALLAFVGFCVQASANPGTGP  219

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I + +
Sbjct  220  LENLATHLSDPWHKNIAEII  239



>ref|XP_009769851.1| PREDICTED: chlorophyll a-b binding protein 6A, chloroplastic 
[Nicotiana sylvestris]
Length=245

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP++   L++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  160  EKDPEKKKYPGGA-FDPLGYSKDPKKFEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGP  218

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  219  LENLATHLADPWHNNIGDVI  238



>ref|NP_192772.1| chlorophyll a-b binding protein CP26 [Arabidopsis thaliana]
 sp|Q9XF89.1|CB5_ARATH RecName: Full=Chlorophyll a-b binding protein CP26, chloroplastic; 
AltName: Full=LHCB5; AltName: Full=LHCIIc; AltName: Full=Light-harvesting 
complex II protein 5; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD28776.1|AF134129_1 Lhcb5 protein [Arabidopsis thaliana]
 gb|AAG41482.1|AF326900_1 putative chlorophyll a/b-binding protein [Arabidopsis thaliana]
 gb|AAK00400.1|AF339718_1 putative chlorophyll a/b-binding protein [Arabidopsis thaliana]
 gb|AAK55712.1|AF380631_1 AT4g10340/F24G24_140 [Arabidopsis thaliana]
 gb|AAL11591.1|AF424597_1 AT4g10340/F24G24_140 [Arabidopsis thaliana]
 emb|CAB39787.1| chlorophyll a/b-binding protein-like [Arabidopsis thaliana]
 emb|CAB78157.1| chlorophyll a/b-binding protein-like [Arabidopsis thaliana]
 gb|AAL06787.1| AT4g10340/F24G24_140 [Arabidopsis thaliana]
 gb|AEE82869.1| chlorophyll a-b binding protein CP26 [Arabidopsis thaliana]
Length=280

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DPE+ A L++ EIK+ RLAM A LGF IQA  TG+GP+ 
Sbjct  194  LDFEDKLHPGGP-FDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVE  252

Query  187  NWATHLGDPFHTTILDTL  240
            N A HL DPF   +L  +
Sbjct  253  NLAKHLSDPFGNNLLTVI  270



>ref|XP_009609516.1| PREDICTED: chlorophyll a-b binding protein 6A, chloroplastic 
[Nicotiana tomentosiformis]
Length=245

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP++   L++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  160  EKDPEKKKYPGGA-FDPLGYSKDPKKFEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGP  218

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  219  LENLATHLADPWHNNIGDVI  238



>gb|AAM65487.1| chlorophyll a/b-binding protein-like [Arabidopsis thaliana]
Length=280

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DPE+ A L++ EIK+ RLAM A LGF IQA  TG+GP+ 
Sbjct  194  LDFEDKLHPGGP-FDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVE  252

Query  187  NWATHLGDPFHTTILDTL  240
            N A HL DPF   +L  +
Sbjct  253  NLAKHLSDPFGNNLLTVI  270



>gb|AFW70295.1| hypothetical protein ZEAMMB73_802965 [Zea mays]
Length=150

 Score = 85.5 bits (210),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP +    +L EIK+ RLAM+AF+GF +Q +A  G GP
Sbjct  65   EKDPEKKKYPGGA-FDPLGFSKDPAKFEEYKLKEIKNGRLAMLAFVGFCVQQSAYPGTGP  123

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N A+HL DP+H  I D +
Sbjct  124  LENLASHLADPWHNNIGDII  143



>ref|XP_011041126.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic isoform 
X2 [Populus euphratica]
Length=338

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPL L+ DP     L++ EIK+ RLAMVA+LGF IQAA TGKGP+ N   H+ 
Sbjct  265  YPGGILFDPLNLSKDPVSFEELKVKEIKNGRLAMVAWLGFYIQAALTGKGPVENLVEHIS  324

Query  208  DPFHTTILDTLGLI  249
            DP H  +  TL L+
Sbjct  325  DPLHNNLFSTLKLV  338



>ref|XP_009616313.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic 
[Nicotiana tomentosiformis]
 gb|ABG73417.1| chloroplast pigment-binding protein CP26 [Nicotiana tabacum]
Length=285

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DP++ A L++ EIK+ RLAM A LGF IQA  TGKGP+ 
Sbjct  199  LDLEDKLHPGGP-FDPLGLAKDPDQAAILKVKEIKNGRLAMFAMLGFFIQAYVTGKGPVE  257

Query  187  NWATHLGDPFHTTILDTL  240
            N A HL DPF   +L  +
Sbjct  258  NLAAHLSDPFGNNLLTVI  275



>ref|XP_006403518.1| hypothetical protein EUTSA_v10010669mg [Eutrema salsugineum]
 gb|ESQ44971.1| hypothetical protein EUTSA_v10010669mg [Eutrema salsugineum]
Length=148

 Score = 85.5 bits (210),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAAT-GKGP  180
            E DPEK+ YPGG  FDPLG + DP++   L++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  66   EKDPEKKKYPGGA-FDPLGYSKDPKKFEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGP  124

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  125  LENLATHLADPWHKNIGDIV  144



>gb|ABK26977.1| unknown [Picea sitchensis]
Length=247

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAAT-GKGP  180
            E DPEKR YPGG  FDPLG + DP +    ++ EIK+ RLA++AF+GF +QA+A  G GP
Sbjct  161  EPDPEKRKYPGGA-FDPLGFSKDPAKFKEYKVKEIKNGRLALLAFVGFCVQASANPGTGP  219

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I + +
Sbjct  220  LENLATHLSDPWHKNIAEII  239



>gb|ACO06087.1| chlorophyll a-b binding protein [Triticum aestivum]
Length=291

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP +   L+L EIK+ RLAM+AF+GF +Q +A  G GP
Sbjct  184  EKDPEKKKYPGGA-FDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGP  242

Query  181  LNNWATHLGDPFHTT  225
            L N ATHL DP+H T
Sbjct  243  LENLATHLADPWHNT  257



>gb|KFM24280.1| Chlorophyll a-b binding protein 3C, chloroplastic [Auxenochlorella 
protothecoides]
Length=268

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +1

Query  10   DPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNN  189
            D    +YPGG YFDPLGLA DPE  A L++ E+K+ RLAMVA LGF +QA  TGKGP+ N
Sbjct  185  DGLDNLYPGGTYFDPLGLADDPETFAELRVKELKNGRLAMVAALGFFVQAVVTGKGPIQN  244

Query  190  WATHLGDP  213
             + HL DP
Sbjct  245  LSDHLADP  252



>ref|XP_006288402.1| hypothetical protein CARUB_v10001659mg [Capsella rubella]
 gb|EOA21300.1| hypothetical protein CARUB_v10001659mg [Capsella rubella]
Length=281

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DPE+ A L++ EIK+ RLAM A LGF IQA  TG+GP+ 
Sbjct  195  LDFEDKLHPGGP-FDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVE  253

Query  187  NWATHLGDPFHTTILDTL  240
            N A HL DPF   +L  +
Sbjct  254  NLAQHLSDPFGNNLLTVI  271



>ref|XP_010246736.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 isoform 
X2 [Nelumbo nucifera]
Length=341

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPLGL+ DP     L++ EIK+ RLAMVA+LGF +QAA TGKGPL N   H+ 
Sbjct  268  YPGGTLFDPLGLSKDPVAFEELKVKEIKNGRLAMVAWLGFYLQAALTGKGPLQNLLEHIS  327

Query  208  DPFHTTILDTL  240
            DP H  IL  L
Sbjct  328  DPLHNNILSFL  338



>ref|XP_010455433.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic-like 
[Camelina sativa]
Length=281

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DPE+ A L++ EIK+ RLAM A LGF IQA  TG+GP+ 
Sbjct  195  LDFEDKLHPGGP-FDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVE  253

Query  187  NWATHLGDPFHTTILDTL  240
            N A HL DPF   +L  +
Sbjct  254  NLAQHLSDPFGNNLLTVI  271



>ref|XP_011095097.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic 
[Sesamum indicum]
Length=287

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA+DP++ A L++ EIK+ RLAM A LGF +QA  TGKGP+ 
Sbjct  201  LDLEDKLHPGGP-FDPLGLANDPDQAALLKVKEIKNGRLAMFAMLGFFLQAYVTGKGPVE  259

Query  187  NWATHLGDPFHTTILDTL  240
            N A HL DPF   +L  +
Sbjct  260  NLAAHLSDPFGNNLLTVI  277



>ref|XP_004499329.1| PREDICTED: chlorophyll a-b binding protein type 1 member F3, 
chloroplastic-like isoform X2 [Cicer arietinum]
Length=289

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPL L+ DPE    L++ EIK+ RLAM+A+LGF +QAA TGKGP+ N   H+ 
Sbjct  213  YPGGALFDPLNLSKDPEAFEELKVKEIKNGRLAMMAWLGFFMQAALTGKGPVQNLMDHIS  272

Query  208  DPFHTTILDTL  240
            DPFH  +L +L
Sbjct  273  DPFHNNLLGSL  283



>ref|XP_010437187.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic 
[Camelina sativa]
 ref|XP_010421955.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic 
[Camelina sativa]
Length=281

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DPE+ A L++ EIK+ RLAM A LGF IQA  TG+GP+ 
Sbjct  195  LDFEDKLHPGGP-FDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVE  253

Query  187  NWATHLGDPFHTTILDTL  240
            N A HL DPF   +L  +
Sbjct  254  NLAQHLSDPFGNNLLTVI  271



>ref|XP_002872508.1| hypothetical protein ARALYDRAFT_489877 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48767.1| hypothetical protein ARALYDRAFT_489877 [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DPE+ A L++ EIK+ RLAM A LGF IQA  TG+GP+ 
Sbjct  194  LDFEDKLHPGGP-FDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVE  252

Query  187  NWATHLGDPFHTTILDTL  240
            N A HL DPF   +L  +
Sbjct  253  NLAKHLSDPFGNNLLTVI  270



>ref|XP_003577951.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Brachypodium 
distachyon]
Length=318

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPLGL+ DP     L++ EIK+ RLAMVA+LGF +QAA TGKGP+ N   HL 
Sbjct  247  YPGGALFDPLGLSKDPVGFEELKVKEIKNGRLAMVAWLGFYLQAAVTGKGPVQNLVEHLS  306

Query  208  DPFHTTILDTL  240
            DP H  IL + 
Sbjct  307  DPLHNNILSSF  317



>dbj|BAK02397.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99432.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=310

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPLGL+ DP      ++ EIK+ RLAMVA++GF IQAA TGKGP+ N A HL 
Sbjct  239  YPGGALFDPLGLSKDPVAFEEFKVKEIKNGRLAMVAWIGFYIQAAVTGKGPVQNLAEHLS  298

Query  208  DPFHTTILD  234
            DP H  IL 
Sbjct  299  DPLHNNILS  307



>ref|XP_008453995.1| PREDICTED: chlorophyll a-b binding protein 6A, chloroplastic 
isoform X1 [Cucumis melo]
Length=246

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DPE+    ++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  161  EKDPEKKKYPGGA-FDPLGYSKDPEKLKEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGP  219

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  220  LENLATHLADPWHNNIGDII  239



>ref|XP_004499328.1| PREDICTED: chlorophyll a-b binding protein type 1 member F3, 
chloroplastic-like isoform X1 [Cicer arietinum]
Length=336

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPL L+ DPE    L++ EIK+ RLAM+A+LGF +QAA TGKGP+ N   H+ 
Sbjct  260  YPGGALFDPLNLSKDPEAFEELKVKEIKNGRLAMMAWLGFFMQAALTGKGPVQNLMDHIS  319

Query  208  DPFHTTILDTL  240
            DPFH  +L +L
Sbjct  320  DPFHNNLLGSL  330



>ref|XP_002264295.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic 
[Vitis vinifera]
 emb|CAN76428.1| hypothetical protein VITISV_023565 [Vitis vinifera]
 emb|CBI16969.3| unnamed protein product [Vitis vinifera]
Length=290

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA+DP++ A L++ EIK+ RLAM A LGF IQA  TG+GP+ 
Sbjct  204  LDLEDKLHPGGP-FDPLGLANDPDQAALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVE  262

Query  187  NWATHLGDPFHTTILDTL  240
            N A HL DPF   +L  +
Sbjct  263  NLAAHLSDPFGNNLLTVI  280



>emb|CAA45523.1| photosystem I light-harvesting chlorophyll a/b-binding protein 
[Nicotiana tabacum]
Length=245

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP++   L++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  160  EKDPEKKKYPGGA-FDPLGYSKDPKKFEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGP  218

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  219  LENLATHLADPWHNNIGDVI  238



>ref|XP_010246735.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 isoform 
X1 [Nelumbo nucifera]
Length=367

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPLGL+ DP     L++ EIK+ RLAMVA+LGF +QAA TGKGPL N   H+ 
Sbjct  294  YPGGTLFDPLGLSKDPVAFEELKVKEIKNGRLAMVAWLGFYLQAALTGKGPLQNLLEHIS  353

Query  208  DPFHTTILDTL  240
            DP H  IL  L
Sbjct  354  DPLHNNILSFL  364



>gb|ABK55743.1| chloroplast type III LHCII CAB precursor protein [Cucumis sativus]
Length=84

 Score = 83.6 bits (205),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +1

Query  25   IYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHL  204
            +YPGG+YFDPLGLA DP   A L++ EIK+ RLAM +  GF +QA  TGKGPL N   HL
Sbjct  22   LYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHL  81

Query  205  GDP  213
             DP
Sbjct  82   DDP  84



>ref|XP_009792367.1| PREDICTED: chlorophyll a-b binding protein 6A, chloroplastic-like 
[Nicotiana sylvestris]
Length=245

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP++   L++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  160  EKDPEKKKYPGGA-FDPLGYSKDPKKFEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGP  218

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  219  LENLATHLADPWHNNIGDVI  238



>gb|ACA66263.1| chloroplast chlorophyll a/b binding protein precursor [Phyllostachys 
edulis]
Length=261

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLASDP++ A L++ EIK+ RLAM + LGF IQA  TG+GP+ 
Sbjct  175  LDLEDKLHPGGP-FDPLGLASDPDQAALLKVKEIKNGRLAMFSMLGFFIQAYVTGEGPVE  233

Query  187  NWATHLGDPFHTTILDTL  240
            N A HL DPF   +L  +
Sbjct  234  NLAKHLSDPFGNNLLTVI  251



>gb|ABR25552.1| chloroplast chlorophyll a-b binding proteinr [Oryza sativa Indica 
Group]
Length=201

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLASDP++ A L++ EIK+ RLAM + LGF IQA  TG+GP+ 
Sbjct  115  LDLEDKLHPGGP-FDPLGLASDPDQAALLKVKEIKNGRLAMFSMLGFFIQAYVTGEGPVE  173

Query  187  NWATHLGDPFHTTILDTL  240
            N + HL DPF   +L  +
Sbjct  174  NLSKHLSDPFGNNLLTVI  191



>ref|XP_004143800.1| PREDICTED: chlorophyll a-b binding protein 6A, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004169556.1| PREDICTED: chlorophyll a-b binding protein 6A, chloroplastic-like 
[Cucumis sativus]
 gb|KGN51208.1| hypothetical protein Csa_5G490820 [Cucumis sativus]
Length=246

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DPE+    ++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  161  EKDPEKKKYPGGA-FDPLGYSKDPEKLKEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGP  219

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  220  LENLATHLADPWHNNIGDII  239



>gb|ABX47017.1| chloroplast chlorophyll a/b binding protein cab-PhE9 [Phyllostachys 
edulis]
Length=283

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLASDP++ A L++ EIK+ RLAM + LGF IQA  TG+GP+ 
Sbjct  197  LDLEDKLHPGGP-FDPLGLASDPDQAALLKVKEIKNGRLAMFSMLGFFIQAYVTGEGPVE  255

Query  187  NWATHLGDPFHTTILDTL  240
            N A HL DPF   +L  +
Sbjct  256  NLAKHLSDPFGNNLLTVI  273



>gb|KHN30537.1| Chlorophyll a-b binding protein CP26, chloroplastic [Glycine 
soja]
Length=159

 Score = 85.1 bits (209),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DP++ A L++ EIK+ RLAM A LGF  QA  TG+GP+ 
Sbjct  73   LDLEDKLHPGGP-FDPLGLAKDPDQAALLKVKEIKNGRLAMFAMLGFYFQAYVTGEGPVE  131

Query  187  NWATHLGDPFHTTILDTL  240
            N A HL DPF   +L  +
Sbjct  132  NLAKHLSDPFGNNLLTVI  149



>gb|ABK21181.1| unknown [Picea sitchensis]
 gb|ABK21632.1| unknown [Picea sitchensis]
 gb|ABK22131.1| unknown [Picea sitchensis]
 gb|ABK25943.1| unknown [Picea sitchensis]
 gb|ABK26096.1| unknown [Picea sitchensis]
 gb|ABR16740.1| unknown [Picea sitchensis]
 gb|ACN39950.1| unknown [Picea sitchensis]
 gb|ACN40024.1| unknown [Picea sitchensis]
 gb|ACN40075.1| unknown [Picea sitchensis]
Length=303

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DP++ A L++ EIK+ RLAM + LGF +QA  TG+GP+ 
Sbjct  217  LDFEDKLHPGGP-FDPLGLAKDPDQFALLKVKEIKNGRLAMFSMLGFFVQAYVTGEGPVE  275

Query  187  NWATHLGDPFHTTILDTLG  243
            N A HL DPF   +L  LG
Sbjct  276  NLAAHLSDPFGNNLLTVLG  294



>gb|ACN40433.1| unknown [Picea sitchensis]
Length=303

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DP++ A L++ EIK+ RLAM + LGF +QA  TG+GP+ 
Sbjct  217  LDFEDKLHPGGP-FDPLGLAKDPDQFALLKVKEIKNGRLAMFSMLGFFVQAYVTGEGPVE  275

Query  187  NWATHLGDPFHTTILDTLG  243
            N A HL DPF   +L  LG
Sbjct  276  NLAAHLSDPFGNNLLTVLG  294



>gb|ABK23158.1| unknown [Picea sitchensis]
Length=303

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DP++ A L++ EIK+ RLAM + LGF +QA  TG+GP+ 
Sbjct  217  LDFEDKLHPGGP-FDPLGLAKDPDQFALLKVKEIKNGRLAMFSMLGFFVQAYVTGEGPVE  275

Query  187  NWATHLGDPFHTTILDTLG  243
            N A HL DPF   +L  LG
Sbjct  276  NLAAHLSDPFGNNLLTVLG  294



>gb|AAX95979.1| chlorophyll a/b-binding protein CP26 precursor - maize [Oryza 
sativa Japonica Group]
 gb|ABA92340.1| Chlorophyll A-B binding protein, expressed [Oryza sativa Japonica 
Group]
Length=225

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLASDP++ A L++ EIK+ RLAM + LGF IQA  TG+GP+ 
Sbjct  139  LDLEDKLHPGGP-FDPLGLASDPDQAALLKVKEIKNGRLAMFSMLGFFIQAYVTGEGPVE  197

Query  187  NWATHLGDPFHTTILDTL  240
            N + HL DPF   +L  +
Sbjct  198  NLSKHLSDPFGNNLLTVI  215



>emb|CAA41405.1| Type 1 chlorophyll a /b-binding protein [Pinus sylvestris]
Length=207

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 2/81 (2%)
 Frame = +1

Query  1    AELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAAT-GKG  177
             E DPEKR YPGG  FDPLG + DP +    ++ EIK+ RLA++AF+GF +QA+A  G G
Sbjct  120  GEPDPEKRKYPGGA-FDPLGFSKDPVKFKEYKVKEIKNGRLALLAFVGFCVQASANPGTG  178

Query  178  PLNNWATHLGDPFHTTILDTL  240
            PL N ATHL DP+H  I + +
Sbjct  179  PLENLATHLSDPWHRNIAEII  199



>gb|ACN40554.1| unknown [Picea sitchensis]
Length=278

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DP++ A L++ EIK+ RLAM + LGF +QA  TG+GP+ 
Sbjct  192  LDFEDKLHPGGP-FDPLGLAKDPDQFALLKVKEIKNGRLAMFSMLGFFVQAYVTGEGPVE  250

Query  187  NWATHLGDPFHTTILDTLG  243
            N A HL DPF   +L  LG
Sbjct  251  NLAAHLSDPFGNNLLTVLG  269



>ref|XP_004965344.1| PREDICTED: chlorophyll a-b binding protein 1B-21, chloroplastic-like 
[Setaria italica]
Length=300

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP +    +L EIK+ RLAM+AF+GF +Q +A  G GP
Sbjct  215  EKDPEKKKYPGGA-FDPLGFSKDPVKFEEYKLKEIKNGRLAMLAFVGFCVQQSAYPGTGP  273

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  274  LENLATHLADPWHNNIGDII  293



>ref|XP_010542365.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic 
[Tarenaya hassleriana]
Length=285

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA+DPE+ A L++ EIK+ RLAM A LGF  QA  TG+GP+ 
Sbjct  199  LDLEDKLHPGGP-FDPLGLANDPEQAALLKVKEIKNGRLAMFAMLGFYFQAYVTGEGPVE  257

Query  187  NWATHLGDPFHTTILDTL  240
            N A HL DPF   +L  +
Sbjct  258  NLAKHLSDPFGNNLLTVI  275



>gb|ABK23587.1| unknown [Picea sitchensis]
Length=303

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DP++ A L++ EIK+ RLAM + LGF +QA  TG+GP+ 
Sbjct  217  LDFEDKLHPGGP-FDPLGLAKDPDQFALLKVKEIKNGRLAMFSMLGFFVQAYVTGEGPVE  275

Query  187  NWATHLGDPFHTTILDTLG  243
            N A HL DPF   +L  LG
Sbjct  276  NLAAHLSDPFGNNLLTVLG  294



>gb|EPS58306.1| hypothetical protein M569_16509, partial [Genlisea aurea]
Length=180

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP++   L++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  95   EKDPEKKKYPGGA-FDPLGYSKDPQKFHELKVKEIKNGRLALLAFVGFVVQQSAYPGTGP  153

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  154  LENLATHLSDPWHNNIGDII  173



>ref|XP_010032204.1| PREDICTED: chlorophyll a-b binding protein 6, chloroplastic [Eucalyptus 
grandis]
 gb|KCW51605.1| hypothetical protein EUGRSUZ_J01096 [Eucalyptus grandis]
Length=247

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP +   L++ EIK+ RLA++AF+GF IQ  A  G GP
Sbjct  162  EKDPEKKKYPGGA-FDPLGYSKDPVKFEELKVKEIKNGRLALLAFVGFCIQQTAYPGTGP  220

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D L
Sbjct  221  LENLATHLADPWHNNIGDIL  240



>gb|AFW70293.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_802965, partial 
[Zea mays]
Length=273

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP +    +L EIK+ RLAM+AF+GF +Q +A  G GP
Sbjct  160  EKDPEKKKYPGGA-FDPLGFSKDPAKFEEYKLKEIKNGRLAMLAFVGFCVQQSAYPGTGP  218

Query  181  LNNWATHLGDPFHTTILDTLGLIS  252
            L N A+HL DP+H  I D +  I+
Sbjct  219  LENLASHLADPWHNNIGDIIPQIN  242



>gb|ABG22426.1| Chlorophyll A-B binding protein, expressed [Oryza sativa Japonica 
Group]
Length=222

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLASDP++ A L++ EIK+ RLAM + LGF IQA  TG+GP+ 
Sbjct  136  LDLEDKLHPGGP-FDPLGLASDPDQAALLKVKEIKNGRLAMFSMLGFFIQAYVTGEGPVE  194

Query  187  NWATHLGDPFHTTILDTL  240
            N + HL DPF   +L  +
Sbjct  195  NLSKHLSDPFGNNLLTVI  212



>gb|KCW51604.1| hypothetical protein EUGRSUZ_J01096 [Eucalyptus grandis]
Length=246

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP +   L++ EIK+ RLA++AF+GF IQ  A  G GP
Sbjct  161  EKDPEKKKYPGGA-FDPLGYSKDPVKFEELKVKEIKNGRLALLAFVGFCIQQTAYPGTGP  219

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D L
Sbjct  220  LENLATHLADPWHNNIGDIL  239



>ref|XP_006403519.1| hypothetical protein EUTSA_v10010669mg [Eutrema salsugineum]
 gb|ESQ44972.1| hypothetical protein EUTSA_v10010669mg [Eutrema salsugineum]
Length=180

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP++   L++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  98   EKDPEKKKYPGGA-FDPLGYSKDPKKFEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGP  156

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  157  LENLATHLADPWHKNIGDIV  176



>emb|CAA41404.1| Type 1 chlorophyll a /b-binding protein [Pinus sylvestris]
Length=246

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAAT-GKGP  180
            E DPEKR YPGG  FDPLG + DP +    ++ EIK+ RLA++AF+GF +QA+A  G GP
Sbjct  160  EPDPEKRKYPGGA-FDPLGFSKDPVKFKEYKVKEIKNGRLALLAFVGFCVQASANPGTGP  218

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I + +
Sbjct  219  LENLATHLSDPWHRNIAEII  238



>ref|XP_009590581.1| PREDICTED: chlorophyll a-b binding protein 6A, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=245

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP++   L++ E+K+ RLA++AF+GF +Q +A  G GP
Sbjct  160  EKDPEKKKYPGGA-FDPLGYSKDPKKFEELKVKEVKNGRLALLAFVGFCVQQSAYPGTGP  218

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  219  LENLATHLADPWHNNIGDVI  238



>gb|KDO48421.1| hypothetical protein CISIN_1g025577mg [Citrus sinensis]
Length=250

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP++    ++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  165  EKDPEKKKYPGGA-FDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGP  223

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  224  LENLATHLADPWHNNIGDVI  243



>ref|XP_009134190.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic 
[Brassica rapa]
Length=280

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DPE+ A L++ EIK+ RLAM A LGF IQA  TG+GP+ 
Sbjct  194  LDFEDKLHPGGP-FDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVE  252

Query  187  NWATHLGDPFHTTILDTL  240
            N + HL DPF   +L  +
Sbjct  253  NLSKHLSDPFGNNLLTVI  270



>ref|XP_003577654.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic 
[Brachypodium distachyon]
Length=286

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLASDP++ A L++ EIK+ RLAM + LGF IQA  TG+GP+ 
Sbjct  200  LDLEDKLHPGGP-FDPLGLASDPDQAALLKVKEIKNGRLAMFSMLGFFIQAYVTGEGPVE  258

Query  187  NWATHLGDPFHTTILDTL  240
            N + HL DPF   +L  +
Sbjct  259  NLSAHLSDPFGNNLLTVI  276



>emb|CDY05098.1| BnaC03g28960D [Brassica napus]
Length=280

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DPE+ A L++ EIK+ RLAM A LGF IQA  TG+GP+ 
Sbjct  194  LDFEDKLHPGGP-FDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVE  252

Query  187  NWATHLGDPFHTTILDTL  240
            N + HL DPF   +L  +
Sbjct  253  NLSKHLSDPFGNNLLTVI  270



>ref|XP_006291772.1| hypothetical protein CARUB_v10017942mg [Capsella rubella]
 gb|EOA24670.1| hypothetical protein CARUB_v10017942mg [Capsella rubella]
Length=241

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP++   L++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  159  EKDPEKKKYPGGA-FDPLGYSKDPKKLEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGP  217

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  218  LENLATHLADPWHNNIGDIV  237



>ref|XP_002878004.1| hypothetical protein ARALYDRAFT_485905 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54263.1| hypothetical protein ARALYDRAFT_485905 [Arabidopsis lyrata subsp. 
lyrata]
Length=241

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP++   L++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  159  EKDPEKKKYPGGA-FDPLGYSKDPKKLEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGP  217

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  218  LENLATHLADPWHNNIGDIV  237



>ref|XP_006342200.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Solanum tuberosum]
Length=318

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPL L+ DP     L++ EIK+ RLAMVA+LGF +QAA TGKGP+ N   H+ 
Sbjct  245  YPGGVLFDPLNLSKDPMAFEELKVKEIKNGRLAMVAWLGFYVQAALTGKGPVQNLLEHIS  304

Query  208  DPFHTTILDTL  240
            DPFH  +L  L
Sbjct  305  DPFHNNLLSIL  315



>ref|XP_006656037.1| PREDICTED: chlorophyll a-b binding protein 1B-21, chloroplastic-like 
[Oryza brachyantha]
Length=244

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP +    +L EIK+ RLAM+AF+GF +Q +A  G GP
Sbjct  159  EKDPEKKKYPGGA-FDPLGFSKDPAKFEEYKLKEIKNGRLAMLAFVGFCVQQSAYPGTGP  217

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N A+HL DP+H  I D +
Sbjct  218  LENLASHLSDPWHNNIGDVI  237



>gb|AAG40043.2|AF324692_1 AT3g54890 [Arabidopsis thaliana]
Length=241

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP++   L++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  159  EKDPEKKKYPGGA-FDPLGYSKDPKKLEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGP  217

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  218  LENLATHLADPWHNNIGDIV  237



>ref|XP_009379890.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009379891.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=142

 Score = 84.3 bits (207),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA+DP++ A L++ EIK+ R+AM A LGF +QA  TG+GP+ 
Sbjct  56   LDLEDKLHPGGP-FDPLGLANDPDQAALLKVKEIKNGRVAMFAMLGFFLQAYVTGEGPVE  114

Query  187  NWATHLGDPFHTTILDTL  240
            N   HL DPF   +L  +
Sbjct  115  NLTRHLSDPFGNNLLTVI  132



>emb|CDX90755.1| BnaA03g24350D [Brassica napus]
Length=280

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DPE+ A L++ EIK+ RLAM A LGF IQA  TG+GP+ 
Sbjct  194  LDFEDKLHPGGP-FDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVE  252

Query  187  NWATHLGDPFHTTILDTL  240
            N + HL DPF   +L  +
Sbjct  253  NLSKHLSDPFGNNLLTVI  270



>ref|XP_010554984.1| PREDICTED: chlorophyll a-b binding protein 6, chloroplastic, 
partial [Tarenaya hassleriana]
Length=210

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP++   L++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  125  EKDPEKKKYPGGA-FDPLGYSKDPKKFEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGP  183

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  184  LENLATHLADPWHNNIGDIV  203



>ref|NP_001141936.1| uncharacterized protein LOC100274085 [Zea mays]
 gb|ACF87337.1| unknown [Zea mays]
 tpg|DAA60925.1| TPA: hypothetical protein ZEAMMB73_235289 [Zea mays]
 tpg|DAA60926.1| TPA: hypothetical protein ZEAMMB73_235289 [Zea mays]
Length=164

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPLGL+ DP     L++ EIK+ RLAMVA+ GF IQAA TGKGP+ N   HL 
Sbjct  93   YPGGPLFDPLGLSKDPVAFEDLKVKEIKNGRLAMVAWFGFYIQAAVTGKGPVQNLVEHLS  152

Query  208  DPFHTTILDTL  240
            DP +  IL + 
Sbjct  153  DPLNNNILSSF  163



>ref|XP_006436282.1| hypothetical protein CICLE_v10032568mg [Citrus clementina]
 ref|XP_006485870.1| PREDICTED: chlorophyll a-b binding protein 6, chloroplastic-like 
[Citrus sinensis]
 gb|ESR49522.1| hypothetical protein CICLE_v10032568mg [Citrus clementina]
 gb|KDO48420.1| hypothetical protein CISIN_1g025577mg [Citrus sinensis]
Length=245

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP++    ++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  160  EKDPEKKKYPGGA-FDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGP  218

Query  181  LNNWATHLGDPFHTTILDTL  240
            L N ATHL DP+H  I D +
Sbjct  219  LENLATHLADPWHNNIGDVI  238



>gb|EAY80485.1| hypothetical protein OsI_35663 [Oryza sativa Indica Group]
Length=283

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLASDP++ A L++ EIK+ RLAM + LGF IQA  TG+GP+ 
Sbjct  197  LDLEDKLHPGGP-FDPLGLASDPDQAALLKVKEIKNGRLAMFSMLGFFIQAYVTGEGPVE  255

Query  187  NWATHLGDPFHTTILDTL  240
            N + HL DPF   +L  +
Sbjct  256  NLSKHLSDPFGNNLLTVI  273



>pdb|2O01|1 Chain 1, The Structure Of A Plant Photosystem I Supercomplex 
At 3.4 Angstrom Resolution
Length=187

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +1

Query  4    ELDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAA-TGKGP  180
            E DPEK+ YPGG  FDPLG + DP++   L++ EIK+ RLA++AF+GF +Q +A  G GP
Sbjct  111  EKDPEKKKYPGGA-FDPLGYSKDPKKLEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGP  169

Query  181  LNNWATHLGDPFHTTILD  234
            L N ATHL DP+H  I D
Sbjct  170  LENLATHLADPWHNNIGD  187



>emb|CDY60092.1| BnaC02g46810D [Brassica napus]
Length=281

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DPE+ A L++ EIK+ RLAM A LGF IQA  TG+GP+ 
Sbjct  195  LDFEDKLHPGGP-FDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVE  253

Query  187  NWATHLGDPFHTTILDTL  240
            N + HL DPF   +L  +
Sbjct  254  NLSKHLSDPFGNNLLTVI  271



>ref|XP_006397075.1| hypothetical protein EUTSA_v10028871mg [Eutrema salsugineum]
 gb|ESQ38528.1| hypothetical protein EUTSA_v10028871mg [Eutrema salsugineum]
Length=280

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DPE+ A L++ EIK+ RLAM A LGF IQA  TG+GP+ 
Sbjct  194  LDFEDKLHPGGP-FDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVE  252

Query  187  NWATHLGDPFHTTILDTL  240
            N + HL DPF   +L  +
Sbjct  253  NLSKHLSDPFGNNLLTVI  270



>gb|KDO42915.1| hypothetical protein CISIN_1g0225291mg [Citrus sinensis]
Length=189

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  7    LDPEKRIYPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLN  186
            LD E +++PGG  FDPLGLA DP++ A L++ EIK+ RLAM A LGF +QA  TG+GP+ 
Sbjct  103  LDLEDKLHPGGP-FDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVE  161

Query  187  NWATHLGDPFHTTILDTL  240
            N A HL DPF   +L  +
Sbjct  162  NLAKHLSDPFANNLLTVI  179



>ref|XP_004238472.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Solanum 
lycopersicum]
Length=318

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  28   YPGGKYFDPLGLASDPEEKARLQLAEIKHARLAMVAFLGFSIQAAATGKGPLNNWATHLG  207
            YPGG  FDPL L+ DP     L++ EIK+ RLAMVA+LGF +QAA TGKGP+ N   H+ 
Sbjct  245  YPGGVLFDPLNLSKDPMAFEELKVKEIKNGRLAMVAWLGFYVQAALTGKGPVQNLLEHIS  304

Query  208  DPFHTTILDTL  240
            DPFH  +L  L
Sbjct  305  DPFHNNLLSIL  315



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 535034735806