BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14732_g1_i1 len=2129 path=[1:0-319 321:320-2128]

Length=2129
                                                                      Score     E

ref|XP_009791276.1|  PREDICTED: decapping nuclease DXO homolog, c...    692   0.0      
ref|XP_006358629.1|  PREDICTED: decapping nuclease Dom3z homolog,...    689   0.0      
ref|XP_009594860.1|  PREDICTED: decapping nuclease DXO homolog, c...    688   0.0      
ref|XP_004245834.1|  PREDICTED: decapping nuclease DXO homolog, c...    681   0.0      
ref|XP_011070262.1|  PREDICTED: decapping nuclease DXO homolog, c...    665   0.0      
ref|XP_007039646.1|  Glycine-rich protein isoform 1                     662   0.0      
emb|CDP08316.1|  unnamed protein product                                655   0.0      
ref|XP_002516686.1|  Protein dom-3, putative                            654   0.0      Ricinus communis
gb|EYU33183.1|  hypothetical protein MIMGU_mgv1a004241mg                653   0.0      
ref|XP_010053552.1|  PREDICTED: decapping nuclease DXO homolog, c...    650   0.0      
gb|KDP28963.1|  hypothetical protein JCGZ_19657                         649   0.0      
ref|XP_008229482.1|  PREDICTED: decapping nuclease DXO homolog, c...    647   0.0      
ref|XP_007210571.1|  hypothetical protein PRUPE_ppa004173mg             646   0.0      
ref|XP_011018677.1|  PREDICTED: decapping nuclease DXO homolog, c...    648   0.0      
ref|XP_010664258.1|  PREDICTED: decapping nuclease DXO homolog, c...    644   0.0      
ref|XP_006385377.1|  glycine-rich family protein                        644   0.0      
gb|KCW77862.1|  hypothetical protein EUGRSUZ_D02138                     644   0.0      
ref|XP_004300311.1|  PREDICTED: protein Dom3z homolog, chloroplas...    643   0.0      
gb|KCW77863.1|  hypothetical protein EUGRSUZ_D02138                     640   0.0      
ref|XP_010269848.1|  PREDICTED: decapping nuclease DXO homolog, c...    639   0.0      
ref|XP_003517391.1|  PREDICTED: decapping nuclease DXO homolog, c...    630   0.0      
ref|XP_006477068.1|  PREDICTED: decapping nuclease DXO homolog, c...    631   0.0      
gb|KDO57021.1|  hypothetical protein CISIN_1g007250mg                   633   0.0      
ref|XP_006573706.1|  PREDICTED: decapping nuclease DXO homolog, c...    626   0.0      
ref|XP_010941024.1|  PREDICTED: decapping nuclease DXO homolog, c...    626   0.0      
ref|XP_006440154.1|  hypothetical protein CICLE_v10019303mg             630   0.0      
ref|XP_010677172.1|  PREDICTED: decapping nuclease DXO homolog, c...    626   0.0      
ref|XP_003539118.1|  PREDICTED: decapping nuclease DXO homolog, c...    624   0.0      
emb|CBI33989.3|  unnamed protein product                                619   0.0      
ref|XP_008465903.1|  PREDICTED: decapping nuclease DXO homolog, c...    624   0.0      
ref|XP_010677170.1|  PREDICTED: decapping nuclease DXO homolog, c...    624   0.0      
ref|XP_004148366.1|  PREDICTED: protein Dom3z homolog, chloroplas...    622   0.0      
ref|XP_008465900.1|  PREDICTED: decapping nuclease DXO homolog, c...    622   0.0      
ref|XP_008363758.1|  PREDICTED: decapping nuclease DXO homolog, c...    622   0.0      
ref|XP_006590587.1|  PREDICTED: decapping nuclease DXO homolog, c...    620   0.0      
ref|XP_009371846.1|  PREDICTED: decapping nuclease DXO homolog, c...    620   0.0      
ref|XP_007156600.1|  hypothetical protein PHAVU_002G002400g             619   0.0      
ref|XP_008345311.1|  PREDICTED: decapping nuclease DXO homolog, c...    620   0.0      
gb|AES94359.2|  Dom3z-like protein                                      618   0.0      
ref|XP_003611401.1|  Dom3z-like protein                                 617   0.0      
gb|KGN60454.1|  hypothetical protein Csa_3G912370                       619   0.0      
ref|XP_004511747.1|  PREDICTED: protein Dom3z homolog, chloroplas...    614   0.0      
ref|XP_010274528.1|  PREDICTED: LOW QUALITY PROTEIN: decapping nu...    607   0.0      
ref|XP_008803075.1|  PREDICTED: decapping nuclease DXO homolog, c...    607   0.0      
ref|XP_008803074.1|  PREDICTED: decapping nuclease DXO homolog, c...    606   0.0      
ref|XP_010518691.1|  PREDICTED: decapping nuclease DXO homolog, c...    590   0.0      
ref|XP_010518690.1|  PREDICTED: decapping nuclease DXO homolog, c...    583   0.0      
ref|XP_009419146.1|  PREDICTED: decapping nuclease DXO homolog, c...    580   0.0      
ref|XP_006440152.1|  hypothetical protein CICLE_v10019303mg             584   0.0      
gb|EEC79165.1|  hypothetical protein OsI_19840                          579   0.0      Oryza sativa Indica Group [Indian rice]
gb|KFK23542.1|  hypothetical protein AALP_AAs66918U000400               575   0.0      
ref|XP_003568532.1|  PREDICTED: decapping nuclease DXO homolog, c...    573   0.0      
ref|XP_008373723.1|  PREDICTED: decapping nuclease DXO homolog, c...    568   0.0      
ref|XP_006655284.1|  PREDICTED: LOW QUALITY PROTEIN: decapping nu...    581   0.0      
dbj|BAJ99622.1|  predicted protein                                      572   0.0      
ref|XP_002439744.1|  hypothetical protein SORBIDRAFT_09g019380          570   0.0      Sorghum bicolor [broomcorn]
ref|XP_008649608.1|  PREDICTED: decapping nuclease DXO homolog, c...    570   0.0      
ref|XP_010540805.1|  PREDICTED: decapping nuclease DXO homolog, c...    569   0.0      
ref|NP_193498.2|  glycine-rich protein                                  569   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004962184.1|  PREDICTED: decapping nuclease Dom3z homolog,...    566   0.0      
ref|XP_010449587.1|  PREDICTED: decapping nuclease DXO homolog, c...    566   0.0      
ref|XP_003611402.1|  Dom3z-like protein                                 557   0.0      
gb|KHN42649.1|  Protein Dom3z like, chloroplastic                       562   0.0      
ref|XP_006283484.1|  hypothetical protein CARUB_v10004533mg             564   0.0      
ref|XP_010439977.1|  PREDICTED: decapping nuclease DXO homolog, c...    563   0.0      
ref|XP_010110545.1|  hypothetical protein L484_023379                   565   0.0      
ref|NP_001031654.1|  glycine-rich protein                               562   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX78785.1|  BnaA01g08520D                                          561   0.0      
ref|XP_010434636.1|  PREDICTED: decapping nuclease DXO homolog, c...    562   0.0      
ref|XP_009136858.1|  PREDICTED: decapping nuclease DXO homolog, c...    560   0.0      
ref|XP_009130831.1|  PREDICTED: decapping nuclease DXO homolog, c...    559   0.0      
ref|XP_006414206.1|  hypothetical protein EUTSA_v10024864mg             558   0.0      
gb|EEE63613.1|  hypothetical protein OsJ_18430                          555   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EPS62858.1|  hypothetical protein M569_11930                         555   0.0      
ref|XP_006838483.1|  hypothetical protein AMTR_s00002p00157480          556   0.0      
ref|XP_008803076.1|  PREDICTED: decapping nuclease DXO homolog, c...    552   0.0      
emb|CDX90463.1|  BnaA03g43180D                                          553   0.0      
emb|CDY38413.1|  BnaC01g10220D                                          551   0.0      
emb|CDY09613.1|  BnaC07g34480D                                          550   0.0      
ref|NP_001190756.1|  glycine-rich protein                               546   0.0      
gb|AFW77892.1|  methylase                                               545   4e-178   
gb|ABD65180.1|  glycine-rich protein -related                           515   8e-172   Brassica oleracea
ref|XP_006440151.1|  hypothetical protein CICLE_v10019303mg             489   2e-161   
ref|XP_002870094.1|  hypothetical protein ARALYDRAFT_354992             511   4e-161   
ref|XP_007039647.1|  Glycine-rich protein isoform 2                     464   3e-153   
gb|EMT12303.1|  hypothetical protein F775_04838                         452   2e-145   
gb|AAV31261.1|  unknown protein                                         442   6e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008803077.1|  PREDICTED: decapping nuclease DXO homolog, c...    429   3e-140   
ref|XP_001761908.1|  predicted protein                                  413   4e-133   
ref|XP_002991233.1|  hypothetical protein SELMODRAFT_43096              389   6e-126   
ref|XP_002991173.1|  hypothetical protein SELMODRAFT_43146              388   2e-125   
emb|CBI33986.3|  unnamed protein product                                387   2e-123   
ref|XP_010664523.1|  PREDICTED: decapping nuclease DXO homolog, c...    384   2e-122   
gb|KHN34887.1|  Protein Dom3z like, chloroplastic                       346   1e-110   
ref|XP_008355558.1|  PREDICTED: decapping nuclease DXO homolog, c...    342   5e-106   
ref|XP_006573707.1|  PREDICTED: decapping nuclease DXO homolog, c...    308   1e-94    
emb|CAB10542.1|  hypothetical protein                                   320   2e-91    Arabidopsis thaliana [mouse-ear cress]
gb|AAS99237.1|  glycine-rich protein                                    189   4e-53    Haloxylon ammodendron
ref|XP_005826089.1|  hypothetical protein GUITHDRAFT_114770             194   3e-52    
emb|CEG77964.1|  hypothetical protein RMATCC62417_12635                 188   2e-49    
gb|ETI35960.1|  hypothetical protein F443_17796                         184   5e-48    
emb|CDS09462.1|  hypothetical protein LRAMOSA10822                      184   5e-48    
gb|ETK76198.1|  hypothetical protein L915_17326                         183   7e-48    
gb|ETM36093.1|  hypothetical protein L914_17122                         183   8e-48    
emb|CEG77965.1|  hypothetical protein RMATCC62417_12635                 184   1e-47    
ref|XP_008896302.1|  hypothetical protein PPTG_04193                    180   9e-47    
emb|CEG70864.1|  hypothetical protein RMATCC62417_06685                 176   4e-45    
gb|EPB91994.1|  hypothetical protein HMPREF1544_01056                   174   2e-44    
ref|XP_008876631.1|  hypothetical protein H310_11666                    173   2e-44    
gb|ETI35961.1|  hypothetical protein, variant                           172   3e-44    
gb|ETK76199.1|  hypothetical protein, variant                           172   5e-44    
ref|XP_009038219.1|  hypothetical protein AURANDRAFT_37889              171   1e-43    
ref|XP_009521402.1|  hypothetical protein PHYSODRAFT_412584             164   2e-41    
gb|EQB49348.1|  hypothetical protein CGLO_11335                         162   1e-40    
ref|XP_009838519.1|  hypothetical protein H257_12866                    162   2e-40    
emb|CBN75330.1|  conserved unknown protein                              164   2e-40    
ref|XP_007039650.1|  Glycine-rich-like protein                          161   3e-40    
gb|ESA08645.1|  hypothetical protein GLOINDRAFT_349026                  160   5e-40    
ref|XP_007284630.1|  hla class iii protein dom3z                        161   6e-40    
ref|XP_003050442.1|  predicted protein                                  158   5e-39    
gb|KHE87326.1|  RAI1-domain-containing protein                          159   5e-39    
sp|Q9HE87.4|DXO_NEUCR  RecName: Full=Decapping nuclease rai1            159   6e-39    Neurospora crassa
ref|XP_007383141.1|  RAI1-domain-containing protein                     159   1e-38    
gb|EFW99933.1|  dhp1-interacting protein                                156   2e-38    
gb|EXX59099.1|  Rai1p                                                   155   6e-38    
ref|XP_003382901.1|  PREDICTED: protein Dom3Z-like                      156   7e-38    
ref|NP_001174410.1|  Os05g0392100                                       147   9e-38    
ref|XP_002905188.1|  conserved hypothetical protein                     152   1e-37    
ref|XP_008079284.1|  Protein RAI1                                       154   1e-37    
ref|XP_007868728.1|  RAI1-domain-containing protein                     155   1e-37    
gb|EFQ27901.1|  hypothetical protein GLRG_03045                         154   2e-37    
ref|XP_006676458.1|  hypothetical protein BATDEDRAFT_85178              150   3e-37    
ref|XP_008618449.1|  hypothetical protein SDRG_14120                    152   3e-37    
gb|EUC57011.1|  RAI1-Rat1p interacting protein, required for pre-...    154   4e-37    
gb|EWG47941.1|  protein RAI1                                            152   9e-37    
emb|CEG77966.1|  hypothetical protein RMATCC62417_12635                 149   9e-37    
ref|XP_004338880.1|  DOM3 exoribonuclease, putative                     152   9e-37    
ref|XP_003662146.1|  hypothetical protein MYCTH_2143293                 152   1e-36    
ref|XP_009255547.1|  hypothetical protein FPSE_04154                    151   1e-36    
ref|XP_005706350.1|  glycine-rich protein                               150   1e-36    
gb|EQL02699.1|  Dhp1-interacting protein Din1                           150   2e-36    
gb|EAS37451.2|  rai1 protein                                            149   5e-36    
ref|XP_003060209.1|  predicted protein                                  154   5e-36    
emb|CEG01060.1|  RAI1-like                                              152   6e-36    
ref|XP_002173580.1|  Dhp1p-interacting protein Din1                     148   6e-36    Schizosaccharomyces japonicus yFS275
ref|XP_005712646.1|  unnamed protein product                            149   6e-36    
ref|XP_001396563.1|  protein rai1                                       149   6e-36    Aspergillus niger CBS 513.88
gb|EMT65096.1|  Protein RAI1                                            149   7e-36    
ref|XP_664118.1|  hypothetical protein AN6514.2                         149   7e-36    Aspergillus nidulans FGSC A4
gb|EXA50700.1|  protein RAI1                                            149   8e-36    
gb|EWY99359.1|  protein RAI1                                            149   9e-36    
gb|EWZ45434.1|  protein RAI1                                            149   1e-35    
dbj|GAD99307.1|  protein rai1                                           148   2e-35    
emb|CCT66699.1|  related to C.elegans dom-3 protein                     148   2e-35    
ref|XP_007723543.1|  hypothetical protein A1O1_04461                    148   2e-35    
ref|XP_006820314.1|  PREDICTED: decapping and exoribonuclease pro...    148   2e-35    
gb|EQL32293.1|  protein rai1                                            148   2e-35    
gb|EXM35919.1|  protein RAI1                                            148   2e-35    
ref|XP_001270042.1|  HLA class III protein Dom3z                        147   2e-35    Aspergillus clavatus NRRL 1
ref|XP_003075116.1|  Nuclear 5'-3' exoribonuclease-interacting pr...    150   3e-35    
ref|XP_007806144.1|  hypothetical protein EPUS_05246                    149   3e-35    
gb|KDR76133.1|  hypothetical protein GALMADRAFT_462464                  149   3e-35    
ref|XP_009544713.1|  hypothetical protein HETIRDRAFT_68507              149   4e-35    
ref|XP_747571.1|  Dhp1-interacting protein Din1                         147   5e-35    Aspergillus fumigatus Af293
gb|EEH16876.2|  hypothetical protein PABG_06963                         146   5e-35    Paracoccidioides brasiliensis Pb03
gb|KDQ14966.1|  hypothetical protein BOTBODRAFT_131994                  147   6e-35    
ref|XP_008598193.1|  RAI1-like protein                                  146   1e-34    
ref|XP_003190244.1|  protein rai1                                       145   1e-34    
gb|KGQ04299.1|  Protein RAI1                                            145   2e-34    
ref|XP_003008466.1|  RAI1                                               145   2e-34    
ref|XP_009658456.1|  RAI1 protein                                       145   2e-34    
ref|XP_007294987.1|  Protein RAI1                                       145   2e-34    
ref|XP_010761641.1|  hypothetical protein PADG_06192                    145   2e-34    
emb|CCA72856.1|  related to RAI1-Rat1p Interacting Protein, requi...    145   2e-34    
gb|EHA24413.1|  hypothetical protein ASPNIDRAFT_209964                  144   2e-34    
ref|XP_007730025.1|  hypothetical protein A1O3_01692                    145   2e-34    
gb|EYB27590.1|  hypothetical protein FG05_13131                         145   2e-34    
ref|XP_010772061.1|  PREDICTED: decapping and exoribonuclease pro...    145   3e-34    
ref|XP_009838520.1|  hypothetical protein, variant 1                    142   5e-34    
ref|XP_003071171.1|  hypothetical protein CPC735_037320                 144   6e-34    
ref|XP_002607257.1|  hypothetical protein BRAFLDRAFT_88205              144   8e-34    Branchiostoma floridae
emb|CCF39257.1|  RAI1                                                   143   8e-34    
gb|KDO32131.1|  hypothetical protein SPRG_03348                         142   8e-34    
gb|KDE09864.1|  hypothetical protein MVLG_00262                         145   9e-34    
ref|XP_006738496.1|  PREDICTED: decapping and exoribonuclease pro...    144   9e-34    
gb|KFA76337.1|  hypothetical protein S40288_02978                       143   1e-33    
gb|KEY69881.1|  hypothetical protein S7711_06437                        143   1e-33    
gb|EGU79322.1|  hypothetical protein FOXB_10151                         143   1e-33    
ref|XP_007602653.1|  hypothetical protein CFIO01_02455                  142   1e-33    
gb|KFA68221.1|  hypothetical protein S40285_01551                       143   1e-33    
ref|XP_006738495.1|  PREDICTED: decapping and exoribonuclease pro...    144   1e-33    
ref|XP_009838523.1|  hypothetical protein, variant 2                    140   2e-33    
ref|XP_003964681.1|  PREDICTED: protein Dom3Z-like                      143   2e-33    
gb|EWG47943.1|  protein RAI1                                            141   2e-33    
ref|XP_008728022.1|  hypothetical protein G647_05469                    142   2e-33    
gb|EGE82944.1|  HLA class III protein Dom3z                             142   3e-33    
ref|XP_002504149.1|  predicted protein                                  146   3e-33    Micromonas commoda
ref|XP_004415323.1|  PREDICTED: protein Dom3Z                           142   4e-33    
dbj|GAM40798.1|  hypothetical protein TCE0_041r13421                    141   4e-33    
ref|XP_001621771.1|  hypothetical protein NEMVEDRAFT_v1g143699          140   5e-33    Nematostella vectensis
ref|XP_008383039.1|  PREDICTED: decapping nuclease DXO homolog, c...    134   5e-33    
gb|KFX94110.1|  hypothetical protein V490_04517                         141   5e-33    
gb|EPE04225.1|  protein rai1                                            141   5e-33    
ref|XP_009847658.1|  hypothetical protein NEUTE1DRAFT_119557            140   6e-33    
ref|XP_001416237.1|  predicted protein                                  143   6e-33    Ostreococcus lucimarinus CCE9901
gb|EGZ75663.1|  RAI1-domain-containing protein                          140   6e-33    
ref|XP_008710087.1|  PREDICTED: decapping and exoribonuclease pro...    141   8e-33    
sp|Q4I613.3|DXO_GIBZE  RecName: Full=Decapping nuclease RAI1            140   8e-33    Fusarium graminearum
gb|EFB21207.1|  hypothetical protein PANDA_019916                       140   9e-33    Ailuropoda melanoleuca
ref|XP_002929678.1|  PREDICTED: protein Dom3Z-like                      140   9e-33    
emb|CDO74212.1|  hypothetical protein BN946_scf185043.g264              142   9e-33    
ref|XP_005339021.1|  PREDICTED: decapping and exoribonuclease pro...    140   1e-32    
ref|XP_007557390.1|  PREDICTED: decapping and exoribonuclease pro...    141   1e-32    
ref|XP_006696508.1|  hypothetical protein CTHT_0061920                  140   1e-32    
gb|KDQ53161.1|  hypothetical protein JAAARDRAFT_137557                  141   1e-32    
gb|KID99328.1|  Protein RAI1                                            140   1e-32    
ref|XP_009160703.1|  hypothetical protein HMPREF1120_08210              140   2e-32    
ref|XP_007949520.1|  PREDICTED: decapping and exoribonuclease pro...    140   2e-32    
ref|XP_010728964.1|  PREDICTED: decapping and exoribonuclease pro...    140   2e-32    
ref|XP_387521.1|  hypothetical protein FG07345.1                        140   2e-32    Fusarium graminearum PH-1
ref|XP_004424385.1|  PREDICTED: protein Dom3Z                           140   2e-32    
ref|XP_006005733.1|  PREDICTED: decapping and exoribonuclease pro...    140   2e-32    
ref|XP_008573238.1|  PREDICTED: decapping and exoribonuclease pro...    139   2e-32    
ref|XP_005965411.1|  PREDICTED: LOW QUALITY PROTEIN: decapping an...    139   3e-32    
ref|XP_007300226.1|  RAI1-domain-containing protein                     139   3e-32    
ref|XP_008383038.1|  PREDICTED: decapping nuclease DXO homolog, c...    132   3e-32    
emb|CDM37618.1|  Protein rai1                                           139   3e-32    
ref|XP_006668966.1|  Dhp1-interacting protein Din1                      139   3e-32    
ref|XP_003719891.1|  rai-1                                              139   3e-32    
ref|XP_007845329.1|  protein rai1                                       139   4e-32    
gb|KDN65734.1|  hypothetical protein CSUB01_09173                       140   4e-32    
ref|XP_001248853.1|  hypothetical protein CIMG_02624                    138   4e-32    Coccidioides immitis RS
ref|XP_005808926.1|  PREDICTED: decapping and exoribonuclease pro...    139   4e-32    
gb|ENH88240.1|  protein rai1                                            138   4e-32    
gb|KGO63743.1|  hypothetical protein PITC_071950                        138   5e-32    
ref|XP_009064515.1|  hypothetical protein LOTGIDRAFT_54612              137   5e-32    
ref|XP_004071492.1|  PREDICTED: protein Dom3Z-like                      139   5e-32    
gb|ESZ97787.1|  hypothetical protein SBOR_1796                          139   5e-32    
ref|XP_003986005.1|  PREDICTED: decapping and exoribonuclease pro...    139   5e-32    
ref|XP_008035940.1|  RAI1-domain-containing protein                     139   5e-32    
gb|KFY52962.1|  hypothetical protein V496_08020                         138   6e-32    
ref|XP_004452439.1|  PREDICTED: protein Dom3Z                           138   7e-32    
gb|EMD33871.1|  hypothetical protein CERSUDRAFT_97807                   139   7e-32    
ref|XP_007098807.1|  PREDICTED: decapping and exoribonuclease pro...    138   7e-32    
ref|XP_004390831.1|  PREDICTED: protein Dom3Z                           138   8e-32    
ref|XP_007527510.1|  PREDICTED: decapping and exoribonuclease pro...    138   9e-32    
ref|XP_006896224.1|  PREDICTED: decapping and exoribonuclease pro...    138   9e-32    
emb|CEF83313.1|  unnamed protein product                                137   1e-31    
ref|XP_004695211.1|  PREDICTED: protein Dom3Z                           137   1e-31    
ref|XP_005696616.1|  PREDICTED: LOW QUALITY PROTEIN: decapping an...    137   1e-31    
ref|XP_007459591.1|  PREDICTED: decapping and exoribonuclease pro...    137   1e-31    
ref|XP_006154365.1|  PREDICTED: decapping and exoribonuclease pro...    137   1e-31    
ref|XP_003032011.1|  hypothetical protein SCHCODRAFT_257047             140   1e-31    
ref|XP_006875634.1|  PREDICTED: decapping and exoribonuclease pro...    137   1e-31    
ref|XP_008383036.1|  PREDICTED: decapping and exoribonuclease pro...    131   1e-31    
ref|XP_003473998.1|  PREDICTED: decapping and exoribonuclease pro...    137   1e-31    
ref|XP_007193981.1|  PREDICTED: decapping and exoribonuclease pro...    137   2e-31    
gb|ELW61884.1|  Protein Dom3Z                                           137   2e-31    
ref|XP_010330545.1|  PREDICTED: decapping and exoribonuclease pro...    137   2e-31    
ref|XP_003789096.1|  PREDICTED: protein Dom3Z                           137   2e-31    
ref|XP_002816724.1|  PREDICTED: decapping and exoribonuclease pro...    137   2e-31    
emb|CCD47993.1|  similar to protein rai1                                137   2e-31    
ref|NP_001279932.1|  decapping exoribonuclease                          137   2e-31    
ref|XP_004314428.1|  PREDICTED: protein Dom3Z isoform 1                 137   2e-31    
ref|XP_007781298.1|  hypothetical protein W97_05223                     136   2e-31    
ref|XP_007110151.1|  PREDICTED: decapping and exoribonuclease pro...    137   2e-31    
ref|XP_004286609.1|  PREDICTED: protein Dom3Z isoform 1                 136   2e-31    
ref|XP_008536823.1|  PREDICTED: decapping and exoribonuclease pro...    136   3e-31    
ref|XP_006215418.1|  PREDICTED: decapping and exoribonuclease pro...    136   3e-31    
ref|XP_007319071.1|  hypothetical protein SERLADRAFT_415895             137   3e-31    
ref|XP_005603811.1|  PREDICTED: decapping and exoribonuclease pro...    136   3e-31    
ref|XP_004846977.1|  PREDICTED: decapping and exoribonuclease pro...    136   3e-31    
ref|XP_007824061.1|  Protein RAI1                                       136   3e-31    
ref|XP_002557316.1|  Pc12g04470                                         136   3e-31    Penicillium rubens Wisconsin 54-1255
ref|XP_008414975.1|  PREDICTED: decapping and exoribonuclease pro...    137   3e-31    
ref|XP_003768988.1|  PREDICTED: protein Dom3Z                           136   3e-31    
ref|XP_006995632.1|  PREDICTED: decapping and exoribonuclease pro...    136   4e-31    
gb|KFG80953.1|  Protein RAI1                                            135   4e-31    
ref|XP_004598742.1|  PREDICTED: protein Dom3Z                           136   4e-31    
ref|XP_010608198.1|  PREDICTED: decapping and exoribonuclease pro...    136   4e-31    
ref|XP_006178858.1|  PREDICTED: decapping and exoribonuclease pro...    136   4e-31    
ref|XP_006725751.1|  PREDICTED: decapping and exoribonuclease pro...    136   4e-31    
emb|CAC18206.1|  conserved hypothetical protein                         135   5e-31    
ref|XP_004043765.1|  PREDICTED: protein Dom3Z                           135   5e-31    
gb|AAC78603.1|  HLA class III protein Dom3z                             135   5e-31    
ref|NP_005501.2|  decapping and exoribonuclease protein                 135   5e-31    
ref|XP_011128099.1|  hypothetical protein AOL_s00215g595                135   5e-31    
ref|XP_004846978.1|  PREDICTED: decapping and exoribonuclease pro...    135   5e-31    
ref|XP_004621358.1|  PREDICTED: protein Dom3Z                           135   5e-31    
ref|XP_002714339.1|  PREDICTED: decapping and exoribonuclease pro...    135   5e-31    
ref|XP_009449217.1|  PREDICTED: decapping and exoribonuclease pro...    135   5e-31    
ref|XP_002488169.1|  Dhp1-interacting protein Din1, putative            135   5e-31    
ref|XP_008955120.1|  PREDICTED: decapping and exoribonuclease pro...    135   5e-31    
ref|XP_005389463.1|  PREDICTED: decapping and exoribonuclease pro...    135   5e-31    
gb|KHG14052.1|  hypothetical protein F383_19650                         127   6e-31    
ref|XP_008328046.1|  PREDICTED: decapping and exoribonuclease pro...    136   6e-31    
ref|XP_004780972.1|  PREDICTED: protein Dom3Z isoform X1                135   6e-31    
gb|EPT04443.1|  hypothetical protein FOMPIDRAFT_1113211                 136   6e-31    
ref|XP_001376419.1|  PREDICTED: decapping and exoribonuclease pro...    135   6e-31    
ref|NP_001014872.2|  decapping and exoribonuclease protein              135   6e-31    
ref|XP_006536561.1|  PREDICTED: decapping and exoribonuclease pro...    135   6e-31    
ref|NP_291091.2|  decapping and exoribonuclease protein                 135   7e-31    
ref|XP_001799452.1|  hypothetical protein SNOG_09150                    135   7e-31    
ref|XP_004905525.1|  PREDICTED: decapping and exoribonuclease pro...    135   8e-31    
ref|XP_003272181.1|  PREDICTED: protein Dom3Z                           135   8e-31    
gb|EKV12065.1|  Protein rai1                                            135   8e-31    
ref|XP_007874938.1|  hypothetical protein PNEG_02900                    133   8e-31    
ref|XP_003422280.1|  PREDICTED: decapping and exoribonuclease pro...    135   8e-31    
gb|EHH18190.1|  hypothetical protein EGK_14741                          135   9e-31    
ref|XP_006637401.1|  PREDICTED: decapping and exoribonuclease pro...    135   9e-31    
ref|XP_006960029.1|  RAI1-domain-containing protein                     134   9e-31    
ref|NP_001253911.1|  protein Dom3Z                                      135   9e-31    
ref|XP_011106312.1|  hypothetical protein H072_320                      135   1e-30    
pdb|3FQI|A  Chain A, Crystal Structure Of The Mouse Dom3z               135   1e-30    
ref|XP_003897437.1|  PREDICTED: decapping and exoribonuclease pro...    135   1e-30    
gb|KIH90893.1|  RAT1-interacting protein                                135   1e-30    
ref|XP_001257715.1|  HLA class III protein Dom3z                        134   1e-30    
ref|XP_007263268.1|  RAI1-domain-containing protein                     134   1e-30    
ref|XP_005893842.1|  PREDICTED: LOW QUALITY PROTEIN: decapping an...    134   1e-30    
pdb|4J7L|A  Chain A, Crystal Structure Of Mouse Dxo In Complex Wi...    134   1e-30    
ref|XP_008301658.1|  PREDICTED: decapping and exoribonuclease pro...    135   1e-30    
gb|EHB16085.1|  Protein Dom3Z                                           134   1e-30    
ref|XP_010381619.1|  PREDICTED: decapping and exoribonuclease pro...    134   1e-30    
ref|XP_004905527.1|  PREDICTED: decapping and exoribonuclease pro...    134   1e-30    
gb|ELR10429.1|  hypothetical protein GMDG_00841                         134   1e-30    
ref|XP_004624340.1|  PREDICTED: protein Dom3Z                           134   2e-30    
emb|CCM01915.1|  predicted protein                                      135   2e-30    
ref|XP_005370851.1|  PREDICTED: decapping and exoribonuclease pro...    134   2e-30    
ref|XP_007971239.1|  PREDICTED: decapping and exoribonuclease pro...    134   2e-30    
ref|XP_005734723.1|  PREDICTED: LOW QUALITY PROTEIN: decapping an...    134   2e-30    
ref|XP_783738.3|  PREDICTED: protein Dom3Z-like                         134   2e-30    
ref|NP_997662.1|  decapping and exoribonuclease protein                 134   2e-30    
ref|XP_007697345.1|  hypothetical protein COCSADRAFT_111901             134   2e-30    
ref|XP_010803209.1|  PREDICTED: decapping and exoribonuclease pro...    134   2e-30    
ref|XP_010895700.1|  PREDICTED: decapping and exoribonuclease pro...    134   2e-30    
ref|XP_006107848.1|  PREDICTED: LOW QUALITY PROTEIN: decapping an...    134   3e-30    
ref|XP_005859977.1|  PREDICTED: LOW QUALITY PROTEIN: decapping ex...    133   3e-30    
gb|EPS26100.1|  hypothetical protein PDE_01036                          133   3e-30    
gb|EWC45081.1|  hypothetical protein DRE_06220                          133   3e-30    
ref|XP_005553494.1|  PREDICTED: decapping and exoribonuclease pro...    133   3e-30    
ref|XP_004018975.1|  PREDICTED: protein Dom3Z                           134   3e-30    
gb|KID72892.1|  Protein RAI1                                            133   4e-30    
emb|CEJ80939.1|  Putative RAI1-like protein                             132   4e-30    
gb|EDL26764.1|  DOM-3 homolog Z (C. elegans), isoform CRA_c             132   4e-30    
ref|XP_007755142.1|  hypothetical protein A1O7_02926                    133   4e-30    
gb|EDL83433.1|  DOM-3 homolog Z (C. elegans), isoform CRA_a             132   5e-30    
ref|XP_007615497.1|  PREDICTED: decapping and exoribonuclease pro...    133   5e-30    
ref|NP_001095296.1|  protein Dom3Z                                      132   5e-30    
ref|XP_007693753.1|  hypothetical protein COCMIDRAFT_10236              133   6e-30    
ref|XP_006961897.1|  predicted protein                                  132   6e-30    
dbj|GAM20311.1|  hypothetical protein SAMD00019534_034860               132   6e-30    
ref|XP_002746416.2|  PREDICTED: decapping and exoribonuclease pro...    133   6e-30    
ref|XP_008710088.1|  PREDICTED: decapping and exoribonuclease pro...    132   6e-30    
ref|XP_007716603.1|  hypothetical protein COCCADRAFT_8646               133   7e-30    
gb|AAX08842.1|  DOM-3 homolog Z                                         132   7e-30    
ref|XP_010831649.1|  PREDICTED: decapping and exoribonuclease pro...    132   7e-30    
gb|ETR99979.1|  RAI1-domain-containing protein                          132   7e-30    
gb|KDR13807.1|  Protein Dom3Z                                           131   1e-29    
gb|KFY96971.1|  hypothetical protein V498_02340                         131   1e-29    
gb|EKC20487.1|  Protein Dom3Z                                           131   1e-29    
ref|XP_010959769.1|  PREDICTED: decapping and exoribonuclease pro...    130   1e-29    
ref|XP_007771394.1|  RAI1-domain-containing protein                     133   1e-29    
ref|XP_007647298.1|  PREDICTED: decapping and exoribonuclease pro...    130   1e-29    
ref|XP_004711863.1|  PREDICTED: protein Dom3Z                           131   1e-29    
ref|XP_005461119.1|  PREDICTED: LOW QUALITY PROTEIN: decapping an...    132   1e-29    
ref|NP_001016388.1|  decapping exoribonuclease                          131   1e-29    
gb|EHK27248.1|  hypothetical protein TRIVIDRAFT_34510                   130   1e-29    
ref|XP_006904688.1|  PREDICTED: decapping and exoribonuclease pro...    131   1e-29    
gb|ERS95729.1|  hypothetical protein HMPREF1624_07804                   132   2e-29    
gb|EUN24338.1|  hypothetical protein COCVIDRAFT_40149                   131   2e-29    
ref|XP_003299622.1|  hypothetical protein PTT_10661                     132   2e-29    
ref|XP_007402691.1|  hypothetical protein PHACADRAFT_69227              130   2e-29    
ref|XP_005279672.1|  PREDICTED: decapping and exoribonuclease pro...    131   2e-29    
gb|EPQ03719.1|  Protein Dom3Z                                           129   2e-29    
gb|KDN41152.1|  RAI1-domain-containing protein                          131   3e-29    
ref|XP_006080888.1|  PREDICTED: LOW QUALITY PROTEIN: decapping ex...    129   3e-29    
ref|XP_006523549.1|  PREDICTED: decapping and exoribonuclease pro...    129   3e-29    
ref|XP_006791528.1|  PREDICTED: decapping and exoribonuclease pro...    130   3e-29    
gb|ELU05819.1|  hypothetical protein CAPTEDRAFT_186717                  130   3e-29    
ref|XP_002620223.1|  protein rai1                                       130   3e-29    
ref|XP_002153269.1|  Dhp1-interacting protein Din1, putative            129   3e-29    
ref|XP_009203118.1|  PREDICTED: decapping and exoribonuclease pro...    130   4e-29    
ref|XP_008819715.1|  PREDICTED: decapping and exoribonuclease pro...    129   4e-29    
ref|XP_008819713.1|  PREDICTED: decapping and exoribonuclease pro...    130   4e-29    
ref|XP_004558366.1|  PREDICTED: LOW QUALITY PROTEIN: protein Dom3...    130   4e-29    
ref|XP_002378236.1|  Dhp1-interacting protein Din1, putative            130   4e-29    
gb|EYE97265.1|  RAI1-domain-containing protein                          130   4e-29    
gb|EMR90125.1|  putative protein rai1 protein                           130   4e-29    
ref|XP_008155551.1|  PREDICTED: decapping and exoribonuclease pro...    130   5e-29    
ref|XP_005925445.1|  PREDICTED: LOW QUALITY PROTEIN: decapping an...    130   5e-29    
ref|XP_005086897.1|  PREDICTED: decapping and exoribonuclease pro...    130   5e-29    
ref|XP_007193983.1|  PREDICTED: decapping and exoribonuclease pro...    129   5e-29    
ref|XP_002403061.1|  protein Dom3Z, putative                            129   6e-29    
ref|XP_005627804.1|  PREDICTED: decapping and exoribonuclease pro...    129   6e-29    
gb|EMD92025.1|  hypothetical protein COCHEDRAFT_1173524                 129   7e-29    
emb|CAG11422.1|  unnamed protein product                                134   7e-29    
ref|XP_007364476.1|  RAI1-domain-containing protein                     129   7e-29    
gb|KEF61115.1|  hypothetical protein A1O9_02680                         128   7e-29    
ref|XP_004672043.1|  PREDICTED: protein Dom3Z                           129   9e-29    
gb|EER40573.1|  HLA class III protein Dom3z                             128   9e-29    
gb|KFH47562.1|  Decapping nuclease-like protein                         129   9e-29    
ref|XP_006725752.1|  PREDICTED: decapping and exoribonuclease pro...    128   9e-29    
ref|XP_009239982.1|  PREDICTED: decapping and exoribonuclease pro...    129   9e-29    
ref|XP_003218044.1|  PREDICTED: decapping and exoribonuclease pro...    129   1e-28    
ref|XP_006715069.1|  PREDICTED: decapping and exoribonuclease pro...    128   1e-28    
ref|XP_002845375.1|  conserved hypothetical protein                     128   1e-28    
gb|KEQ92281.1|  hypothetical protein AUEXF2481DRAFT_43062               129   1e-28    
ref|XP_008717340.1|  hypothetical protein HMPREF1541_04774              129   1e-28    
gb|KGO37558.1|  hypothetical protein PEXP_076380                        128   1e-28    
pdb|3FQG|A  Chain A, Crystal Structure Of The S. Pombe Rai1             128   1e-28    
ref|XP_001931394.1|  hypothetical protein PTRG_01061                    129   1e-28    
gb|EHK41646.1|  hypothetical protein TRIATDRAFT_77806                   128   1e-28    
ref|XP_003171736.1|  hypothetical protein MGYG_06284                    127   1e-28    
ref|NP_594904.1|  Dhp1p-interacting protein Din1                        127   2e-28    
gb|EFA77974.1|  hypothetical protein PPL_08619                          132   2e-28    
ref|XP_008066959.1|  PREDICTED: decapping and exoribonuclease pro...    128   2e-28    
gb|EMS19260.1|  RAI1-like domain containing protein                     129   3e-28    
gb|EZF24903.1|  hypothetical protein H100_02668                         127   3e-28    
emb|CBY19105.1|  unnamed protein product                                128   3e-28    
emb|CCH44341.1|  hypothetical protein BN7_3904                          127   3e-28    
ref|XP_009224070.1|  rai-1                                              127   4e-28    
gb|KEQ75938.1|  HLA class III protein Dom3z                             127   4e-28    
ref|NP_001088937.1|  decapping and exoribonuclease protein              127   4e-28    
ref|XP_007797353.1|  putative protein rai1 protein                      126   4e-28    
ref|XP_961151.2|  hypothetical protein NCU04191                         125   5e-28    
gb|KEQ84741.1|  rai1 protein                                            126   6e-28    
gb|EGD96481.1|  hypothetical protein TESG_03923                         126   6e-28    
ref|XP_003233428.1|  hypothetical protein TERG_06417                    125   8e-28    
gb|EFW22573.1|  rai1                                                    125   8e-28    
ref|XP_007437890.1|  PREDICTED: decapping and exoribonuclease pro...    126   1e-27    
gb|EZF97361.1|  hypothetical protein H113_02675                         125   1e-27    
gb|KEQ64846.1|  protein rai1                                            125   1e-27    
ref|XP_001214847.1|  conserved hypothetical protein                     124   2e-27    
emb|CEI89707.1|  hypothetical protein RMCBS344292_04056                 122   2e-27    
ref|XP_001700121.1|  predicted protein                                  125   2e-27    
gb|KFX41970.1|  Decapping nuclease rai1                                 124   2e-27    
ref|XP_007743755.1|  hypothetical protein A1O5_04961                    125   2e-27    
ref|XP_010803205.1|  PREDICTED: decapping and exoribonuclease pro...    125   2e-27    
gb|EZF75841.1|  hypothetical protein H105_02677                         124   2e-27    
gb|EGC48313.1|  HLA class III protein Dom3z                             124   2e-27    
emb|CCX33337.1|  Similar to Protein rai1; acc. no. Q5AYW6               124   3e-27    
emb|CCU76689.1|  Dhp1-interacting protein Din1                          124   4e-27    
gb|EMF12300.1|  protein rai1                                            124   4e-27    
gb|EJU05097.1|  RAI1-domain-containing protein                          124   5e-27    
ref|XP_001911906.1|  hypothetical protein                               124   5e-27    
dbj|GAA92241.1|  Dhp1-interacting protein Din1                          123   6e-27    
gb|AAX31351.1|  DOM-3 homolog Z                                         124   6e-27    
gb|ELQ61064.1|  hypothetical protein OOW_P131scaffold01204g13           123   8e-27    
emb|CEJ03717.1|  hypothetical protein RMCBS344292_17696                 120   8e-27    
ref|XP_007834525.1|  Protein rai-1                                      123   9e-27    
gb|KFX41969.1|  Decapping nuclease rai1                                 122   1e-26    
emb|CCE27676.1|  uncharacterized protein CPUR_01150                     123   1e-26    
ref|XP_003649737.1|  hypothetical protein THITE_58765                   122   1e-26    
ref|XP_001224827.1|  hypothetical protein CHGG_07171                    122   1e-26    
pdb|3FQD|B  Chain B, Crystal Structure Of The S. Pombe Rat1-Rai1 ...    122   2e-26    
ref|XP_001551888.1|  hypothetical protein BC1G_09223                    122   2e-26    
gb|KFH72306.1|  hypothetical protein MVEG_02597                         122   3e-26    
dbj|GAA95660.1|  hypothetical protein E5Q_02316                         122   4e-26    
gb|EME43465.1|  hypothetical protein DOTSEDRAFT_174304                  121   4e-26    
gb|EGE05704.1|  hypothetical protein TEQG_04712                         120   5e-26    
gb|KHO01533.1|  Protein RAI1                                            120   9e-26    
ref|XP_005108505.1|  PREDICTED: decapping and exoribonuclease pro...    119   2e-25    
ref|XP_004355707.1|  hypothetical protein DFA_08213                     119   2e-25    
ref|XP_007927036.1|  hypothetical protein MYCFIDRAFT_49657              118   4e-25    
ref|XP_003737799.1|  PREDICTED: protein Dom3Z-like                      117   5e-25    
emb|CCC10760.1|  unnamed protein product                                114   6e-25    
emb|CDP97218.1|  Protein Bm4341, isoform b                              117   6e-25    
gb|KFX41971.1|  Decapping nuclease rai1                                 117   8e-25    
ref|XP_008383037.1|  PREDICTED: uncharacterized protein LOC103445...    111   1e-24    
ref|XP_002543617.1|  conserved hypothetical protein                     116   2e-24    
ref|XP_002837256.1|  hypothetical protein                               115   2e-24    
ref|XP_002126837.1|  PREDICTED: decapping and exoribonuclease pro...    115   2e-24    
gb|EEH02596.1|  HLA class III protein Dom3z                             114   3e-24    
gb|ADD37972.1|  Dom3Z                                                   115   3e-24    
gb|ADD24238.1|  Dom3Z                                                   114   4e-24    
emb|CDR38532.1|  CYFA0S02e02740g1_1                                     115   4e-24    
gb|EPX73308.1|  Dhp1p-interacting protein Din1                          114   8e-24    
gb|EWG47944.1|  protein RAI1                                            112   9e-24    
ref|XP_003194839.1|  enzyme regulator                                   114   1e-23    
gb|EIE86727.1|  hypothetical protein RO3G_11438                         110   1e-23    
emb|CCU97772.1|  unnamed protein product                                114   2e-23    
ref|XP_003672137.1|  hypothetical protein NDAI_0I03260                  112   2e-23    
gb|ETS59458.1|  hypothetical protein PaG_06376                          114   2e-23    
ref|XP_565004.3|  AGAP007205-PA                                         112   3e-23    
ref|XP_002159022.1|  PREDICTED: protein Dom3Z-like                      108   5e-23    
dbj|GAC71987.1|  nuclear 5'-3' exoribonuclease-interacting protein      113   5e-23    
emb|CCF52190.1|  related to RAI1-Rat1p Interacting Protein, requi...    113   5e-23    
gb|EPY50201.1|  Dhp1p-interacting protein Din1                          111   6e-23    
gb|KDN48615.1|  hypothetical protein RSAG8_02602                        112   7e-23    
ref|XP_009266040.1|  Protein RAI1                                       110   8e-23    
ref|XP_008066957.1|  PREDICTED: decapping and exoribonuclease pro...    111   1e-22    
gb|EFX83717.1|  hypothetical protein DAPPUDRAFT_47834                   110   1e-22    
gb|KFM80607.1|  Protein Dom3Z                                           110   1e-22    
ref|XP_003719890.1|  rai-1, variant                                     109   1e-22    
ref|XP_007513649.1|  predicted protein                                  113   1e-22    
gb|ESX01340.1|  Protein RAI1                                            110   1e-22    
ref|XP_003849928.1|  hypothetical protein MYCGRDRAFT_100890             109   1e-22    
ref|XP_003017419.1|  hypothetical protein ARB_04300                     110   2e-22    
ref|XP_001659979.1|  hypothetical protein AaeL_AAEL009348               109   2e-22    
ref|XP_571489.1|  enzyme regulator                                      109   2e-22    



>ref|XP_009791276.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic [Nicotiana 
sylvestris]
Length=531

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/447 (83%), Positives = 400/447 (89%), Gaps = 4/447 (1%)
 Frame = -2

Query  1735  EEDDNGEVRSSLNSNINSHSKYGNEdddsdkdlfgsDNEEYVKTPATSTYPVPVLPPVRN  1556
             E+DDNGEV S  N++ +S   +  EDDD DKDLFGSDNE+YVKT + S +PVPVLPP+RN
Sbjct  86    EDDDNGEVISHNNNHNSSSGYFQEEDDDDDKDLFGSDNEDYVKTLSKSPFPVPVLPPIRN  145

Query  1555  TNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGYGRG--NAPRDERFVSELKFAKSE  1385
             TN+ TRGGFGRGRWQN RG GILP P  YPPRQNYGYG    N  RDERFVSELKFAKSE
Sbjct  146   TNHHTRGGFGRGRWQNDRGAGILPRPGPYPPRQNYGYGPKFFNGHRDERFVSELKFAKSE  205

Query  1384  ETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKR  1205
             ETLARK  A QEPCELAC+SRV+ G+VYFDDRSLRLFKRLITED+G+DLNEGFDTF EK+
Sbjct  206   ETLARKCIAFQEPCELACFSRVEGGEVYFDDRSLRLFKRLITEDVGADLNEGFDTFVEKK  265

Query  1204  DLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYL  1025
             DLGSQGFGDLLA IRNKNIPLDRMHFVTYRNNLNKIMATAY+R+EPWEMGVHKRKGVVYL
Sbjct  266   DLGSQGFGDLLASIRNKNIPLDRMHFVTYRNNLNKIMATAYLRHEPWEMGVHKRKGVVYL  325

Query  1024  DVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAH  845
             DVHKLPERPKSELDRRRCYWGYCFESLATEDP RSDG+ IH +DANVEYCAV+KTK+GAH
Sbjct  326   DVHKLPERPKSELDRRRCYWGYCFESLATEDPTRSDGEGIHHVDANVEYCAVVKTKLGAH  385

Query  844   RILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIV  665
             RILMGAEMDCCDS DDGRRFYVELKTSRE LD+ TEE +EREKLLKFWIQSFLAGVPYIV
Sbjct  386   RILMGAEMDCCDSTDDGRRFYVELKTSRE-LDYHTEERYEREKLLKFWIQSFLAGVPYIV  444

Query  664   VGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQ  485
             VGFRDD GRLVRTERLRT +IT RVKMK+YWQGGVCLAFADEVLCWLYGTVKENEDY+LQ
Sbjct  445   VGFRDDAGRLVRTERLRTKDITHRVKMKNYWQGGVCLAFADEVLCWLYGTVKENEDYVLQ  504

Query  484   FTPHSNRLELLRGPSCPDAITHHVQQL  404
             F P S RLELL+  SCPDAIT HVQQL
Sbjct  505   FAPPSARLELLQAQSCPDAITDHVQQL  531



>ref|XP_006358629.1| PREDICTED: decapping nuclease Dom3z homolog, chloroplastic-like 
[Solanum tuberosum]
Length=552

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/412 (84%), Positives = 375/412 (91%), Gaps = 4/412 (1%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGY  1448
             NE+Y KT + S +PVPVLPP+RN+N+ TRGGFGRGRWQN RG GILP P  YPPRQNYGY
Sbjct  138   NEDYAKTLSKSRFPVPVLPPIRNSNHQTRGGFGRGRWQNDRGAGILPRPGPYPPRQNYGY  197

Query  1447  GRG--NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLF  1274
             G    N  RDERFVSELKFAKSEETLARK  A QEPCELAC+SRV+ GDVYFDDRSLRLF
Sbjct  198   GSKFFNGHRDERFVSELKFAKSEETLARKCIAFQEPCELACFSRVEGGDVYFDDRSLRLF  257

Query  1273  KRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIM  1094
             KRLITED+G+DLN+GFDTFTEK+DLGSQGFGDLLA IRNKNIPLDRMHFVTYRNNLNKIM
Sbjct  258   KRLITEDVGADLNQGFDTFTEKKDLGSQGFGDLLASIRNKNIPLDRMHFVTYRNNLNKIM  317

Query  1093  ATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDG  914
             ATAY+RNE WEMGVHKRKGVVYLDVHKLPERP+S LDRRRCYWGYCFESLATEDP RSDG
Sbjct  318   ATAYLRNEAWEMGVHKRKGVVYLDVHKLPERPQSVLDRRRCYWGYCFESLATEDPRRSDG  377

Query  913   DRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEE  734
             + IH +DANVEYC+V+KTK+GAHR+LMGAEMDCCDS DDGRRFYVELKTSRE L++ TEE
Sbjct  378   EGIHHVDANVEYCSVVKTKLGAHRVLMGAEMDCCDSTDDGRRFYVELKTSRE-LEYHTEE  436

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCL  554
              +EREKLLKFWIQSFLAGVPYIVVGFRDD GRLVRTERLRT +IT RVKMK+YWQGGVCL
Sbjct  437   KYEREKLLKFWIQSFLAGVPYIVVGFRDDGGRLVRTERLRTKDITHRVKMKNYWQGGVCL  496

Query  553   AFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLES  398
             AFADEVLCWLYGTVKENEDYILQFTPHS RLELL+  SCPDAIT+HVQQL S
Sbjct  497   AFADEVLCWLYGTVKENEDYILQFTPHSARLELLQAQSCPDAITNHVQQLNS  548



>ref|XP_009594860.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic [Nicotiana 
tomentosiformis]
Length=528

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/447 (83%), Positives = 400/447 (89%), Gaps = 5/447 (1%)
 Frame = -2

Query  1735  EEDDNGEVRSSLNSNINSHSKYGNEdddsdkdlfgsDNEEYVKTPATSTYPVPVLPPVRN  1556
             E+DDNGEV  S N+N +S   +  E+DD DKDLFGSDNE+YVKT + S +PVPVLPP+RN
Sbjct  84    EDDDNGEV-ISHNNNNSSSGYFQEEEDDDDKDLFGSDNEDYVKTLSKSPFPVPVLPPIRN  142

Query  1555  TNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGYGRG--NAPRDERFVSELKFAKSE  1385
             TN+ TRGGFGRGRWQN RG GILP P  YPPRQNYGYG    N  RDERFVSELKFAKSE
Sbjct  143   TNHHTRGGFGRGRWQNDRGAGILPRPGPYPPRQNYGYGPKFFNGHRDERFVSELKFAKSE  202

Query  1384  ETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKR  1205
             ETLARK  A QEPCELAC+SRV+ G+VYFDDRSLRLFKRLITED+G+DLNEGFDTF EK+
Sbjct  203   ETLARKCIAFQEPCELACFSRVEGGEVYFDDRSLRLFKRLITEDVGADLNEGFDTFVEKK  262

Query  1204  DLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYL  1025
             DLGSQGFGDLLA IRNKNIPLDRMHFVTYRNNLNKIMATAY+R+EPWEMGVHKRKGVVYL
Sbjct  263   DLGSQGFGDLLASIRNKNIPLDRMHFVTYRNNLNKIMATAYLRHEPWEMGVHKRKGVVYL  322

Query  1024  DVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAH  845
             DVHKLPERPKSELDRRRCYWGYCFESLATEDP RSDG+ IH +DANVEYCAV+KTK+GAH
Sbjct  323   DVHKLPERPKSELDRRRCYWGYCFESLATEDPARSDGEGIHHVDANVEYCAVVKTKLGAH  382

Query  844   RILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIV  665
             RILMGAEMDCCDS DDGRRFYVELKTSRE LD+ TEE +EREKLLKFWIQSFLAGVPYIV
Sbjct  383   RILMGAEMDCCDSTDDGRRFYVELKTSRE-LDYHTEERYEREKLLKFWIQSFLAGVPYIV  441

Query  664   VGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQ  485
             VGFRDD GRLVRTERLRT +IT RVKMK+YWQGGVCLAFADEVLCWLYGTVKENEDYILQ
Sbjct  442   VGFRDDAGRLVRTERLRTKDITHRVKMKNYWQGGVCLAFADEVLCWLYGTVKENEDYILQ  501

Query  484   FTPHSNRLELLRGPSCPDAITHHVQQL  404
             F P S RLELL+  SCPDAIT HVQQL
Sbjct  502   FAPPSARLELLQAQSCPDAITDHVQQL  528



>ref|XP_004245834.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic [Solanum 
lycopersicum]
Length=554

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/412 (84%), Positives = 371/412 (90%), Gaps = 4/412 (1%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGY  1448
             NE+Y KT + S +PVPVLPP+RN N+  RGGFGRGRWQN RG GILP P  YPPRQN GY
Sbjct  143   NEDYAKTLSKSRFPVPVLPPIRNNNHQPRGGFGRGRWQNDRGAGILPRPGPYPPRQNCGY  202

Query  1447  GRG--NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLF  1274
             G    N  RDERFVSELKFAKSEETLARK  A QEPCELAC+SRV+ GDVYFDDRSLRLF
Sbjct  203   GSKFFNGHRDERFVSELKFAKSEETLARKCIAFQEPCELACFSRVEGGDVYFDDRSLRLF  262

Query  1273  KRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIM  1094
             KRLITED+G+DLN+GFDTFTEK+DLGSQGFGDLLA IRNKNIPLDRMHFVTYRNNLNKIM
Sbjct  263   KRLITEDVGADLNQGFDTFTEKKDLGSQGFGDLLASIRNKNIPLDRMHFVTYRNNLNKIM  322

Query  1093  ATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDG  914
             ATAY+RNEPWEMGVHKRKGVVYLDVHKLPERP+S LDRRRCYWGYCFESLATEDP RSDG
Sbjct  323   ATAYLRNEPWEMGVHKRKGVVYLDVHKLPERPQSVLDRRRCYWGYCFESLATEDPRRSDG  382

Query  913   DRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEE  734
             + IH +DANVE+C+V+KTK+GAHR+LMGAEMDCCDS DDGRRFYVELKTSRE L++ TEE
Sbjct  383   EGIHHVDANVEFCSVVKTKLGAHRVLMGAEMDCCDSTDDGRRFYVELKTSRE-LEYHTEE  441

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCL  554
              +EREKLLKFWIQSFLAGVPYIVVGFRDD GRLVRTERLRT +IT RVKMK+YWQGGVCL
Sbjct  442   KYEREKLLKFWIQSFLAGVPYIVVGFRDDAGRLVRTERLRTKDITHRVKMKNYWQGGVCL  501

Query  553   AFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLES  398
             AFADEVLCWLYGTVKENEDYILQFTPHS RLELL+  SCPDAIT HVQ L S
Sbjct  502   AFADEVLCWLYGTVKENEDYILQFTPHSARLELLQAQSCPDAITEHVQLLNS  553



>ref|XP_011070262.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic [Sesamum 
indicum]
Length=528

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/454 (80%), Positives = 396/454 (87%), Gaps = 12/454 (3%)
 Frame = -2

Query  1732  EDDNGEVRSS--------LNSNINSHSKYGNEdddsdkdlfgsDNEEYVKTPATSTYPVP  1577
             +D +GEV+SS         N + NSH    +E+ + DKDLF SDNEEY+KTPA S +PVP
Sbjct  76    DDTHGEVKSSSYNNHDYNYNDDSNSHYYENDEEAEEDKDLFDSDNEEYIKTPANSPFPVP  135

Query  1576  VLPPVRNTNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGYGRG--NAPRDERFVSE  1406
             VLPPVRNTNN TRGGFGRGRWQN RG G+LP P  YP RQNYGYG+   N+ RDERFVSE
Sbjct  136   VLPPVRNTNNHTRGGFGRGRWQNDRGPGLLPRPGPYPQRQNYGYGQKFFNSHRDERFVSE  195

Query  1405  LKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGF  1226
             LKF+KSEETLARK+ A QEPCELAC+SRV+ GDVYFDDRSLRLFKRLITEDIG+DLNEGF
Sbjct  196   LKFSKSEETLARKAIAFQEPCELACFSRVEGGDVYFDDRSLRLFKRLITEDIGTDLNEGF  255

Query  1225  DTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHK  1046
             D+F EK+DLGSQGFGDLLA IRNKNIPL  MHFVTYRNNLNKI+ATAYIR+EPWEMGVHK
Sbjct  256   DSFIEKKDLGSQGFGDLLATIRNKNIPLQNMHFVTYRNNLNKILATAYIRHEPWEMGVHK  315

Query  1045  RKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVI  866
             R GVVYLDVHKLPERP+SELDRRRCYWGYCFE+LATEDP R+DG+ IH +DANVEYCAVI
Sbjct  316   RNGVVYLDVHKLPERPQSELDRRRCYWGYCFETLATEDPRRADGEGIHHVDANVEYCAVI  375

Query  865   KTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFL  686
             KTK+GAHRILMGAEMDCCDS DDGRRFYVELKTSRE LD+ TEE +EREKLLKFWIQSFL
Sbjct  376   KTKLGAHRILMGAEMDCCDSTDDGRRFYVELKTSRE-LDYHTEERYEREKLLKFWIQSFL  434

Query  685   AGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKE  506
             AGVPYIV+GFRDD GRLVRTERLRT +IT RVKMK+YWQGGVCLAFADEVLCWLYGTVKE
Sbjct  435   AGVPYIVIGFRDDGGRLVRTERLRTKDITHRVKMKNYWQGGVCLAFADEVLCWLYGTVKE  494

Query  505   NEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             NEDYILQF P   RLELL+  SCPD IT+HV QL
Sbjct  495   NEDYILQFAPPFTRLELLQAQSCPDVITNHVLQL  528



>ref|XP_007039646.1| Glycine-rich protein isoform 1 [Theobroma cacao]
 gb|EOY24147.1| Glycine-rich protein isoform 1 [Theobroma cacao]
Length=518

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/409 (81%), Positives = 364/409 (89%), Gaps = 3/409 (1%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPNYPPRQNYGYG  1445
             NE+Y KTPATS + +PVLP +RN NNP RGGFGRGRWQN RG GIL  P YPPRQ YGYG
Sbjct  111   NEDYCKTPATSPFSIPVLPVIRNPNNPGRGGFGRGRWQNDRGAGILGRPGYPPRQGYGYG  170

Query  1444  R--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFK  1271
                 N   DERFVSELK +KSEETL+RK  A QEPCELACYSRV+ GDVYFDDRSLRLFK
Sbjct  171   SKFANGRHDERFVSELKLSKSEETLSRKCIAFQEPCELACYSRVEGGDVYFDDRSLRLFK  230

Query  1270  RLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMA  1091
             RLITEDIG+DLN+GF+TF EK+DLGS+GFGDLLACIR+KNIPL  +HFVT+RNNLNKIMA
Sbjct  231   RLITEDIGADLNQGFNTFIEKKDLGSEGFGDLLACIRDKNIPLQNIHFVTFRNNLNKIMA  290

Query  1090  TAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGD  911
             TAYIRNEPWEMGVHKR GVVYLDVHKLPERP+SELDR+RCYWGYCFESLATEDP R+DG+
Sbjct  291   TAYIRNEPWEMGVHKRNGVVYLDVHKLPERPRSELDRQRCYWGYCFESLATEDPRRADGE  350

Query  910   RIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEI  731
              IH IDAN EYC+VIKTK+GAHRILMGAEMDCCDS D+GRRFYVELKTSRE LD+ TEE 
Sbjct  351   EIHHIDANAEYCSVIKTKLGAHRILMGAEMDCCDSTDEGRRFYVELKTSRE-LDYHTEER  409

Query  730   FEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLA  551
             +EREKLLKFWIQSFLAGVPYIV+GFRDD GRLVRTERLRT +IT RVKMK+YWQGGVCLA
Sbjct  410   YEREKLLKFWIQSFLAGVPYIVIGFRDDAGRLVRTERLRTKDITHRVKMKNYWQGGVCLA  469

Query  550   FADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             FADEVLCWLYGTVKENEDY+LQF P  +RLELL+   CPDAIT+HV+QL
Sbjct  470   FADEVLCWLYGTVKENEDYVLQFAPPFSRLELLQAQFCPDAITNHVEQL  518



>emb|CDP08316.1| unnamed protein product [Coffea canephora]
Length=547

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/460 (77%), Positives = 387/460 (84%), Gaps = 18/460 (4%)
 Frame = -2

Query  1732  EDDNGEVRSSLNSNIN----SHSKYGN----------EdddsdkdlfgsDNEEYVKTPAT  1595
             E+D GEVRS  NSNIN    S + Y N          ++++ DKDLFGSDNE+Y KTP  
Sbjct  89    ENDGGEVRSRDNSNINHNRSSDTNYNNCGKENYYENLDEEEDDKDLFGSDNEDYGKTPVN  148

Query  1594  STYPVPVLPPVRNTNNPTrggfgrgr-wqngrgnGILPSPN-YPPRQNYGYGRG-NAPRD  1424
             S YPVPVLP +RNTNN  RGGFGRGR   N RG G+LP P  YP R N+G  +  NAPRD
Sbjct  149   SPYPVPVLPAIRNTNNHMRGGFGRGRWQHNNRGPGLLPRPGPYPQRPNFGGPKFFNAPRD  208

Query  1423  ERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGS  1244
             ERFVSELKF+KSE+TLARK  A QEPCELACYSR++ G V+FDDRSLRLFKRLIT+DIG 
Sbjct  209   ERFVSELKFSKSEQTLARKCIAFQEPCELACYSRIEGGGVFFDDRSLRLFKRLITQDIGF  268

Query  1243  DLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPW  1064
             DLNEGFDTF  K+DLGS+GFGDLL CIR+KNIPL  MHFVTYRNNLNKI+ATAYIR+EPW
Sbjct  269   DLNEGFDTFIPKKDLGSEGFGDLLGCIRSKNIPLQNMHFVTYRNNLNKILATAYIRHEPW  328

Query  1063  EMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANV  884
             EMGVHKR GVVYLDVHKLPERP+SEL+RRRCYWGYCFESLATEDP R DG+ IH +DANV
Sbjct  329   EMGVHKRNGVVYLDVHKLPERPQSELERRRCYWGYCFESLATEDPTRGDGEGIHHVDANV  388

Query  883   EYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKF  704
             EYC+V+KTK+GAHRILMGAEMDCCDS DDGRRFYVELKTSRE LD+ TEE FEREKLLKF
Sbjct  389   EYCSVLKTKLGAHRILMGAEMDCCDSTDDGRRFYVELKTSRE-LDYHTEERFEREKLLKF  447

Query  703   WIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWL  524
             WIQSFLAGVPYIV+GFRDD GRLVRTERLRT E+T RVKMK+YWQGGVCLAFADEVLCWL
Sbjct  448   WIQSFLAGVPYIVIGFRDDGGRLVRTERLRTKEVTGRVKMKNYWQGGVCLAFADEVLCWL  507

Query  523   YGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             YGTVKENEDYILQF P   RLELL+  SCPDAIT HV QL
Sbjct  508   YGTVKENEDYILQFAPPFTRLELLQADSCPDAITDHVDQL  547



>ref|XP_002516686.1| Protein dom-3, putative [Ricinus communis]
 gb|EEF45705.1| Protein dom-3, putative [Ricinus communis]
Length=528

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/409 (79%), Positives = 359/409 (88%), Gaps = 3/409 (1%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPNYPPRQNYGYG  1445
             NE+YVKTPA S + +PVLP +RN +NP RG FGRGRWQN RG G+LP P +PPRQ YGYG
Sbjct  121   NEDYVKTPAISRFSIPVLPVIRNVHNPGRGNFGRGRWQNDRGAGLLPRPGFPPRQGYGYG  180

Query  1444  R--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFK  1271
                 N  RDERFVSELKF KSEETL+RK+ A Q PCEL CYSR + G+VYFDDR+LRLFK
Sbjct  181   SKFSNGHRDERFVSELKFLKSEETLSRKAVAFQAPCELGCYSRAEGGEVYFDDRTLRLFK  240

Query  1270  RLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMA  1091
             R I+EDIG+DLNEGFDTFTEK+DLGS+GFGDLL CIR+KNIPL  MHFVT+RNNLNKI+ 
Sbjct  241   RYISEDIGADLNEGFDTFTEKKDLGSEGFGDLLGCIRDKNIPLQNMHFVTFRNNLNKILV  300

Query  1090  TAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGD  911
             TAYIR+EPWEMGVHKR GVVYLDVHKLPERPKSEL+RRRCYWGYCFESLATEDP R+DG+
Sbjct  301   TAYIRHEPWEMGVHKRNGVVYLDVHKLPERPKSELERRRCYWGYCFESLATEDPKRADGE  360

Query  910   RIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEI  731
              IH +DANVEYC+V+KTK+GAHRILMGAEMDCCDS DDG+RFYVELKTSRE LD+ TEE 
Sbjct  361   GIHHVDANVEYCSVLKTKLGAHRILMGAEMDCCDSTDDGKRFYVELKTSRE-LDYHTEER  419

Query  730   FEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLA  551
             FEREKLLKFWIQSFLAGVPYIV+GFRDD GRLVRTERL T +IT RVK K+YWQGGVCLA
Sbjct  420   FEREKLLKFWIQSFLAGVPYIVIGFRDDAGRLVRTERLTTKDITNRVKAKNYWQGGVCLA  479

Query  550   FADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             FADEVLCWLYGTVKENEDYILQF P   RLELL+  SCPDAIT+HV QL
Sbjct  480   FADEVLCWLYGTVKENEDYILQFAPPFTRLELLQAQSCPDAITNHVMQL  528



>gb|EYU33183.1| hypothetical protein MIMGU_mgv1a004241mg [Erythranthe guttata]
Length=538

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/410 (80%), Positives = 364/410 (89%), Gaps = 4/410 (1%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSP-NYPPRQNYGY  1448
             N++YVKTPA ST+P+PVLPP+RNTNN  RGGFGRGRWQN RG G+LP P +Y  RQNYGY
Sbjct  130   NDDYVKTPAASTHPIPVLPPLRNTNNQPRGGFGRGRWQNDRGRGLLPRPGSYQQRQNYGY  189

Query  1447  GRG--NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLF  1274
             G    N  RDERFVSELKF+KSEETLARKS A QEPCELACYSRV+ GDVYFDDR +RLF
Sbjct  190   GNNFYNGHRDERFVSELKFSKSEETLARKSIAFQEPCELACYSRVEGGDVYFDDRGVRLF  249

Query  1273  KRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIM  1094
             KRLITEDIGSDLNEGF+TF  K++LGS GFGDLLA IRNKNIPL  MHFVTYRNNLNKIM
Sbjct  250   KRLITEDIGSDLNEGFNTFIPKKELGSDGFGDLLAAIRNKNIPLQNMHFVTYRNNLNKIM  309

Query  1093  ATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDG  914
             ATAY+R+EPWEMGVHKR GVVYLDVHKLPERP++ELD+RRCYWGY FE+LATEDP R+DG
Sbjct  310   ATAYMRHEPWEMGVHKRNGVVYLDVHKLPERPQNELDKRRCYWGYAFEALATEDPTRADG  369

Query  913   DRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEE  734
             + IH +DANVEYCAVIKTK+GAHRILMGAEMDCCDS D+GRRFYVELKTSRE LD+ TEE
Sbjct  370   EGIHHVDANVEYCAVIKTKLGAHRILMGAEMDCCDSTDEGRRFYVELKTSRE-LDYHTEE  428

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCL  554
              +EREKLLKFWIQSFLAGVPYIV+G+RDD G LVRTERLRT +IT RVKMK+YWQGGVCL
Sbjct  429   RYEREKLLKFWIQSFLAGVPYIVIGYRDDAGVLVRTERLRTKDITHRVKMKNYWQGGVCL  488

Query  553   AFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             AFADEVLCWLYGTVKENEDY+LQF P  +RLELL+  SCPD I  HV+QL
Sbjct  489   AFADEVLCWLYGTVKENEDYVLQFAPPFSRLELLQAHSCPDVIKQHVEQL  538



>ref|XP_010053552.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic [Eucalyptus 
grandis]
 ref|XP_010053553.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic [Eucalyptus 
grandis]
 gb|KCW77864.1| hypothetical protein EUGRSUZ_D02138 [Eucalyptus grandis]
 gb|KCW77865.1| hypothetical protein EUGRSUZ_D02138 [Eucalyptus grandis]
Length=530

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/451 (75%), Positives = 385/451 (85%), Gaps = 11/451 (2%)
 Frame = -2

Query  1735  EEDDNGEVRSSLNSNINSHSKYGNEdddsdkdlfgsDNEEYVKTPATSTYPVPVLPPVRN  1556
             EED+NGE   +++   +SH    +E ++ + DLFGSDNEEY KTPATS +P+PVLPP+R 
Sbjct  84    EEDENGEDLENVSGVTSSHR---SEFEEKETDLFGSDNEEYCKTPATSRFPIPVLPPIRT  140

Query  1555  TNNPTrggfg----rgrwqngrgnGILPSPN-YPPRQNYGYGR--GNAPRDERFVSELKF  1397
              N+  RG FG    +G   NGRG GILP P  YPPRQNYG+G    N  RDERFVSELK 
Sbjct  141   NNSQGRGTFGRGRWQGGHPNGRGAGILPRPGPYPPRQNYGFGPKFSNGHRDERFVSELKL  200

Query  1396  AKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTF  1217
             +KSEETL+R+  A QEPCELACYSR + GDVYFDDR+LRLFKR ITED+G+DLNEGFDTF
Sbjct  201   SKSEETLSRRCIAFQEPCELACYSRAEGGDVYFDDRTLRLFKRFITEDVGADLNEGFDTF  260

Query  1216  TEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKG  1037
              EK+DLGS+GFGDLLAC+R+KNIPL  +HFVT+RNNLNKI+ATAYIRNEPWEMGVHKR G
Sbjct  261   IEKKDLGSEGFGDLLACVRDKNIPLQNIHFVTFRNNLNKILATAYIRNEPWEMGVHKRNG  320

Query  1036  VVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTK  857
             VVYLDVHKLPERP+S+LDRRR YWGYCFE+LATEDP R+ G+ IH ++ANVEYC+VIKTK
Sbjct  321   VVYLDVHKLPERPQSDLDRRRSYWGYCFENLATEDPQRAVGEGIHHVNANVEYCSVIKTK  380

Query  856   IGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGV  677
             +GAHRILMGAEMDCCD+ DDGRRFY+ELKTSRE L++ TEE FEREKLLKFWIQ+FLAGV
Sbjct  381   LGAHRILMGAEMDCCDAADDGRRFYIELKTSRE-LEYHTEERFEREKLLKFWIQTFLAGV  439

Query  676   PYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENED  497
             P IV+GFRDD GRLVRTERLRT +ITQRVKMK+YWQGGVCLAFADEVLCWLYGTVKENED
Sbjct  440   PCIVIGFRDDAGRLVRTERLRTKDITQRVKMKNYWQGGVCLAFADEVLCWLYGTVKENED  499

Query  496   YILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             YILQF P  NRLELL+  SCPDAIT+HV QL
Sbjct  500   YILQFAPPFNRLELLQANSCPDAITNHVTQL  530



>gb|KDP28963.1| hypothetical protein JCGZ_19657 [Jatropha curcas]
Length=521

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/410 (78%), Positives = 352/410 (86%), Gaps = 4/410 (1%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrw-qngrgnGILPSPNYPPRQNYGY  1448
             NE+YVKT ATS YP+PVLP +RN+NN    G       QN RG G+LP P +PPRQ YGY
Sbjct  113   NEDYVKTLATSPYPIPVLPVIRNSNNQGGRGNFGRGGWQNDRGAGLLPRPGFPPRQGYGY  172

Query  1447  GR--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLF  1274
             G    N  RDERFVSELKF+KSEETL+RK  A Q P EL+CYSRV+ GDVYFDDRSLRLF
Sbjct  173   GSKFSNGHRDERFVSELKFSKSEETLSRKMVAFQAPFELSCYSRVESGDVYFDDRSLRLF  232

Query  1273  KRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIM  1094
             KR I+EDIG+DLNEGFDTF EK+DLGS+GFGDLL CIR+K IPL  MHFVT+RNNLNKI+
Sbjct  233   KRFISEDIGADLNEGFDTFIEKKDLGSEGFGDLLGCIRDKKIPLQNMHFVTFRNNLNKIL  292

Query  1093  ATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDG  914
             ATAYIR+EPWEMGVHKR GVVYLDVHKL ERP+SEL+RRRCYWGYCFESLATEDP R+DG
Sbjct  293   ATAYIRHEPWEMGVHKRNGVVYLDVHKLRERPQSELERRRCYWGYCFESLATEDPNRADG  352

Query  913   DRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEE  734
             +RIH +DANVEYC+V KTK+GAHRILMGAEMDCCDS DDG+RFYVELKTSRE LD+ TEE
Sbjct  353   ERIHHVDANVEYCSVFKTKLGAHRILMGAEMDCCDSTDDGKRFYVELKTSRE-LDYHTEE  411

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCL  554
              FEREKLLKFWIQSFLAGVPYIV+GFRDD GRLVRTERL T +IT RVK K+YWQGGVCL
Sbjct  412   RFEREKLLKFWIQSFLAGVPYIVIGFRDDAGRLVRTERLTTKDITNRVKAKNYWQGGVCL  471

Query  553   AFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             AFADEVLCWLYGTVKENEDYILQF P   RLELL+  SCPDAIT+HV QL
Sbjct  472   AFADEVLCWLYGTVKENEDYILQFAPPYTRLELLQAQSCPDAITNHVLQL  521



>ref|XP_008229482.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic [Prunus 
mume]
Length=525

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/414 (79%), Positives = 357/414 (86%), Gaps = 9/414 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfg----rgrwqngrgnGILPSPN-YPPRQ  1460
             NE++ KTPATS + +PVLP +RNTNN  RG FG    +    N RG GILP P  YP R 
Sbjct  114   NEDFCKTPATSPFLIPVLPVIRNTNNQGRGNFGRGRWQSGHPNDRGAGILPRPGPYPQRH  173

Query  1459  NYGYGR--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
             NYGYG    N  RDERFVS+L+  KSEETL+RK  A QEPCELACYSRV+ GDV FDD S
Sbjct  174   NYGYGSKFSNGHRDERFVSDLRLTKSEETLSRKMIAFQEPCELACYSRVEGGDVTFDDTS  233

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
             LRLFKRLITEDIG+DLN+G+DTF  K+DLGSQGFGDLLACIR+KNIPL  +HFVTYRNNL
Sbjct  234   LRLFKRLITEDIGADLNDGYDTFIGKKDLGSQGFGDLLACIRDKNIPLQNIHFVTYRNNL  293

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+ATAYIR+EPWEMGVHKR GVVYLDVHKLPERP+SELDRRRCYWGYCFESLATEDPG
Sbjct  294   NKILATAYIRHEPWEMGVHKRNGVVYLDVHKLPERPQSELDRRRCYWGYCFESLATEDPG  353

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDH  746
             R DG  IH +DANVE+C+VIKTK+GAHRILMGAEMDCCDS DDGRRFYVELKTSRE LD+
Sbjct  354   RGDGG-IHHVDANVEFCSVIKTKLGAHRILMGAEMDCCDSTDDGRRFYVELKTSRE-LDY  411

Query  745   RTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQG  566
              TEE FEREKLLKFWIQSFLAGVPYIV+GFRDD GRLVRTERLRT +ITQRVKMK+YWQG
Sbjct  412   HTEERFEREKLLKFWIQSFLAGVPYIVIGFRDDAGRLVRTERLRTKDITQRVKMKNYWQG  471

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             GVCLAFADEVLCWLYGTVKENEDYILQF P  NRLELL+  SCP+ IT+HVQQL
Sbjct  472   GVCLAFADEVLCWLYGTVKENEDYILQFAPPFNRLELLQAQSCPEEITNHVQQL  525



>ref|XP_007210571.1| hypothetical protein PRUPE_ppa004173mg [Prunus persica]
 gb|EMJ11770.1| hypothetical protein PRUPE_ppa004173mg [Prunus persica]
Length=525

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/414 (79%), Positives = 357/414 (86%), Gaps = 9/414 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfg----rgrwqngrgnGILPSPN-YPPRQ  1460
             NE++ KTPATS + +PVLP +RNTNN  RG FG    +    N RG GILP P  YP R 
Sbjct  114   NEDFCKTPATSPFLIPVLPVIRNTNNQGRGNFGRGRWQSGHPNDRGAGILPRPGPYPQRH  173

Query  1459  NYGYGR--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
             NYGYG    N  RDERFVS+L+  KSEETL+RK  A QEPCELACYSRV+ GDV FDD S
Sbjct  174   NYGYGSKFSNGHRDERFVSDLRLTKSEETLSRKIIAFQEPCELACYSRVEGGDVTFDDTS  233

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
             LRLFKRLITEDIG+DLN+G+DTF  K+DLGSQGFGDLLACIR+KNIPL  +HFVTYRNNL
Sbjct  234   LRLFKRLITEDIGADLNDGYDTFIGKKDLGSQGFGDLLACIRDKNIPLQNIHFVTYRNNL  293

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+ATAYIR+EPWEMGVHKR GVVYLDVHKLPERP+SELDRRRCYWGYCFESLATEDPG
Sbjct  294   NKILATAYIRHEPWEMGVHKRNGVVYLDVHKLPERPQSELDRRRCYWGYCFESLATEDPG  353

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDH  746
             R DG  IH +DANVE+C+VIKTK+GAHRILMGAEMDCCDS DDGRRFYVELKTSRE LD+
Sbjct  354   RGDGG-IHHVDANVEFCSVIKTKLGAHRILMGAEMDCCDSTDDGRRFYVELKTSRE-LDY  411

Query  745   RTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQG  566
              TEE FEREKLLKFWIQSFLAGVPYIV+GFRDD GRLVRTERLRT +ITQRVKMK+YWQG
Sbjct  412   HTEERFEREKLLKFWIQSFLAGVPYIVIGFRDDAGRLVRTERLRTKDITQRVKMKNYWQG  471

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             GVCLAFADEVLCWLYGTVKENEDYILQF P  NRLELL+  SCP+ IT+HVQQL
Sbjct  472   GVCLAFADEVLCWLYGTVKENEDYILQFAPPFNRLELLQAQSCPEEITNHVQQL  525



>ref|XP_011018677.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic [Populus 
euphratica]
Length=599

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/409 (77%), Positives = 359/409 (88%), Gaps = 2/409 (0%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPNYPPRQNYGYG  1445
             NE+Y+KT   S +P+PVLP +R+ NNP RG FGRGRW N RG G+LP P +PPRQ YGYG
Sbjct  191   NEDYMKTTVISPHPIPVLPAMRHPNNPGRGNFGRGRWHNNRGAGLLPRPGFPPRQGYGYG  250

Query  1444  R--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFK  1271
                 N  RDERFVSELKF+KS+ETL+RK  A QEPCELACYSR++ G+VYFDDRSLRLFK
Sbjct  251   SKFANGHRDERFVSELKFSKSDETLSRKCVAFQEPCELACYSRIEGGEVYFDDRSLRLFK  310

Query  1270  RLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMA  1091
             RLI+ED+G+DLNEGFDTF EKRDLGSQGFGDLLACIR KNIPL  MHFVT+RNNLNKI+A
Sbjct  311   RLISEDVGADLNEGFDTFIEKRDLGSQGFGDLLACIRGKNIPLQNMHFVTFRNNLNKILA  370

Query  1090  TAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGD  911
             TAY+R+E WEMGVHKR GVVYLDVHKLPERP+SEL+RRRCYWGYCFESLATEDP R++G+
Sbjct  371   TAYMRHEHWEMGVHKRNGVVYLDVHKLPERPQSELERRRCYWGYCFESLATEDPRRANGE  430

Query  910   RIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEI  731
              IH +DANVEYC+VIKTK+GAHRILMGAEMDCCDS D GRRFYVELKT+RE+ ++  EE 
Sbjct  431   AIHHVDANVEYCSVIKTKLGAHRILMGAEMDCCDSTDSGRRFYVELKTNREIDNYHQEER  490

Query  730   FEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLA  551
             FE+EKLLK WIQ+FLAGVPYIV+G+RDD GRLVRTERL T +ITQRVKMK+YWQGGVCLA
Sbjct  491   FEKEKLLKCWIQAFLAGVPYIVIGYRDDAGRLVRTERLTTKDITQRVKMKNYWQGGVCLA  550

Query  550   FADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             FADEVLCWLYGTVKENEDYILQF P   RLELL+  SCP+AIT HV+Q+
Sbjct  551   FADEVLCWLYGTVKENEDYILQFAPPFTRLELLQAQSCPEAITSHVEQM  599



>ref|XP_010664258.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic [Vitis 
vinifera]
Length=502

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/409 (81%), Positives = 362/409 (89%), Gaps = 3/409 (1%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGY  1448
             NE+Y KT A S YPVPVLP +RN NN  RGGFGRGRWQN RG GILP P  YP R NYGY
Sbjct  95    NEDYCKTLAISPYPVPVLPAIRNNNNQNRGGFGRGRWQNDRGAGILPRPGPYPQRHNYGY  154

Query  1447  G-RGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFK  1271
             G + N   DERFVSELK +KSEETL+RK  A QEPCELACYSRV+ GDV FDDRSLRLFK
Sbjct  155   GSKFNNRHDERFVSELKLSKSEETLSRKCIAFQEPCELACYSRVEGGDVCFDDRSLRLFK  214

Query  1270  RLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMA  1091
             RLITED+G+DLNEG+DTF EK+DLGS+GFGDLLA IRN+NIPL  +HFVT+RNNLNKI+A
Sbjct  215   RLITEDVGADLNEGYDTFIEKKDLGSEGFGDLLAAIRNRNIPLGNIHFVTFRNNLNKILA  274

Query  1090  TAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGD  911
             TAYIR+EPWEMGVHKR GVVYLDVHKLPERP+S+LDRRRCYWGYCFESLATEDP R+DG+
Sbjct  275   TAYIRHEPWEMGVHKRNGVVYLDVHKLPERPQSDLDRRRCYWGYCFESLATEDPRRADGE  334

Query  910   RIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEI  731
              IH IDAN EYC+VIKTK+GAHRILMGAEMDCCDS DDGRRFYVELKTSRE LD+ TEE 
Sbjct  335   GIHHIDANAEYCSVIKTKLGAHRILMGAEMDCCDSTDDGRRFYVELKTSRE-LDYHTEER  393

Query  730   FEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLA  551
             +EREKLLKFWIQSFLAGVPYIV+GFRDD GRLVRTERLRT +ITQRVKMK+YWQGGVCLA
Sbjct  394   YEREKLLKFWIQSFLAGVPYIVIGFRDDGGRLVRTERLRTKDITQRVKMKNYWQGGVCLA  453

Query  550   FADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             FADEVLCWLYGTVKENEDYILQF P   RLELL+  SCPDAI++HVQQL
Sbjct  454   FADEVLCWLYGTVKENEDYILQFAPPFTRLELLQAQSCPDAISNHVQQL  502



>ref|XP_006385377.1| glycine-rich family protein [Populus trichocarpa]
 gb|ERP63174.1| glycine-rich family protein [Populus trichocarpa]
Length=532

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/409 (77%), Positives = 360/409 (88%), Gaps = 2/409 (0%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPNYPPRQNYGYG  1445
             NE+YVKT   S +P+PVLP +R+ +NP RG FGRGRW N RG G+LP P +PPRQ YGYG
Sbjct  124   NEDYVKTTVISPHPIPVLPAMRHPHNPGRGNFGRGRWHNNRGAGLLPRPGFPPRQGYGYG  183

Query  1444  R--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFK  1271
                 N  RDERFVSELKF+KS+ETL+RK  A QEPCELACYSR++ G+VYFDDRSLRLFK
Sbjct  184   SKFANGHRDERFVSELKFSKSDETLSRKCVAFQEPCELACYSRIEGGEVYFDDRSLRLFK  243

Query  1270  RLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMA  1091
             RLI+ED+G+DLNEGFDTF EKRDLGSQGFGDLLACIR+KNIPL  MHFVT+RNNLNKI+A
Sbjct  244   RLISEDVGADLNEGFDTFIEKRDLGSQGFGDLLACIRDKNIPLQNMHFVTFRNNLNKILA  303

Query  1090  TAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGD  911
             TAY+R+E WEMGVHKR GVVYLDVHKLPERP+SEL+RRRCYWGYCFESLATEDP R++G+
Sbjct  304   TAYMRHEHWEMGVHKRNGVVYLDVHKLPERPQSELERRRCYWGYCFESLATEDPRRANGE  363

Query  910   RIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEI  731
              IH +D+NVEYC+VIKTK+GAHRILMGAEMDCCDS D GRRFYVELKT+RE+ ++  EE 
Sbjct  364   AIHHVDSNVEYCSVIKTKLGAHRILMGAEMDCCDSTDSGRRFYVELKTNREIDNYHQEER  423

Query  730   FEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLA  551
             FE+EKLLK WIQ+FLAGVPYIV+G+RDD GRLVRTERL T +ITQRVKMK+YWQGGVCLA
Sbjct  424   FEKEKLLKCWIQAFLAGVPYIVIGYRDDAGRLVRTERLTTKDITQRVKMKNYWQGGVCLA  483

Query  550   FADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             FADEVLCWLYGTVKENEDYILQF P   RLELL+  SCP+AIT HV+Q+
Sbjct  484   FADEVLCWLYGTVKENEDYILQFAPPFTRLELLQAQSCPEAITSHVEQM  532



>gb|KCW77862.1| hypothetical protein EUGRSUZ_D02138 [Eucalyptus grandis]
Length=530

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/451 (74%), Positives = 383/451 (85%), Gaps = 11/451 (2%)
 Frame = -2

Query  1735  EEDDNGEVRSSLNSNINSHSKYGNEdddsdkdlfgsDNEEYVKTPATSTYPVPVLPPVRN  1556
             EED+NGE   +++   +SH    +E ++ + DLFGSDNEEY KTPATS +P+PVLPP+R 
Sbjct  84    EEDENGEDLENVSGVTSSHR---SEFEEKETDLFGSDNEEYCKTPATSRFPIPVLPPIRT  140

Query  1555  TNNPTrggfg----rgrwqngrgnGILPSPN-YPPRQNYGYGR--GNAPRDERFVSELKF  1397
              N+  RG FG    +G   NGRG GILP P  YPPRQNYG+G    N  RDERFVSELK 
Sbjct  141   NNSQGRGTFGRGRWQGGHPNGRGAGILPRPGPYPPRQNYGFGPKFSNGHRDERFVSELKL  200

Query  1396  AKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTF  1217
             +KSEETL+R+  A QEPCELACYSR + GDVYFDDR+LRLFKR ITED+G+DLNEGFDTF
Sbjct  201   SKSEETLSRRCIAFQEPCELACYSRAEGGDVYFDDRTLRLFKRFITEDVGADLNEGFDTF  260

Query  1216  TEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKG  1037
              EK+DLGS+GFGDLLAC+R+KNIPL  +HFVT+RNNLNKI+ATAYIRNEPWEMGVHKR G
Sbjct  261   IEKKDLGSEGFGDLLACVRDKNIPLQNIHFVTFRNNLNKILATAYIRNEPWEMGVHKRNG  320

Query  1036  VVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTK  857
             VVYLDVHKLPERP+S+LDRRR YWGYCFE+LATEDP R+ G+ IH ++ANVEYC+VIKTK
Sbjct  321   VVYLDVHKLPERPQSDLDRRRSYWGYCFENLATEDPQRAVGEGIHHVNANVEYCSVIKTK  380

Query  856   IGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGV  677
             +GAHRILMGAEMDCCD+ DDGRRFY+ELKTSRE L++ TEE FEREKLLKFWIQ+FLAGV
Sbjct  381   LGAHRILMGAEMDCCDAADDGRRFYIELKTSRE-LEYHTEERFEREKLLKFWIQTFLAGV  439

Query  676   PYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENED  497
             P IV+GFRDD GRLVRTERLRT +ITQRVKMK+YWQ  VCLAFADEVLCWLYGTVKENED
Sbjct  440   PCIVIGFRDDAGRLVRTERLRTKDITQRVKMKNYWQVRVCLAFADEVLCWLYGTVKENED  499

Query  496   YILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             YILQF P  NRLELL+  SCPDAIT+HV QL
Sbjct  500   YILQFAPPFNRLELLQANSCPDAITNHVTQL  530



>ref|XP_004300311.1| PREDICTED: protein Dom3z homolog, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=523

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/416 (77%), Positives = 355/416 (85%), Gaps = 10/416 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgr------wqngrgnGILPSPN-YPP  1466
             NEEY +TPATS + +PVLP +RN N+    G            QN RG GILP P  YP 
Sbjct  109   NEEYTRTPATSPFLIPVLPVIRNNNHNQGRGGFGRGGRWQPGHQNDRGAGILPRPGPYPQ  168

Query  1465  R-QNYGYGR-GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDD  1292
             R  NYGYG+  N   DERFVSEL+ +KSEETL+RK   IQEPCELACYSRV+ GDV FD+
Sbjct  169   RGHNYGYGKFSNGRHDERFVSELRLSKSEETLSRKVIQIQEPCELACYSRVEGGDVIFDE  228

Query  1291  RSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRN  1112
              SLRLFKRLITEDIG+DLN+GFDTFT K DLGSQGFGDLLACIR+KNIPL  +HFVTYRN
Sbjct  229   SSLRLFKRLITEDIGADLNQGFDTFTAKNDLGSQGFGDLLACIRDKNIPLQNIHFVTYRN  288

Query  1111  NLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATED  932
             NLNKI+ATAYIRNEPWEMGVHKR GVVYLDVHKLPERP++E+DRRRCYWGYCFESLATED
Sbjct  289   NLNKILATAYIRNEPWEMGVHKRNGVVYLDVHKLPERPQNEMDRRRCYWGYCFESLATED  348

Query  931   PGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELL  752
             PGR DG+ IH +DAN+EYC+VIKTK+GAHRILMGAEMDCCDS DDGRRFYVELKTSRE L
Sbjct  349   PGRGDGELIHHVDANIEYCSVIKTKLGAHRILMGAEMDCCDSTDDGRRFYVELKTSRE-L  407

Query  751   DHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYW  572
             ++ TEE FEREKLLKFWIQSFLAGVPYIV+GFRDD+GRLVRTERLRT +ITQRVK K+YW
Sbjct  408   EYHTEERFEREKLLKFWIQSFLAGVPYIVIGFRDDSGRLVRTERLRTKDITQRVKTKNYW  467

Query  571   QGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             QGGVCLAFADEVLCWLYGTVKENEDYILQF P   RLELL+  SCP+AIT+HV+QL
Sbjct  468   QGGVCLAFADEVLCWLYGTVKENEDYILQFAPPFQRLELLQAQSCPEAITNHVEQL  523



>gb|KCW77863.1| hypothetical protein EUGRSUZ_D02138 [Eucalyptus grandis]
Length=541

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/462 (73%), Positives = 385/462 (83%), Gaps = 22/462 (5%)
 Frame = -2

Query  1735  EEDDNGEVRSSLNSNINSHSKYGNEdddsdkdlfgsDNEEYVKTPATSTYPVPVLPPVRN  1556
             EED+NGE   +++   +SH    +E ++ + DLFGSDNEEY KTPATS +P+PVLPP+R 
Sbjct  84    EEDENGEDLENVSGVTSSHR---SEFEEKETDLFGSDNEEYCKTPATSRFPIPVLPPIRT  140

Query  1555  TNNPTrggfg----rgrwqngrgnGILPSPN-YPPRQNYGYGR--GNAPRDERFVSELKF  1397
              N+  RG FG    +G   NGRG GILP P  YPPRQNYG+G    N  RDERFVSELK 
Sbjct  141   NNSQGRGTFGRGRWQGGHPNGRGAGILPRPGPYPPRQNYGFGPKFSNGHRDERFVSELKL  200

Query  1396  AKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTF  1217
             +KSEETL+R+  A QEPCELACYSR + GDVYFDDR+LRLFKR ITED+G+DLNEGFDTF
Sbjct  201   SKSEETLSRRCIAFQEPCELACYSRAEGGDVYFDDRTLRLFKRFITEDVGADLNEGFDTF  260

Query  1216  TEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKG  1037
              EK+DLGS+GFGDLLAC+R+KNIPL  +HFVT+RNNLNKI+ATAYIRNEPWEMGVHKR G
Sbjct  261   IEKKDLGSEGFGDLLACVRDKNIPLQNIHFVTFRNNLNKILATAYIRNEPWEMGVHKRNG  320

Query  1036  VVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTK  857
             VVYLDVHKLPERP+S+LDRRR YWGYCFE+LATEDP R+ G+ IH ++ANVEYC+VIKTK
Sbjct  321   VVYLDVHKLPERPQSDLDRRRSYWGYCFENLATEDPQRAVGEGIHHVNANVEYCSVIKTK  380

Query  856   IGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGV  677
             +GAHRILMGAEMDCCD+ DDGRRFY+ELKTSRE L++ TEE FEREKLLKFWIQ+FLAGV
Sbjct  381   LGAHRILMGAEMDCCDAADDGRRFYIELKTSRE-LEYHTEERFEREKLLKFWIQTFLAGV  439

Query  676   PYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKEN--  503
             P IV+GFRDD GRLVRTERLRT +ITQRVKMK+YWQGGVCLAFADEVLCWLYGTVKE+  
Sbjct  440   PCIVIGFRDDAGRLVRTERLRTKDITQRVKMKNYWQGGVCLAFADEVLCWLYGTVKESEI  499

Query  502   ---------EDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
                      EDYILQF P  NRLELL+  SCPDAIT+HV QL
Sbjct  500   HISISYYLYEDYILQFAPPFNRLELLQANSCPDAITNHVTQL  541



>ref|XP_010269848.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010269849.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
[Nelumbo nucifera]
Length=504

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/417 (76%), Positives = 356/417 (85%), Gaps = 8/417 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfg----rgrwqngrgnGILPSPN-YPPRQ  1460
             NE+Y +T A+S YPVPVLPP+RN NN  RG FG     G   +  G GILP P  Y  RQ
Sbjct  89    NEDYCRTLASSRYPVPVLPPIRNPNNQARGTFGRGRWHGHQNDRGGFGILPRPGPYHQRQ  148

Query  1459  NYGYGR--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
             NYG+G    N  +DERFVSELK +KSEETL+RK   IQEPCE+ACYSR++ GDVYFDDRS
Sbjct  149   NYGFGSRFNNGRQDERFVSELKLSKSEETLSRKCIQIQEPCEVACYSRIEGGDVYFDDRS  208

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
             LRLFKRLITED+G+DLNEGF +F EK++LGSQGFGDLL+CIR+KNIPL  +HFVT+RNNL
Sbjct  209   LRLFKRLITEDVGADLNEGFQSFIEKKELGSQGFGDLLSCIRDKNIPLQNIHFVTFRNNL  268

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+A AYIRNEPWEMGVHKR G+VYLDVHKLPERP++E+DRRRCYWGYCFESLATED  
Sbjct  269   NKILAAAYIRNEPWEMGVHKRNGIVYLDVHKLPERPQNEIDRRRCYWGYCFESLATEDSR  328

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDH  746
              +DGD IH IDANVE+C+VIKTK+GAHRI+MGAEMDCCDS D+GRRFY+ELKTSRE LD+
Sbjct  329   GADGDGIHHIDANVEFCSVIKTKLGAHRIIMGAEMDCCDSTDEGRRFYIELKTSRE-LDY  387

Query  745   RTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQG  566
              TEE +EREKLLKFWIQSFLAGVPYIV+GFRDD+GRLVRTERLRT +ITQRVKMK YWQG
Sbjct  388   HTEERYEREKLLKFWIQSFLAGVPYIVIGFRDDSGRLVRTERLRTKDITQRVKMKGYWQG  447

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLESF  395
             GVCLAFADEVLCWLYGTVKENEDYILQF P  NRLELL+  SCPD IT HV+Q +  
Sbjct  448   GVCLAFADEVLCWLYGTVKENEDYILQFAPPFNRLELLQAQSCPDVITSHVEQYQQL  504



>ref|XP_003517391.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
isoform X1 [Glycine max]
Length=507

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/445 (73%), Positives = 371/445 (83%), Gaps = 10/445 (2%)
 Frame = -2

Query  1735  EEDDNGEVRSSLNSNINSHSKYGNEdddsdkdlfgsDNEEYVKTPATSTYPVPVLPPVRN  1556
             ++D+NG+V  S  +  + H  Y ++D           NE+Y KT A S YP+PVLP  RN
Sbjct  68    DDDENGDVVDSAKARAHHHHDYEDKDLFGSD------NEDYCKTLARSPYPIPVLPATRN  121

Query  1555  TNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGYGR--GNAPRDERFVSELKFAKSE  1385
              NN  RGGFGRGRWQN RG G+LP P  YP RQN+GYG    N   DERFVSELK +KSE
Sbjct  122   VNNQGRGGFGRGRWQNDRGAGLLPRPGPYPQRQNFGYGNRFQNGRHDERFVSELKLSKSE  181

Query  1384  ETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKR  1205
             ETL+RK  A QEPCE+ACYSRV+ G+VYFDDRSLRLFKR ITED+G+DLNEG+DT+  K+
Sbjct  182   ETLSRKCIAFQEPCEVACYSRVEGGEVYFDDRSLRLFKRHITEDVGADLNEGYDTYIPKK  241

Query  1204  DLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYL  1025
             DLGS+GFGDLLACIR+KNIPL  +HFVT+RNNLNKI+ATAYIR+EPWEMGVHKR GVVYL
Sbjct  242   DLGSEGFGDLLACIRDKNIPLQNIHFVTFRNNLNKILATAYIRHEPWEMGVHKRNGVVYL  301

Query  1024  DVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAH  845
             DVHKLPERP+S+LDRRRCY GYCFESLATEDP R+DG+ IH +DAN E+CAVIKTK+GAH
Sbjct  302   DVHKLPERPQSDLDRRRCYVGYCFESLATEDPNRADGEGIHHVDANAEFCAVIKTKLGAH  361

Query  844   RILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIV  665
             RILMGAEMDCCDS ++G+RFYVELKTS E L++ TEE FEREKLLKFWIQSFLAGVPYIV
Sbjct  362   RILMGAEMDCCDSTNEGKRFYVELKTSCE-LNYHTEERFEREKLLKFWIQSFLAGVPYIV  420

Query  664   VGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQ  485
             +GFRDD GRLVRTERLRT +ITQRVKMK+YWQGGVCLAFADEVLCWLYGTVKE EDYILQ
Sbjct  421   IGFRDDAGRLVRTERLRTKDITQRVKMKNYWQGGVCLAFADEVLCWLYGTVKEGEDYILQ  480

Query  484   FTPHSNRLELLRGPSCPDAITHHVQ  410
             F P  NRLELL+  SCPD IT H++
Sbjct  481   FAPPFNRLELLQAQSCPDVITSHLE  505



>ref|XP_006477068.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
[Citrus sinensis]
Length=551

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/415 (76%), Positives = 352/415 (85%), Gaps = 8/415 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrw--qngrgnGILPSPNYPPRQNYG  1451
             NE Y +T A S YP+PVLP VRN NN    G         +  G GILP P YPPRQ  G
Sbjct  138   NEAYCRTSAISPYPIPVLPVVRNNNNHGGRGGFGRGRWPNDRGGVGILPRPGYPPRQG-G  196

Query  1450  YGRG----NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSL  1283
             YGRG    N  +DERFVSE + ++SEETL+RK  A QEPCELA YSRV+ GDVYFDDRSL
Sbjct  197   YGRGSRFSNGRQDERFVSEFRLSRSEETLSRKVVAFQEPCELAQYSRVEGGDVYFDDRSL  256

Query  1282  RLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLN  1103
             RLFKRLI+ED+G+DLNEGFDTF EK++LGS+GFGDLL+CIRN+NIPL  MHFVT+RNNLN
Sbjct  257   RLFKRLISEDVGADLNEGFDTFIEKKELGSEGFGDLLSCIRNRNIPLQNMHFVTFRNNLN  316

Query  1102  KIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGR  923
             KI+ATAYIRNEPW MGVHKR GVVYLDVHK+ ERPKSELDRRRCYWGYCFESLATEDP R
Sbjct  317   KILATAYIRNEPWAMGVHKRNGVVYLDVHKVQERPKSELDRRRCYWGYCFESLATEDPRR  376

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
             +DG+ IH IDANVE+CAV+KTK+GAHR+LMGAEMDCCDS DDGRRFYVELKTSRE LD+ 
Sbjct  377   ADGEGIHHIDANVEFCAVMKTKLGAHRLLMGAEMDCCDSTDDGRRFYVELKTSRE-LDYH  435

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
             TEE FEREKLLKFWIQSFLAGVP+IVVGFRDD GRLVRTERLRT +IT RVKMK+YWQGG
Sbjct  436   TEERFEREKLLKFWIQSFLAGVPFIVVGFRDDAGRLVRTERLRTKDITHRVKMKNYWQGG  495

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLES  398
             VCLAFADEVLCWLYGTVKENEDY L F P SNRLELL+  SCP++IT HV+QL++
Sbjct  496   VCLAFADEVLCWLYGTVKENEDYTLHFNPPSNRLELLQASSCPESITCHVEQLQN  550



>gb|KDO57021.1| hypothetical protein CISIN_1g007250mg [Citrus sinensis]
Length=611

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/416 (76%), Positives = 352/416 (85%), Gaps = 8/416 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrw--qngrgnGILPSPNYPPRQNYG  1451
             NE Y +T A S YP+PVLP VRN NN    G         +  G GILP P YPPRQ  G
Sbjct  198   NEAYCRTSAISPYPIPVLPVVRNNNNHGGRGGFGRGRWPNDRGGVGILPRPGYPPRQG-G  256

Query  1450  YGRG----NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSL  1283
             YGRG    N  +DERFVSE + ++SEETL+RK  A QEPCELA YSRV+ GDVYFDDRSL
Sbjct  257   YGRGSRFSNGRQDERFVSEFRLSRSEETLSRKVVAFQEPCELAQYSRVEGGDVYFDDRSL  316

Query  1282  RLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLN  1103
             RLFKRLI+ED+G+DLNEGFDTF EK++LGS+GFGDLL+CIRN+NIPL  MHFVT+RNNLN
Sbjct  317   RLFKRLISEDVGADLNEGFDTFIEKKELGSEGFGDLLSCIRNRNIPLQNMHFVTFRNNLN  376

Query  1102  KIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGR  923
             KI+ATAYIRNEPW MGVHKR GVVYLDVHK+ ERPKSELDRRRCYWGYCFESLATEDP R
Sbjct  377   KILATAYIRNEPWAMGVHKRNGVVYLDVHKVQERPKSELDRRRCYWGYCFESLATEDPRR  436

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
             +DG+ IH IDANVE+CAV+KTK+GAHR+LMGAEMDCCDS DDGRRFYVELKTSRE LD+ 
Sbjct  437   ADGEGIHHIDANVEFCAVMKTKLGAHRLLMGAEMDCCDSTDDGRRFYVELKTSRE-LDYH  495

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
             TEE FEREKLLKFWIQSFLAGVP+IVVGFRDD GRLVRTERLRT +IT RVKMK+YWQGG
Sbjct  496   TEERFEREKLLKFWIQSFLAGVPFIVVGFRDDAGRLVRTERLRTKDITHRVKMKNYWQGG  555

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLESF  395
             VCLAFADEVLCWLYGTVKENEDY L F P SNRLELL+  SCP++IT HV+QL++ 
Sbjct  556   VCLAFADEVLCWLYGTVKENEDYTLHFNPPSNRLELLQASSCPESITCHVEQLQNI  611



>ref|XP_006573706.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
isoform X2 [Glycine max]
Length=508

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/446 (73%), Positives = 371/446 (83%), Gaps = 11/446 (2%)
 Frame = -2

Query  1735  EEDDNGEVRSSLNSNINSHSKYGNEdddsdkdlfgsDNEEYVKTPATSTYPVPVLPPVRN  1556
             ++D+NG+V  S  +  + H  Y ++D           NE+Y KT A S YP+PVLP  RN
Sbjct  68    DDDENGDVVDSAKARAHHHHDYEDKDLFGSD------NEDYCKTLARSPYPIPVLPATRN  121

Query  1555  TNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGYGR--GNAPRDERFVSELKFAKSE  1385
              NN  RGGFGRGRWQN RG G+LP P  YP RQN+GYG    N   DERFVSELK +KSE
Sbjct  122   VNNQGRGGFGRGRWQNDRGAGLLPRPGPYPQRQNFGYGNRFQNGRHDERFVSELKLSKSE  181

Query  1384  ETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKR  1205
             ETL+RK  A QEPCE+ACYSRV+ G+VYFDDRSLRLFKR ITED+G+DLNEG+DT+  K+
Sbjct  182   ETLSRKCIAFQEPCEVACYSRVEGGEVYFDDRSLRLFKRHITEDVGADLNEGYDTYIPKK  241

Query  1204  -DLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
              DLGS+GFGDLLACIR+KNIPL  +HFVT+RNNLNKI+ATAYIR+EPWEMGVHKR GVVY
Sbjct  242   ADLGSEGFGDLLACIRDKNIPLQNIHFVTFRNNLNKILATAYIRHEPWEMGVHKRNGVVY  301

Query  1027  LDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGA  848
             LDVHKLPERP+S+LDRRRCY GYCFESLATEDP R+DG+ IH +DAN E+CAVIKTK+GA
Sbjct  302   LDVHKLPERPQSDLDRRRCYVGYCFESLATEDPNRADGEGIHHVDANAEFCAVIKTKLGA  361

Query  847   HRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYI  668
             HRILMGAEMDCCDS ++G+RFYVELKTS E L++ TEE FEREKLLKFWIQSFLAGVPYI
Sbjct  362   HRILMGAEMDCCDSTNEGKRFYVELKTSCE-LNYHTEERFEREKLLKFWIQSFLAGVPYI  420

Query  667   VVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYIL  488
             V+GFRDD GRLVRTERLRT +ITQRVKMK+YWQGGVCLAFADEVLCWLYGTVKE EDYIL
Sbjct  421   VIGFRDDAGRLVRTERLRTKDITQRVKMKNYWQGGVCLAFADEVLCWLYGTVKEGEDYIL  480

Query  487   QFTPHSNRLELLRGPSCPDAITHHVQ  410
             QF P  NRLELL+  SCPD IT H++
Sbjct  481   QFAPPFNRLELLQAQSCPDVITSHLE  506



>ref|XP_010941024.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic [Elaeis 
guineensis]
Length=513

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/414 (76%), Positives = 356/414 (86%), Gaps = 9/414 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnG----ILPSPNYPPRQN  1457
             NEEY++TPA S +PVPVLPP+++TNN  RG FGRGRWQ+G  N     +LP P YP RQN
Sbjct  99    NEEYMRTPARSRFPVPVLPPLQSTNNHGRGNFGRGRWQSGYSNDRGPPLLPRPGYPQRQN  158

Query  1456  YGYGR---GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
             +GYGR    N   DERFVSE+K  KSEETL+RK+ AIQEPCE+ACYSRV+ GDVYFDDRS
Sbjct  159   FGYGRFSHANGRNDERFVSEMKLTKSEETLSRKAIAIQEPCEIACYSRVEGGDVYFDDRS  218

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
             LRLFKR I +D+G+DLN+GF++F EKRDLGS+GFGDLLACIRNKNIPL  +HFVT+RNNL
Sbjct  219   LRLFKRSICQDVGADLNQGFESFVEKRDLGSEGFGDLLACIRNKNIPLQNIHFVTFRNNL  278

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+AT YIRNEPW+MGVHKR GVVYLDVHKLPERP+SE+DRRRCYWGY FE+LATE+  
Sbjct  279   NKILATTYIRNEPWKMGVHKRNGVVYLDVHKLPERPQSEVDRRRCYWGYAFENLATENSR  338

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDH  746
               D +    IDANVE+C+VIKTK+GAHRI+MGAEMDCCDS DDGRRFYVELKTSRE LD 
Sbjct  339   EIDANG-KGIDANVEFCSVIKTKLGAHRIIMGAEMDCCDSTDDGRRFYVELKTSRE-LDF  396

Query  745   RTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQG  566
             RTEE +EREKLLKFWIQSFLAGVPYIV+GFRDD G LVRTERLRT +ITQRVKMK+YWQG
Sbjct  397   RTEERYEREKLLKFWIQSFLAGVPYIVIGFRDDAGVLVRTERLRTKDITQRVKMKNYWQG  456

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             GVCLAFADEVLCWLYGTVKENEDY+LQF P  +RLELLR  SCPD +T HV QL
Sbjct  457   GVCLAFADEVLCWLYGTVKENEDYVLQFLPPFHRLELLRAQSCPDIVTQHVGQL  510



>ref|XP_006440154.1| hypothetical protein CICLE_v10019303mg [Citrus clementina]
 gb|ESR53394.1| hypothetical protein CICLE_v10019303mg [Citrus clementina]
Length=626

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/416 (76%), Positives = 350/416 (84%), Gaps = 8/416 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrw--qngrgnGILPSPNYPPRQNYG  1451
             NE Y +T A S YP+PVLP VRN NN    G         +  G GILP P YPPRQ  G
Sbjct  213   NEAYCRTSAISPYPIPVLPVVRNNNNHGGRGGFGRGRWPNDRGGVGILPRPGYPPRQG-G  271

Query  1450  YGRG----NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSL  1283
             YG G    N  +DERFVSE K ++SEETL+RK  A QEPCELA YSRV+ GDVYFDDRSL
Sbjct  272   YGHGSRFSNGRQDERFVSEFKLSRSEETLSRKVVAFQEPCELAQYSRVEGGDVYFDDRSL  331

Query  1282  RLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLN  1103
             RLFKRLI+ED+G+DLNEGFDTF EK++LGS+GFGDLL+CIRN+NIPL  MHFVT+RNNLN
Sbjct  332   RLFKRLISEDVGADLNEGFDTFIEKKELGSEGFGDLLSCIRNRNIPLQNMHFVTFRNNLN  391

Query  1102  KIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGR  923
             KI+ATAYIRNE W MGVHKR GVVYLDVHK+ ERPKSELDRRRCYWGYCFESLATEDP R
Sbjct  392   KILATAYIRNEAWAMGVHKRNGVVYLDVHKVQERPKSELDRRRCYWGYCFESLATEDPRR  451

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
             +DG+ IH IDANVE+CAV+KTK+GAHR+LMGAEMDCCDS DDGRRFYVELKTSRE LD+ 
Sbjct  452   ADGEGIHHIDANVEFCAVMKTKLGAHRLLMGAEMDCCDSTDDGRRFYVELKTSRE-LDYH  510

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
             TEE FEREKLLKFWIQSFLAGVP+IVVGFRDD GRLVRTERLRT +IT RVKMK+YWQGG
Sbjct  511   TEERFEREKLLKFWIQSFLAGVPFIVVGFRDDAGRLVRTERLRTKDITHRVKMKNYWQGG  570

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLESF  395
             VCLAFADEVLCWLYGTVKENEDY L F P SNRLELL+  SCP++IT HV+QL++ 
Sbjct  571   VCLAFADEVLCWLYGTVKENEDYTLHFNPPSNRLELLQASSCPESITCHVEQLQNI  626



>ref|XP_010677172.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=525

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/367 (81%), Positives = 328/367 (89%), Gaps = 4/367 (1%)
 Frame = -2

Query  1492  ILPSPNYPPRQNYGYGRGNAP--RDERFVSELKFAKSEETLARKSTAIQEPCELACYSRV  1319
             ILP P YPPRQNYG+     P  RDERFVSELKFAKSEETL+RK+   QEPCELACYSRV
Sbjct  160   ILPRPGYPPRQNYGFNPRFPPVVRDERFVSELKFAKSEETLSRKAVQFQEPCELACYSRV  219

Query  1318  QDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLD  1139
             + G+V+FDDRSLRLFKRLI+ED+G+DLNEGFDTF+EK+DLGSQGFGDLLACIR K IPL 
Sbjct  220   EGGEVFFDDRSLRLFKRLISEDVGADLNEGFDTFSEKKDLGSQGFGDLLACIRQKRIPLQ  279

Query  1138  RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGY  959
              MHFVTYRNNLNKI+ATAYIRNEPWEMGVHKRKGVVYLDVHKLPERP++E+DRRRCYWGY
Sbjct  280   NMHFVTYRNNLNKILATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPQTEMDRRRCYWGY  339

Query  958   CFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYV  779
             CFE+LATEDP R  G+ IH IDANVEYCAVIKTK+GAHRILMGAEMDCCDS DDGRRFYV
Sbjct  340   CFETLATEDPRRDGGEGIHHIDANVEYCAVIKTKLGAHRILMGAEMDCCDSTDDGRRFYV  399

Query  778   ELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEIT  599
             ELKTSRE L++ TEE +EREKLLKFWIQSFLAGVPYIVVGFRDD+GRLVRTER+RT +I 
Sbjct  400   ELKTSRE-LEYHTEERYEREKLLKFWIQSFLAGVPYIVVGFRDDSGRLVRTERMRTKDIN  458

Query  598   QRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRG-PSCPDAIT  422
             QRVKMK+YWQGGVCLAFADEVLCWLYGTVKENEDYILQF     RLELL+   SCPD I 
Sbjct  459   QRVKMKNYWQGGVCLAFADEVLCWLYGTVKENEDYILQFAAPFTRLELLQANNSCPDVIA  518

Query  421   HHVQQLE  401
             HH++ L+
Sbjct  519   HHLELLQ  525



>ref|XP_003539118.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
isoformX1 [Glycine max]
Length=507

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/446 (72%), Positives = 370/446 (83%), Gaps = 10/446 (2%)
 Frame = -2

Query  1732  EDDNGEVRSSLNSNINSHSKYGNEdddsdkdlfgsDNEEYVKTPATSTYPVPVLPPVRNT  1553
             +D+NG+V  S     + H  Y ++D           NE+Y KT A S YP+PVLP +RN 
Sbjct  69    DDENGDVVDSTKVRAHHHHDYEDKDLFGSD------NEDYCKTLARSPYPIPVLPAIRNV  122

Query  1552  NNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGYGR--GNAPRDERFVSELKFAKSEE  1382
             +N  RGGFGRGRWQN RG G+LP P  YP RQN+GYG    +   DERFVSELK +KSEE
Sbjct  123   HNQGRGGFGRGRWQNDRGAGLLPRPGPYPQRQNFGYGNRFQDGRHDERFVSELKLSKSEE  182

Query  1381  TLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRD  1202
             TL+RK  A QEPCE+ACYSR +  +VYFDDRSLRLFKR ITED+G+DLNEG+DT+  K+D
Sbjct  183   TLSRKCIAFQEPCEVACYSRAEGREVYFDDRSLRLFKRHITEDVGADLNEGYDTYIPKKD  242

Query  1201  LGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLD  1022
             LGSQGFGDLLACIR+KNIPL  +HFVT+RNNLNKI+ATAYIR+EPWEMGVHKR GVVYLD
Sbjct  243   LGSQGFGDLLACIRDKNIPLQNIHFVTFRNNLNKILATAYIRHEPWEMGVHKRNGVVYLD  302

Query  1021  VHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHR  842
             VHKLPE+P+S+LDRRRCY GYCFESLATEDP R+DG+ IH +DANVE+CAVIKTK+GAHR
Sbjct  303   VHKLPEKPQSDLDRRRCYVGYCFESLATEDPNRADGEGIHHVDANVEFCAVIKTKLGAHR  362

Query  841   ILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVV  662
             ILMGAEMDCCDS ++G+RFYVELKTS E L++ TEE FEREKLLKFWIQSFLAGVPYIV+
Sbjct  363   ILMGAEMDCCDSTNEGKRFYVELKTSCE-LNYHTEERFEREKLLKFWIQSFLAGVPYIVI  421

Query  661   GFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQF  482
             GFRDD GRLVRTERLRT +ITQRVKMK+YWQGGVCLAFADEVLCWLYGTVKE EDYILQF
Sbjct  422   GFRDDAGRLVRTERLRTKDITQRVKMKNYWQGGVCLAFADEVLCWLYGTVKEGEDYILQF  481

Query  481   TPHSNRLELLRGPSCPDAITHHVQQL  404
              P  NRLELL+  SCPD IT H++ L
Sbjct  482   APPFNRLELLQSQSCPDVITSHLELL  507



>emb|CBI33989.3| unnamed protein product [Vitis vinifera]
Length=403

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/365 (82%), Positives = 328/365 (90%), Gaps = 3/365 (1%)
 Frame = -2

Query  1492  ILPSPN-YPPRQNYGYG-RGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRV  1319
             ILP P  YP R NYGYG + N   DERFVSELK +KSEETL+RK  A QEPCELACYSRV
Sbjct  40    ILPRPGPYPQRHNYGYGSKFNNRHDERFVSELKLSKSEETLSRKCIAFQEPCELACYSRV  99

Query  1318  QDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLD  1139
             + GDV FDDRSLRLFKRLITED+G+DLNEG+DTF EK+DLGS+GFGDLLA IRN+NIPL 
Sbjct  100   EGGDVCFDDRSLRLFKRLITEDVGADLNEGYDTFIEKKDLGSEGFGDLLAAIRNRNIPLG  159

Query  1138  RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGY  959
              +HFVT+RNNLNKI+ATAYIR+EPWEMGVHKR GVVYLDVHKLPERP+S+LDRRRCYWGY
Sbjct  160   NIHFVTFRNNLNKILATAYIRHEPWEMGVHKRNGVVYLDVHKLPERPQSDLDRRRCYWGY  219

Query  958   CFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYV  779
             CFESLATEDP R+DG+ IH IDAN EYC+VIKTK+GAHRILMGAEMDCCDS DDGRRFYV
Sbjct  220   CFESLATEDPRRADGEGIHHIDANAEYCSVIKTKLGAHRILMGAEMDCCDSTDDGRRFYV  279

Query  778   ELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEIT  599
             ELKTSRE LD+ TEE +EREKLLKFWIQSFLAGVPYIV+GFRDD GRLVRTERLRT +IT
Sbjct  280   ELKTSRE-LDYHTEERYEREKLLKFWIQSFLAGVPYIVIGFRDDGGRLVRTERLRTKDIT  338

Query  598   QRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITH  419
             QRVKMK+YWQGGVCLAFADEVLCWLYGTVKENEDYILQF P   RLELL+  SCPDAI++
Sbjct  339   QRVKMKNYWQGGVCLAFADEVLCWLYGTVKENEDYILQFAPPFTRLELLQAQSCPDAISN  398

Query  418   HVQQL  404
             HVQQL
Sbjct  399   HVQQL  403



>ref|XP_008465903.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic isoform 
X2 [Cucumis melo]
 ref|XP_008465904.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic isoform 
X2 [Cucumis melo]
Length=517

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/414 (77%), Positives = 352/414 (85%), Gaps = 8/414 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrg--rwqngrgnGILPSPN-YPPRQNY  1454
             NE+Y KT A S + VPVLP +RN N+  RG FGRG    QN RG+G+LP P  YP R  +
Sbjct  105   NEDYCKTLAVSPFSVPVLPAIRNNNHHARGTFGRGRWGNQNDRGSGLLPRPGPYPQRHGF  164

Query  1453  G-YGR---GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
             G YG         DERFVS++K  KSEETLARK  A QEPCELACYSRV+ GDVYFDDRS
Sbjct  165   GGYGSKFSNGRHHDERFVSDMKLTKSEETLARKCIAFQEPCELACYSRVEGGDVYFDDRS  224

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
             LRLFKR ITEDIG+DLNEGFDTF EK+DLGSQGFGDLL CIR+KNIPL  +HFVT+RNNL
Sbjct  225   LRLFKRFITEDIGADLNEGFDTFIEKKDLGSQGFGDLLGCIRDKNIPLQNIHFVTFRNNL  284

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+ATAYIR+EPWEMGVHKR GVVYLDVHKLPERP+SE++RRRCYWGYCFE+LATEDP 
Sbjct  285   NKILATAYIRHEPWEMGVHKRNGVVYLDVHKLPERPQSEMERRRCYWGYCFENLATEDPR  344

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDH  746
             R +G+ IH +DAN EYCAVIKTK+GAHRILMGAEMDCCDS D+GRRFYVELKTSRE LD 
Sbjct  345   RGNGEGIHHVDANAEYCAVIKTKLGAHRILMGAEMDCCDSTDEGRRFYVELKTSRE-LDQ  403

Query  745   RTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQG  566
             RTEE +EREKLLKFWIQSFLAGVPYIV+GFR+D G+LVRTERLRT +ITQRVKMK+YWQG
Sbjct  404   RTEERYEREKLLKFWIQSFLAGVPYIVIGFRNDAGQLVRTERLRTKDITQRVKMKNYWQG  463

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             GVCLAFADEVLCWLYGTVKENEDYILQF     RLELL+  SCPDAITHH++ L
Sbjct  464   GVCLAFADEVLCWLYGTVKENEDYILQFAHPFTRLELLQASSCPDAITHHIELL  517



>ref|XP_010677170.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010677171.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=549

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/367 (81%), Positives = 328/367 (89%), Gaps = 4/367 (1%)
 Frame = -2

Query  1492  ILPSPNYPPRQNYGYGRGNAP--RDERFVSELKFAKSEETLARKSTAIQEPCELACYSRV  1319
             ILP P YPPRQNYG+     P  RDERFVSELKFAKSEETL+RK+   QEPCELACYSRV
Sbjct  184   ILPRPGYPPRQNYGFNPRFPPVVRDERFVSELKFAKSEETLSRKAVQFQEPCELACYSRV  243

Query  1318  QDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLD  1139
             + G+V+FDDRSLRLFKRLI+ED+G+DLNEGFDTF+EK+DLGSQGFGDLLACIR K IPL 
Sbjct  244   EGGEVFFDDRSLRLFKRLISEDVGADLNEGFDTFSEKKDLGSQGFGDLLACIRQKRIPLQ  303

Query  1138  RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGY  959
              MHFVTYRNNLNKI+ATAYIRNEPWEMGVHKRKGVVYLDVHKLPERP++E+DRRRCYWGY
Sbjct  304   NMHFVTYRNNLNKILATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPQTEMDRRRCYWGY  363

Query  958   CFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYV  779
             CFE+LATEDP R  G+ IH IDANVEYCAVIKTK+GAHRILMGAEMDCCDS DDGRRFYV
Sbjct  364   CFETLATEDPRRDGGEGIHHIDANVEYCAVIKTKLGAHRILMGAEMDCCDSTDDGRRFYV  423

Query  778   ELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEIT  599
             ELKTSRE L++ TEE +EREKLLKFWIQSFLAGVPYIVVGFRDD+GRLVRTER+RT +I 
Sbjct  424   ELKTSRE-LEYHTEERYEREKLLKFWIQSFLAGVPYIVVGFRDDSGRLVRTERMRTKDIN  482

Query  598   QRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRG-PSCPDAIT  422
             QRVKMK+YWQGGVCLAFADEVLCWLYGTVKENEDYILQF     RLELL+   SCPD I 
Sbjct  483   QRVKMKNYWQGGVCLAFADEVLCWLYGTVKENEDYILQFAAPFTRLELLQANNSCPDVIA  542

Query  421   HHVQQLE  401
             HH++ L+
Sbjct  543   HHLELLQ  549



>ref|XP_004148366.1| PREDICTED: protein Dom3z homolog, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004162413.1| PREDICTED: protein Dom3z homolog, chloroplastic-like [Cucumis 
sativus]
Length=519

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/414 (76%), Positives = 351/414 (85%), Gaps = 8/414 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrg--rwqngrgnGILPSPN-YPPRQNY  1454
             NE+Y KT A S + VPVLP +RN N+  RG FGRG    QN RG+G+LP P  YP R  +
Sbjct  107   NEDYCKTLAVSPFSVPVLPAIRNNNHHARGTFGRGRWGNQNDRGSGLLPRPGPYPQRHGF  166

Query  1453  G-YGR---GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
             G YG         DERFVS++K  KSEETLARK    QEPCELACYSRV+ GDVYFDDRS
Sbjct  167   GGYGSKFSNGRHHDERFVSDMKLTKSEETLARKCITFQEPCELACYSRVEGGDVYFDDRS  226

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
             LRLFKR ITEDIG+DLNEGFDTF EK+DLGSQGFGDLL CIR+KNIPL  +HFVT+RNNL
Sbjct  227   LRLFKRFITEDIGADLNEGFDTFIEKKDLGSQGFGDLLGCIRDKNIPLQNIHFVTFRNNL  286

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+ATAYIR+EPWEMGVHKR GVVYLDVHKLPERP+SE++RRRCYWGYCFE+LATEDP 
Sbjct  287   NKILATAYIRHEPWEMGVHKRNGVVYLDVHKLPERPQSEMERRRCYWGYCFENLATEDPR  346

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDH  746
             R +G+ IH +DAN EYCAVIKTK+GAHRILMGAEMDCCDS D+GRRFYVELKTSRE LD 
Sbjct  347   RGNGEGIHHVDANAEYCAVIKTKLGAHRILMGAEMDCCDSTDEGRRFYVELKTSRE-LDQ  405

Query  745   RTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQG  566
             RTEE +EREKLLKFWIQSFLAGVPYIV+GFR+D G+LVRTERLRT +ITQRVKMK+YWQG
Sbjct  406   RTEERYEREKLLKFWIQSFLAGVPYIVIGFRNDAGQLVRTERLRTKDITQRVKMKNYWQG  465

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             GVCLAFADEVLCWLYGTVKENEDYILQF     RLELL+  SCPDAITHH++ L
Sbjct  466   GVCLAFADEVLCWLYGTVKENEDYILQFAHPFTRLELLQASSCPDAITHHIELL  519



>ref|XP_008465900.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic isoform 
X1 [Cucumis melo]
 ref|XP_008465901.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic isoform 
X1 [Cucumis melo]
 ref|XP_008465902.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic isoform 
X1 [Cucumis melo]
Length=524

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/420 (75%), Positives = 353/420 (84%), Gaps = 13/420 (3%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrg--rwqngrgnGILPSPN-YPPRQNY  1454
             NE+Y KT A S + VPVLP +RN N+  RG FGRG    QN RG+G+LP P  YP R  +
Sbjct  105   NEDYCKTLAVSPFSVPVLPAIRNNNHHARGTFGRGRWGNQNDRGSGLLPRPGPYPQRHGF  164

Query  1453  G-YGR---GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
             G YG         DERFVS++K  KSEETLARK  A QEPCELACYSRV+ GDVYFDDRS
Sbjct  165   GGYGSKFSNGRHHDERFVSDMKLTKSEETLARKCIAFQEPCELACYSRVEGGDVYFDDRS  224

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
             LRLFKR ITEDIG+DLNEGFDTF EK+DLGSQGFGDLL CIR+KNIPL  +HFVT+RNNL
Sbjct  225   LRLFKRFITEDIGADLNEGFDTFIEKKDLGSQGFGDLLGCIRDKNIPLQNIHFVTFRNNL  284

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+ATAYIR+EPWEMGVHKR GVVYLDVHKLPERP+SE++RRRCYWGYCFE+LATEDP 
Sbjct  285   NKILATAYIRHEPWEMGVHKRNGVVYLDVHKLPERPQSEMERRRCYWGYCFENLATEDPR  344

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRE----  758
             R +G+ IH +DAN EYCAVIKTK+GAHRILMGAEMDCCDS D+GRRFYVELKTSRE    
Sbjct  345   RGNGEGIHHVDANAEYCAVIKTKLGAHRILMGAEMDCCDSTDEGRRFYVELKTSREVDSN  404

Query  757   --LLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM  584
               +LD RTEE +EREKLLKFWIQSFLAGVPYIV+GFR+D G+LVRTERLRT +ITQRVKM
Sbjct  405   ETILDQRTEERYEREKLLKFWIQSFLAGVPYIVIGFRNDAGQLVRTERLRTKDITQRVKM  464

Query  583   KSYWQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             K+YWQGGVCLAFADEVLCWLYGTVKENEDYILQF     RLELL+  SCPDAITHH++ L
Sbjct  465   KNYWQGGVCLAFADEVLCWLYGTVKENEDYILQFAHPFTRLELLQASSCPDAITHHIELL  524



>ref|XP_008363758.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
[Malus domestica]
Length=529

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/413 (77%), Positives = 353/413 (85%), Gaps = 7/413 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngr----gnGILPSPN-YPPRQ  1460
             NE+Y KTPATS +P+PVLP +R+TNN  RG  GRGR Q+GR    G GIL     +  RQ
Sbjct  118   NEDYCKTPATSPFPIPVLPVIRSTNNQGRGNPGRGRRQSGRPNDRGAGILGRGGPFQQRQ  177

Query  1459  NYGYGRGNAPRDERFVSELKF-AKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSL  1283
             N+GYG  N  RDERF+SELK  +KSEETL+RK+ A QEPCELACYSRV+ GDV FDD SL
Sbjct  178   NFGYGGSNGYRDERFISELKLLSKSEETLSRKAVAFQEPCELACYSRVEGGDVSFDDTSL  237

Query  1282  RLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLN  1103
             RLFKRLITE+IG DLNEG+DTF  K+DLGSQGFGDLLACIR+KNIPL  +HFVTYRNNLN
Sbjct  238   RLFKRLITEEIGRDLNEGYDTFIAKKDLGSQGFGDLLACIRDKNIPLQNIHFVTYRNNLN  297

Query  1102  KIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGR  923
             KI+AT Y + +PWEMGVHKR GVVYLDVHKLPERP++ELDRRRCYWGYCFESLATEDPGR
Sbjct  298   KILATFYNQRDPWEMGVHKRNGVVYLDVHKLPERPQTELDRRRCYWGYCFESLATEDPGR  357

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
              DG  IH +DANVEYC+VIKTK+GAHRILMGAEMDCCDS DDGRRFYVELKTS EL +H+
Sbjct  358   GDGP-IHHVDANVEYCSVIKTKLGAHRILMGAEMDCCDSTDDGRRFYVELKTSHELDNHK  416

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
              E  FE+EKLLKFWIQSFLAGVPYIV+GFR+D G+LVRTERLRT +IT RVKMK+YWQGG
Sbjct  417   IEYEFEKEKLLKFWIQSFLAGVPYIVIGFRNDAGQLVRTERLRTKDITHRVKMKNYWQGG  476

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             VCLAFADEVLCWLYGTVKENEDYILQFT    RLELL+  SCP+ IT+HVQQL
Sbjct  477   VCLAFADEVLCWLYGTVKENEDYILQFTHPFQRLELLQAQSCPEEITNHVQQL  529



>ref|XP_006590587.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
isoform X2 [Glycine max]
Length=508

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/447 (72%), Positives = 370/447 (83%), Gaps = 11/447 (2%)
 Frame = -2

Query  1732  EDDNGEVRSSLNSNINSHSKYGNEdddsdkdlfgsDNEEYVKTPATSTYPVPVLPPVRNT  1553
             +D+NG+V  S     + H  Y ++D           NE+Y KT A S YP+PVLP +RN 
Sbjct  69    DDENGDVVDSTKVRAHHHHDYEDKDLFGSD------NEDYCKTLARSPYPIPVLPAIRNV  122

Query  1552  NNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGYGR--GNAPRDERFVSELKFAKSEE  1382
             +N  RGGFGRGRWQN RG G+LP P  YP RQN+GYG    +   DERFVSELK +KSEE
Sbjct  123   HNQGRGGFGRGRWQNDRGAGLLPRPGPYPQRQNFGYGNRFQDGRHDERFVSELKLSKSEE  182

Query  1381  TLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKR-  1205
             TL+RK  A QEPCE+ACYSR +  +VYFDDRSLRLFKR ITED+G+DLNEG+DT+  K+ 
Sbjct  183   TLSRKCIAFQEPCEVACYSRAEGREVYFDDRSLRLFKRHITEDVGADLNEGYDTYIPKKA  242

Query  1204  DLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYL  1025
             DLGSQGFGDLLACIR+KNIPL  +HFVT+RNNLNKI+ATAYIR+EPWEMGVHKR GVVYL
Sbjct  243   DLGSQGFGDLLACIRDKNIPLQNIHFVTFRNNLNKILATAYIRHEPWEMGVHKRNGVVYL  302

Query  1024  DVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAH  845
             DVHKLPE+P+S+LDRRRCY GYCFESLATEDP R+DG+ IH +DANVE+CAVIKTK+GAH
Sbjct  303   DVHKLPEKPQSDLDRRRCYVGYCFESLATEDPNRADGEGIHHVDANVEFCAVIKTKLGAH  362

Query  844   RILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIV  665
             RILMGAEMDCCDS ++G+RFYVELKTS E L++ TEE FEREKLLKFWIQSFLAGVPYIV
Sbjct  363   RILMGAEMDCCDSTNEGKRFYVELKTSCE-LNYHTEERFEREKLLKFWIQSFLAGVPYIV  421

Query  664   VGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQ  485
             +GFRDD GRLVRTERLRT +ITQRVKMK+YWQGGVCLAFADEVLCWLYGTVKE EDYILQ
Sbjct  422   IGFRDDAGRLVRTERLRTKDITQRVKMKNYWQGGVCLAFADEVLCWLYGTVKEGEDYILQ  481

Query  484   FTPHSNRLELLRGPSCPDAITHHVQQL  404
             F P  NRLELL+  SCPD IT H++ L
Sbjct  482   FAPPFNRLELLQSQSCPDVITSHLELL  508



>ref|XP_009371846.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic [Pyrus 
x bretschneideri]
Length=526

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/413 (75%), Positives = 347/413 (84%), Gaps = 7/413 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNP----TrggfgrgrwqngrgnGILPSPN-YPPRQ  1460
             NE+Y KTPATS +P+PVLP +RNTNN     +  G       N RG GIL     +  RQ
Sbjct  115   NEDYCKTPATSPFPIPVLPVIRNTNNQGRGNSGRGRWPSGRPNDRGAGILGRGGPFQQRQ  174

Query  1459  NYGYGRGNAPRDERFVSELKF-AKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSL  1283
             N+GYG  N  RDERFVSEL+  +KSEETL+RK+ A QEPCELACYSRV+ GDV FD+ SL
Sbjct  175   NFGYGGSNGYRDERFVSELRLLSKSEETLSRKAVAFQEPCELACYSRVEGGDVSFDETSL  234

Query  1282  RLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLN  1103
             RLFKRLITE+IG DLNEG+DTF  K+DLGSQGFGDLL CIR+KNIPL  +HFVTYRNNLN
Sbjct  235   RLFKRLITEEIGRDLNEGYDTFIAKKDLGSQGFGDLLDCIRDKNIPLQNIHFVTYRNNLN  294

Query  1102  KIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGR  923
             KI+AT Y + +PWEMGVHKR GVVYLDVHKLPERP++ELDRRRCYWGYCFESLATEDPGR
Sbjct  295   KILATFYNKRDPWEMGVHKRNGVVYLDVHKLPERPQTELDRRRCYWGYCFESLATEDPGR  354

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
              DG  IH +DANVEYC+VIKTK+GAHRILMGAEMDCCDS DDGRRFYVELKTS EL +H+
Sbjct  355   GDGG-IHHVDANVEYCSVIKTKLGAHRILMGAEMDCCDSTDDGRRFYVELKTSHELDNHK  413

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
              E  FE+EKLLKFWIQSFLAGVPYIV+GFR+D G+LVRTERLRT +ITQRVKMK+YWQGG
Sbjct  414   IEYEFEKEKLLKFWIQSFLAGVPYIVIGFRNDAGQLVRTERLRTKDITQRVKMKNYWQGG  473

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             VCLAFADEVLCWLYGTVK+NEDYILQFT    RLELL+  SCP+ IT+HVQQL
Sbjct  474   VCLAFADEVLCWLYGTVKDNEDYILQFTHPYQRLELLQAQSCPEEITNHVQQL  526



>ref|XP_007156600.1| hypothetical protein PHAVU_002G002400g [Phaseolus vulgaris]
 gb|ESW28594.1| hypothetical protein PHAVU_002G002400g [Phaseolus vulgaris]
Length=509

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/414 (75%), Positives = 356/414 (86%), Gaps = 8/414 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfg----rgrwqngrgnGILPSPN-YPPRQ  1460
             NE+Y KT A S YP+PVLP  RN NN  RGGFG    +  +QN RG G+LP P  YP RQ
Sbjct  97    NEDYCKTLARSPYPIPVLPATRNANNQGRGGFGRGRWQQGYQNDRGAGLLPRPGPYPQRQ  156

Query  1459  NYGYGR--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
             N+GYG    N   DERFVSELK +KSEETL+RK  A QEPCE+ACYSRV+ G+V+FDDRS
Sbjct  157   NFGYGNRFQNGRHDERFVSELKLSKSEETLSRKCIAFQEPCEIACYSRVEGGEVFFDDRS  216

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
             LRLFKR ITED+G+DLNEG+DTF  K+DLGS+GFGDLLACIR+KN+PL  +HFVT+RNNL
Sbjct  217   LRLFKRHITEDVGADLNEGYDTFIPKKDLGSEGFGDLLACIRDKNVPLQNIHFVTFRNNL  276

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+ATAYIR+EPWEMGVHKR GVVYLDVHKLPERP+S+LDRRRCY GYCFESLATEDP 
Sbjct  277   NKILATAYIRHEPWEMGVHKRNGVVYLDVHKLPERPQSDLDRRRCYVGYCFESLATEDPR  336

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDH  746
             R+DG+ IH +DANVE+C+VIKTK+GAHRILMGAEMDCCDS ++G+RFYVELKTS E L++
Sbjct  337   RADGEGIHHVDANVEFCSVIKTKLGAHRILMGAEMDCCDSTNEGKRFYVELKTSCE-LNY  395

Query  745   RTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQG  566
              +EE FEREKLLKFWIQSFLAGVPYIV+GFRDD GRLVRTERLRT +ITQRVKMK+YWQG
Sbjct  396   HSEERFEREKLLKFWIQSFLAGVPYIVIGFRDDAGRLVRTERLRTKDITQRVKMKNYWQG  455

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             GVCLAFADEVLCWLYGTVKE+EDYILQF P  NRLELL+G SCPD I  H++ L
Sbjct  456   GVCLAFADEVLCWLYGTVKEDEDYILQFAPPFNRLELLQGQSCPDVIISHLELL  509



>ref|XP_008345311.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
[Malus domestica]
Length=529

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/413 (76%), Positives = 351/413 (85%), Gaps = 7/413 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngr----gnGILPSPN-YPPRQ  1460
             NE+Y KTPATS +P+PVLP +R+TNN  RG  GRGR Q+GR    G GIL     +  RQ
Sbjct  118   NEDYCKTPATSPFPIPVLPVIRSTNNQGRGNPGRGRRQSGRPNDRGAGILGRGGPFQQRQ  177

Query  1459  NYGYGRGNAPRDERFVSELKF-AKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSL  1283
             N+GYG  N  RDERF+SELK  +K EETL+RK+ A QEPCELACYSRV+ GDV FDD SL
Sbjct  178   NFGYGGSNGYRDERFISELKLLSKXEETLSRKAVAFQEPCELACYSRVEGGDVSFDDTSL  237

Query  1282  RLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLN  1103
             RLFKRLITE+IG DLNEG+DTF  K+DLGSQGFGDLLACIR+KNIPL  +HFVTYRNNLN
Sbjct  238   RLFKRLITEEIGRDLNEGYDTFIAKKDLGSQGFGDLLACIRDKNIPLQNIHFVTYRNNLN  297

Query  1102  KIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGR  923
             KI+AT Y + +PWEMGVHKR GVVYLDVHKLPERP++ELDRRRCYWGYCFESLATEDPGR
Sbjct  298   KILATFYNQRDPWEMGVHKRNGVVYLDVHKLPERPQTELDRRRCYWGYCFESLATEDPGR  357

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
              DG  IH +DANVEYC+VIKTK+GAHRILMGAEMDCCDS DDGRRFYVELKTS EL +H+
Sbjct  358   GDGP-IHHVDANVEYCSVIKTKLGAHRILMGAEMDCCDSTDDGRRFYVELKTSHELDNHK  416

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
              E  FE+EKLLKFWIQSFLAGVPYIV+GFR+D G+LVRTERLRT +IT RVKMK YWQGG
Sbjct  417   IEYEFEKEKLLKFWIQSFLAGVPYIVIGFRNDAGQLVRTERLRTKDITHRVKMKBYWQGG  476

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             VCLAFADEVLCWLYGTVKENEDYILQFT    RLELL+  SCP+ IT+HVQQL
Sbjct  477   VCLAFADEVLCWLYGTVKENEDYILQFTHPFQRLELLQAQSCPEEITNHVQQL  529



>gb|AES94359.2| Dom3z-like protein [Medicago truncatula]
Length=512

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/415 (76%), Positives = 353/415 (85%), Gaps = 9/415 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRN-TNNPTrggfgrgrwqngrg----nGILPSPN-YPPR  1463
             NE+Y KT A S YP+PVLPP+RN TNNP RGG GRGRWQ G+      GILP P  YP R
Sbjct  99    NEDYCKTLAKSPYPIPVLPPIRNNTNNPGRGGGGRGRWQQGQHNDRGAGILPRPGPYPQR  158

Query  1462  QNYGYGR--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDR  1289
             QN+GYG    N  RDERFVSE+K +KSEETL+RK  A QEPCELACYSR + G+VYFDDR
Sbjct  159   QNFGYGNRFQNGHRDERFVSEMKLSKSEETLSRKVIAFQEPCELACYSRAEGGEVYFDDR  218

Query  1288  SLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNN  1109
             SLRLFKR ITEDIG+DLNEG+DT+  K+DLGS+G+GDLLACIR+K I L  +HFVTYRNN
Sbjct  219   SLRLFKRHITEDIGADLNEGYDTYIPKKDLGSEGYGDLLACIRDKKIHLQNIHFVTYRNN  278

Query  1108  LNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDP  929
             LNKI+ATAYIR+EPWEMGVHKR GVVYLDVHKLPERP+S+LDRRRCY GY FESLATEDP
Sbjct  279   LNKILATAYIRHEPWEMGVHKRNGVVYLDVHKLPERPQSDLDRRRCYLGYSFESLATEDP  338

Query  928   GRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLD  749
              R+DG+ IHD+DANVE+C+VIKTK+GAHRILMGAEMDCCD+  DG+RFYVELKTS E L+
Sbjct  339   KRADGEPIHDVDANVEFCSVIKTKLGAHRILMGAEMDCCDTTTDGKRFYVELKTSYE-LN  397

Query  748   HRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQ  569
             +  EE FEREKLLKFWIQSFLAGVPYI +GFRDD GRLVRTE LRT +ITQR+KMK YWQ
Sbjct  398   YHNEEKFEREKLLKFWIQSFLAGVPYICIGFRDDAGRLVRTEMLRTKDITQRIKMKGYWQ  457

Query  568   GGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             GGVCLAFADEVLCWLYGTVKENEDYILQF P  NRLELL+  SCPD IT H++ L
Sbjct  458   GGVCLAFADEVLCWLYGTVKENEDYILQFAPPFNRLELLQAHSCPDVITSHLELL  512



>ref|XP_003611401.1| Dom3z-like protein [Medicago truncatula]
Length=517

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/419 (75%), Positives = 354/419 (84%), Gaps = 12/419 (3%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRN-TNNPTrggfgrgrwqngrg----nGILPSPN-YPPR  1463
             NE+Y KT A S YP+PVLPP+RN TNNP RGG GRGRWQ G+      GILP P  YP R
Sbjct  99    NEDYCKTLAKSPYPIPVLPPIRNNTNNPGRGGGGRGRWQQGQHNDRGAGILPRPGPYPQR  158

Query  1462  QNYGYGR--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDR  1289
             QN+GYG    N  RDERFVSE+K +KSEETL+RK  A QEPCELACYSR + G+VYFDDR
Sbjct  159   QNFGYGNRFQNGHRDERFVSEMKLSKSEETLSRKVIAFQEPCELACYSRAEGGEVYFDDR  218

Query  1288  SLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNN  1109
             SLRLFKR ITEDIG+DLNEG+DT+  K+DLGS+G+GDLLACIR+K I L  +HFVTYRNN
Sbjct  219   SLRLFKRHITEDIGADLNEGYDTYIPKKDLGSEGYGDLLACIRDKKIHLQNIHFVTYRNN  278

Query  1108  LNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDP  929
             LNKI+ATAYIR+EPWEMGVHKR GVVYLDVHKLPERP+S+LDRRRCY GY FESLATEDP
Sbjct  279   LNKILATAYIRHEPWEMGVHKRNGVVYLDVHKLPERPQSDLDRRRCYLGYSFESLATEDP  338

Query  928   GRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSREL--  755
              R+DG+ IHD+DANVE+C+VIKTK+GAHRILMGAEMDCCD+  DG+RFYVELKTS E+  
Sbjct  339   KRADGEPIHDVDANVEFCSVIKTKLGAHRILMGAEMDCCDTTTDGKRFYVELKTSYEVDI  398

Query  754   --LDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK  581
               L++  EE FEREKLLKFWIQSFLAGVPYI +GFRDD GRLVRTE LRT +ITQR+KMK
Sbjct  399   VTLNYHNEEKFEREKLLKFWIQSFLAGVPYICIGFRDDAGRLVRTEMLRTKDITQRIKMK  458

Query  580   SYWQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
              YWQGGVCLAFADEVLCWLYGTVKENEDYILQF P  NRLELL+  SCPD IT H++ L
Sbjct  459   GYWQGGVCLAFADEVLCWLYGTVKENEDYILQFAPPFNRLELLQAHSCPDVITSHLELL  517



>gb|KGN60454.1| hypothetical protein Csa_3G912370 [Cucumis sativus]
Length=591

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/414 (76%), Positives = 351/414 (85%), Gaps = 8/414 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrg--rwqngrgnGILPSPN-YPPRQNY  1454
             NE+Y KT A S + VPVLP +RN N+  RG FGRG    QN RG+G+LP P  YP R  +
Sbjct  179   NEDYCKTLAVSPFSVPVLPAIRNNNHHARGTFGRGRWGNQNDRGSGLLPRPGPYPQRHGF  238

Query  1453  G-YGR---GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
             G YG         DERFVS++K  KSEETLARK    QEPCELACYSRV+ GDVYFDDRS
Sbjct  239   GGYGSKFSNGRHHDERFVSDMKLTKSEETLARKCITFQEPCELACYSRVEGGDVYFDDRS  298

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
             LRLFKR ITEDIG+DLNEGFDTF EK+DLGSQGFGDLL CIR+KNIPL  +HFVT+RNNL
Sbjct  299   LRLFKRFITEDIGADLNEGFDTFIEKKDLGSQGFGDLLGCIRDKNIPLQNIHFVTFRNNL  358

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+ATAYIR+EPWEMGVHKR GVVYLDVHKLPERP+SE++RRRCYWGYCFE+LATEDP 
Sbjct  359   NKILATAYIRHEPWEMGVHKRNGVVYLDVHKLPERPQSEMERRRCYWGYCFENLATEDPR  418

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDH  746
             R +G+ IH +DAN EYCAVIKTK+GAHRILMGAEMDCCDS D+GRRFYVELKTSRE LD 
Sbjct  419   RGNGEGIHHVDANAEYCAVIKTKLGAHRILMGAEMDCCDSTDEGRRFYVELKTSRE-LDQ  477

Query  745   RTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQG  566
             RTEE +EREKLLKFWIQSFLAGVPYIV+GFR+D G+LVRTERLRT +ITQRVKMK+YWQG
Sbjct  478   RTEERYEREKLLKFWIQSFLAGVPYIVIGFRNDAGQLVRTERLRTKDITQRVKMKNYWQG  537

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             GVCLAFADEVLCWLYGTVKENEDYILQF     RLELL+  SCPDAITHH++ L
Sbjct  538   GVCLAFADEVLCWLYGTVKENEDYILQFAHPFTRLELLQASSCPDAITHHIELL  591



>ref|XP_004511747.1| PREDICTED: protein Dom3z homolog, chloroplastic-like [Cicer arietinum]
Length=513

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/416 (74%), Positives = 349/416 (84%), Gaps = 10/416 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfg------rgrwqngrgnGILPSPN-YPP  1466
             NE+Y KT A S +P+PVLP +RNTNN   G  G      +    N RG GILP P  YP 
Sbjct  99    NEDYCKTLAKSPHPIPVLPAIRNTNNHNPGRGGFGRGRWQQGHHNDRGAGILPRPGPYPQ  158

Query  1465  RQNYGYGR--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDD  1292
             RQN+GYG    N   DERFVSE+K  KSEETL+RKS A QEP E+ACYSRV+ G+VYFDD
Sbjct  159   RQNFGYGNRFQNGRHDERFVSEMKLTKSEETLSRKSIAFQEPREIACYSRVEGGEVYFDD  218

Query  1291  RSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRN  1112
             RSLRLFKR ITED+G+DLNEG+DT+  K+DLGS+GFGDLLACIR+KNIPL+ +HFVTYRN
Sbjct  219   RSLRLFKRHITEDVGADLNEGYDTYIPKKDLGSEGFGDLLACIRDKNIPLENIHFVTYRN  278

Query  1111  NLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATED  932
             NLNKI+ATAYIR+EPWEMGVHKR GVVYLDVHKLPERP+S+LDRRRCY GY FESLATED
Sbjct  279   NLNKILATAYIRHEPWEMGVHKRNGVVYLDVHKLPERPQSDLDRRRCYLGYSFESLATED  338

Query  931   PGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELL  752
             P R+DG+ IH +DANVE+C+VIKTK+GAHRILMGAEMDCCD+ +DG+R YVELKTS E L
Sbjct  339   PSRADGEGIHHVDANVEFCSVIKTKLGAHRILMGAEMDCCDTTNDGKRLYVELKTSYE-L  397

Query  751   DHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYW  572
             ++R EE FEREKLLKFWIQSFLAGVPYI++GFRDD GRLVRTE LRT +ITQRVKMK+YW
Sbjct  398   NYRNEEKFEREKLLKFWIQSFLAGVPYILIGFRDDAGRLVRTEMLRTKDITQRVKMKNYW  457

Query  571   QGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             QGGVCLAFADEVLCWLYGTVKENEDYILQF P  +RLELL+  SCPD IT H+  L
Sbjct  458   QGGVCLAFADEVLCWLYGTVKENEDYILQFAPPFHRLELLQAQSCPDVITSHLDLL  513



>ref|XP_010274528.1| PREDICTED: LOW QUALITY PROTEIN: decapping nuclease DXO homolog, 
chloroplastic [Nelumbo nucifera]
Length=447

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/402 (75%), Positives = 344/402 (86%), Gaps = 8/402 (2%)
 Frame = -2

Query  1588  YPVPVLPPVRNTNNPTrggfg----rgrwqngrgnGILPSP-NYPPRQNYGYGR--GNAP  1430
             Y VPVLPP+RN+NN TRG FG    +   QN RG+GILP P +Y  RQNYG+     N  
Sbjct  47    YLVPVLPPIRNSNNHTRGTFGRGRWQSGHQNDRGHGILPRPGSYHHRQNYGFRSRFSNGR  106

Query  1429  RDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDI  1250
             +DERFVSELK +KSEETL+RK  A QEPCE+ACYSRV+ GDVYFDDRSLRLFKRLITED+
Sbjct  107   QDERFVSELKLSKSEETLSRKCIAFQEPCEIACYSRVEGGDVYFDDRSLRLFKRLITEDV  166

Query  1249  GSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNE  1070
             G+DLNEGF++F EK+++   GFGDLL+CIR+KNIPL  +HFVT+RNNLNKI+ATAYIR+E
Sbjct  167   GADLNEGFESFVEKKEISCHGFGDLLSCIRDKNIPLQNIHFVTFRNNLNKILATAYIRHE  226

Query  1069  PWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDA  890
             PWEMGVHKR GVVYLDVH LPERP++ELDRRRCYWGYCFESLATED    DGD IH +DA
Sbjct  227   PWEMGVHKRNGVVYLDVHNLPERPRNELDRRRCYWGYCFESLATEDSRGPDGDGIHHLDA  286

Query  889   NVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLL  710
             NVE+C+VIKTK+GAHRI+MGAEMDCCDS D+GRRFY+ELKTSRE LD+ TE  +EREKLL
Sbjct  287   NVEFCSVIKTKLGAHRIIMGAEMDCCDSTDEGRRFYIELKTSRE-LDYHTEGRYEREKLL  345

Query  709   KFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLC  530
             KFWIQSFLAGVPYIV+GFRDD+GRLVRTERLRT +ITQ  KMK YWQGGVCLAF DEVLC
Sbjct  346   KFWIQSFLAGVPYIVIGFRDDSGRLVRTERLRTKDITQXNKMKGYWQGGVCLAFTDEVLC  405

Query  529   WLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             WLYGTVKENEDYILQF P  NRLELL+  SCPD IT H++QL
Sbjct  406   WLYGTVKENEDYILQFAPPFNRLELLQAQSCPDVITSHIEQL  447



>ref|XP_008803075.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic isoform 
X2 [Phoenix dactylifera]
Length=515

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/414 (76%), Positives = 357/414 (86%), Gaps = 9/414 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnG----ILPSPNYPPRQN  1457
             NEEY++TPA S +PVPVLPP+++TNN  RG FGRGRWQ+G  N     +LP P Y  RQN
Sbjct  99    NEEYMRTPARSPFPVPVLPPLQSTNNHGRGNFGRGRWQSGYPNDRGPPLLPRPGYMQRQN  158

Query  1456  YGYGR---GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
             +GYGR    N   DERFVSE+K  KSEETL+RK+ AIQEPCE+ACYSRV+ GDVYFDDRS
Sbjct  159   FGYGRFSHANGRNDERFVSEMKLTKSEETLSRKAIAIQEPCEIACYSRVEGGDVYFDDRS  218

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
             LRLFKR I +D+G+ LN+GF++F EKRDLGS+GFGDLLACIRNKNIPL  +HFVT+RNNL
Sbjct  219   LRLFKRSICQDVGAHLNQGFESFVEKRDLGSEGFGDLLACIRNKNIPLQNIHFVTFRNNL  278

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+ TAYIRNEPW+MGVHKR GVVYLDVHKLPERP+SE+DRRRCYWGY FE+LATE+  
Sbjct  279   NKILTTAYIRNEPWKMGVHKRNGVVYLDVHKLPERPQSEVDRRRCYWGYAFENLATENSR  338

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDH  746
               D D    IDANVE+C+VIKTK+GAHRI+MGAEMDCCDS DDGRRFYVELKTSRE LD+
Sbjct  339   EIDADG-KGIDANVEFCSVIKTKLGAHRIIMGAEMDCCDSTDDGRRFYVELKTSRE-LDY  396

Query  745   RTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQG  566
             RTEE +EREKLLKFWIQSFLAGVPYIV+GFR+D G LVRTERLRT +ITQRVKMK+YWQG
Sbjct  397   RTEERYEREKLLKFWIQSFLAGVPYIVIGFRNDAGILVRTERLRTKDITQRVKMKNYWQG  456

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             GVCLAFADEVLCWLYGTVKENEDY+LQF PH +RLELLR  SCPD IT HV+QL
Sbjct  457   GVCLAFADEVLCWLYGTVKENEDYVLQFVPHFHRLELLRAQSCPDVITQHVEQL  510



>ref|XP_008803074.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic isoform 
X1 [Phoenix dactylifera]
Length=523

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/414 (76%), Positives = 357/414 (86%), Gaps = 9/414 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnG----ILPSPNYPPRQN  1457
             NEEY++TPA S +PVPVLPP+++TNN  RG FGRGRWQ+G  N     +LP P Y  RQN
Sbjct  99    NEEYMRTPARSPFPVPVLPPLQSTNNHGRGNFGRGRWQSGYPNDRGPPLLPRPGYMQRQN  158

Query  1456  YGYGR---GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
             +GYGR    N   DERFVSE+K  KSEETL+RK+ AIQEPCE+ACYSRV+ GDVYFDDRS
Sbjct  159   FGYGRFSHANGRNDERFVSEMKLTKSEETLSRKAIAIQEPCEIACYSRVEGGDVYFDDRS  218

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
             LRLFKR I +D+G+ LN+GF++F EKRDLGS+GFGDLLACIRNKNIPL  +HFVT+RNNL
Sbjct  219   LRLFKRSICQDVGAHLNQGFESFVEKRDLGSEGFGDLLACIRNKNIPLQNIHFVTFRNNL  278

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+ TAYIRNEPW+MGVHKR GVVYLDVHKLPERP+SE+DRRRCYWGY FE+LATE+  
Sbjct  279   NKILTTAYIRNEPWKMGVHKRNGVVYLDVHKLPERPQSEVDRRRCYWGYAFENLATENSR  338

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDH  746
               D D    IDANVE+C+VIKTK+GAHRI+MGAEMDCCDS DDGRRFYVELKTSRE LD+
Sbjct  339   EIDADG-KGIDANVEFCSVIKTKLGAHRIIMGAEMDCCDSTDDGRRFYVELKTSRE-LDY  396

Query  745   RTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQG  566
             RTEE +EREKLLKFWIQSFLAGVPYIV+GFR+D G LVRTERLRT +ITQRVKMK+YWQG
Sbjct  397   RTEERYEREKLLKFWIQSFLAGVPYIVIGFRNDAGILVRTERLRTKDITQRVKMKNYWQG  456

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             GVCLAFADEVLCWLYGTVKENEDY+LQF PH +RLELLR  SCPD IT HV+QL
Sbjct  457   GVCLAFADEVLCWLYGTVKENEDYVLQFVPHFHRLELLRAQSCPDVITQHVEQL  510



>ref|XP_010518691.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=523

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/409 (71%), Positives = 335/409 (82%), Gaps = 6/409 (1%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgr--wqngrgnGILPSPN-YPPRQNY  1454
             NE+Y KTPA S+Y +PVLP   N N+    G            G G+LP P  YP RQ +
Sbjct  114   NEDYCKTPAISSYSIPVLPAQWNNNHHGGRGGPGRGRWQNGRGGAGLLPRPGPYPGRQGH  173

Query  1453  GYGR--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLR  1280
             G+G       RDERFVSELK +KS+ETLARKST  QEP ELACYSRV+ G+V+FD+R LR
Sbjct  174   GFGSRFQYYQRDERFVSELKLSKSKETLARKSTVFQEPIELACYSRVEGGEVFFDERGLR  233

Query  1279  LFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNK  1100
             LFKRLI+E++G+DLN+G+DTFT KRD+GS+GFGDLL CIR KNI L  +HFVT+RNNLNK
Sbjct  234   LFKRLISEEVGADLNQGYDTFTAKRDMGSEGFGDLLDCIRAKNITLGNIHFVTFRNNLNK  293

Query  1099  IMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRS  920
             I+  AY R+EPWEMGVHKR G +YLDVHKLPERP+++LDRRRCYWGYCFESL+TEDPGR+
Sbjct  294   ILGAAYNRHEPWEMGVHKRNGTIYLDVHKLPERPQTDLDRRRCYWGYCFESLSTEDPGRA  353

Query  919   DGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRT  740
              G+ I ++DANVEYC V KTK+GAHR+LMGAEMDCCDS D+GRRFYVELKTSRE LD RT
Sbjct  354   YGEEIQNVDANVEYCGVFKTKLGAHRVLMGAEMDCCDSTDEGRRFYVELKTSRE-LDDRT  412

Query  739   EEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGV  560
              E FER+KLLKFWIQSFLAGVPYIVVGFRDD GRLVRTERLRT +IT R ++K+YWQGGV
Sbjct  413   VERFERDKLLKFWIQSFLAGVPYIVVGFRDDGGRLVRTERLRTKDITHRARLKNYWQGGV  472

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHV  413
             CLAFADEVLCWLYGTVK+NEDYILQFT    RLELL+  SCPD IT+H+
Sbjct  473   CLAFADEVLCWLYGTVKDNEDYILQFTHPFTRLELLQAQSCPDVITNHL  521



>ref|XP_010518690.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=529

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/415 (70%), Positives = 335/415 (81%), Gaps = 12/415 (3%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgr--wqngrgnGILPSPN-YPPRQNY  1454
             NE+Y KTPA S+Y +PVLP   N N+    G            G G+LP P  YP RQ +
Sbjct  114   NEDYCKTPAISSYSIPVLPAQWNNNHHGGRGGPGRGRWQNGRGGAGLLPRPGPYPGRQGH  173

Query  1453  GYGR--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLR  1280
             G+G       RDERFVSELK +KS+ETLARKST  QEP ELACYSRV+ G+V+FD+R LR
Sbjct  174   GFGSRFQYYQRDERFVSELKLSKSKETLARKSTVFQEPIELACYSRVEGGEVFFDERGLR  233

Query  1279  LFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNK  1100
             LFKRLI+E++G+DLN+G+DTFT KRD+GS+GFGDLL CIR KNI L  +HFVT+RNNLNK
Sbjct  234   LFKRLISEEVGADLNQGYDTFTAKRDMGSEGFGDLLDCIRAKNITLGNIHFVTFRNNLNK  293

Query  1099  IMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRS  920
             I+  AY R+EPWEMGVHKR G +YLDVHKLPERP+++LDRRRCYWGYCFESL+TEDPGR+
Sbjct  294   ILGAAYNRHEPWEMGVHKRNGTIYLDVHKLPERPQTDLDRRRCYWGYCFESLSTEDPGRA  353

Query  919   DGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRT  740
              G+ I ++DANVEYC V KTK+GAHR+LMGAEMDCCDS D+GRRFYVELKTSRE LD RT
Sbjct  354   YGEEIQNVDANVEYCGVFKTKLGAHRVLMGAEMDCCDSTDEGRRFYVELKTSRE-LDDRT  412

Query  739   EEIFEREKLLKFW------IQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKS  578
              E FER+KLLKFW      IQSFLAGVPYIVVGFRDD GRLVRTERLRT +IT R ++K+
Sbjct  413   VERFERDKLLKFWDTRVMQIQSFLAGVPYIVVGFRDDGGRLVRTERLRTKDITHRARLKN  472

Query  577   YWQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHV  413
             YWQGGVCLAFADEVLCWLYGTVK+NEDYILQFT    RLELL+  SCPD IT+H+
Sbjct  473   YWQGGVCLAFADEVLCWLYGTVKDNEDYILQFTHPFTRLELLQAQSCPDVITNHL  527



>ref|XP_009419146.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=509

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/361 (77%), Positives = 309/361 (86%), Gaps = 6/361 (2%)
 Frame = -2

Query  1474  YPPRQNYGYG----RGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGD  1307
             Y  RQNYG+G     GN    E FVSE+K  KSEETL+RK    QEP E+ CYSRV+ G 
Sbjct  151   YSQRQNYGFGSKFSHGNGRESEHFVSEMKLTKSEETLSRKIIQFQEPSEIGCYSRVEGGV  210

Query  1306  VYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHF  1127
             VYFDDRSLRLFKR I ED+G+DLN+GF++F EKRDLGSQGFGDLLACIRNKNIPL  +HF
Sbjct  211   VYFDDRSLRLFKRTICEDVGADLNKGFESFVEKRDLGSQGFGDLLACIRNKNIPLQNIHF  270

Query  1126  VTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFES  947
             VT+RNNLNKI+ATAYIRNEPW+MGVHKR+GVVYLDVHKLPERP+S+LD RRCYWGY FE+
Sbjct  271   VTFRNNLNKILATAYIRNEPWKMGVHKRRGVVYLDVHKLPERPQSQLDSRRCYWGYAFEN  330

Query  946   LATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKT  767
             LATE+   +D D    IDANVE+C+VIKTK+GAHRI+MGAEMDCCDS DDGRRFYVELKT
Sbjct  331   LATENSTETDIDG-KGIDANVEFCSVIKTKLGAHRIIMGAEMDCCDSTDDGRRFYVELKT  389

Query  766   SRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVK  587
             SRE LD+RTEE +EREKLLKFWIQSFLAGVPYIV+GFRDD G LVRTERLRT +ITQRVK
Sbjct  390   SRE-LDYRTEERYEREKLLKFWIQSFLAGVPYIVIGFRDDAGILVRTERLRTKDITQRVK  448

Query  586   MKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQ  407
             MK+YWQGGVCLAFADEVLCWLYGTVKENEDY+LQF P  +RLELLR  SCPD I  H +Q
Sbjct  449   MKNYWQGGVCLAFADEVLCWLYGTVKENEDYVLQFVPPFHRLELLRAESCPDIIAEHAEQ  508

Query  406   L  404
             L
Sbjct  509   L  509



>ref|XP_006440152.1| hypothetical protein CICLE_v10019303mg [Citrus clementina]
 gb|ESR53392.1| hypothetical protein CICLE_v10019303mg [Citrus clementina]
Length=629

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/418 (71%), Positives = 335/418 (80%), Gaps = 20/418 (5%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrw--qngrgnGILPSPNYPPRQNYG  1451
             NE Y +T A S YP+PVLP VRN NN    G         +  G GILP P YPPRQ  G
Sbjct  213   NEAYCRTSAISPYPIPVLPVVRNNNNHGGRGGFGRGRWPNDRGGVGILPRPGYPPRQG-G  271

Query  1450  YGRG----NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSL  1283
             YG G    N  +DERFVSE K ++SEETL+RK  A QEPCELA YSRV+ GDVYFDDRSL
Sbjct  272   YGHGSRFSNGRQDERFVSEFKLSRSEETLSRKVVAFQEPCELAQYSRVEGGDVYFDDRSL  331

Query  1282  RLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLN  1103
             RLFKRLI+ED+G+DLNEGFDTF EK++LGS+GFGDLL+CIRN+NIPL  MHFVT+RNNLN
Sbjct  332   RLFKRLISEDVGADLNEGFDTFIEKKELGSEGFGDLLSCIRNRNIPLQNMHFVTFRNNLN  391

Query  1102  KIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGR  923
             KI+ATAYIRNE W MGVHKR GVVYLDVHK+ ERPKSELDRRRCYWGYCFESLATEDP R
Sbjct  392   KILATAYIRNEAWAMGVHKRNGVVYLDVHKVQERPKSELDRRRCYWGYCFESLATEDPRR  451

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
             +DG+ IH IDANVE+CAV+KTK+GAHR+LMGAEMDCCDS DDGRRFYVELKTSRE LD+ 
Sbjct  452   ADGEGIHHIDANVEFCAVMKTKLGAHRLLMGAEMDCCDSTDDGRRFYVELKTSRE-LDYH  510

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
             TEE FEREKLLKFWIQSFLAGVP+IVVGFRDD GRLVRTERLRT +IT RVKMK+YWQGG
Sbjct  511   TEERFEREKLLKFWIQSFLAGVPFIVVGFRDDAGRLVRTERLRTKDITHRVKMKNYWQGG  570

Query  562   VCLAFADEVLCWLYGTVKENE-----------DYILQFTPHSNRLELLRGPSCPDAIT  422
             VCLAFADEVLCWLYGTVKE+E            ++      SN   +++  +C D +T
Sbjct  571   VCLAFADEVLCWLYGTVKESETLTFISENLLSSFVAMLCLGSNNFTIIK-CNCCDCVT  627



>gb|EEC79165.1| hypothetical protein OsI_19840 [Oryza sativa Indica Group]
Length=531

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/413 (71%), Positives = 339/413 (82%), Gaps = 14/413 (3%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGY  1448
             NE+YVKTPA S Y VPVLP +RNTNN +RGG+G    +      +LP P  +P R N+GY
Sbjct  122   NEDYVKTPARSNYLVPVLPSIRNTNNHSRGGYGGRNGRGPP---LLPRPGGHPGRHNFGY  178

Query  1447  G----RGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLR  1280
             G     GN    E FVSE+K  KSEETL+RK  A QEP E+ACYSR++ GDVYFDDRSLR
Sbjct  179   GGRFSHGNGRNVEGFVSEMKLNKSEETLSRKFVAFQEPSEIACYSRIEGGDVYFDDRSLR  238

Query  1279  LFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNK  1100
             LFKR I + +G +LN+GF++F EKRDLGS+GFGDLLACIRN  +PL  +HFVTYRNNLNK
Sbjct  239   LFKRNICDYVGENLNKGFESFIEKRDLGSEGFGDLLACIRNSTVPLQNIHFVTYRNNLNK  298

Query  1099  IMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRS  920
             I+ATAY+R EPW+MGVHKR GVVYLDVHKLPERP+SE++RRRCYWGY FE+LATE+    
Sbjct  299   ILATAYLR-EPWKMGVHKRNGVVYLDVHKLPERPQSEVERRRCYWGYSFENLATENSIDE  357

Query  919   DGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRT  740
             DG     IDANVE+CAVIKTK+GAHRI+MGAEMDCCD+ DDGRRFYVELKTSRE L++ T
Sbjct  358   DG---RGIDANVEFCAVIKTKLGAHRIIMGAEMDCCDATDDGRRFYVELKTSRE-LEYHT  413

Query  739   EEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGV  560
              E FE+EKLL+FWIQSF+AGVPY+VVGFR+D G L+RTERLRT EITQ+VK K+YWQGGV
Sbjct  414   VEKFEKEKLLRFWIQSFIAGVPYVVVGFRNDAGVLIRTERLRTKEITQKVKAKNYWQGGV  473

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPS-CPDAITHHVQQL  404
             CLAFADEVLCWLYGTV+ENEDYILQF    NRLELLR  S CPDAITHHV+QL
Sbjct  474   CLAFADEVLCWLYGTVRENEDYILQFVHPFNRLELLRAQSPCPDAITHHVEQL  526



>gb|KFK23542.1| hypothetical protein AALP_AAs66918U000400 [Arabis alpina]
Length=520

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/418 (68%), Positives = 333/418 (80%), Gaps = 10/418 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPNYPPRQNYG--  1451
             NEEY KTP+ STY +PVLP   + +N    G G        G G+LP P   P    G  
Sbjct  98    NEEYTKTPSISTYSIPVLPVGWSNDNHGGRGRGGRWPNGRGGAGLLPRPGPFPGGRGGGG  157

Query  1450  -------YGRGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDD  1292
                    Y + N  RDERFVSELK +KS+ETLARKST  QEPCEL  YSRV+ G+V+FD+
Sbjct  158   RGGFGGRYHQQNYQRDERFVSELKLSKSKETLARKSTNFQEPCELTSYSRVEGGEVFFDE  217

Query  1291  RSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRN  1112
             R LRLFKR I E+IG+DLN+G+DTF EK+DLGS+GFGDLLA IR KNI L+ MHFVT+RN
Sbjct  218   RGLRLFKRRIAEEIGADLNQGYDTFIEKKDLGSEGFGDLLASIRAKNISLENMHFVTFRN  277

Query  1111  NLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATED  932
             NLNKI+ TAY R+E WEMGVHKR G +YLDVHKLPERP+S+LDRRRCYWGYCFESLATED
Sbjct  278   NLNKILGTAYNRHEAWEMGVHKRNGTIYLDVHKLPERPQSDLDRRRCYWGYCFESLATED  337

Query  931   PGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELL  752
             PGR+ G+ IH +DANVE+C+V+KTK+GAHR+LMGAEMDCCD  D+GRR Y+ELKTSRE L
Sbjct  338   PGRAYGEEIHHVDANVEFCSVVKTKLGAHRVLMGAEMDCCDETDEGRRIYIELKTSRE-L  396

Query  751   DHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYW  572
             D RT + FEREKLLKFWIQSF+AGVPYIVVGFRDD GRLVRTERLRT +I  R ++K+YW
Sbjct  397   DDRTVDRFEREKLLKFWIQSFVAGVPYIVVGFRDDGGRLVRTERLRTKDIAHRARLKNYW  456

Query  571   QGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLES  398
             QGGVCLAFADEVLCWL+GTVKENEDYILQF     RLELL+  SCPD+IT+HV  L++
Sbjct  457   QGGVCLAFADEVLCWLFGTVKENEDYILQFVHPFMRLELLQAQSCPDSITNHVHLLQN  514



>ref|XP_003568532.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic [Brachypodium 
distachyon]
Length=531

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/412 (71%), Positives = 336/412 (82%), Gaps = 12/412 (3%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPNYPP-RQNYGY  1448
             NEEYVKTPA S Y VPVLP +R+TNN +RG FG    +            +P  R N+GY
Sbjct  122   NEEYVKTPARSNYLVPVLPSIRSTNNHSRGVFGGRGGRGPPLLP--RPGGHPGGRHNFGY  179

Query  1447  GR---GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRL  1277
             GR   GN    E FVSE+K  KSEETL+RK+ A QEPCE+ACYSRV+ GDVYFDDRSLRL
Sbjct  180   GRFSHGNGRNVEGFVSEMKLNKSEETLSRKAVAFQEPCEIACYSRVEGGDVYFDDRSLRL  239

Query  1276  FKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKI  1097
             FKR I + IG +LN+GF++FTEKRDLGS+GFGDLLACIRN N+PL  +HFVTYRNNLNKI
Sbjct  240   FKRNICDYIGENLNKGFESFTEKRDLGSEGFGDLLACIRNSNLPLQNIHFVTYRNNLNKI  299

Query  1096  MATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSD  917
             +ATAY+R EPW+MGVHKR GVVYLDVHKLPERP+SE++RRRC+WGY FE+LATE+    D
Sbjct  300   LATAYLR-EPWKMGVHKRNGVVYLDVHKLPERPQSEIERRRCFWGYSFENLATENSIDED  358

Query  916   GDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTE  737
             G     IDANVEYC+VIKTK+GAHRI+MGAEMDCCD+ DDGRRFYVELKTSRE L++ T 
Sbjct  359   G---RGIDANVEYCSVIKTKLGAHRIIMGAEMDCCDATDDGRRFYVELKTSRE-LEYHTV  414

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVC  557
             E FE+EKLL+FWIQSFLAGV Y+VVGFR+D G LVRTERLRT +ITQ+VK K+YWQGGVC
Sbjct  415   ERFEKEKLLRFWIQSFLAGVSYVVVGFRNDAGELVRTERLRTKDITQKVKAKNYWQGGVC  474

Query  556   LAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPS-CPDAITHHVQQL  404
             LAFADEVLCWLYGTVKENEDY+LQF    +RLEL+   S CPDAIT HV+QL
Sbjct  475   LAFADEVLCWLYGTVKENEDYVLQFVQPFHRLELIMAQSPCPDAITQHVEQL  526



>ref|XP_008373723.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
[Malus domestica]
Length=389

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/332 (80%), Positives = 297/332 (89%), Gaps = 1/332 (0%)
 Frame = -2

Query  1399  FAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDT  1220
              +KS ETL+RK+ A QEPCELACYSRV+ GDV FD+ SLRLFKRLITE+IG DLNEG+DT
Sbjct  59    LSKSGETLSRKAVAFQEPCELACYSRVEGGDVSFDETSLRLFKRLITEEIGRDLNEGYDT  118

Query  1219  FTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRK  1040
             F  K+DLGSQGFGDLL CIR+KNIPL  +HFVTYRNNLNKI+AT Y + +PWEMGVHKR 
Sbjct  119   FIAKKDLGSQGFGDLLGCIRDKNIPLQNIHFVTYRNNLNKILATFYNKRDPWEMGVHKRN  178

Query  1039  GVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKT  860
             GVVYLDVHKLPERP++ELDRRRCYWGYCFESLATEDPGR DG  IH +DANVEYC+VIKT
Sbjct  179   GVVYLDVHKLPERPQTELDRRRCYWGYCFESLATEDPGRGDGG-IHHVDANVEYCSVIKT  237

Query  859   KIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
             K+GAHRILMGAEMDCCDS DDGRRFYVELKTSREL +H+ E  FE+EKLLKFWIQSFLAG
Sbjct  238   KLGAHRILMGAEMDCCDSTDDGRRFYVELKTSRELDNHKIEYEFEKEKLLKFWIQSFLAG  297

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENE  500
             VPYIV+GFR+D G+LVRTERLRT +ITQRVKMK+YWQGGVCLAFADEVLCWLYGTVK+NE
Sbjct  298   VPYIVIGFRNDAGQLVRTERLRTKDITQRVKMKNYWQGGVCLAFADEVLCWLYGTVKDNE  357

Query  499   DYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             DYILQFT    RLELL+  SCP+ IT+HVQQL
Sbjct  358   DYILQFTHPYQRLELLQAQSCPEEITNHVQQL  389



>ref|XP_006655284.1| PREDICTED: LOW QUALITY PROTEIN: decapping nuclease DXO homolog, 
chloroplastic-like [Oryza brachyantha]
Length=760

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/412 (72%), Positives = 338/412 (82%), Gaps = 13/412 (3%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGY  1448
             N+EYVKTPA S Y VPVLP +R+TNN +RGGFG    +      +LP P  +P R N+GY
Sbjct  82    NDEYVKTPARSNYLVPVLPSIRSTNNHSRGGFGGRNGRGPP---LLPRPGGHPGRHNFGY  138

Query  1447  GR---GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRL  1277
             GR   GN    E FVSE+K  KSEETL+RK+ A QEPCE+ACYSRV+ GDVYFDDRSLRL
Sbjct  139   GRFSHGNGRNVEGFVSEMKLNKSEETLSRKAVAFQEPCEIACYSRVEGGDVYFDDRSLRL  198

Query  1276  FKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKI  1097
             FKR I + +G +LN+GF++F EKRDLGS GFGDLLACIR   IPL  +HFVTYRNNLNKI
Sbjct  199   FKRNICDYVGVNLNKGFESFIEKRDLGSDGFGDLLACIRGSTIPLQNIHFVTYRNNLNKI  258

Query  1096  MATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSD  917
             +ATAY+R EPW+MGVHKR GVVYLDVHKLPERPKSE++RRRCYWGY FE+LATE+    D
Sbjct  259   LATAYLR-EPWKMGVHKRNGVVYLDVHKLPERPKSEIERRRCYWGYSFENLATENSIDED  317

Query  916   GDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTE  737
             G     IDANVE+C+VIKTK+GAHRI+MGAEMDCCD+ DDGRRFYVELKTSRE L++ T 
Sbjct  318   G---RGIDANVEFCSVIKTKLGAHRIIMGAEMDCCDATDDGRRFYVELKTSRE-LEYNTV  373

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVC  557
             E FE+EKLL+FWIQSFLAGVPY+VVGFR+D G LVRTERLRT +ITQ+VK K+YWQGGVC
Sbjct  374   EKFEKEKLLRFWIQSFLAGVPYVVVGFRNDAGVLVRTERLRTKDITQKVKAKNYWQGGVC  433

Query  556   LAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPS-CPDAITHHVQQL  404
             LAFADEVLCWLYGTV+ENEDY LQF    NRLELLR  S CPDAIT HV+QL
Sbjct  434   LAFADEVLCWLYGTVRENEDYTLQFVHPFNRLELLRAQSPCPDAITQHVEQL  485



>dbj|BAJ99622.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=532

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/430 (70%), Positives = 348/430 (81%), Gaps = 14/430 (3%)
 Frame = -2

Query  1678  SKYGNEdddsdkdlfgsDNEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrg  1499
             + YG+E+++  +DLFGSDNEEYVKTPA S Y VPVLPP+RNTNN +RGG G         
Sbjct  107   AGYGDEEEEEARDLFGSDNEEYVKTPARSNYLVPVLPPIRNTNNFSRGGRGGRGPPLLPR  166

Query  1498  nGILPSPNYPPRQNYGYG----RGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELAC  1331
              G  P      R NYG+G     GN    E FVSE+K  KSEETL+RK+ A QEPCE+AC
Sbjct  167   PGGHPGG----RNNYGHGGRYSYGNGRNVEGFVSEMKLNKSEETLSRKAVAFQEPCEIAC  222

Query  1330  YSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKN  1151
             YSRV+ GDVYFDDRSLRLFKR I +  G DLN+GF+TF EKRDLGSQGFGDLLACIRN N
Sbjct  223   YSRVEGGDVYFDDRSLRLFKRNICDYAGEDLNKGFETFIEKRDLGSQGFGDLLACIRNSN  282

Query  1150  IPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRC  971
             +PL  +HFVTYRNNLNKI+ATAY++ +PW+MGVHKR GVVYLDVHKLPERP+SE++RRRC
Sbjct  283   LPLQNIHFVTYRNNLNKILATAYLK-DPWKMGVHKRNGVVYLDVHKLPERPQSEIERRRC  341

Query  970   YWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGR  791
             +WGY FE+LATE+    DG     IDANVEYC+VIKTK+GAHRI+MGAEMDCCDS DDGR
Sbjct  342   FWGYSFENLATENSIDEDG---RGIDANVEYCSVIKTKLGAHRIVMGAEMDCCDSTDDGR  398

Query  790   RFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRT  611
             RFYVELKTSRE L++ T E FE+EKLL+FWIQSFLAGV Y+VVGFR+D G LVRTERLRT
Sbjct  399   RFYVELKTSRE-LEYHTVEKFEKEKLLRFWIQSFLAGVSYVVVGFRNDAGVLVRTERLRT  457

Query  610   NEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPS-CP  434
              +ITQ+VK K+YWQGGVCLAFADEVLCWLYGTVKENEDY+LQF    +RLELL+  S CP
Sbjct  458   KDITQKVKAKNYWQGGVCLAFADEVLCWLYGTVKENEDYVLQFAHPFHRLELLKAQSPCP  517

Query  433   DAITHHVQQL  404
             + IT HV+QL
Sbjct  518   EPITLHVEQL  527



>ref|XP_002439744.1| hypothetical protein SORBIDRAFT_09g019380 [Sorghum bicolor]
 gb|EES18174.1| hypothetical protein SORBIDRAFT_09g019380 [Sorghum bicolor]
Length=529

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/410 (71%), Positives = 335/410 (82%), Gaps = 10/410 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPNYPPRQNYGYG  1445
             NEEYV+TPA S Y VPVLP +RNTNN +RGGFG    +            +P R N+GYG
Sbjct  120   NEEYVRTPARSNYLVPVLPAIRNTNNHSRGGFGGRGGRGPPLLP--RPGGHPGRHNFGYG  177

Query  1444  R-GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKR  1268
             R GN    E  VS++K  KSEETL+RK+   QEPCE+AC SRV  G+VYFDDRSLRLFKR
Sbjct  178   RFGNGRHVEGLVSDMKLNKSEETLSRKAVTFQEPCEIACLSRVDGGEVYFDDRSLRLFKR  237

Query  1267  LITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDR-MHFVTYRNNLNKIMA  1091
              I + +G+DLN+GF+TF EKRDLGS+GFGDLLACIRN NI L   +HFVTYRNNLNKI+A
Sbjct  238   EICDYVGADLNKGFETFIEKRDLGSEGFGDLLACIRNSNILLQHTIHFVTYRNNLNKILA  297

Query  1090  TAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGD  911
             TAY+R EPW+MGVHKRKGVVYLDVHKLPERPKSE++RRRCYWGY FE+LATE+    DG 
Sbjct  298   TAYLR-EPWKMGVHKRKGVVYLDVHKLPERPKSEVERRRCYWGYSFENLATENSFSDDG-  355

Query  910   RIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEI  731
                 IDANVE+C+VIKTK+GAHRI+MGAEMDCCD+ DDGRRFYVELKTSREL ++ T E 
Sbjct  356   --RGIDANVEFCSVIKTKLGAHRIVMGAEMDCCDATDDGRRFYVELKTSREL-EYHTVEA  412

Query  730   FEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLA  551
             +E+EKLL+FWIQSFLAGVPY+VVGFR+D G LVRTERLRT +ITQ+VK K+YWQGGVCLA
Sbjct  413   YEKEKLLRFWIQSFLAGVPYVVVGFRNDAGILVRTERLRTKDITQKVKAKNYWQGGVCLA  472

Query  550   FADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPS-CPDAITHHVQQL  404
             FADEVLCWLYGTV+ENEDY+LQF    NRLEL+R  S CP+AIT HVQQL
Sbjct  473   FADEVLCWLYGTVRENEDYVLQFVHPFNRLELIRAQSPCPEAITLHVQQL  522



>ref|XP_008649608.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic [Zea 
mays]
 gb|AFW77891.1| hypothetical protein ZEAMMB73_398059 [Zea mays]
Length=530

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/410 (71%), Positives = 337/410 (82%), Gaps = 10/410 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPNYPPRQNYGYG  1445
             NEEYV+TPA S Y VPVLPP+RNTNN +RGGFG    +            +P R N+GYG
Sbjct  123   NEEYVRTPARSHYLVPVLPPIRNTNNHSRGGFGGRGGRGPPLLP--RPGGHPGRHNFGYG  180

Query  1444  R-GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKR  1268
             R GN    E  VS++K  KSEETL+RK+   QEPCE+AC SRV+ G+VYFDDRSLRLFKR
Sbjct  181   RFGNGRHVEGLVSDMKLNKSEETLSRKAVTFQEPCEIACLSRVEGGEVYFDDRSLRLFKR  240

Query  1267  LITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPL-DRMHFVTYRNNLNKIMA  1091
              I E  G+DLN+GF+++ EKRDLGS+GFGDLLACIRN NI L + +HFVTYRNNLNKI+A
Sbjct  241   EICEYRGADLNKGFESYIEKRDLGSEGFGDLLACIRNSNILLQNTIHFVTYRNNLNKILA  300

Query  1090  TAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGD  911
             TAY+R EPW+MGVHKR+GVVYLDVHKLPERPKSE++R+RCYWGY FE+LATE+    DG 
Sbjct  301   TAYLR-EPWKMGVHKRRGVVYLDVHKLPERPKSEVERKRCYWGYSFENLATENSFSDDG-  358

Query  910   RIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEI  731
                 IDANVE+C+VIKTK+GAHRI+MGAEMDCCD+ DDGRRFYVELKTSREL ++ T E 
Sbjct  359   --RGIDANVEFCSVIKTKLGAHRIVMGAEMDCCDATDDGRRFYVELKTSREL-EYHTVEA  415

Query  730   FEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLA  551
             +E+EKLL+FWIQSFLAGVPY+VVGFR+D G LVRTERLRT +ITQ+VK K+YWQGGVCLA
Sbjct  416   YEKEKLLRFWIQSFLAGVPYVVVGFRNDAGILVRTERLRTKDITQKVKAKNYWQGGVCLA  475

Query  550   FADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPS-CPDAITHHVQQL  404
             FADEVLCWLYGTVKENEDY+LQF    NRLELLR  S CP+AIT HVQQL
Sbjct  476   FADEVLCWLYGTVKENEDYVLQFVHPFNRLELLRAQSPCPEAITLHVQQL  525



>ref|XP_010540805.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
[Tarenaya hassleriana]
Length=531

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/413 (69%), Positives = 331/413 (80%), Gaps = 13/413 (3%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPP-VRNTNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYG  1451
             NE Y  TPATS YP+PVLPP +RN  +        GR   GRG GILP P  YPPRQ YG
Sbjct  126   NEVYWNTPATSPYPIPVLPPAIRNNQH------QGGRGGFGRGRGILPRPGPYPPRQGYG  179

Query  1450  YGRG----NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSL  1283
             YG G    N  RD+RFVSELK  KS ETL+RK+T  QEPCE+A YSR + G+VYFD+RSL
Sbjct  180   YGYGLRFANGNRDDRFVSELKLNKSTETLSRKATVFQEPCEIASYSRAEGGEVYFDERSL  239

Query  1282  RLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLN  1103
             RLF R I + IG+DLN+GFD+FTEK + GS+ FGDLLAC R KN+PL  +HFVT+ + L 
Sbjct  240   RLFNRSIPDHIGADLNQGFDSFTEKIEQGSREFGDLLACTRAKNLPLGNIHFVTFADCLK  299

Query  1102  KIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGR  923
             KIMATAYIR+EPWEMGVHKR GVVY++ HKLPERP+SELDRR  YWGYCFE+LA EDPGR
Sbjct  300   KIMATAYIRHEPWEMGVHKRNGVVYVEEHKLPERPQSELDRRIRYWGYCFEALAVEDPGR  359

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
             +DG  I  +DAN+EYCAVIKTK+GAHRILMG +MDCCDS D+GRRFYV+LKT+R+ L+HR
Sbjct  360   ADGQEISHVDANLEYCAVIKTKLGAHRILMGVQMDCCDSTDEGRRFYVDLKTARQ-LEHR  418

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
             T E FERE+LLK+WI +FL G+PYIVVG+RDD G LV TERLRT +ITQRVKM +YWQGG
Sbjct  419   TVERFEREELLKYWIHAFLTGIPYIVVGYRDDRGVLVDTERLRTKDITQRVKMNNYWQGG  478

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             VCLAFADEVLCWLYGTVKEN+DYILQFT    RLELL+  SCP+ IT HV QL
Sbjct  479   VCLAFADEVLCWLYGTVKENQDYILQFTSPFMRLELLQAQSCPEVITSHVAQL  531



>ref|NP_193498.2| glycine-rich protein [Arabidopsis thaliana]
 sp|Q8RY73.1|DXO_ARATH RecName: Full=Decapping nuclease DXO homolog, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL69514.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91749.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE98968.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83924.1| glycine-rich protein [Arabidopsis thaliana]
Length=544

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/416 (68%), Positives = 330/416 (79%), Gaps = 8/416 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnG--ILPSPN-YPPRQNY  1454
             NEEY KTPA STY +PVLP   + +N    G       +    G  +LP P  YP R   
Sbjct  121   NEEYTKTPAISTYSIPVLPAGWSNDNHGGRGGMGRGRWSNGRGGPGLLPRPGPYPGRGGN  180

Query  1453  GYGRG----NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
               G G    N  RDERFVSELK +KS+ETLARK T  QEPCEL CYSRV+ G+V +DD+ 
Sbjct  181   RGGFGGRYQNYQRDERFVSELKLSKSKETLARKQTNFQEPCELTCYSRVEGGEVIYDDQG  240

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
             LRLFKR I E+IG+DLN+G+DTF EK+DLGS+GFGDLL  IR KNI LD +HFVT+RNNL
Sbjct  241   LRLFKRHIGEEIGADLNQGYDTFIEKKDLGSEGFGDLLGSIRAKNISLDNIHFVTFRNNL  300

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+  AY R+EPWEMGVHKR G +YLDVHKLPERP+S+LDRRRCYWGYCFESLATEDPG
Sbjct  301   NKILGAAYNRHEPWEMGVHKRNGTIYLDVHKLPERPQSDLDRRRCYWGYCFESLATEDPG  360

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDH  746
             R+ G+ IH +DANVE+C+V++TK+GAHR++MGAEMDCCD  D G+RFYVELKT+RE LD 
Sbjct  361   RAYGEEIHHVDANVEFCSVVRTKLGAHRVMMGAEMDCCDVSDKGKRFYVELKTTRE-LDD  419

Query  745   RTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQG  566
             RT + FEREKLLKFWIQSF+AGVPYIVVGFRDD GRLVRTERL T +I  R ++K+YWQG
Sbjct  420   RTVDRFEREKLLKFWIQSFVAGVPYIVVGFRDDGGRLVRTERLTTRDIAHRARLKNYWQG  479

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLES  398
             GVCLAFADEVLCWLYGTVKENEDYILQF     RLELL+  SCPDAIT+HV  L++
Sbjct  480   GVCLAFADEVLCWLYGTVKENEDYILQFVHPFMRLELLQAQSCPDAITNHVHLLQN  535



>ref|XP_004962184.1| PREDICTED: decapping nuclease Dom3z homolog, chloroplastic-like 
[Setaria italica]
Length=528

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/410 (70%), Positives = 335/410 (82%), Gaps = 10/410 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPNYPPRQNYGYG  1445
             NE+YV+TPA S Y VPVLP +RNTNN +RGGFG    +            +P R N+GYG
Sbjct  121   NEDYVRTPARSNYLVPVLPAIRNTNNHSRGGFGGRGGRGPPLLP--RPGGHPGRHNFGYG  178

Query  1444  R-GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKR  1268
             R GN    E FVS+LK  KSEETL+RK+ A QEPCE A +SRV+ G VYFDDRSLRLFKR
Sbjct  179   RFGNGRNVEGFVSDLKLNKSEETLSRKAVAFQEPCEFASFSRVEGGAVYFDDRSLRLFKR  238

Query  1267  LITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPL-DRMHFVTYRNNLNKIMA  1091
              I + +G+DLN+GF++F EK+DLG +GFGDLLACIRN  I L + +HFVTYRNNLNKI+A
Sbjct  239   EICDYVGADLNKGFESFVEKKDLGPEGFGDLLACIRNSPITLQNNIHFVTYRNNLNKILA  298

Query  1090  TAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGD  911
             TAY+R EPW+MGVHKRKGVVYLDVHKLPERPKSE++RRRCYWGY FE+LATE+    DG 
Sbjct  299   TAYLR-EPWKMGVHKRKGVVYLDVHKLPERPKSEMERRRCYWGYSFENLATENSFSEDGG  357

Query  910   RIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEI  731
                 IDANVE+C+VIKTK+GAHRI+MGAEMDCCD+ DDGRRFYVELKTSREL ++ T E 
Sbjct  358   ---GIDANVEFCSVIKTKLGAHRIVMGAEMDCCDATDDGRRFYVELKTSREL-EYHTVEA  413

Query  730   FEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLA  551
             +E+EKLL+FWIQSFLAGVPY+VVGFR+D G LVRTERLRT +ITQ+VK K+YWQGGVCLA
Sbjct  414   YEKEKLLRFWIQSFLAGVPYVVVGFRNDAGILVRTERLRTKDITQKVKAKNYWQGGVCLA  473

Query  550   FADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPS-CPDAITHHVQQL  404
             FADEVLCWLYGTV+ENEDYILQF    NRLELLR  S CP+AIT HVQQL
Sbjct  474   FADEVLCWLYGTVRENEDYILQFVHPFNRLELLRAQSPCPEAITLHVQQL  523



>ref|XP_010449587.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic [Camelina 
sativa]
Length=547

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/414 (68%), Positives = 331/414 (80%), Gaps = 7/414 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrw--qngrgnGILPSPN-YPPRQNY  1454
             NEEY KTPA STY +PVLP   + +N    G            G G+LP P  YP R N 
Sbjct  123   NEEYTKTPAISTYSIPVLPAGWSNDNHGGRGGMGRGRWPNGRGGPGLLPRPGPYPGRGNR  182

Query  1453  GYGRG---NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSL  1283
             G   G   N  RDERFVSELK +KS+ETLARK T  QEPCEL  YSRV+ G+V++D+R L
Sbjct  183   GGFGGRYQNYQRDERFVSELKLSKSKETLARKQTNFQEPCELTSYSRVEGGEVFYDERGL  242

Query  1282  RLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLN  1103
             RLFKR + E+IG+DLN+GFDTF EK+DLGS+GFGD+L  IR KNI L+ +HFVT+RNNLN
Sbjct  243   RLFKRHVAEEIGADLNQGFDTFIEKKDLGSEGFGDMLGSIRAKNISLENIHFVTFRNNLN  302

Query  1102  KIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGR  923
             KI+  AY R+EPWEMGVHKR G +YLDVHKLPERP+S+LDRRRCYWGYCFESLATEDPGR
Sbjct  303   KILGAAYNRHEPWEMGVHKRNGTIYLDVHKLPERPQSDLDRRRCYWGYCFESLATEDPGR  362

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
             + G+ +H +DANVE+C+V+KTK+GAHR+LMGAEMDCCD  D+GRR Y+ELKTSRE LD R
Sbjct  363   AYGEEVHHVDANVEFCSVVKTKLGAHRVLMGAEMDCCDETDEGRRIYIELKTSRE-LDDR  421

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
             T + +EREKLLKFWIQSF+AGVPYIVVG+RDD GRLVRTERLRT EI  R ++K++WQGG
Sbjct  422   TVDRYEREKLLKFWIQSFVAGVPYIVVGYRDDGGRLVRTERLRTKEIAHRARLKNFWQGG  481

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLE  401
             VCLAFADEVLCWLYGTVKENEDYILQF     RLELL+  SCPDAIT+HV  L+
Sbjct  482   VCLAFADEVLCWLYGTVKENEDYILQFQHPFMRLELLQAQSCPDAITNHVHLLQ  535



>ref|XP_003611402.1| Dom3z-like protein [Medicago truncatula]
Length=338

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/338 (78%), Positives = 297/338 (88%), Gaps = 4/338 (1%)
 Frame = -2

Query  1405  LKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGF  1226
             +K +KSEETL+RK  A QEPCELACYSR + G+VYFDDRSLRLFKR ITEDIG+DLNEG+
Sbjct  1     MKLSKSEETLSRKVIAFQEPCELACYSRAEGGEVYFDDRSLRLFKRHITEDIGADLNEGY  60

Query  1225  DTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHK  1046
             DT+  K+DLGS+G+GDLLACIR+K I L  +HFVTYRNNLNKI+ATAYIR+EPWEMGVHK
Sbjct  61    DTYIPKKDLGSEGYGDLLACIRDKKIHLQNIHFVTYRNNLNKILATAYIRHEPWEMGVHK  120

Query  1045  RKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVI  866
             R GVVYLDVHKLPERP+S+LDRRRCY GY FESLATEDP R+DG+ IHD+DANVE+C+VI
Sbjct  121   RNGVVYLDVHKLPERPQSDLDRRRCYLGYSFESLATEDPKRADGEPIHDVDANVEFCSVI  180

Query  865   KTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSREL----LDHRTEEIFEREKLLKFWI  698
             KTK+GAHRILMGAEMDCCD+  DG+RFYVELKTS E+    L++  EE FEREKLLKFWI
Sbjct  181   KTKLGAHRILMGAEMDCCDTTTDGKRFYVELKTSYEVDIVTLNYHNEEKFEREKLLKFWI  240

Query  697   QSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYG  518
             QSFLAGVPYI +GFRDD GRLVRTE LRT +ITQR+KMK YWQGGVCLAFADEVLCWLYG
Sbjct  241   QSFLAGVPYICIGFRDDAGRLVRTEMLRTKDITQRIKMKGYWQGGVCLAFADEVLCWLYG  300

Query  517   TVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             TVKENEDYILQF P  NRLELL+  SCPD IT H++ L
Sbjct  301   TVKENEDYILQFAPPFNRLELLQAHSCPDVITSHLELL  338



>gb|KHN42649.1| Protein Dom3z like, chloroplastic [Glycine soja]
Length=467

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/443 (67%), Positives = 341/443 (77%), Gaps = 46/443 (10%)
 Frame = -2

Query  1735  EEDDNGEVRSSLNSNINSHSKYGNEdddsdkdlfgsDNEEYVKTPATSTYPVPVLPPVRN  1556
             ++D+NG+V  S  +  + H  Y ++D           NE+Y KT A S YP+PVLP  RN
Sbjct  68    DDDENGDVVDSAKARAHHHHDYEDKDLFGSD------NEDYCKTLARSPYPIPVLPATRN  121

Query  1555  TNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGYGRGNAPRDERFVSELKFAKSEET  1379
              NN  RGGFGRGRWQN RG G+LP P  YP RQN+GYG                      
Sbjct  122   VNNQGRGGFGRGRWQNDRGAGLLPRPGPYPQRQNFGYGN---------------------  160

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
                              SRV+ G+VYFDDRSLRLFKR ITED+G+DLNEG+DT+  K+DL
Sbjct  161   -----------------SRVEGGEVYFDDRSLRLFKRHITEDVGADLNEGYDTYIPKKDL  203

Query  1198  GSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDV  1019
             GS+GFGDLLACIR+KNIPL  +HFVT+RNNLNKI+ATAYIR+EPWEMGVHKR GVVYLDV
Sbjct  204   GSEGFGDLLACIRDKNIPLQNIHFVTFRNNLNKILATAYIRHEPWEMGVHKRNGVVYLDV  263

Query  1018  HKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRI  839
             HKLPERP+S+LDRRRCY GYCFESLATEDP R+DG+ IH +DAN E+CAVIKTK+GAHRI
Sbjct  264   HKLPERPQSDLDRRRCYVGYCFESLATEDPNRADGEGIHHVDANAEFCAVIKTKLGAHRI  323

Query  838   LMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVG  659
             LMGAEMDCCDS ++G+RFYVELKTS E L++ TEE FEREKLLKFWIQSFLAGVPYIV+G
Sbjct  324   LMGAEMDCCDSTNEGKRFYVELKTSCE-LNYHTEERFEREKLLKFWIQSFLAGVPYIVIG  382

Query  658   FRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQFT  479
             FRDD GRLVRTERLRT +ITQRVKMK+YWQGGVCLAFADEVLCWLYGTVKE EDYILQF 
Sbjct  383   FRDDAGRLVRTERLRTKDITQRVKMKNYWQGGVCLAFADEVLCWLYGTVKEGEDYILQFA  442

Query  478   PHSNRLELLRGPSCPDAITHHVQ  410
             P  NRLELL+  SCPD IT H++
Sbjct  443   PPFNRLELLQAQSCPDVITSHLE  465



>ref|XP_006283484.1| hypothetical protein CARUB_v10004533mg [Capsella rubella]
 gb|EOA16382.1| hypothetical protein CARUB_v10004533mg [Capsella rubella]
Length=543

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/414 (68%), Positives = 331/414 (80%), Gaps = 7/414 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgr--wqngrgnGILPSPN-YPPRQNY  1454
             NEEY KTPA STY +PVLP   + +N    G            G G+LP P  YP R N 
Sbjct  122   NEEYTKTPAISTYSIPVLPAGWSNDNHGGRGGMGRGRWSNGRGGPGLLPRPGPYPGRGNR  181

Query  1453  GYGRG---NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSL  1283
             G   G   N  RDERFVSELK +KS+ETLARK T  QEPCEL  YSRV+ G+V++D+R L
Sbjct  182   GGFGGRYQNYQRDERFVSELKLSKSKETLARKQTNFQEPCELTSYSRVEGGEVFYDERGL  241

Query  1282  RLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLN  1103
             RLFKR + E+IG+DLN+G+DTF EK+DLGS+GFGDLL  IR KNI L+ +HFVT+RNNLN
Sbjct  242   RLFKRHVAEEIGADLNQGYDTFIEKKDLGSEGFGDLLGSIRAKNISLENIHFVTFRNNLN  301

Query  1102  KIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGR  923
             KI+  AY R+EPWEMGVHKR G +YLDVHKLPERP+S+LDRRRCYWGYCFESLATEDPGR
Sbjct  302   KILGAAYNRHEPWEMGVHKRNGTIYLDVHKLPERPQSDLDRRRCYWGYCFESLATEDPGR  361

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
             + G+ IH +DANVE+C+V+KTK+GAHR+LMGAEMDCCD  D+G+R Y+ELKTSRE LD R
Sbjct  362   AYGEEIHHVDANVEFCSVVKTKLGAHRVLMGAEMDCCDETDEGKRIYIELKTSRE-LDDR  420

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
             T + +EREKLLKFWIQSF+AGVPYIVVG+RDD GRLVRTERLRT +I  R ++K++WQGG
Sbjct  421   TVDRYEREKLLKFWIQSFVAGVPYIVVGYRDDGGRLVRTERLRTKDIAHRARLKNFWQGG  480

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLE  401
             VCLAFADEVLCWLYGTVKENEDYILQF     RLELL+  SCPDAIT+HV  L+
Sbjct  481   VCLAFADEVLCWLYGTVKENEDYILQFVHPFMRLELLQAQSCPDAITNHVHLLQ  534



>ref|XP_010439977.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
[Camelina sativa]
Length=547

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/414 (68%), Positives = 331/414 (80%), Gaps = 7/414 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrw--qngrgnGILPSPN-YPPRQNY  1454
             NEEY KTPA STY +PVLP   + +N    G            G G+LP P  YP R N 
Sbjct  123   NEEYTKTPAISTYSIPVLPAGWSNDNHGARGGVGRGRWPNGRGGPGLLPRPGPYPGRGNR  182

Query  1453  GYGRG---NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSL  1283
             G   G   N  RDERFVSELK +KS+ETLARK T  QEPCEL  YSRV+ G+V++D+R L
Sbjct  183   GGFGGRYQNYQRDERFVSELKLSKSKETLARKQTNFQEPCELTSYSRVEGGEVFYDERGL  242

Query  1282  RLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLN  1103
             RLFKR + E+IG+DLN+G+DTF EK+DLGS+GFGDLL  IR KNI L+ +HFVT+RNNLN
Sbjct  243   RLFKRHVAEEIGADLNQGYDTFIEKKDLGSEGFGDLLGSIRAKNISLENIHFVTFRNNLN  302

Query  1102  KIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGR  923
             KI+  AY R+EPWEMGVHKR G +YLDVHKLPERP+S+LDRRRCYWGYCFESLATEDPGR
Sbjct  303   KILGAAYNRHEPWEMGVHKRNGTIYLDVHKLPERPQSDLDRRRCYWGYCFESLATEDPGR  362

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
             + G+ +H +DANVE+C+V+KTK+GAHR+LMGAEMDCCD  D+GRR Y+ELKTSRE LD R
Sbjct  363   AYGEEVHHVDANVEFCSVVKTKLGAHRVLMGAEMDCCDETDEGRRIYIELKTSRE-LDDR  421

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
             T + +EREKLLKFWIQSF+AGVPYI+VG+RDD GRLVRTERLRT +I  R ++K++WQGG
Sbjct  422   TVDRYEREKLLKFWIQSFVAGVPYILVGYRDDGGRLVRTERLRTKDIAHRARLKNFWQGG  481

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLE  401
             VCLAFADEVLCWLYGTVKENEDYILQF     RLELL+  SCPDAIT+HV  L+
Sbjct  482   VCLAFADEVLCWLYGTVKENEDYILQFQHPFMRLELLQAQSCPDAITNHVHLLQ  535



>ref|XP_010110545.1| hypothetical protein L484_023379 [Morus notabilis]
 gb|EXC26763.1| hypothetical protein L484_023379 [Morus notabilis]
Length=602

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/412 (74%), Positives = 346/412 (84%), Gaps = 17/412 (4%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgr-wqngrgnGILPSPN-YPPRQNYG  1451
             NE+Y KT ATS YP+PVLP +RN NNP RG FGRGR  QN RG G+LP P  YP RQN+G
Sbjct  110   NEDYCKTLATSPYPIPVLPVIRNNNNPGRGNFGRGRWHQNDRGAGLLPRPGPYPQRQNFG  169

Query  1450  YGR--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRL  1277
             YG    N   DERFVSELK +KSEETL+RK  A QEPCE+ACYSRV+ GDV+FDDRSLRL
Sbjct  170   YGSKFSNPRHDERFVSELKLSKSEETLSRKCIAFQEPCEVACYSRVEGGDVFFDDRSLRL  229

Query  1276  FKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKI  1097
             FKRLITED+G+DLN+GFDTF EK+  G+  F  L     N+N   DR    T+RNNLNKI
Sbjct  230   FKRLITEDVGADLNQGFDTFIEKK--GNPVFFPL-----NQN--WDRK---TFRNNLNKI  277

Query  1096  MATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSD  917
             +ATAYIR+EPWEMGVHKR GVVYLDVHKLPERP+SEL+RRRCYWGYCFESLATEDP R+D
Sbjct  278   LATAYIRHEPWEMGVHKRNGVVYLDVHKLPERPQSELERRRCYWGYCFESLATEDPRRAD  337

Query  916   GDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTE  737
             G+ IH +DANVEYC+VIKTK+GAHRILMGAEMDCCDS DDGRRFYVELKT+RE LD+ TE
Sbjct  338   GEGIHHVDANVEYCSVIKTKLGAHRILMGAEMDCCDSTDDGRRFYVELKTNRE-LDYHTE  396

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVC  557
             E +EREKLL+ WIQSFLAGV YIV+GFRDD GRLVRTERLRT ++TQRVKMK+YWQGGVC
Sbjct  397   ERYEREKLLRIWIQSFLAGVSYIVIGFRDDRGRLVRTERLRTKDVTQRVKMKNYWQGGVC  456

Query  556   LAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLE  401
             LAFADEVLCWLYGTVKENE+YILQF P  NRLELL+  SCP+ IT+H  +++
Sbjct  457   LAFADEVLCWLYGTVKENENYILQFAPPFNRLELLQAQSCPEEITNHKNKIK  508



>ref|NP_001031654.1| glycine-rich protein [Arabidopsis thaliana]
 gb|AEE83925.1| glycine-rich protein [Arabidopsis thaliana]
Length=544

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/416 (68%), Positives = 328/416 (79%), Gaps = 8/416 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnG--ILPSPN-YPPRQNY  1454
             NEEY KTPA STY +PVLP   + +N    G       +    G  +LP P  YP R   
Sbjct  121   NEEYTKTPAISTYSIPVLPAGWSNDNHGGRGGMGRGRWSNGRGGPGLLPRPGPYPGRGGN  180

Query  1453  GYGRG----NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
               G G    N  RDERFVSELK +KS+ETLARK T  QEPCEL CYSRV+ G+V +DD+ 
Sbjct  181   RGGFGGRYQNYQRDERFVSELKLSKSKETLARKQTNFQEPCELTCYSRVEGGEVIYDDQG  240

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
             LRLFKR I E+IG+DLN+G+DTF EK+DLGS+GFGDLL  IR KNI LD +HFVT+RNNL
Sbjct  241   LRLFKRHIGEEIGADLNQGYDTFIEKKDLGSEGFGDLLGSIRAKNISLDNIHFVTFRNNL  300

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+  AY R+EPWEMGVHKR G +YLDVHKLPERP+S+LDRRRCYWGYCFESLATEDPG
Sbjct  301   NKILGAAYNRHEPWEMGVHKRNGTIYLDVHKLPERPQSDLDRRRCYWGYCFESLATEDPG  360

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDH  746
             R+ G+ IH +DANVE+C+V++TK+GAHR++MGAEMDCCD  D G+RFYVELKT+RE LD 
Sbjct  361   RAYGEEIHHVDANVEFCSVVRTKLGAHRVMMGAEMDCCDVSDKGKRFYVELKTTRE-LDD  419

Query  745   RTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQG  566
             RT + FEREKLLKFWIQSF+AGVPYIVVGFRDD GRLVRTERL T +I  R ++K+YWQ 
Sbjct  420   RTVDRFEREKLLKFWIQSFVAGVPYIVVGFRDDGGRLVRTERLTTRDIAHRARLKNYWQV  479

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLES  398
              VCLAFADEVLCWLYGTVKENEDYILQF     RLELL+  SCPDAIT+HV  L++
Sbjct  480   RVCLAFADEVLCWLYGTVKENEDYILQFVHPFMRLELLQAQSCPDAITNHVHLLQN  535



>emb|CDX78785.1| BnaA01g08520D [Brassica napus]
Length=515

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/414 (67%), Positives = 325/414 (79%), Gaps = 8/414 (2%)
 Frame = -2

Query  1621  EEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnG--ILPSPNYPPRQNYGY  1448
             + Y KTPA STY +PVLP   +++N    G            G  +LP P   P    G 
Sbjct  94    DNYTKTPALSTYSIPVLPAGWSSDNNGGRGGTGRGRWGNGRGGAGLLPRPGPFPGGREGR  153

Query  1447  GRG-----NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSL  1283
             G       N  RDERFVSELK +KS+ETL+RKST  QEPCEL  YSRV+ G+V+FD+R L
Sbjct  154   GGFGGRYQNYQRDERFVSELKLSKSKETLSRKSTVFQEPCELTSYSRVEGGEVFFDERGL  213

Query  1282  RLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLN  1103
             RLFKR ++EDIG+DLN+G+DTF EK DLGS+GFGD LA IR KNI L+ +HFVT+RNNLN
Sbjct  214   RLFKRHVSEDIGADLNQGYDTFIEKIDLGSEGFGDFLASIRAKNISLENIHFVTFRNNLN  273

Query  1102  KIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGR  923
             KI+  AY RNEPWEMGVHKR G +YLDVHKLPERP+S+LDRRRCYWGYCFESLATEDPGR
Sbjct  274   KILGAAYNRNEPWEMGVHKRNGTIYLDVHKLPERPQSDLDRRRCYWGYCFESLATEDPGR  333

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
             + G+ IH +DANVE+ +V+KTK+GAHR+LMGAEMDCCD  D+GRR Y+ELKTSRE LD R
Sbjct  334   AYGEDIHHVDANVEFVSVVKTKLGAHRVLMGAEMDCCDETDEGRRIYIELKTSRE-LDDR  392

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
             T E FEREKLLKFWIQSF+AGVPYI+VG+RDD GRLVRTERLRT +I  R ++K+YWQGG
Sbjct  393   TVERFEREKLLKFWIQSFVAGVPYILVGYRDDGGRLVRTERLRTKDIAHRARLKNYWQGG  452

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLE  401
             VCLAFADEVLCWLYGTVKENEDY LQF     RLELL+  SCPDAIT+HV  L+
Sbjct  453   VCLAFADEVLCWLYGTVKENEDYTLQFVHPFMRLELLQAQSCPDAITNHVHLLQ  506



>ref|XP_010434636.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
[Camelina sativa]
Length=547

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/414 (68%), Positives = 331/414 (80%), Gaps = 7/414 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrw--qngrgnGILPSPN-YPPRQNY  1454
             NEEY KTPA STY +PVLP   + +N    G            G G+LP P  YP R N 
Sbjct  123   NEEYTKTPAISTYSIPVLPAGWSNDNHGGRGAMGRGRWPNGRGGPGLLPRPGPYPGRGNR  182

Query  1453  GYGRG---NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSL  1283
             G   G   N  RDERFVSELK +KS+ETLARK T  QEPCEL  YSRV+ G+V++D+R L
Sbjct  183   GGFGGRYQNYQRDERFVSELKLSKSKETLARKQTNFQEPCELTSYSRVEGGEVFYDERGL  242

Query  1282  RLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLN  1103
             RLFKR + E+IG+DLN+G+DTF EK+DLGS+GFGDLL  IR KNI L+ +HFVT+RNNLN
Sbjct  243   RLFKRHVAEEIGADLNQGYDTFIEKKDLGSEGFGDLLGSIRAKNISLENIHFVTFRNNLN  302

Query  1102  KIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGR  923
             KI+  AY R+EPWEMGVHKR G +YLDVHKLPERP+S+LDRRRCYWGYCFESLATEDPGR
Sbjct  303   KILGAAYNRHEPWEMGVHKRNGTIYLDVHKLPERPQSDLDRRRCYWGYCFESLATEDPGR  362

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
             + G+ +H +DANVE+C+V+KTK+GAHR+LMGAEMDCCD  D+GRR Y+ELKTSRE LD R
Sbjct  363   AYGEEVHHVDANVEFCSVVKTKLGAHRVLMGAEMDCCDETDEGRRIYIELKTSRE-LDDR  421

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
             T + +EREKLLKFWIQSF+AGVPYI+VG+RDD GRLVRTERLRT +I  R ++K++WQGG
Sbjct  422   TVDRYEREKLLKFWIQSFVAGVPYILVGYRDDGGRLVRTERLRTKDIAHRARLKNFWQGG  481

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLE  401
             VCLAFADEVLCWLYGTVKENEDY+LQF     RLELL+  SCPDAIT+HV  L+
Sbjct  482   VCLAFADEVLCWLYGTVKENEDYMLQFQHPFMRLELLQAQSCPDAITNHVHLLQ  535



>ref|XP_009136858.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic [Brassica 
rapa]
Length=536

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/420 (66%), Positives = 324/420 (77%), Gaps = 20/420 (5%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNP------------TrggfgrgrwqngrgnGILPS  1481
             NEEY KTPA STY +PVLP   + +N             + G  G G             
Sbjct  113   NEEYTKTPALSTYSIPVLPAGWSNDNNHGGRGGMGRGRWSNGRGGPGLLPRPGPYPGGRG  172

Query  1480  PNYPPRQNYGYGRGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVY  1301
                   Q+Y        RDERFVSELK +KS+ETL+RKST  QEPCEL  YSRV+ G+V+
Sbjct  173   GRGGRYQSY-------QRDERFVSELKLSKSKETLSRKSTVFQEPCELTSYSRVEGGEVF  225

Query  1300  FDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVT  1121
             +D+R LRLFKR ++EDIG+DLN+G+DTF EK DLGS+GFGDLL  IR KNI L+ +HFVT
Sbjct  226   YDERGLRLFKRHVSEDIGADLNQGYDTFIEKIDLGSEGFGDLLGSIRAKNISLENIHFVT  285

Query  1120  YRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLA  941
             +RNNLNKI+  AY R+EPWEMGVHKR G +YLDVHKLPERP+S+LDRRRCYWGYCFESLA
Sbjct  286   FRNNLNKILGAAYNRHEPWEMGVHKRNGTIYLDVHKLPERPQSDLDRRRCYWGYCFESLA  345

Query  940   TEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSR  761
             TEDPGR+ G+ IH +DANVE+C+V+KTK+GAHR+LMGAEMDCCD  D+GRR Y+ELKT+R
Sbjct  346   TEDPGRAYGEEIHHVDANVEFCSVVKTKLGAHRVLMGAEMDCCDETDEGRRIYIELKTTR  405

Query  760   ELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK  581
             E LD RT E +EREKLLKFWIQSF+AGVPYIVVG+RDD GRLVRTERLRT +I  R ++K
Sbjct  406   E-LDDRTVERYEREKLLKFWIQSFVAGVPYIVVGYRDDGGRLVRTERLRTKDIAHRARLK  464

Query  580   SYWQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLE  401
             +YWQGGVCLAFADEVLCWLYGTVKENEDY LQF     RLELL+  SCPDAIT+HV  L+
Sbjct  465   NYWQGGVCLAFADEVLCWLYGTVKENEDYTLQFVHPFMRLELLQAQSCPDAITNHVHLLQ  524



>ref|XP_009130831.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
[Brassica rapa]
Length=541

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/451 (65%), Positives = 347/451 (77%), Gaps = 9/451 (2%)
 Frame = -2

Query  1732  EDDNGEVRSSLNSNINSHSKYGNEdddsdkdlfgsDNEEYVKTPATSTYPVPVLPPVRNT  1553
             ED  G+   S N N++S S    E++D ++DLFGSDNE+Y KTPA STY +PVLP   ++
Sbjct  77    EDHGGDSYRS-NDNVDSGSYPYEEEEDDERDLFGSDNEDYTKTPALSTYSIPVLPAGWSS  135

Query  1552  NNPTrggfgrgrwqngrgnGIL-------PSPNYPPRQNYGYGRGNAPRDERFVSELKFA  1394
             +N    G            G                R  +G    N  RDERFVSELK +
Sbjct  136   DNNGGRGGMGRGRWGNGRGGAGLLPRPGPFPGGRGGRGGFGGRYQNYQRDERFVSELKLS  195

Query  1393  KSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFT  1214
             KS+ETL+RKST  QEPCEL  YSRV+ G+V+FD+R LRLFKR ++EDIG+DLN+G+DTF 
Sbjct  196   KSKETLSRKSTVFQEPCELTSYSRVEGGEVFFDERGLRLFKRHVSEDIGADLNQGYDTFI  255

Query  1213  EKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGV  1034
             EK DLGS+GFGD LA IR KNI L+ +HFVT+RNNLNKI+  AY RNEPWEMGVHKR G 
Sbjct  256   EKIDLGSEGFGDFLASIRAKNISLENIHFVTFRNNLNKILGAAYNRNEPWEMGVHKRNGT  315

Query  1033  VYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKI  854
             +YLDVHKLPERP+S+LDRRRCYWGYCFESLATEDPGR+ G+ IH +DANVE+ +V+KTK+
Sbjct  316   IYLDVHKLPERPQSDLDRRRCYWGYCFESLATEDPGRAYGEDIHHVDANVEFVSVVKTKL  375

Query  853   GAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVP  674
             GAHR+LMGAEMDCCD  D+GRR Y+ELKTSRE LD RT E FEREKLLKFWIQSF+AGVP
Sbjct  376   GAHRVLMGAEMDCCDETDEGRRIYIELKTSRE-LDDRTVERFEREKLLKFWIQSFVAGVP  434

Query  673   YIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDY  494
             YI+VG+RDD GRLVRTERLRT +I +R ++K+YWQGGVCLAFADEVLCWLYGTVKENEDY
Sbjct  435   YILVGYRDDGGRLVRTERLRTKDIARRARLKNYWQGGVCLAFADEVLCWLYGTVKENEDY  494

Query  493   ILQFTPHSNRLELLRGPSCPDAITHHVQQLE  401
              LQF     RLELL+  SCPDAIT+HV  L+
Sbjct  495   TLQFVHPFIRLELLQAQSCPDAITNHVHLLQ  525



>ref|XP_006414206.1| hypothetical protein EUTSA_v10024864mg [Eutrema salsugineum]
 gb|ESQ55659.1| hypothetical protein EUTSA_v10024864mg [Eutrema salsugineum]
Length=541

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/417 (67%), Positives = 322/417 (77%), Gaps = 15/417 (4%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNN---------PTrggfgrgrwqngrgnGILPSPNY  1472
             NEEY +TPA STY +PVLP   +  N         P   G      + G   G       
Sbjct  123   NEEYTRTPAISTYSIPVLPAGWSNENQRGIGRGRWPNGRGGPGLLPRPGPYPGGRGGRGG  182

Query  1471  PPRQNYGYGRGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDD  1292
                +   Y      RDERFVSELK +KS+ETLAR  T  QEPCELA YSRV+ G+V+FDD
Sbjct  183   FGGRYQSY-----QRDERFVSELKLSKSKETLARIHTNFQEPCELASYSRVEGGEVFFDD  237

Query  1291  RSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRN  1112
             R LRLFKRL++E+IG+DLN+G+DTF EKRDLGS+GFGDLL  IR +NI L+ +HFVT+RN
Sbjct  238   RGLRLFKRLVSEEIGADLNQGYDTFIEKRDLGSEGFGDLLGSIRARNISLENIHFVTFRN  297

Query  1111  NLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATED  932
             NLNKI+  AY R+EPWEMGVHKR G +YLDVHKLPERP+SELDRRRCYWGYCFESLATED
Sbjct  298   NLNKILGAAYNRHEPWEMGVHKRNGTIYLDVHKLPERPQSELDRRRCYWGYCFESLATED  357

Query  931   PGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELL  752
             PGR+ G+ I  +DANVE+C+VIKTK+GAHR+LMGAEMDCCD  D+G R Y+ELKTSRE L
Sbjct  358   PGRAYGEEISHVDANVEFCSVIKTKLGAHRVLMGAEMDCCDETDEGLRMYIELKTSRE-L  416

Query  751   DHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYW  572
             D RT E FEREKLLKFWIQSF+AGVPYI+VGFRDD GRLVRTERL+T +I  R ++K+YW
Sbjct  417   DDRTVERFEREKLLKFWIQSFVAGVPYILVGFRDDAGRLVRTERLKTKDIAHRARLKNYW  476

Query  571   QGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLE  401
             QGGVCLAFADEVLCWLYGTVKENEDY LQF     RLELL+  SCPDAIT+HV  L+
Sbjct  477   QGGVCLAFADEVLCWLYGTVKENEDYTLQFVHPFMRLELLQAQSCPDAITNHVYLLQ  533



>gb|EEE63613.1| hypothetical protein OsJ_18430 [Oryza sativa Japonica Group]
Length=485

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/399 (70%), Positives = 326/399 (82%), Gaps = 14/399 (4%)
 Frame = -2

Query  1582  VPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGYG----RGNAPRDER  1418
               VLP +RNTNN +RGG+G    +      +LP P  +P R N+GYG     GN    E 
Sbjct  90    AAVLPSIRNTNNHSRGGYGGRNGRGPP---LLPRPGGHPGRHNFGYGGRFSHGNGRNVEG  146

Query  1417  FVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDL  1238
             FVSE+K  KSEETL+RK  A QEP E+ACYSR++ GDVYFDDRSLRLFKR I + +G +L
Sbjct  147   FVSEMKLNKSEETLSRKFVAFQEPSEIACYSRIEGGDVYFDDRSLRLFKRNICDYVGENL  206

Query  1237  NEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEM  1058
             N+GF++F EKRDLGS+GFGDLLACIRN  +PL  +HFVTYRNNLNKI+ATAY+R EPW+M
Sbjct  207   NKGFESFIEKRDLGSEGFGDLLACIRNSTVPLQNIHFVTYRNNLNKILATAYLR-EPWKM  265

Query  1057  GVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEY  878
             GVHKR GVVYLDVHKLPERP+SE++RRRCYWGY FE+LATE+    DG     IDANVE+
Sbjct  266   GVHKRNGVVYLDVHKLPERPQSEVERRRCYWGYSFENLATENSIDEDG---RGIDANVEF  322

Query  877   CAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWI  698
             CAVIKTK+GAHRI+MGAEMDCCD+ DDGRRFYVELKTSRE L++ T E FE+EKLL+FWI
Sbjct  323   CAVIKTKLGAHRIIMGAEMDCCDATDDGRRFYVELKTSRE-LEYHTVEKFEKEKLLRFWI  381

Query  697   QSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYG  518
             QSF+AGVPY+VVGFR+D G L+RTERLRT EITQ+VK K+YWQGGVCLAFADEVLCWLYG
Sbjct  382   QSFIAGVPYVVVGFRNDAGVLIRTERLRTKEITQKVKAKNYWQGGVCLAFADEVLCWLYG  441

Query  517   TVKENEDYILQFTPHSNRLELLRGPS-CPDAITHHVQQL  404
             TV+ENEDYILQF    NRLELLR  S CPDAITHHV+QL
Sbjct  442   TVRENEDYILQFVHPFNRLELLRAQSPCPDAITHHVEQL  480



>gb|EPS62858.1| hypothetical protein M569_11930, partial [Genlisea aurea]
Length=472

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/399 (75%), Positives = 337/399 (84%), Gaps = 11/399 (3%)
 Frame = -2

Query  1729  DDNGEVRSSLNSNINSHSKYGNEdddsdkdlfgsDNEEYVKTPATSTYPVPVLPPVRNTN  1550
             D+N EVRS       S+S Y     D +KDLFGSDNE YVK PA S YP+PVLPP+ N +
Sbjct  81    DNNVEVRSL------SYSDYNYNLVDDEKDLFGSDNEGYVKIPANSIYPIPVLPPLPNMS  134

Query  1549  NPTrggfgrgrwqngrgnGILPSP-NYPPRQNYGYGRG--NAPRDERFVSELKFAKSEET  1379
             N  RGGF RGRWQN RG G+LP P +YP RQ YGYG    N PRDERFVSE+K  KSEET
Sbjct  135   NNARGGFRRGRWQNDRGRGLLPRPGSYPQRQGYGYGSKFFNGPRDERFVSEMKITKSEET  194

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
             LARK  A QEPCELACYSRV+ GDVYFDDRSLRLFKRLITEDIG+DLNEGFDTF EK+DL
Sbjct  195   LARKVIAFQEPCELACYSRVEGGDVYFDDRSLRLFKRLITEDIGADLNEGFDTFVEKKDL  254

Query  1198  GSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDV  1019
             GSQGFGDLLA IR+KNIPL+ MHFVT+RNNLNKI+ATAY R+EPWEMGVHKR GVVYLDV
Sbjct  255   GSQGFGDLLAAIRDKNIPLENMHFVTFRNNLNKILATAYNRHEPWEMGVHKRNGVVYLDV  314

Query  1018  HKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRI  839
             HKLPERP+++LDRRR YWGYCFE+LATEDP R+DG+ IH +DANVEYC+V+KTK+GAHRI
Sbjct  315   HKLPERPETDLDRRRSYWGYCFETLATEDPRRTDGEGIHHVDANVEYCSVLKTKLGAHRI  374

Query  838   LMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVG  659
             LMGAEMDCCDS D+GRRFYVELKT+RE LD+ TEE +EREKLLKFWIQSFLAGVPYIV+G
Sbjct  375   LMGAEMDCCDSTDEGRRFYVELKTTRE-LDYHTEERYEREKLLKFWIQSFLAGVPYIVIG  433

Query  658   F-RDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFA  545
             F RDD G+LVRTERLRT +IT RVKMK+YWQ  VC  F+
Sbjct  434   FSRDDRGKLVRTERLRTKDITHRVKMKNYWQVCVCRVFS  472



>ref|XP_006838483.1| hypothetical protein AMTR_s00002p00157480 [Amborella trichopoda]
 gb|ERN01052.1| hypothetical protein AMTR_s00002p00157480 [Amborella trichopoda]
Length=514

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/417 (67%), Positives = 331/417 (79%), Gaps = 9/417 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgr---grwqngrgnGILPSPNYPPRQNY  1454
             +E+Y+KT A S +PVP LP +R +NN  R   GR       +  G GILP   Y  RQ +
Sbjct  98    DEDYMKTLAKSPFPVPTLPVIRISNNQNRMNSGRGRWQPSFSNGGRGILPRGPYHHRQPF  157

Query  1453  GYGR-----GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDR  1289
             G         N   DER VSE+  + SEETL+RK+  IQEPCELACYSRV+ G+V+FDDR
Sbjct  158   GASHPGHRFANGRPDERLVSEMMLSMSEETLSRKNVKIQEPCELACYSRVEGGEVHFDDR  217

Query  1288  SLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNN  1109
              LR F+RL++E++G+DLN GF+TF EKRD  ++GFGDLLA IRNK IPL  +HFVT+RNN
Sbjct  218   CLRQFRRLVSEEVGADLNAGFETFIEKRDTDNEGFGDLLASIRNKKIPLQNIHFVTFRNN  277

Query  1108  LNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDP  929
             LNKIMATAY R +PWEMGVHKR GVVYLDVHKLPERP++ELDRRRCYWGY FE+LATE+ 
Sbjct  278   LNKIMATAYNRLDPWEMGVHKRNGVVYLDVHKLPERPQNELDRRRCYWGYSFENLATEES  337

Query  928   GRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLD  749
              R+D D +H +DANVE+CAVIKTK+GAHRI+MGAEMDC D  D+GR+ Y+ELKT+RE LD
Sbjct  338   RRNDIDNLHPVDANVEFCAVIKTKLGAHRIIMGAEMDCYDISDNGRKHYIELKTNRE-LD  396

Query  748   HRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQ  569
               TEE FEREKLLKFWIQSF+AGVP+IVVGFRDD+GRL RTERLR N+I  RVKMK+YWQ
Sbjct  397   FHTEERFEREKLLKFWIQSFIAGVPWIVVGFRDDHGRLRRTERLRVNDIIHRVKMKNYWQ  456

Query  568   GGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLES  398
             G VCLAFADEV CWLYGTVK+NEDY+LQ+ P SNRLELL+  SCP +IT H++QL S
Sbjct  457   GTVCLAFADEVFCWLYGTVKDNEDYVLQYMPPSNRLELLQARSCPPSITAHLEQLGS  513



>ref|XP_008803076.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic isoform 
X3 [Phoenix dactylifera]
Length=501

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/414 (71%), Positives = 336/414 (81%), Gaps = 31/414 (7%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnG----ILPSPNYPPRQN  1457
             NEEY++TPA S +PVPVLPP+++TNN  RG FGRGRWQ+G  N     +LP P Y  RQN
Sbjct  99    NEEYMRTPARSPFPVPVLPPLQSTNNHGRGNFGRGRWQSGYPNDRGPPLLPRPGYMQRQN  158

Query  1456  YGYGR---GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
             +GYGR    N   DERFVSE+K  KSEETL+RK+ AIQE                     
Sbjct  159   FGYGRFSHANGRNDERFVSEMKLTKSEETLSRKAIAIQE---------------------  197

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
              RLFKR I +D+G+ LN+GF++F EKRDLGS+GFGDLLACIRNKNIPL  +HFVT+RNNL
Sbjct  198   -RLFKRSICQDVGAHLNQGFESFVEKRDLGSEGFGDLLACIRNKNIPLQNIHFVTFRNNL  256

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+ TAYIRNEPW+MGVHKR GVVYLDVHKLPERP+SE+DRRRCYWGY FE+LATE+  
Sbjct  257   NKILTTAYIRNEPWKMGVHKRNGVVYLDVHKLPERPQSEVDRRRCYWGYAFENLATENSR  316

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDH  746
               D D    IDANVE+C+VIKTK+GAHRI+MGAEMDCCDS DDGRRFYVELKTSRE LD+
Sbjct  317   EIDADG-KGIDANVEFCSVIKTKLGAHRIIMGAEMDCCDSTDDGRRFYVELKTSRE-LDY  374

Query  745   RTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQG  566
             RTEE +EREKLLKFWIQSFLAGVPYIV+GFR+D G LVRTERLRT +ITQRVKMK+YWQG
Sbjct  375   RTEERYEREKLLKFWIQSFLAGVPYIVIGFRNDAGILVRTERLRTKDITQRVKMKNYWQG  434

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             GVCLAFADEVLCWLYGTVKENEDY+LQF PH +RLELLR  SCPD IT HV+QL
Sbjct  435   GVCLAFADEVLCWLYGTVKENEDYVLQFVPHFHRLELLRAQSCPDVITQHVEQL  488



>emb|CDX90463.1| BnaA03g43180D [Brassica napus]
Length=538

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/417 (66%), Positives = 323/417 (77%), Gaps = 10/417 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVP-----VLPPVRNTNNPTrggfgrgrwqngrg----nGILPSPNY  1472
             NEEY KTPA STY +P      LP   + +N    G       +           P P  
Sbjct  111   NEEYTKTPALSTYSIPGKFESFLPAGWSNDNHGGRGGMGRGRWSNGRGGPGLLPRPGPYP  170

Query  1471  PPRQNYGYGRGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDD  1292
               R   G    +  RDERFVSELK +KS+ETL+RKST  QEPCEL  YSRV+ G+V++D+
Sbjct  171   GGRGGRGGRYQSYQRDERFVSELKLSKSKETLSRKSTVFQEPCELTSYSRVEGGEVFYDE  230

Query  1291  RSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRN  1112
             R LRLFKR ++EDIG+DLN+G+DTF EK DLGS+GFGDLL  IR KNI L+ +HFVT+RN
Sbjct  231   RGLRLFKRHVSEDIGADLNQGYDTFIEKIDLGSEGFGDLLGSIRAKNISLENIHFVTFRN  290

Query  1111  NLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATED  932
             NLNKI+  AY R+EPWEMGVHKR G +YLDVHKLPERP+S+LDRRRCYWGYCFESLATED
Sbjct  291   NLNKILGAAYNRHEPWEMGVHKRNGTIYLDVHKLPERPQSDLDRRRCYWGYCFESLATED  350

Query  931   PGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELL  752
             PGR+ G+ IH +DANVE+C+V+KTK+GAHR+LMGAEMDCCD  D+GRR Y+ELKT+RE L
Sbjct  351   PGRAYGEEIHHVDANVEFCSVVKTKLGAHRVLMGAEMDCCDETDEGRRIYIELKTTRE-L  409

Query  751   DHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYW  572
             D RT E +EREKLLKFWIQSF+AGVPYIVVG+RDD GRLVRTERLRT +I  R ++K+YW
Sbjct  410   DDRTVERYEREKLLKFWIQSFVAGVPYIVVGYRDDGGRLVRTERLRTKDIAHRARLKNYW  469

Query  571   QGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLE  401
             QGGVCLAFADEVLCWLYGTVKENEDY LQF     RLELL+  SCPDAIT+HV  L+
Sbjct  470   QGGVCLAFADEVLCWLYGTVKENEDYTLQFVHPFMRLELLQAQSCPDAITNHVHLLQ  526



>emb|CDY38413.1| BnaC01g10220D [Brassica napus]
Length=509

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/405 (67%), Positives = 316/405 (78%), Gaps = 1/405 (0%)
 Frame = -2

Query  1615  YVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPNYPPRQNYGYGRGN  1436
             Y KTPA STY +PVLP   +++N    G            G    P    R  +G    N
Sbjct  91    YTKTPALSTYSIPVLPAGWSSDNHGGRGGMGRGRWANGRGGAGLLPRPGGRGGFGGRYQN  150

Query  1435  APRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITE  1256
               RDERFVSELK +KS+ETL+RK T  QEPCEL  YSRV+ G V+FD+R LRLFKR ++E
Sbjct  151   YQRDERFVSELKLSKSKETLSRKHTVFQEPCELTSYSRVEGGQVFFDERGLRLFKRHVSE  210

Query  1255  DIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIR  1076
             DIG+DLN+G+DTF EK DLGS+GFGD L  IR KNI L+ +HFVT+RNNLNKI+   Y R
Sbjct  211   DIGADLNQGYDTFIEKIDLGSEGFGDFLGSIRAKNISLENIHFVTFRNNLNKILGAVYNR  270

Query  1075  NEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDI  896
             +EPWEMGVHKR G +YLDVHKLPERP+S+LDRRRCYWGYCFESLATEDPGR+ G+ IH +
Sbjct  271   HEPWEMGVHKRNGTIYLDVHKLPERPQSDLDRRRCYWGYCFESLATEDPGRAYGEDIHHV  330

Query  895   DANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREK  716
             D+NVE+ +V+KTK+GAHR+LMGAEMDCCD  D+GRR Y+ELKTSRE LD RT E FEREK
Sbjct  331   DSNVEFVSVVKTKLGAHRVLMGAEMDCCDETDEGRRIYIELKTSRE-LDDRTVERFEREK  389

Query  715   LLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEV  536
             LLKFWIQSF+AGVPYI+VG+RDD GRLVRTERLRT +I  R ++K+YWQG VCLAFADEV
Sbjct  390   LLKFWIQSFVAGVPYILVGYRDDGGRLVRTERLRTKDIAHRARLKNYWQGNVCLAFADEV  449

Query  535   LCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLE  401
             LCWLYGTVKENEDY LQF     RLELL+  SCPDAIT+HV  L+
Sbjct  450   LCWLYGTVKENEDYTLQFVHPFMRLELLQAQSCPDAITNHVHLLQ  494



>emb|CDY09613.1| BnaC07g34480D [Brassica napus]
Length=530

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/456 (63%), Positives = 340/456 (75%), Gaps = 24/456 (5%)
 Frame = -2

Query  1732  EDDNGEVRSSLNSNINSHSKYGNEdddsdkdlfgsDNEEYVKTPATSTYPVPVLPPVRNT  1553
             +DD+G      N N      Y  E+++ +KDLFGSDNEEY KTPA STY +P      N 
Sbjct  77    DDDDGVDSYRSNDNNGETGVYEEEEEEEEKDLFGSDNEEYTKTPAISTYSIPG----NND  132

Query  1552  NN------------PTrggfgrgrwqngrgnGILPSPNYPPRQNYGYGRGNAPRDERFVS  1409
             NN             + G  G G                   Q+Y        RDERFVS
Sbjct  133   NNHGGRGGMGRGRWSSNGRGGPGLLPRPGPYPGGRGGRGGRYQSY-------QRDERFVS  185

Query  1408  ELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEG  1229
             ELK +KS+ETL+RKST  QEPCEL  YSRV+ G+V++D+R LRLFKR ++EDIG+DLN+G
Sbjct  186   ELKLSKSKETLSRKSTVFQEPCELTSYSRVEGGEVFYDERGLRLFKRHVSEDIGADLNQG  245

Query  1228  FDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVH  1049
             +DTF EK DL S+GFGDLL  IR KNI L+ +HFVT+RNNLNKI+  AY R+EPWEMGVH
Sbjct  246   YDTFIEKIDLDSEGFGDLLGSIRAKNISLENIHFVTFRNNLNKILGAAYNRHEPWEMGVH  305

Query  1048  KRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAV  869
             KR G +YLDVHKLPERP+S+LDRRRCYWGYCFESLATEDPGR+ G+ IH +DANVE+C+V
Sbjct  306   KRNGTIYLDVHKLPERPQSDLDRRRCYWGYCFESLATEDPGRAYGEEIHHVDANVEFCSV  365

Query  868   IKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSF  689
             +KTK+GAHR+LMGAEMDCCD  D+GRR Y+ELKT+RE LD RT E +EREKLLKFWIQSF
Sbjct  366   VKTKLGAHRVLMGAEMDCCDETDEGRRIYIELKTTRE-LDDRTVERYEREKLLKFWIQSF  424

Query  688   LAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVK  509
             +AGVPYIVVG+RDD GRLVRTERLRT +I  R ++K+YWQGGVCLAFADEVLCWLYGTVK
Sbjct  425   VAGVPYIVVGYRDDGGRLVRTERLRTKDIAHRARLKNYWQGGVCLAFADEVLCWLYGTVK  484

Query  508   ENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLE  401
             ENEDY LQF     RLELL+  SCPDAIT+HV  L+
Sbjct  485   ENEDYTLQFVHPFMRLELLQAQSCPDAITNHVHLLQ  520



>ref|NP_001190756.1| glycine-rich protein [Arabidopsis thaliana]
 gb|AEE83926.1| glycine-rich protein [Arabidopsis thaliana]
Length=536

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/416 (67%), Positives = 322/416 (77%), Gaps = 16/416 (4%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnG--ILPSPN-YPPRQNY  1454
             NEEY KTPA STY +PVLP   + +N    G       +    G  +LP P  YP R   
Sbjct  121   NEEYTKTPAISTYSIPVLPAGWSNDNHGGRGGMGRGRWSNGRGGPGLLPRPGPYPGRGGN  180

Query  1453  GYGRG----NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
               G G    N  RDERFVSELK +KS+ETLARK T  QEPCEL CYSRV+ G+       
Sbjct  181   RGGFGGRYQNYQRDERFVSELKLSKSKETLARKQTNFQEPCELTCYSRVEGGE-------  233

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
              RLFKR I E+IG+DLN+G+DTF EK+DLGS+GFGDLL  IR KNI LD +HFVT+RNNL
Sbjct  234   -RLFKRHIGEEIGADLNQGYDTFIEKKDLGSEGFGDLLGSIRAKNISLDNIHFVTFRNNL  292

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+  AY R+EPWEMGVHKR G +YLDVHKLPERP+S+LDRRRCYWGYCFESLATEDPG
Sbjct  293   NKILGAAYNRHEPWEMGVHKRNGTIYLDVHKLPERPQSDLDRRRCYWGYCFESLATEDPG  352

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDH  746
             R+ G+ IH +DANVE+C+V++TK+GAHR++MGAEMDCCD  D G+RFYVELKT+RE LD 
Sbjct  353   RAYGEEIHHVDANVEFCSVVRTKLGAHRVMMGAEMDCCDVSDKGKRFYVELKTTRE-LDD  411

Query  745   RTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQG  566
             RT + FEREKLLKFWIQSF+AGVPYIVVGFRDD GRLVRTERL T +I  R ++K+YWQ 
Sbjct  412   RTVDRFEREKLLKFWIQSFVAGVPYIVVGFRDDGGRLVRTERLTTRDIAHRARLKNYWQV  471

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLES  398
              VCLAFADEVLCWLYGTVKENEDYILQF     RLELL+  SCPDAIT+HV  L++
Sbjct  472   RVCLAFADEVLCWLYGTVKENEDYILQFVHPFMRLELLQAQSCPDAITNHVHLLQN  527



>gb|AFW77892.1| methylase [Zea mays]
Length=933

 Score =   545 bits (1405),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 289/457 (63%), Positives = 337/457 (74%), Gaps = 57/457 (12%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVP--------------------------------------------  1577
             NEEYV+TPA S Y VP                                            
Sbjct  123   NEEYVRTPARSHYLVPGPLLVNPKVGTNALKYVSRLNSSSFCVAIELSRRPILNPAKFIQ  182

Query  1576  ---VLPPVRNTNNPTrggfgrgrwqngrgnGILPSPNYPPRQNYGYGR-GNAPRDERFVS  1409
                +LPP+RNTNN +RGGFG    +            +P R N+GYGR GN    E  VS
Sbjct  183   WFYLLPPIRNTNNHSRGGFGGRGGRGPPLLPR--PGGHPGRHNFGYGRFGNGRHVEGLVS  240

Query  1408  ELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEG  1229
             ++K  KSEETL+RK+   QEPCE+AC SRV+ G+VYFDDRSLRLFKR I E  G+DLN+G
Sbjct  241   DMKLNKSEETLSRKAVTFQEPCEIACLSRVEGGEVYFDDRSLRLFKREICEYRGADLNKG  300

Query  1228  FDTFTEKRDLGSQGFGDLLACIRNKNIPL-DRMHFVTYRNNLNKIMATAYIRNEPWEMGV  1052
             F+++ EKRDLGS+GFGDLLACIRN NI L + +HFVTYRNNLNKI+ATAY+R EPW+MGV
Sbjct  301   FESYIEKRDLGSEGFGDLLACIRNSNILLQNTIHFVTYRNNLNKILATAYLR-EPWKMGV  359

Query  1051  HKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCA  872
             HKR+GVVYLDVHKLPERPKSE++R+RCYWGY FE+LATE+    DG     IDANVE+C+
Sbjct  360   HKRRGVVYLDVHKLPERPKSEVERKRCYWGYSFENLATENSFSDDG---RGIDANVEFCS  416

Query  871   VIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQS  692
             VIKTK+GAHRI+MGAEMDCCD+ DDGRRFYVELKTSREL ++ T E +E+EKLL+FWIQS
Sbjct  417   VIKTKLGAHRIVMGAEMDCCDATDDGRRFYVELKTSREL-EYHTVEAYEKEKLLRFWIQS  475

Query  691   FLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTV  512
             FLAGVPY+VVGFR+D G LVRTERLRT +ITQ+VK K+YWQGGVCLAFADEVLCWLYGTV
Sbjct  476   FLAGVPYVVVGFRNDAGILVRTERLRTKDITQKVKAKNYWQGGVCLAFADEVLCWLYGTV  535

Query  511   KENEDYILQFTPHSNRLELLRGPS-CPDAITHHVQQL  404
             KENEDY+LQF    NRLELLR  S CP+AIT HVQQL
Sbjct  536   KENEDYVLQFVHPFNRLELLRAQSPCPEAITLHVQQL  572



>gb|ABD65180.1| glycine-rich protein -related [Brassica oleracea]
Length=526

 Score =   515 bits (1326),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 264/425 (62%), Positives = 311/425 (73%), Gaps = 36/425 (8%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVP-----VLPPVRNTNNPTrggfgrgrwqngrgnGILPS------P  1478
             NEEY KTPA STY +P      LP   + +N   G  G GR +        P       P
Sbjct  111   NEEYTKTPALSTYSIPGKFESFLPAGWSNDNNHGGRGGMGRGRWSSNGRGGPGLLPRPGP  170

Query  1477  NYPPRQNYGYGRGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYF  1298
                 R   G    +  RDERFVSELK +KS+ETL+RKST  QEPCEL  YSRV+ G+V++
Sbjct  171   YPGGRGGRGGRYQSYQRDERFVSELKLSKSKETLSRKSTVFQEPCELTSYSRVEGGEVFY  230

Query  1297  DDRSLRLFKRLITEDIGSDLNEGFDTFTEK------RDLGSQGFGDLLACIRNKNIPLDR  1136
             D+R LRLFKR ++EDIG+DLN+G+DTF EK       DLGS+GFGDLL  IR KNI L+ 
Sbjct  231   DERGLRLFKRHVSEDIGADLNQGYDTFIEKIGNGFSADLGSEGFGDLLGSIRAKNISLEN  290

Query  1135  MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYC  956
             +HFVT+RNNLNKI+  AY R+EPWEMGVHKR G +YLDVHKLPERP+S+LDRRRCYWGYC
Sbjct  291   IHFVTFRNNLNKILGAAYNRHEPWEMGVHKRNGTIYLDVHKLPERPQSDLDRRRCYWGYC  350

Query  955   FESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVE  776
             FESLATEDPGR+ G+ IH +DANVE+C+V+KTK+GAHR+LMGAEMDCCD  D+GRR Y+E
Sbjct  351   FESLATEDPGRAYGEEIHHVDANVEFCSVVKTKLGAHRVLMGAEMDCCDETDEGRRIYIE  410

Query  775   LKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQ  596
             LKT+RE                   IQSF+AGVPYIVVG+RDD GRLVRTERLRT +I  
Sbjct  411   LKTTRE-------------------IQSFVAGVPYIVVGYRDDGGRLVRTERLRTKDIAH  451

Query  595   RVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHH  416
             R ++K+YWQGGVCLAFADEVLCWLYGTVKENEDY LQF     RLELL+  SCPDAIT+H
Sbjct  452   RARLKNYWQGGVCLAFADEVLCWLYGTVKENEDYTLQFVHPFMRLELLQAQSCPDAITNH  511

Query  415   VQQLE  401
             V  L+
Sbjct  512   VHLLQ  516



>ref|XP_006440151.1| hypothetical protein CICLE_v10019303mg [Citrus clementina]
 ref|XP_006440153.1| hypothetical protein CICLE_v10019303mg [Citrus clementina]
 gb|ESR53391.1| hypothetical protein CICLE_v10019303mg [Citrus clementina]
 gb|ESR53393.1| hypothetical protein CICLE_v10019303mg [Citrus clementina]
Length=540

 Score =   489 bits (1258),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 248/330 (75%), Positives = 275/330 (83%), Gaps = 8/330 (2%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrw--qngrgnGILPSPNYPPRQNYG  1451
             NE Y +T A S YP+PVLP VRN NN    G         +  G GILP P YPPRQ  G
Sbjct  213   NEAYCRTSAISPYPIPVLPVVRNNNNHGGRGGFGRGRWPNDRGGVGILPRPGYPPRQG-G  271

Query  1450  YGRG----NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSL  1283
             YG G    N  +DERFVSE K ++SEETL+RK  A QEPCELA YSRV+ GDVYFDDRSL
Sbjct  272   YGHGSRFSNGRQDERFVSEFKLSRSEETLSRKVVAFQEPCELAQYSRVEGGDVYFDDRSL  331

Query  1282  RLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLN  1103
             RLFKRLI+ED+G+DLNEGFDTF EK++LGS+GFGDLL+CIRN+NIPL  MHFVT+RNNLN
Sbjct  332   RLFKRLISEDVGADLNEGFDTFIEKKELGSEGFGDLLSCIRNRNIPLQNMHFVTFRNNLN  391

Query  1102  KIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGR  923
             KI+ATAYIRNE W MGVHKR GVVYLDVHK+ ERPKSELDRRRCYWGYCFESLATEDP R
Sbjct  392   KILATAYIRNEAWAMGVHKRNGVVYLDVHKVQERPKSELDRRRCYWGYCFESLATEDPRR  451

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
             +DG+ IH IDANVE+CAV+KTK+GAHR+LMGAEMDCCDS DDGRRFYVELKTSRE LD+ 
Sbjct  452   ADGEGIHHIDANVEFCAVMKTKLGAHRLLMGAEMDCCDSTDDGRRFYVELKTSRE-LDYH  510

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFR  653
             TEE FEREKLLKFWIQSFLAGVP+IVVGFR
Sbjct  511   TEERFEREKLLKFWIQSFLAGVPFIVVGFR  540



>ref|XP_002870094.1| hypothetical protein ARALYDRAFT_354992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46353.1| hypothetical protein ARALYDRAFT_354992 [Arabidopsis lyrata subsp. 
lyrata]
Length=1299

 Score =   511 bits (1315),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 262/446 (59%), Positives = 311/446 (70%), Gaps = 57/446 (13%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnG--ILPSPN-YPPRQNY  1454
             NEEY KTPA STY +PVLP   + +N    G       +    G  +LP P  YP R   
Sbjct  865   NEEYTKTPAISTYSIPVLPAGWSNDNHGGRGGMGRGRWSNGRGGPGLLPRPGPYPGRGGN  924

Query  1453  GYGRG----NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
               G G    N  RDERFVSELK +KS+ETLARK T  QEPCEL  YSRV+ G+V++D+R 
Sbjct  925   RGGFGGRYQNYQRDERFVSELKLSKSKETLARKHTNFQEPCELTSYSRVEGGEVFYDERG  984

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
             LRLFKR + E+IG+DLN+G+DTF EK DLGS+GFGDLL  IR KNI L+ +HFVT+RNNL
Sbjct  985   LRLFKRRVAEEIGADLNQGYDTFIEKIDLGSEGFGDLLDSIRAKNISLENIHFVTFRNNL  1044

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+  AY R+E WEMGVHKR G +YLDVHKLPERP+S+LDRRRCYWGYCFESLATEDPG
Sbjct  1045  NKILGAAYNRHEAWEMGVHKRNGTIYLDVHKLPERPQSDLDRRRCYWGYCFESLATEDPG  1104

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDH  746
             R  G+ IH +DANVE+C+V+KTK+GAHR+LMGAEMDCCD  ++G+R Y+ELKTSRE    
Sbjct  1105  RDYGEEIHHVDANVEFCSVVKTKLGAHRVLMGAEMDCCDETEEGKRIYIELKTSRE----  1160

Query  745   RTEEIFEREKLLKFWIQSFLAGVPYIVVGFR-----------------------------  653
                            IQSF+AGVPYIVVG+R                             
Sbjct  1161  ---------------IQSFVAGVPYIVVGYRYEFANHSEDKLKKPLAIQVNITIFPFSSW  1205

Query  652   --DDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQFT  479
               DD G+LVRTE L+T +I  R ++K++WQGGVCLAFADEVLCWLYGTVKENEDYILQF 
Sbjct  1206  CRDDGGKLVRTEMLKTKDIAHRARLKNFWQGGVCLAFADEVLCWLYGTVKENEDYILQFV  1265

Query  478   PHSNRLELLRGPSCPDAITHHVQQLE  401
                 RLELL+  SCPDAIT+HV  L+
Sbjct  1266  HPFMRLELLQAQSCPDAITNHVHLLQ  1291



>ref|XP_007039647.1| Glycine-rich protein isoform 2 [Theobroma cacao]
 gb|EOY24148.1| Glycine-rich protein isoform 2 [Theobroma cacao]
Length=436

 Score =   464 bits (1193),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 254/377 (67%), Positives = 276/377 (73%), Gaps = 64/377 (17%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPNYPPRQNYGYG  1445
             NE+Y KTPATS + +PVLP +RN NNP RGGFGRGRWQN RG GIL  P YPPRQ YGYG
Sbjct  111   NEDYCKTPATSPFSIPVLPVIRNPNNPGRGGFGRGRWQNDRGAGILGRPGYPPRQGYGYG  170

Query  1444  R--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFK  1271
                 N   DERFVSELK +KSEETL+RK  A QEPCELACYSRV                
Sbjct  171   SKFANGRHDERFVSELKLSKSEETLSRKCIAFQEPCELACYSRV----------------  214

Query  1270  RLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMA  1091
                         EG D + + R L                                 IMA
Sbjct  215   ------------EGGDVYFDDRSL---------------------------------IMA  229

Query  1090  TAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGD  911
             TAYIRNEPWEMGVHKR GVVYLDVHKLPERP+SELDR+RCYWGYCFESLATEDP R+DG+
Sbjct  230   TAYIRNEPWEMGVHKRNGVVYLDVHKLPERPRSELDRQRCYWGYCFESLATEDPRRADGE  289

Query  910   RIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEI  731
              IH IDAN EYC+VIKTK+GAHRILMGAEMDCCDS D+GRRFYVELKTSRE LD+ TEE 
Sbjct  290   EIHHIDANAEYCSVIKTKLGAHRILMGAEMDCCDSTDEGRRFYVELKTSRE-LDYHTEER  348

Query  730   FEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLA  551
             +EREKLLKFWIQSFLAGVPYIV+GFRDD GRLVRTERLRT +IT RVKMK+YWQGGVCLA
Sbjct  349   YEREKLLKFWIQSFLAGVPYIVIGFRDDAGRLVRTERLRTKDITHRVKMKNYWQGGVCLA  408

Query  550   FADEVLCWLYGTVKENE  500
             FADEVLCWLYGTVKE++
Sbjct  409   FADEVLCWLYGTVKESK  425



>gb|EMT12303.1| hypothetical protein F775_04838 [Aegilops tauschii]
Length=680

 Score =   452 bits (1164),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 255/466 (55%), Positives = 292/466 (63%), Gaps = 96/466 (21%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPNYPPRQNYGYG  1445
             NEEYVKTPA S Y VP  P V  +                       SP Y     YG  
Sbjct  247   NEEYVKTPARSNYLVPGPPLVTESAASFFWATL--------------SPQYLCCPRYGTP  292

Query  1444  RGNAPRDERFVSELKFAKSE-----ETLARKSTAIQ-------EPCELACYSRVQDGDVY  1301
                   DE   + L F   E     E +   +           +PCE+ACYSRV+ GDVY
Sbjct  293   TIFLEEDEVAGAHLFFQGQEAIQEDEIILATAGGFHMEMGVTLKPCEIACYSRVEGGDVY  352

Query  1300  FDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFV-  1124
             FDDRSLRLFKR I +  G DLN+GF+TF EKRDLGSQGFGDLLACIRN N+PL  +HFV 
Sbjct  353   FDDRSLRLFKRNICDYAGEDLNKGFETFIEKRDLGSQGFGDLLACIRNSNLPLQNIHFVV  412

Query  1123  ------------TYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDR  980
                         TYRNNLNKI+ATAY++ +PW+MGVHKR GVVYLDVHKLPERP+SE++R
Sbjct  413   KCIIANFIFVILTYRNNLNKILATAYLK-DPWKMGVHKRNGVVYLDVHKLPERPQSEIER  471

Query  979   RRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRD  800
             RRC+WGY FE+LATE+    DG     IDANVEYC+VIKTK+GAHRI+MGAEMDCCDS D
Sbjct  472   RRCFWGYSFENLATENSIDEDGS---GIDANVEYCSVIKTKLGAHRIVMGAEMDCCDSTD  528

Query  799   DGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTER  620
             DGRRFYVELKTSRE                   IQSFLAGV Y+VVGFR+D G L+RTER
Sbjct  529   DGRRFYVELKTSRE-------------------IQSFLAGVSYVVVGFRNDAGVLIRTER  569

Query  619   LRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKEN---------------------  503
             LRT +ITQ+VK K+YWQGGVCLAFADEVLCWLYGTVKE+                     
Sbjct  570   LRTKDITQKVKAKNYWQGGVCLAFADEVLCWLYGTVKESENSFTTFTRCIFTFLSQKYAL  629

Query  502   ------------EDYILQFTPHSNRLELLRGPS-CPDAITHHVQQL  404
                         EDY+LQF    +RLELL+  S CPDAIT HV+QL
Sbjct  630   VAIHNPEYLSSYEDYVLQFAHPFHRLELLKAQSPCPDAITLHVEQL  675



>gb|AAV31261.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG94274.1| unnamed protein product [Oryza sativa Japonica Group]
Length=440

 Score =   442 bits (1138),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 226/329 (69%), Positives = 266/329 (81%), Gaps = 13/329 (4%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGY  1448
             NE+YVKTPA S Y VPVLP +RNTNN +RGG+G    +      +LP P  +P R N+GY
Sbjct  120   NEDYVKTPARSNYLVPVLPSIRNTNNHSRGGYGGRNGRGPP---LLPRPGGHPGRHNFGY  176

Query  1447  G----RGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLR  1280
             G     GN    E FVSE+K  KSEETL+RK  A QEP E+ACYSR++ GDVYFDDRSLR
Sbjct  177   GGRFSHGNGRNVEGFVSEMKLNKSEETLSRKFVAFQEPSEIACYSRIEGGDVYFDDRSLR  236

Query  1279  LFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNK  1100
             LFKR I + +G +LN+GF++F EKRDLGS+GFGDLLACIRN  +PL  +HFVTYRNNLNK
Sbjct  237   LFKRNICDYVGENLNKGFESFIEKRDLGSEGFGDLLACIRNSTVPLQNIHFVTYRNNLNK  296

Query  1099  IMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRS  920
             I+ATAY+R EPW+MGVHKR GVVYLDVHKLPERP+SE++RRRCYWGY FE+LATE+    
Sbjct  297   ILATAYLR-EPWKMGVHKRNGVVYLDVHKLPERPQSEVERRRCYWGYSFENLATENSIDE  355

Query  919   DGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRT  740
             DG     IDANVE+CAVIKTK+GAHRI+MGAEMDCCD+ DDGRRFYVELKTSRE L++ T
Sbjct  356   DG---RGIDANVEFCAVIKTKLGAHRIIMGAEMDCCDATDDGRRFYVELKTSRE-LEYHT  411

Query  739   EEIFEREKLLKFWIQSFLAGVPYIVVGFR  653
              E FE+EKLL+FWIQSF+AGVPY+VVGFR
Sbjct  412   VEKFEKEKLLRFWIQSFIAGVPYVVVGFR  440



>ref|XP_008803077.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic isoform 
X4 [Phoenix dactylifera]
Length=414

 Score =   429 bits (1104),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 232/315 (74%), Positives = 267/315 (85%), Gaps = 9/315 (3%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnG----ILPSPNYPPRQN  1457
             NEEY++TPA S +PVPVLPP+++TNN  RG FGRGRWQ+G  N     +LP P Y  RQN
Sbjct  99    NEEYMRTPARSPFPVPVLPPLQSTNNHGRGNFGRGRWQSGYPNDRGPPLLPRPGYMQRQN  158

Query  1456  YGYGR---GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRS  1286
             +GYGR    N   DERFVSE+K  KSEETL+RK+ AIQEPCE+ACYSRV+ GDVYFDDRS
Sbjct  159   FGYGRFSHANGRNDERFVSEMKLTKSEETLSRKAIAIQEPCEIACYSRVEGGDVYFDDRS  218

Query  1285  LRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNL  1106
             LRLFKR I +D+G+ LN+GF++F EKRDLGS+GFGDLLACIRNKNIPL  +HFVT+RNNL
Sbjct  219   LRLFKRSICQDVGAHLNQGFESFVEKRDLGSEGFGDLLACIRNKNIPLQNIHFVTFRNNL  278

Query  1105  NKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPG  926
             NKI+ TAYIRNEPW+MGVHKR GVVYLDVHKLPERP+SE+DRRRCYWGY FE+LATE+  
Sbjct  279   NKILTTAYIRNEPWKMGVHKRNGVVYLDVHKLPERPQSEVDRRRCYWGYAFENLATENSR  338

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDH  746
               D D    IDANVE+C+VIKTK+GAHRI+MGAEMDCCDS DDGRRFYVELKTSRE LD+
Sbjct  339   EIDADG-KGIDANVEFCSVIKTKLGAHRIIMGAEMDCCDSTDDGRRFYVELKTSRE-LDY  396

Query  745   RTEEIFEREKLLKFW  701
             RTEE +EREKLLKFW
Sbjct  397   RTEERYEREKLLKFW  411



>ref|XP_001761908.1| predicted protein [Physcomitrella patens]
 gb|EDQ73349.1| predicted protein [Physcomitrella patens]
Length=454

 Score =   413 bits (1061),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 201/351 (57%), Positives = 256/351 (73%), Gaps = 12/351 (3%)
 Frame = -2

Query  1423  ERFVSELKFAKS---EETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITED  1253
             E  V+++K   +    +    K    QEP  +A +SR  DG V FD+  LR F+R I ++
Sbjct  99    EALVADMKLGATGHNNDMYRVKCPPFQEPSHIAGFSRSADGSVQFDESCLRRFRREILQE  158

Query  1252  IGSDLNEGFDTFTEKRDLGS-QGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIR  1076
              G DLNEGFDT+ EK++ G+  GFGDLLAC+R+K +PLD +HFVTYRNNLNKI+ TAY R
Sbjct  159   SGLDLNEGFDTYVEKKEDGAGSGFGDLLACLRDKQVPLDNIHFVTYRNNLNKILGTAYNR  218

Query  1075  NEPWEMGVHKRKGVVYLDVHKLPERPKSE--LDRRRCYWGYCFESLATEDPGRSDGDRI-  905
              + WEMGVHKR+G VYLDVHKLPE P  +  + +RR YWGY FE  ATE P     +   
Sbjct  219   QDVWEMGVHKRQGTVYLDVHKLPEAPHLDVTMQKRRSYWGYSFERFATEAPSSRQVNGTA  278

Query  904   ----HDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTE  737
                 + ++ANVE+CA++KTK+G HRI+MGAEMDC D+  DGR+++VELKTSR L D RT 
Sbjct  279   RKPKNAVNANVEFCAIVKTKLGPHRIIMGAEMDCYDTASDGRKYFVELKTSRAL-DARTV  337

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVC  557
             + FER+KLLKFWIQSFLAGV  I+VG+RDD GRL+ TE +R  +IT RVK K +W+GGVC
Sbjct  338   DRFERDKLLKFWIQSFLAGVQRILVGYRDDAGRLLGTEMMRPQDITHRVKQKHHWEGGVC  397

Query  556   LAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             LAFAD+VLCWLYG+VKE EDY L+F  H+NRLEL++  SCPD I+ H+  L
Sbjct  398   LAFADQVLCWLYGSVKEGEDYTLRFNRHANRLELVKANSCPDTISSHMDLL  448



>ref|XP_002991233.1| hypothetical protein SELMODRAFT_43096, partial [Selaginella moellendorffii]
 gb|EFJ07661.1| hypothetical protein SELMODRAFT_43096, partial [Selaginella moellendorffii]
Length=327

 Score =   389 bits (1000),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 185/328 (56%), Positives = 238/328 (73%), Gaps = 8/328 (2%)
 Frame = -2

Query  1360  AIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLG-SQGF  1184
             ++++P ++ CYSR  DG VY+D+R LR F+R +     +DLNEGFD+F +K D   S  F
Sbjct  1     SLEQPNQICCYSRTPDGTVYYDERCLRKFRRRVLSSFEADLNEGFDSFVQKNDDSESSAF  60

Query  1183  GDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPE  1004
             GDLLAC+R K      +HFVT+RNNLNKI+ T Y R + WEMGVHKR G VYLD  K PE
Sbjct  61    GDLLACVRTKLTSFKDIHFVTFRNNLNKILGTTYSRRDAWEMGVHKRSGTVYLDCRKTPE  120

Query  1003  RPKSELDRRRCYWGYCFESLATEDPGR------SDGDRIHDIDANVEYCAVIKTKIGAHR  842
              P++EL +R+CYWGY +E +ATE+P R       D      +DANVE+C V++TK+G HR
Sbjct  121   PPQTELQQRQCYWGYKYEEVATENPQRDLYEMSGDAGPPVAVDANVEFCTVVRTKLGPHR  180

Query  841   ILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVV  662
             I+MGAE+DC D   DG + Y ELKTSREL D R+ E FE+EKLLKFWIQSFL GVP IV 
Sbjct  181   IIMGAEIDCYDVGSDGTKRYTELKTSREL-DKRSFERFEKEKLLKFWIQSFLVGVPRIVC  239

Query  661   GFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQF  482
             GFRDDNGRL+R++ + T EI +++K K YW+GGVCLAFAD VLCWLYG+V +  DY L++
Sbjct  240   GFRDDNGRLLRSDMMLTQEIARKMKQKHYWEGGVCLAFADRVLCWLYGSVNDGGDYTLRY  299

Query  481   TPHSNRLELLRGPSCPDAITHHVQQLES  398
              P+SNR+EL+   SCP  I+ H++ LES
Sbjct  300   IPNSNRIELVNCDSCPRVISEHIELLES  327



>ref|XP_002991173.1| hypothetical protein SELMODRAFT_43146, partial [Selaginella moellendorffii]
 gb|EFJ07717.1| hypothetical protein SELMODRAFT_43146, partial [Selaginella moellendorffii]
Length=327

 Score =   388 bits (996),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 184/328 (56%), Positives = 238/328 (73%), Gaps = 8/328 (2%)
 Frame = -2

Query  1360  AIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLG-SQGF  1184
             ++++P ++ CYSR  DG VY+D+R LR F+R +     +DLNEGFD+F +K D   S  F
Sbjct  1     SLEQPNQICCYSRTPDGTVYYDERCLRKFRRRVLSSFEADLNEGFDSFVQKNDDSESSAF  60

Query  1183  GDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPE  1004
             GDLLAC+R K      +HFVT+RNNLNKI+ T Y R + WEMGVHKR G VYLD  K P+
Sbjct  61    GDLLACVRTKLTSFKDIHFVTFRNNLNKILGTTYSRRDAWEMGVHKRSGTVYLDCRKTPD  120

Query  1003  RPKSELDRRRCYWGYCFESLATEDPGR------SDGDRIHDIDANVEYCAVIKTKIGAHR  842
              P++EL +R+CYWGY +E +ATE+P R       D      +DANVE+C V++TK+G HR
Sbjct  121   PPQTELQQRQCYWGYKYEEVATENPQRDLYEMSGDAGPPVAVDANVEFCTVVRTKLGPHR  180

Query  841   ILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVV  662
             I+MGAE+DC D   DG + Y ELKTSREL D R+ E FE+EKLLKFWIQSFL GVP IV 
Sbjct  181   IIMGAEIDCYDVGSDGTKRYTELKTSREL-DKRSFERFEKEKLLKFWIQSFLVGVPRIVC  239

Query  661   GFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQF  482
             GFRDDNGRL+R++ + T EI +++K K YW+GGVCLAFAD VLCWLYG+V +  DY L++
Sbjct  240   GFRDDNGRLLRSDMMLTQEIARKMKQKHYWEGGVCLAFADRVLCWLYGSVNDGGDYTLRY  299

Query  481   TPHSNRLELLRGPSCPDAITHHVQQLES  398
              P+SNR+EL+   SCP  I+ H++ LES
Sbjct  300   IPNSNRIELVNCDSCPRVISEHIELLES  327



>emb|CBI33986.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   387 bits (995),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 237/412 (58%), Positives = 272/412 (66%), Gaps = 64/412 (16%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGY  1448
             NE+Y KT A S YPVPVLP +RN NN  RGGFGRGRWQN RG GILP P  YP R NYGY
Sbjct  95    NEDYCKTLAISPYPVPVLPAIRNNNNQNRGGFGRGRWQNDRGAGILPRPGPYPQRHNYGY  154

Query  1447  G-RGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFK  1271
             G + N   DERFVSELK +KSEETL+RK  A QEPCELACYSRV+ GDV FDDRSLRLFK
Sbjct  155   GSKFNNRHDERFVSELKLSKSEETLSRKCIAFQEPCELACYSRVEGGDVCFDDRSLRLFK  214

Query  1270  RLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMA  1091
             RLITED+G+DLNEG+DTF EK+DLGS+GFGDLLA IRN+NIPL  +HFVT+RNNLNKI+A
Sbjct  215   RLITEDVGADLNEGYDTFIEKKDLGSEGFGDLLAAIRNRNIPLGNIHFVTFRNNLNKILA  274

Query  1090  TAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGD  911
             TAYIR+EPWEMGVHKR GVVYLDVHKLPERP+S+LD + C W          D  +SD  
Sbjct  275   TAYIRHEPWEMGVHKRNGVVYLDVHKLPERPQSDLDLKLCAW----------DSSKSDTC  324

Query  910   RIHDIDANVEYCAVIKTKIGAHRI---LMGAEMDCCDSRDDGRRFYVELKTSRELLDHRT  740
               + +   V +  +  T   + +I   L G        RDDG R    ++T R     RT
Sbjct  325   VNNCLFWVVRWNRLSSTLFCSGKIQSFLAGVPYIVIGFRDDGGRL---VRTER----LRT  377

Query  739   EEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGV  560
             ++I +R K+  +W                                           QGGV
Sbjct  378   KDITQRVKMKNYW------------------------------------------QQGGV  395

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             CLAFADEVLCWLYGTVKENEDYILQF P   RLELL+  SCPDAI+ HVQQL
Sbjct  396   CLAFADEVLCWLYGTVKENEDYILQFAPPFTRLELLQAQSCPDAISGHVQQL  447



>ref|XP_010664523.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
[Vitis vinifera]
Length=429

 Score =   384 bits (986),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 235/409 (57%), Positives = 264/409 (65%), Gaps = 76/409 (19%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGY  1448
             NE+Y KT A S YPVPVLP +RN NN  RGGFGRGRWQN RG GILP P  YP R NYGY
Sbjct  95    NEDYCKTLAISPYPVPVLPAIRNNNNQNRGGFGRGRWQNDRGAGILPRPGPYPQRHNYGY  154

Query  1447  G-RGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFK  1271
             G + N   DERFVSELK +KSEETL+RK  A QEPCELACYSRV+ GDV FDDRSLRLFK
Sbjct  155   GSKFNNRHDERFVSELKLSKSEETLSRKCIAFQEPCELACYSRVEGGDVCFDDRSLRLFK  214

Query  1270  RLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMA  1091
             RLITED+G+DLNEG+DTF EK+DLGS+GFGDLLA IRN+NIPL  +HFVT+RNNLNKI+A
Sbjct  215   RLITEDVGADLNEGYDTFIEKKDLGSEGFGDLLAAIRNRNIPLGNIHFVTFRNNLNKILA  274

Query  1090  TAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGD  911
             TAYIR+EPWEMGVHKR GVVYLDVHKLPERP+S+LDRRR    Y    +  E        
Sbjct  275   TAYIRHEPWEMGVHKRNGVVYLDVHKLPERPQSDLDRRR----YSHNWVIIE--------  322

Query  910   RIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEI  731
                          V    +     L G        RDDG R    ++T R     RT++I
Sbjct  323   ------------CVYPFSLQIQSFLAGVPYIVIGFRDDGGRL---VRTER----LRTKDI  363

Query  730   FEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLA  551
              +R K+  +W                                           QGGVCLA
Sbjct  364   TQRVKMKNYW-------------------------------------------QGGVCLA  380

Query  550   FADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
             FADEVLCWLYGTVKENEDYILQF P   RLELL+  SCPDAI+ HVQQL
Sbjct  381   FADEVLCWLYGTVKENEDYILQFAPPFTRLELLQAQSCPDAISGHVQQL  429



>gb|KHN34887.1| Protein Dom3z like, chloroplastic [Glycine soja]
Length=222

 Score =   346 bits (887),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 183/203 (90%), Gaps = 1/203 (0%)
 Frame = -2

Query  1012  LPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILM  833
             LPE+P+S+LDRRRCY GYCFESLATEDP R+DG+ IH +DANVE+CAVIKTK+GAHRILM
Sbjct  21    LPEKPQSDLDRRRCYVGYCFESLATEDPNRADGEGIHHVDANVEFCAVIKTKLGAHRILM  80

Query  832   GAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFR  653
             GAEMDCCDS ++G+RFYVELKTS EL ++ TEE FEREKLLKFWIQSFLAGVPYIV+GFR
Sbjct  81    GAEMDCCDSTNEGKRFYVELKTSCEL-NYHTEERFEREKLLKFWIQSFLAGVPYIVIGFR  139

Query  652   DDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQFTPH  473
             DD GRLVRTERLRT +ITQRVKMK+YWQGGVCLAFADEVLCWLYGTVKE EDYILQF P 
Sbjct  140   DDAGRLVRTERLRTKDITQRVKMKNYWQGGVCLAFADEVLCWLYGTVKEGEDYILQFAPP  199

Query  472   SNRLELLRGPSCPDAITHHVQQL  404
              NRLELL+  SCPD IT H++ L
Sbjct  200   FNRLELLQSQSCPDVITSHLELL  222



>ref|XP_008355558.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
[Malus domestica]
Length=426

 Score =   342 bits (876),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 177/197 (90%), Gaps = 1/197 (1%)
 Frame = -2

Query  994  SELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDC  815
            S+LDRRRCYWGYCFESLATEDPGR DG  IH +DANVEYC+VIKTK+GAHRILMGAEMDC
Sbjct  231  SKLDRRRCYWGYCFESLATEDPGRGDGP-IHHVDANVEYCSVIKTKLGAHRILMGAEMDC  289

Query  814  CDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRL  635
            CDS DDGRRFYVELKTS EL +H+ E  FE+EKLLKFWIQSFLAGVPYIV+GFR+D G+L
Sbjct  290  CDSTDDGRRFYVELKTSHELDNHKIEYEFEKEKLLKFWIQSFLAGVPYIVIGFRNDAGQL  349

Query  634  VRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLEL  455
            VRTERLRT +IT RVKMK+YWQGGVCLAFADEVLCWLYGTVKENEDYILQFT    RLEL
Sbjct  350  VRTERLRTKDITHRVKMKNYWQGGVCLAFADEVLCWLYGTVKENEDYILQFTHPFQRLEL  409

Query  454  LRGPSCPDAITHHVQQL  404
            L+  SCP+ IT+HVQQL
Sbjct  410  LQAQSCPEEITNHVQQL  426


 Score = 65.5 bits (158),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 66/111 (59%), Gaps = 21/111 (19%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVP---------------VLPPVRNTNNPTrggfgrgrwqngr----  1502
             NE+Y KTPATS +P+P               VLP +R+TNN  RG  GRGR Q+GR    
Sbjct  118   NEDYCKTPATSPFPIPGNYLFHGGVVFFCLKVLPVIRSTNNQGRGNPGRGRRQSGRPNDR  177

Query  1501  gnGILPSPN-YPPRQNYGYGRGNAPRDERFVSELK-FAKSEETLARKSTAI  1355
             G GIL     +  RQN+GYG  N  RDERF+SELK  +K EETL+RK   I
Sbjct  178   GAGILGRGGPFQQRQNFGYGGSNGYRDERFISELKLLSKGEETLSRKGRCI  228



>ref|XP_006573707.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
isoform X3 [Glycine max]
Length=322

 Score =   308 bits (789),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 173/261 (66%), Positives = 204/261 (78%), Gaps = 10/261 (4%)
 Frame = -2

Query  1735  EEDDNGEVRSSLNSNINSHSKYGNEdddsdkdlfgsDNEEYVKTPATSTYPVPVLPPVRN  1556
             ++D+NG+V  S  +  + H  Y ++D           NE+Y KT A S YP+PVLP  RN
Sbjct  68    DDDENGDVVDSAKARAHHHHDYEDKDLFGSD------NEDYCKTLARSPYPIPVLPATRN  121

Query  1555  TNNPTrggfgrgrwqngrgnGILPSPN-YPPRQNYGYGR--GNAPRDERFVSELKFAKSE  1385
              NN  RGGFGRGRWQN RG G+LP P  YP RQN+GYG    N   DERFVSELK +KSE
Sbjct  122   VNNQGRGGFGRGRWQNDRGAGLLPRPGPYPQRQNFGYGNRFQNGRHDERFVSELKLSKSE  181

Query  1384  ETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKR  1205
             ETL+RK  A QEPCE+ACYSRV+ G+VYFDDRSLRLFKR ITED+G+DLNEG+DT+  K+
Sbjct  182   ETLSRKCIAFQEPCEVACYSRVEGGEVYFDDRSLRLFKRHITEDVGADLNEGYDTYIPKK  241

Query  1204  -DLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
              DLGS+GFGDLLACIR+KNIPL  +HFVT+RNNLNKI+ATAYIR+EPWEMGVHKR GVVY
Sbjct  242   ADLGSEGFGDLLACIRDKNIPLQNIHFVTFRNNLNKILATAYIRHEPWEMGVHKRNGVVY  301

Query  1027  LDVHKLPERPKSELDRRRCYW  965
             LDVHKLPERP+S+LDRRR  +
Sbjct  302   LDVHKLPERPQSDLDRRRILF  322



>emb|CAB10542.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78765.1| hypothetical protein [Arabidopsis thaliana]
Length=1148

 Score =   320 bits (820),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 188/377 (50%), Positives = 230/377 (61%), Gaps = 56/377 (15%)
 Frame = -2

Query  1624  NEEYVKTPATSTYPVPVLPPVRNTNNPTrggfgrgrwqngrgnG--ILPSPN-YPPRQNY  1454
             NEEY KTPA STY +PVLP   + +N    G       +    G  +LP P  YP R   
Sbjct  798   NEEYTKTPAISTYSIPVLPAGWSNDNHGGRGGMGRGRWSNGRGGPGLLPRPGPYPGRGGN  857

Query  1453  GYGRG----NAPRDERFVSELKFAKSEETLARKSTAIQEPCEL--ACYSRVQDGDVYFDD  1292
               G G    N  RDERFVSELK +KS+ETLARK T  QE   +   C++       Y+  
Sbjct  858   RGGFGGRYQNYQRDERFVSELKLSKSKETLARKQTNFQEVIYIKECCFN-------YY--  908

Query  1291  RSLRLFKRLITEDIGSDLNE---------GFDTFTEKRDLGSQGFGDLLACIRNKNIPLD  1139
                 +F  ++T     D+N           F    E++      F  L   +R    P  
Sbjct  909   ----IFMVMVTRFELLDINSHIWALRALVTFLAVLEQKTFRWTTF-ILWYEVRMYICPF-  962

Query  1138  RMHFVT----YRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRC  971
                F+T    +RNNLNKI+  AY R+EPWEMGVHKR G +YLDVHKLPERP+S+LDRRRC
Sbjct  963   HCQFITLKETFRNNLNKILGAAYNRHEPWEMGVHKRNGTIYLDVHKLPERPQSDLDRRRC  1022

Query  970   YWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGR  791
             YWGYCFESLATEDPGR+ G+ IH +DANVE+C+V++TK+GAHR++MGAEMDCCD  D G+
Sbjct  1023  YWGYCFESLATEDPGRAYGEEIHHVDANVEFCSVVRTKLGAHRVMMGAEMDCCDVSDKGK  1082

Query  790   RFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRT  611
             RFYVELKT+RE                   IQSF+AGVPYIVVGFRDD GRLVRTERL T
Sbjct  1083  RFYVELKTTRE-------------------IQSFVAGVPYIVVGFRDDGGRLVRTERLTT  1123

Query  610   NEITQRVKMKSYWQGGV  560
              +I  R ++K+YWQ  V
Sbjct  1124  RDIAHRARLKNYWQVSV  1140



>gb|AAS99237.1| glycine-rich protein [Haloxylon ammodendron]
Length=113

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  727  EREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAF  548
            EREKLLKFWIQSFLAGVPYIVVGFRDD+GRLVRTER+RT +I QRVK+K YWQGGVCLAF
Sbjct  1    EREKLLKFWIQSFLAGVPYIVVGFRDDSGRLVRTERMRTKDINQRVKLKGYWQGGVCLAF  60

Query  547  ADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAITHHVQQL  404
            ADEVLCWLYGTVKENEDYILQF P   RLELL+  SCPD I  HV +L
Sbjct  61   ADEVLCWLYGTVKENEDYILQFAPPFARLELLQANSCPDVIADHVLEL  108



>ref|XP_005826089.1| hypothetical protein GUITHDRAFT_114770 [Guillardia theta CCMP2712]
 gb|EKX39109.1| hypothetical protein GUITHDRAFT_114770 [Guillardia theta CCMP2712]
Length=320

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 121/306 (40%), Positives = 168/306 (55%), Gaps = 25/306 (8%)
 Frame = -2

Query  1381  TLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRD  1202
             TL   S  +  P E+  YS+   G +      +RL+K+     +  DLN G   +  K++
Sbjct  13    TLRASSVRVTAPAEITSYSKDASGRITIPACRIRLYKK---PHLPYDLNIGMSEYIAKKE  69

Query  1201  LGSQGFGDLLACIRNKNIPLDR-MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYL  1025
              G      +L  + +      R   FV+YRNNLNKIM T Y + +PW++ + K   V+Y+
Sbjct  70    -GDVTLEPVLQALSHAQFSTTRSCDFVSYRNNLNKIMETPYNKKDPWKIKLRKDSSVIYM  128

Query  1024  DVHKLPER----PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTK  857
             DV KL E+    P+S   R+  YWGY FE   T D    DGD+ H +DAN EYC+V +  
Sbjct  129   DVVKLEEQSTQSPRSM--RKFQYWGYKFEGACTSD----DGDQSH-VDANEEYCSVFQIS  181

Query  856   IGAHRILMGAEMDCCDSRDD--------GRRFYVELKTSRELLDHRTEEIFEREKLLKFW  701
             IG +R+++ AEMDC +   +        G+R YVELKTSR +        F+R KLLKFW
Sbjct  182   IGENRLVLAAEMDCIEPEKEEQSEKEGGGKRRYVELKTSRVISHPNQNNTFQRFKLLKFW  241

Query  700   IQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK-SYWQGGVCLAFADEVLCWL  524
             IQSFL GV  IV GFRDD+G L   +  +T EI + V+ K + W   VCL F +++L  L
Sbjct  242   IQSFLGGVGKIVCGFRDDDGILQEVKEFKTLEIPRMVRGKPNMWDPNVCLKFTEDLLTRL  301

Query  523   YGTVKE  506
                VKE
Sbjct  302   KTLVKE  307



>emb|CEG77964.1| hypothetical protein RMATCC62417_12635 [Rhizopus microsporus]
Length=385

 Score =   188 bits (478),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 174/303 (57%), Gaps = 23/303 (8%)
 Frame = -2

Query  1354  QEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFG--  1181
             ++P EL CYS      V+FDDR ++ +       +G DLN G+D F ++ +  S+     
Sbjct  39    KQPQELTCYSIDHHRRVWFDDREMKYY----YPPLGKDLNVGYDQFIQRDESVSEHIDTL  94

Query  1180  -DLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPE  1004
              D L  ++ K+        VT+R  + KI+ T Y R + WE+   +  G ++++   L +
Sbjct  95    LDALTTVKQKHPSDIHADIVTWRGIMTKILCTPYSRRDAWELRATRYNGTIFIEEQSLKD  154

Query  1003  RPKSELDRRRC--YWGYCFESLAT--EDPGRSDGDRIHDID-----ANVEYCAVIKTKIG  851
               K + DR++   YWGY FE+L T  + P + + + +   D      NV+YC V+KTK+G
Sbjct  155   NSK-DTDRQKLMGYWGYRFETLCTVSQPPHKVNKEELKKRDNESANTNVQYCVVVKTKLG  213

Query  850   AHRILMGAEMDCC---DSRDDGRRF--YVELKTSRELLDHRTEEIFEREKLLKFWIQSFL  686
              + I+MGAE+DCC     +D   +   Y+ELKTSR +   R +  F+R KLLKFW QSFL
Sbjct  214   NNSIIMGAEVDCCRDVKPKDPTAQLSNYIELKTSRVIETGRHDYSFQRYKLLKFWAQSFL  273

Query  685   AGVPYIVVGFRDDNGRLVRTERLRTNEITQRVK-MKSYWQGGVCLAFADEVLCWLYGTVK  509
              GVP I+ GFR+D+G L+  ++ +T EI ++V+  K+ W   VCL FA+++L W+   + 
Sbjct  274   VGVPRIICGFRNDDGLLMEVKQYKTLEIPRQVRNTKNTWNPAVCLNFANQLLDWIQHNIT  333

Query  508   ENE  500
             E++
Sbjct  334   EDD  336



>gb|ETI35960.1| hypothetical protein F443_17796 [Phytophthora parasitica P1569]
 gb|ETL82858.1| hypothetical protein L917_17052 [Phytophthora parasitica]
Length=371

 Score =   184 bits (466),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 120/336 (36%), Positives = 177/336 (53%), Gaps = 23/336 (7%)
 Frame = -2

Query  1420  RFVSELKFA--KSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIG  1247
             R +S L+FA  ++ E   +   ++ +P E+A +S+  D DV FD  +L ++K+    +IG
Sbjct  32    RSLSYLRFAVPRAHELSQQGRVSLSKPREIAYFSKYADDDVRFDRSNLLVYKQA---EIG  88

Query  1246  SDLNEGFDTFTEKRDLGSQG----FGDLLACIRN---KNIPLDRMHFVTYRNNLNKIMAT  1088
             S+L +GF+ +T K +            LLA + +    N   +R HFVTYRNNLNKIM T
Sbjct  89    SNLLDGFEEYTAKDESNPTASPAPIAPLLAALEHFQADNKDRERAHFVTYRNNLNKIMGT  148

Query  1087  AYIRNEPWEMGVHKRKGVVYLDVHKLPE-----RPKSELDRRRCYWGYCFESLATEDPGR  923
              Y     W   V KR G VYLDV +  E     R   E  RR  + G  FE  +T  P  
Sbjct  149   PYNSKNGWTFEVEKRSGCVYLDVRRTQEDIDSNRNPHENQRRGAFAGRRFEIYSTH-PKA  207

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
              D  R   ++ + EYC+V    +G  R+++ AE+DC + +  G+R Y+ELKT R L   +
Sbjct  208   DDEQR--KVNEDEEYCSVSAMTLGDKRLVVAAEIDCYEDKS-GQREYIELKTFRLLQREK  264

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
              + +FER KLL FWIQSFL G P IV  FR D+  + + +  R  EI      + +W   
Sbjct  265   DQFVFERFKLLTFWIQSFLVGTPKIVCAFRSDDFEVRKLQSFRVTEIPNFC--RKHWTPV  322

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLEL  455
             VCL F   +L W+Y    E   + + + P  + +E+
Sbjct  323   VCLNFTKALLDWIYEHADEGRVHRVTYIPQQHVVEM  358



>emb|CDS09462.1| hypothetical protein LRAMOSA10822 [Absidia idahoensis var. thermophila]
Length=392

 Score =   184 bits (468),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 111/303 (37%), Positives = 161/303 (53%), Gaps = 16/303 (5%)
 Frame = -2

Query  1354  QEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLG-----SQ  1190
             ++P E+  YS   +  V+FD R L+ +        G  L+ G+D F  KRD         
Sbjct  41    KQPVEIQSYSIDANRQVWFDQRELKYYIEPKLSSPGPCLSRGYDRFI-KRDESVPEHLDT  99

Query  1189  GFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKL  1010
                 L     N +  +D +  VT+R  + KI  T + RNEPWE+   + K  +Y++    
Sbjct  100   LLDTLTTARLNGSHDVDHVDIVTWRGIMTKIFCTPFTRNEPWELRASRYKNTIYMEEQAT  159

Query  1009  PERPKSEL---DRRR--CYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAH  845
              ++ + E    DR++   YWGY FES+ T    +   D     + NV+YC  +KT++G +
Sbjct  160   EQKQRQEQTMSDRQKLMSYWGYSFESMCTATDPQGTPDPNDVPNTNVQYCVAVKTRLGKN  219

Query  844   RILMGAEMDCCDSRD--DGR--RFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGV  677
              I MGAE+DC +     DG   R YVELKTSR +   R +E FER KLLKFW QSFL GV
Sbjct  220   TIAMGAEVDCIEGEKPKDGNLLRHYVELKTSRRMDTQRQKENFERFKLLKFWAQSFLIGV  279

Query  676   PYIVVGFRDDNGRLVRTERLRTNEITQRVKMKS-YWQGGVCLAFADEVLCWLYGTVKENE  500
             P ++ GFRDD+G L   E  +T EI ++V+  +  W    C+ FA+E L WL   V E++
Sbjct  280   PKVICGFRDDDGVLSHLETFKTLEIPRKVRHGTGAWDASACMNFANEFLDWLKKVVTEDD  339

Query  499   DYI  491
               +
Sbjct  340   PTV  342



>gb|ETK76198.1| hypothetical protein L915_17326 [Phytophthora parasitica]
 gb|ETL29636.1| hypothetical protein L916_17219 [Phytophthora parasitica]
 gb|ETP05781.1| hypothetical protein F441_17674 [Phytophthora parasitica CJ01A1]
Length=371

 Score =   183 bits (465),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 120/336 (36%), Positives = 175/336 (52%), Gaps = 23/336 (7%)
 Frame = -2

Query  1420  RFVSELKFA--KSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIG  1247
             R +S L+FA  ++ E   +   ++ +P E+A +S+  D DV FD  +L ++K+    +IG
Sbjct  32    RSLSYLRFAVPRAHELSQQGRVSLSKPREIAYFSKYADDDVRFDRSNLLVYKQA---EIG  88

Query  1246  SDLNEGFDTFTEKRDLGSQG----FGDLLACIRN---KNIPLDRMHFVTYRNNLNKIMAT  1088
             S+L  GF+ +T K +            LLA + +    N   +R HFVTYRNNLNKIM T
Sbjct  89    SNLLNGFEEYTAKDESNPTASPAPIAPLLAALEHFQADNKDRERAHFVTYRNNLNKIMGT  148

Query  1087  AYIRNEPWEMGVHKRKGVVYLDVHKLPE-----RPKSELDRRRCYWGYCFESLATEDPGR  923
              Y     W   V KR G VYLDV +  E     R   E  RR  + G  FE  +T  P  
Sbjct  149   PYNSKNGWTFEVEKRSGCVYLDVRRTQEDIDSNRNPHENQRRGAFAGRRFEIYSTH-PKA  207

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
              D  R   ++ + EYC+V    +G  R+++ AE+DC + + D R  Y+ELKT R L   +
Sbjct  208   DDEQR--KVNEDEEYCSVSAMTLGDKRLVVAAEIDCYEDKSDQRE-YIELKTFRLLQREK  264

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
              + +FER KLL FWIQSFL G P IV  FR D+  + + +  R  EI      + +W   
Sbjct  265   DQFVFERFKLLTFWIQSFLVGTPKIVCAFRSDDFEVRKLQSFRVTEIPNFC--RKHWTPV  322

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLEL  455
             VCL F   +L W+Y    E   + + + P  + +E+
Sbjct  323   VCLNFTKALLDWIYEHADEGRVHRVTYIPQQHVVEM  358



>gb|ETM36093.1| hypothetical protein L914_17122 [Phytophthora parasitica]
 gb|ETO64682.1| hypothetical protein F444_17832 [Phytophthora parasitica P1976]
 gb|ETP33892.1| hypothetical protein F442_17654 [Phytophthora parasitica P10297]
Length=371

 Score =   183 bits (464),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 119/336 (35%), Positives = 177/336 (53%), Gaps = 23/336 (7%)
 Frame = -2

Query  1420  RFVSELKFA--KSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIG  1247
             R +S L+FA  ++ E   +   ++ +P E+A +S+  D DV FD  +L ++K+    ++G
Sbjct  32    RSLSYLRFAVPRAHELSQQGRVSLSKPREIAYFSKYADDDVRFDRSNLLVYKQA---EVG  88

Query  1246  SDLNEGFDTFTEKRDLGSQG----FGDLLACIRN---KNIPLDRMHFVTYRNNLNKIMAT  1088
             S+L +GF+ +T K +            LLA + +    N   +R HFVTYRNNLNKIM T
Sbjct  89    SNLLDGFEEYTAKDESNPTASPAPIAPLLAALEHFQADNKDRERAHFVTYRNNLNKIMGT  148

Query  1087  AYIRNEPWEMGVHKRKGVVYLDVHKLPE-----RPKSELDRRRCYWGYCFESLATEDPGR  923
              Y     W   V KR G VYLDV +  E     R   E  RR  + G  FE  +T  P  
Sbjct  149   PYNSKNGWTFEVEKRSGCVYLDVRRTQEDIDSNRNPHENQRRGAFAGRRFEIYSTH-PKA  207

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
              D  R   ++ + EYC+V    +G  R+++ AE+DC + +  G+R Y+ELKT R L   +
Sbjct  208   DDEQR--KVNEDEEYCSVSAMTLGDKRLVVAAEIDCYEDKS-GQREYIELKTFRLLQREK  264

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
              + +FER KLL FWIQSFL G P IV  FR D+  + + +  R  EI      + +W   
Sbjct  265   DQFVFERFKLLTFWIQSFLVGTPKIVCAFRSDDFEVRKLQSFRVTEIPNFC--RKHWTPV  322

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLEL  455
             VCL F   +L W+Y    E   + + + P  + +E+
Sbjct  323   VCLNFTKALLDWIYEHADEGRVHRVTYIPQQHVVEM  358



>emb|CEG77965.1| hypothetical protein RMATCC62417_12635 [Rhizopus microsporus]
Length=402

 Score =   184 bits (466),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 173/320 (54%), Gaps = 40/320 (13%)
 Frame = -2

Query  1354  QEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFG--  1181
             ++P EL CYS      V+FDDR ++ +       +G DLN G+D F ++ +  S+     
Sbjct  39    KQPQELTCYSIDHHRRVWFDDREMKYY----YPPLGKDLNVGYDQFIQRDESVSEHIDTL  94

Query  1180  -DLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPE  1004
              D L  ++ K+        VT+R  + KI+ T Y R + WE+   +  G ++++   L +
Sbjct  95    LDALTTVKQKHPSDIHADIVTWRGIMTKILCTPYSRRDAWELRATRYNGTIFIEEQSLKD  154

Query  1003  RPKSELDRRRC--YWGYCFESLAT--EDPGRSDGDRIHDID-----ANVEYCAVIKTKIG  851
               K + DR++   YWGY FE+L T  + P + + + +   D      NV+YC V+KTK+G
Sbjct  155   NSK-DTDRQKLMGYWGYRFETLCTVSQPPHKVNKEELKKRDNESANTNVQYCVVVKTKLG  213

Query  850   AHRILMGAEMDCCDSRDDGRRF----------------------YVELKTSRELLDHRTE  737
              + I+MGAE+DCC   D    F                      Y+ELKTSR +   R +
Sbjct  214   NNSIIMGAEVDCCRGIDALFYFTKYTHKDRKDVKPKDPTAQLSNYIELKTSRVIETGRHD  273

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVK-MKSYWQGGV  560
               F+R KLLKFW QSFL GVP I+ GFR+D+G L+  ++ +T EI ++V+  K+ W   V
Sbjct  274   YSFQRYKLLKFWAQSFLVGVPRIICGFRNDDGLLMEVKQYKTLEIPRQVRNTKNTWNPAV  333

Query  559   CLAFADEVLCWLYGTVKENE  500
             CL FA+++L W+   + E++
Sbjct  334   CLNFANQLLDWIQHNITEDD  353



>ref|XP_008896302.1| hypothetical protein PPTG_04193 [Phytophthora parasitica INRA-310]
 gb|ETN18662.1| hypothetical protein PPTG_04193 [Phytophthora parasitica INRA-310]
Length=371

 Score =   180 bits (457),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 118/336 (35%), Positives = 176/336 (52%), Gaps = 23/336 (7%)
 Frame = -2

Query  1420  RFVSELKFA--KSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIG  1247
             R +S L+FA  ++ E   +   ++ +P E+A +S+  D DV FD  +L ++K+    ++G
Sbjct  32    RSLSYLRFAVPRAHELSQQGRVSLSKPREIAYFSKYVDDDVRFDRSNLLVYKQA---EVG  88

Query  1246  SDLNEGFDTFTEKRDLGSQG----FGDLLACIRN---KNIPLDRMHFVTYRNNLNKIMAT  1088
             S+L +GF+ +T K +            LLA + +    N   +R HFVTYRNNLNKIM T
Sbjct  89    SNLLDGFEEYTAKDESNPTASPAPIAPLLAALEHFQADNKDRERAHFVTYRNNLNKIMGT  148

Query  1087  AYIRNEPWEMGVHKRKGVVYLDVHKLPE-----RPKSELDRRRCYWGYCFESLATEDPGR  923
              Y     W   V KR G VYLDV +  +     R   E  RR  + G  FE  +T  P  
Sbjct  149   PYNSKNGWTFEVEKRSGCVYLDVRRTQKDIDSNRNPHENQRRGAFAGRRFEIYSTH-PKA  207

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
              D  R   ++ + EYC+V    +G  R+++ AE+DC + +  G+R Y+ELKT R L    
Sbjct  208   DDEQR--KVNEDEEYCSVSAMTLGDKRLVVAAEIDCYEDKS-GQREYIELKTFRLLQREN  264

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
              + +FER KLL FWIQSFL G P IV  FR D+  + + +  R  EI      + +W   
Sbjct  265   DQFVFERFKLLTFWIQSFLVGTPKIVCAFRSDDFEVRKLQSFRVTEIPNFC--RKHWTPV  322

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLEL  455
             VCL F   +L W+Y    E   + + + P  + +E+
Sbjct  323   VCLNFTKALLDWIYEHADEGRVHRVTYIPQQHVVEM  358



>emb|CEG70864.1| hypothetical protein RMATCC62417_06685 [Rhizopus microsporus]
Length=401

 Score =   176 bits (447),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 108/319 (34%), Positives = 174/319 (55%), Gaps = 39/319 (12%)
 Frame = -2

Query  1354  QEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFG--  1181
             ++P EL CYS      V+FDDR ++ +       +G DLN G+D F ++ +  S+     
Sbjct  39    KQPQELTCYSIDHHRRVWFDDREMKYY----YPPLGKDLNVGYDQFIQRDESVSEHIDTL  94

Query  1180  -DLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPE  1004
              D L  ++ K+    +   VT+R  + KI+ T Y R + WE+   +  G ++++   L +
Sbjct  95    LDALTTVKQKHSSDIQADIVTWRGIMTKILCTPYSRRDAWELRATRYNGTIFIEEQSLKD  154

Query  1003  RPKSELDRRRC--YWGYCFESLAT--EDPGRSDGDRIHDID-----ANVEYCAVIKTKIG  851
               K + DR++   YWGY FE+L T  + P + + + +   D      NV+YC V+KTK+G
Sbjct  155   NSK-DTDRQKLMGYWGYRFETLCTVSQPPHKVNKEELKKRDNESANTNVQYCVVVKTKLG  213

Query  850   AHRILMGAEMDCC---DSRDDGRRF--YVELKTSRELLDHRTEEIFEREKLLKFWIQSFL  686
              + I+MGAE+DCC     +D   +   Y+ELKTSR +   R +  F+R KLLKFW QSFL
Sbjct  214   NNSIIMGAEVDCCRDVKPKDPTAQLSNYIELKTSRVIETGRHDYSFQRYKLLKFWAQSFL  273

Query  685   AGVPYIVVGFRDDNGRLVRTERLRTNEITQRVK-MKSYWQG----------------GVC  557
              GVP I+ GFR+D+G L+  ++ +T EI ++V+  K+ W                   VC
Sbjct  274   VGVPRIICGFRNDDGLLMEVKQYKTLEIPRQVRNTKNTWVSDIEQECDIITNIEKNPAVC  333

Query  556   LAFADEVLCWLYGTVKENE  500
             L FA+ +L W+   + +++
Sbjct  334   LNFANRLLDWIQHNITKDD  352



>gb|EPB91994.1| hypothetical protein HMPREF1544_01056 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=393

 Score =   174 bits (441),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 107/310 (35%), Positives = 173/310 (56%), Gaps = 27/310 (9%)
 Frame = -2

Query  1354  QEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDL  1175
             ++P E+  YS   +  V+FD+R ++ +    ++    DLN G++   ++ +   +    L
Sbjct  35    KQPQEITSYSIDHERRVWFDNREMKYYYPPTSD--KKDLNVGYEKMVQRDESIPEHIDTL  92

Query  1174  LACIRNKNI--PLDRM---HFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKL  1010
             L  + N N   P D       VT+R  + KI+ T Y R EPWE+   K  G ++++    
Sbjct  93    LDALTNANAKQPDDNQITADIVTWRGIMTKILCTPYSRKEPWELRATKYNGSIFMEEQVT  152

Query  1009  PERPKSE---LDRRR--CYWGYCFESLAT-----EDPGRSDG---DRI-HDIDANVEYCA  872
              ++  SE    DR++   YWGY FE+L T      +  ++D    DR+    + N++YC 
Sbjct  153   EQKKNSENQASDRQKLMSYWGYRFETLCTVTKPPHEMTKTDAELRDRLTASANTNIQYCI  212

Query  871   VIKTKIGAHRILMGAEMDCC---DSRDDGRR--FYVELKTSRELLDHRTEEIFEREKLLK  707
             + KTK+G + I+MGAE+DCC     +D  ++   Y+ELKTSR +   R +  F+R KLLK
Sbjct  213   LAKTKLGNNSIIMGAEVDCCRDVKPKDPLQQPSNYIELKTSRVIESERNQYSFDRYKLLK  272

Query  706   FWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK-SYWQGGVCLAFADEVLC  530
             FW QSFL GVP ++ GFRDD G ++   + +T EI ++V+ K + W   VCL FAD+VL 
Sbjct  273   FWAQSFLVGVPRVICGFRDDQGIVLDVVQFKTLEIPRQVREKRNTWNPSVCLNFADQVLD  332

Query  529   WLYGTVKENE  500
             W+   + +++
Sbjct  333   WIRSVIIQDD  342



>ref|XP_008876631.1| hypothetical protein H310_11666 [Aphanomyces invadans]
 gb|ETV94686.1| hypothetical protein H310_11666 [Aphanomyces invadans]
Length=369

 Score =   173 bits (439),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/313 (34%), Positives = 157/313 (50%), Gaps = 28/313 (9%)
 Frame = -2

Query  1351  EPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLL  1172
             +P ++  +S+  DG V FD   L+  +      + SDL  G DT+TE  +          
Sbjct  45    KPVQVGGFSKYPDGRVKFDQSLLKSLRN--AAPLHSDLLAGMDTYTEPHNTAPLEHVIAA  102

Query  1171  ACIRNKNI---------PLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDV  1019
             A   ++ +         PL + H VTYRNNLNKIM T Y  N P+ M V + +G +YL+V
Sbjct  103   ALPEHRRLHDHATCSPPPLSKHHVVTYRNNLNKIMGTPYNTNSPYSMQVQRTQGCIYLNV  162

Query  1018  ---HKLPER-PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
                   P R P S    +  Y G  +E L ++      G          EYC V    +G
Sbjct  163   VLSDLAPSRLPASFTQLQAAYAGRRYEELTSKTASPRGG----------EYCGVFSVSLG  212

Query  850   AHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPY  671
               ++L+GAE+D  D   D    Y+ELKT R L   +    FER KLL FWIQS++ GVP 
Sbjct  213   QTKLLIGAELDGIDDSGDISNLYIELKTFRALATSKDRFTFERYKLLAFWIQSYVVGVPL  272

Query  670   IVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENE-DY  494
             I VGFRDD+ RLV+ +  +T  + +    + YW   VC+ FA+  L WL     +++  Y
Sbjct  273   IRVGFRDDSFRLVKEQTFQTTGLPR--YGEKYWNPTVCINFANSFLTWLAEQALDDQVVY  330

Query  493   ILQFTPHSNRLEL  455
             ++++ P +  ++L
Sbjct  331   LIEYDPRNKCIQL  343



>gb|ETI35961.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETL82859.1| hypothetical protein, variant [Phytophthora parasitica]
Length=363

 Score =   172 bits (437),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 115/336 (34%), Positives = 170/336 (51%), Gaps = 31/336 (9%)
 Frame = -2

Query  1420  RFVSELKFA--KSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIG  1247
             R +S L+FA  ++ E   +   ++ +P E+A +S+  D D+ +              +IG
Sbjct  32    RSLSYLRFAVPRAHELSQQGRVSLSKPREIAYFSKYADDDLVYKQ-----------AEIG  80

Query  1246  SDLNEGFDTFTEKRDLGSQG----FGDLLACIRN---KNIPLDRMHFVTYRNNLNKIMAT  1088
             S+L +GF+ +T K +            LLA + +    N   +R HFVTYRNNLNKIM T
Sbjct  81    SNLLDGFEEYTAKDESNPTASPAPIAPLLAALEHFQADNKDRERAHFVTYRNNLNKIMGT  140

Query  1087  AYIRNEPWEMGVHKRKGVVYLDVHKLPE-----RPKSELDRRRCYWGYCFESLATEDPGR  923
              Y     W   V KR G VYLDV +  E     R   E  RR  + G  FE  +T  P  
Sbjct  141   PYNSKNGWTFEVEKRSGCVYLDVRRTQEDIDSNRNPHENQRRGAFAGRRFEIYSTH-PKA  199

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
              D  R   ++ + EYC+V    +G  R+++ AE+DC + +  G+R Y+ELKT R L   +
Sbjct  200   DDEQR--KVNEDEEYCSVSAMTLGDKRLVVAAEIDCYEDKS-GQREYIELKTFRLLQREK  256

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
              + +FER KLL FWIQSFL G P IV  FR D+  + + +  R  EI      + +W   
Sbjct  257   DQFVFERFKLLTFWIQSFLVGTPKIVCAFRSDDFEVRKLQSFRVTEIPNFC--RKHWTPV  314

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLEL  455
             VCL F   +L W+Y    E   + + + P  + +E+
Sbjct  315   VCLNFTKALLDWIYEHADEGRVHRVTYIPQQHVVEM  350



>gb|ETK76199.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL29637.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETP05782.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
Length=363

 Score =   172 bits (436),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 115/336 (34%), Positives = 168/336 (50%), Gaps = 31/336 (9%)
 Frame = -2

Query  1420  RFVSELKFA--KSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIG  1247
             R +S L+FA  ++ E   +   ++ +P E+A +S+  D D+ +              +IG
Sbjct  32    RSLSYLRFAVPRAHELSQQGRVSLSKPREIAYFSKYADDDLVYKQ-----------AEIG  80

Query  1246  SDLNEGFDTFTEKRDLGSQG----FGDLLACIRN---KNIPLDRMHFVTYRNNLNKIMAT  1088
             S+L  GF+ +T K +            LLA + +    N   +R HFVTYRNNLNKIM T
Sbjct  81    SNLLNGFEEYTAKDESNPTASPAPIAPLLAALEHFQADNKDRERAHFVTYRNNLNKIMGT  140

Query  1087  AYIRNEPWEMGVHKRKGVVYLDVHKLPE-----RPKSELDRRRCYWGYCFESLATEDPGR  923
              Y     W   V KR G VYLDV +  E     R   E  RR  + G  FE  +T  P  
Sbjct  141   PYNSKNGWTFEVEKRSGCVYLDVRRTQEDIDSNRNPHENQRRGAFAGRRFEIYSTH-PKA  199

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHR  743
              D  R   ++ + EYC+V    +G  R+++ AE+DC + + D R  Y+ELKT R L   +
Sbjct  200   DDEQR--KVNEDEEYCSVSAMTLGDKRLVVAAEIDCYEDKSDQRE-YIELKTFRLLQREK  256

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGG  563
              + +FER KLL FWIQSFL G P IV  FR D+  + + +  R  EI      + +W   
Sbjct  257   DQFVFERFKLLTFWIQSFLVGTPKIVCAFRSDDFEVRKLQSFRVTEIPNFC--RKHWTPV  314

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLEL  455
             VCL F   +L W+Y    E   + + + P  + +E+
Sbjct  315   VCLNFTKALLDWIYEHADEGRVHRVTYIPQQHVVEM  350



>ref|XP_009038219.1| hypothetical protein AURANDRAFT_37889 [Aureococcus anophagefferens]
 gb|EGB06978.1| hypothetical protein AURANDRAFT_37889 [Aureococcus anophagefferens]
Length=341

 Score =   171 bits (432),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 116/319 (36%), Positives = 164/319 (51%), Gaps = 30/319 (9%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             ST   +P E+  +SR + G V++D R+LR ++      + S L+ GF+ F  KR+     
Sbjct  32    STPYAQPVEVGAFSRDRAGGVHYDRRALRTYRE---PRLPSPLSAGFNDFVPKRN-DLAA  87

Query  1186  FGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHK-RKGVVYLDVHKL  1010
                 L     K     R  FVTYRNNLNK+ AT Y  ++ WEMGV +   G   L V + 
Sbjct  88    SEAALVAAAEKFPDAKRAAFVTYRNNLNKLCATPY-SDDDWEMGVSRLADGRALLSVRET  146

Query  1009  PERPKSEL-----DRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAH  845
               R +++      +R   ++GY FE+L T+D      D    +DAN E+  V   K+G H
Sbjct  147   ERRRRNDAAQTDDERLWSFFGYRFEALCTDD------DATRPVDANEEFVGVFACKLGDH  200

Query  844   RILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIV  665
             R+ + AE+DC    DDG   YVELKT++ L   R    FER KL KFW+QSFL G P +V
Sbjct  201   RVCVAAEIDC---EDDGG--YVELKTNKLLTTPRQVRTFERFKLFKFWLQSFLVGTPAVV  255

Query  664   VGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKE------N  503
             VGFRDD G   + +R  T ++        +WQ  V L FAD  L WL    +       +
Sbjct  256   VGFRDDAGECSKRQRFDTLKLP--ALGAKHWQPRVALHFADSALSWLGDATRAAWADEPD  313

Query  502   EDYILQFTPHSNRLELLRG  446
              + +++F P    + LLR 
Sbjct  314   AELVVRFEPSERSVVLLRA  332



>ref|XP_009521402.1| hypothetical protein PHYSODRAFT_412584, partial [Phytophthora 
sojae]
 gb|EGZ26114.1| hypothetical protein PHYSODRAFT_412584 [Phytophthora sojae]
Length=346

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/325 (32%), Positives = 167/325 (51%), Gaps = 27/325 (8%)
 Frame = -2

Query  1363  TAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG-  1187
              A+ +P E+A +S+  D DV FD  +L ++K+    ++G++L +G + ++ K +      
Sbjct  18    AALSQPREIAYFSKYADEDVRFDRSNLLVYKQA---EVGANLLDGIEEYSSKDETDPTAP  74

Query  1186  ---FGDLLACI---RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYL  1025
                 G LL+ +   +      ++ HFVT+RNNLNKIM T Y     W  GV KR+G VYL
Sbjct  75    PAPLGPLLSALEHFQGDRGAKEQPHFVTFRNNLNKIMGTPYNSKNDWTFGVEKREGCVYL  134

Query  1024  DVHKLPE-----RPKSELDRRRCYWGYCFESLATE-------DPGRSDGDRIHDIDANVE  881
             DV +  +     R   E  RR  + G  FE  +T          G   G     ++ + E
Sbjct  135   DVRRTQQDIESNRNPHENQRRGAFAGRRFEIYSTHPKPSSSDSSGSGQGGDQRKVNEDEE  194

Query  880   YCAVIKTKIGAHRILMGAEMDCCDSRDDG---RRFYVELKTSRELLDHRTEEIFEREKLL  710
             +C++    +G   +++ AE+DC +++D      R Y+ELKT R L   + + +FER KLL
Sbjct  195   FCSISAMTLGDKGLVVAAEIDCYEAKDGSSGSEREYIELKTFRLLQREKDQFVFERFKLL  254

Query  709   KFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLC  530
              FWIQSFL G P IV  FR+D+  + + +  R  EI      + +W   VCL F   +L 
Sbjct  255   AFWIQSFLVGTPKIVCAFRNDDFEIRKLQSFRVTEIPSFC--RRHWDPVVCLNFTKALLD  312

Query  529   WLYGTVKENEDYILQFTPHSNRLEL  455
             W+Y   +E   Y + + P  + +E+
Sbjct  313   WIYERAEEGRVYRVTYIPRQHAVEM  337



>gb|EQB49348.1| hypothetical protein CGLO_11335 [Colletotrichum gloeosporioides 
Cg-14]
Length=387

 Score =   162 bits (411),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 105/333 (32%), Positives = 171/333 (51%), Gaps = 31/333 (9%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             S  ++ P E AC+S   + + +  D SLR +    T  +G DL++G+D+F +  D  ++ 
Sbjct  17    SQPVKRPKEFACFSYDDNHEFHLGDSSLRYY---YTPSLGVDLSDGYDSFIKHDDSKAEH  73

Query  1186  FGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDV-  1019
              G LL  I+       +      VT+R  + KIMA+ +   + +EM     +  ++++  
Sbjct  74    LGSLLKTIKAHEEETGQKIDAQIVTWRGMMTKIMASPFEDRDGFEMNATLYQDCIFIEEN  133

Query  1018  --HKLPERPKSELDRRRC--------YWGYCFESLATEDPGRSDGDRIHD-------IDA  890
               +K+  + K    +RR         +WGY FE+LAT      D  R +        ++ 
Sbjct  134   HEYKVASQAKQNAQQRRGPIPPEVMQFWGYKFETLATLPAPWGDTPRAYIENRPREIVNN  193

Query  889   NVEYCAVIKTKIGAHRILMGAEMDCC----DSRDDGRRFYVELKTSRELLDHRTEEIFER  722
             N +YC+V++T IGA  I +G E+D       ++      +VELKTS  + D R  + F R
Sbjct  194   NAQYCSVVRTGIGATTICIGGEVDAVWDSKPAKQGAPTNWVELKTSLAIRDERDVDNFHR  253

Query  721   EKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGVCLAF  548
              KL+KFWIQSFL GVP I+VGFR  +G L   + + T +I   V+   ++ W G +C+ F
Sbjct  254   -KLMKFWIQSFLLGVPKIIVGFRSRDGMLTSVDEIETEKIPDTVQRRGRANWNGDMCVNF  312

Query  547   ADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             A E L WL  TV ++  + ++  P S  +E+ R
Sbjct  313   AAEFLVWLRQTVNDDGVWRIRRRPGSPMIEVFR  345



>ref|XP_009838519.1| hypothetical protein H257_12866 [Aphanomyces astaci]
 gb|ETV72076.1| hypothetical protein H257_12866 [Aphanomyces astaci]
Length=357

 Score =   162 bits (409),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 111/351 (32%), Positives = 164/351 (47%), Gaps = 30/351 (9%)
 Frame = -2

Query  1444  RGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRL  1265
             R    R    V  L      E + R    I +P +++ +S+  DG V +D   L+L K+ 
Sbjct  14    RSKQARMHDGVLVLPIPSMRELMQRSKQRISKPVQVSGFSKYPDGHVTYDRSLLKLLKK-  72

Query  1264  ITEDIGSDLNEGFDTFTEKRDLG--SQGFGDLLACIRNKN------IPLDRMHFVTYRNN  1109
                 + SDL EG D + E  +          +L   R+ +       PL + H VTYRNN
Sbjct  73    -AAPLNSDLLEGMDAYAEPPNTAPLEHVIDAMLPANRHLHNHTTDAQPLPKYHVVTYRNN  131

Query  1108  LNKIMATAYIRNEPWEMGVHKRKGVVYLDV--HKLPERPKSELDRRRCYWGYCFESLATE  935
             LNKIM T Y  N  + M + + +G VYL+V    +P    S    +  Y G  +E L++ 
Sbjct  132   LNKIMGTPYNTNSAYTMQMQRIQGCVYLNVTLSHIPPSSFSSNQAQGAYAGRRYEVLSSA  191

Query  934   DPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSR---DDGRRFYVELKTS  764
               G              EYC V    +G  ++L+GAEMD   +    DD    YVELKT 
Sbjct  192   AVGGG------------EYCGVFSVSLGQKKLLIGAEMDGVTASKDDDDDTTNYVELKTF  239

Query  763   RELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM  584
             R L   +    FER KLL FWIQS+L GVP I VGFR+++  L + +   T ++ +    
Sbjct  240   RILNTPKDRFTFERYKLLAFWIQSYLVGVPTIRVGFRNESFILTKEQAFETADLPRY--G  297

Query  583   KSYWQGGVCLAFADEVLCWLY-GTVKENEDYILQFTPHSNRLELLRGPSCP  434
               +W   VC+AF D VL W     ++E   Y +++ P +  + +    + P
Sbjct  298   DKHWHPSVCVAFTDLVLSWFVEQPLQEMAVYTVEYKPQTKCMTMSLSTTPP  348



>emb|CBN75330.1| conserved unknown protein [Ectocarpus siliculosus]
Length=441

 Score =   164 bits (414),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 100/275 (36%), Positives = 153/275 (56%), Gaps = 21/275 (8%)
 Frame = -2

Query  1249  GSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDR----MHFVTYRNNLNKIMATAY  1082
             G DLN+G+  + E     S      +A + ++   L+R     HF+TYRNNLNKI+ T Y
Sbjct  139   GKDLNQGYLNYVEPDSTSSTS---EIAEMLDETPGLEREEEAAHFITYRNNLNKILVTPY  195

Query  1081  IRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIH  902
              + + WEM V K  GV+YL+V  +  R + +LDR   YWG  FE+L        +G R+ 
Sbjct  196   SKQK-WEMEVFKEGGVIYLEV-VMTNRNQGKLDRT-SYWGRRFETLCVLG---VEGARLD  249

Query  901   DID------ANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRT  740
             ++           YC + ++++G+H +LMGAE+D C   D GR  +VE+KT+R + D + 
Sbjct  250   ELQRGPGDLPRPSYCGLYRSRLGSHNLLMGAEIDACRPGDPGR--FVEIKTTRLIRDSKD  307

Query  739   EEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGV  560
             E+IF++ K LK+W Q +LAGV  IV+G+RDD+G +   +   T+ + + V    +W   V
Sbjct  308   EQIFKKHKTLKYWAQCYLAGVRDIVLGYRDDHGIVRDVKSWTTDGLVESVDKNKHWDKDV  367

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLEL  455
             CL FAD  L +L   V E   Y  ++    + L L
Sbjct  368   CLNFADRCLSFLKDNVDEGLRYSFKYLEPFDHLTL  402



>ref|XP_007039650.1| Glycine-rich-like protein [Theobroma cacao]
 gb|EOY24151.1| Glycine-rich-like protein [Theobroma cacao]
Length=369

 Score =   161 bits (408),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 103/147 (70%), Gaps = 20/147 (14%)
 Frame = -2

Query  1468  PRQNYGYGR--GNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFD  1295
             PRQ YGYG    N   DERFVSELK +KSE TL+RK  A QEPCELAC+SRV+ GDVYFD
Sbjct  92    PRQGYGYGSKFANGRHDERFVSELKLSKSEGTLSRKCIAFQEPCELACHSRVEGGDVYFD  151

Query  1294  DRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFV---  1124
             DRSLRLFKRLITEDIG+DLN+         DL S+G GDLLACIR+KNIPL  +HFV   
Sbjct  152   DRSLRLFKRLITEDIGADLNQ---------DLCSEGLGDLLACIRDKNIPLQNIHFVNLI  202

Query  1123  -----TYRNNLNKIMATAYIRNEPWEM  1058
                  T++N    ++A A++  +P  +
Sbjct  203   SFLSLTFQNKPAFLLA-AFLTGQPISI  228



>gb|ESA08645.1| hypothetical protein GLOINDRAFT_349026 [Rhizophagus irregularis 
DAOM 181602]
Length=374

 Score =   160 bits (406),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 107/336 (32%), Positives = 174/336 (52%), Gaps = 36/336 (11%)
 Frame = -2

Query  1372  RKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGS  1193
             +K    ++P E+ C+S  ++  ++ DDR  R +     ED   +L+ G++   +K + G 
Sbjct  24    KKCVEFKQPVEITCFSYDENRQLHMDDRESRYYYPPNLED--CNLSVGYENLIQKSE-GP  80

Query  1192  QGFGDLL-ACIRNKNIPLD--RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLD  1022
             +    LL A I       D  +   V++R    K++ T Y RNE WE G       ++++
Sbjct  81    EPIHSLLDALIHLNETKGDEVKADIVSWRGIFTKLLCTPYNRNESWEFGATLYNNTIFIE  140

Query  1021  VHKLPER--------PKSELDRRRCYWGYCFESL------ATEDPGRSDGDRIHD----I  896
              H+  +         PK++L     YWGY FE+L      ATE     D + +      +
Sbjct  141   EHETEQTRLYREGSTPKAKL---MGYWGYKFEALCTIGVPATEIQSPDDPELLARKNTIV  197

Query  895   DANVEYCAVIKTKIGAHRILMGAEMDC-CDSR----DDGRRFYVELKTSRELLDHRTEEI  731
             + N++YC+V KT +G +R++MGAE+DC  D +    ++    Y+ELKT++ L + R   +
Sbjct  198   NTNIQYCSVSKTSLGKNRLIMGAEVDCLIDVKPPYPENPINRYIELKTTKILKNERDNFL  257

Query  730   FEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK-SYWQGGVCL  554
             FER KL+KFW QSFL G+P I+VGFRDD+G L   + ++T EI + V+ K   W   +CL
Sbjct  258   FERYKLIKFWAQSFLIGLPKIIVGFRDDDGNLCSLKEIKTLEIPRMVRGKDKMWDAVICL  317

Query  553   AFADEVLCWLYGTV---KENEDYILQFTPHSNRLEL  455
              F +E   WL   +     N  Y++ F      +E+
Sbjct  318   NFLNEFFEWLRRVIDIEDANSSYVISFKEPYQEIEV  353



>ref|XP_007284630.1| hla class iii protein dom3z [Colletotrichum gloeosporioides Nara 
gc5]
 gb|ELA26289.1| hla class iii protein dom3z [Colletotrichum gloeosporioides Nara 
gc5]
Length=392

 Score =   161 bits (407),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 107/340 (31%), Positives = 175/340 (51%), Gaps = 38/340 (11%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             S  ++ P E AC+S   + + +  D SLR +    T  +G DL++G+D+F +  D  ++ 
Sbjct  17    SQPVKRPKEFACFSYDDNHEFHLGDSSLRYY---YTPPLGVDLSDGYDSFIKHDDSKAEH  73

Query  1186  FGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGV------HKR-KG  1037
              G LL  I+     + +      VT+R  + KIMA+ +   + +EM        HK  + 
Sbjct  74    LGSLLKTIKAHEEEMGQKIDAQIVTWRGMMTKIMASPFEDRDGFEMNATLYQVPHKPPEN  133

Query  1036  VVYLDV---HKLPERPKSELDRRRC--------YWGYCFESLATEDPGRSDGDRIHD---  899
             +++++    +K+  + K    +RR         +WGY FE+LAT      D  R +    
Sbjct  134   IIFIEENHEYKVASQAKQNAQQRRGPIPPEVMQFWGYKFETLATLPAPWGDTPRAYIENR  193

Query  898   ----IDANVEYCAVIKTKIGAHRILMGAEMDCC----DSRDDGRRFYVELKTSRELLDHR  743
                 ++ N +YC+V++T IGA  I +G E+D       ++      +VELKTS  + D R
Sbjct  194   PREVVNNNAQYCSVVRTGIGATTICIGGEVDAVWDSKPAKQGAPTNWVELKTSLAIRDER  253

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQ  569
               + F R KL+KFWIQSFL GVP I+VGFR  +G L   + + T +I   V+   ++ W 
Sbjct  254   DVDNFHR-KLMKFWIQSFLLGVPKIIVGFRSRDGMLTSVDEIETEKIPDTVQRRGRANWN  312

Query  568   GGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             G +C+ FA E L WL  TV ++  + ++  P S  +E+ R
Sbjct  313   GDMCVNFAAEFLVWLRQTVNDDGVWRIRRRPGSPMIEVFR  352



>ref|XP_003050442.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU44729.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=368

 Score =   158 bits (399),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 112/337 (33%), Positives = 176/337 (52%), Gaps = 37/337 (11%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A +S A++ P E AC+S   + + + D  SL+ +    T  +G+DL++GFDTF ++ D 
Sbjct  13    FAGESQAVKRPKEFACFSYDDNHEFHLDASSLKYY---YTPQLGADLSKGFDTFQKQDDS  69

Query  1198  GSQGFGDLLACI----RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVV  1031
             G +    LL  I    +     +D  H VT+R  + KIMA  +   + +EM        +
Sbjct  70    GDEHLDSLLKTIIAYEKETGKKID-AHLVTWRGMMTKIMAAPFEDRDGFEM-----NATL  123

Query  1030  YLDVH--KLPERPKSELDRRR--------CYWGYCFESLATEDPGRSDGDR--IHD----  899
             Y + H  K+  R      +RR         +WGY FE+L+T     ++  R  I +    
Sbjct  124   YQENHAYKVASRANEGNGKRRRGPPLEVMQFWGYKFETLSTLPSPWAETSREFIENRENE  183

Query  898   -IDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRDD--GRRF-YVELKTSRELLDHRTEE  734
              ++   +YC+V++T IG   + +G E+D   DS+ +  G+   +VELKTS E+ +    E
Sbjct  184   IVNNKAQYCSVVRTGIGKTVLCLGGEVDAIWDSKPEEPGKPINWVELKTSAEIRNPGDME  243

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK--SYWQGGV  560
              F R KL+KFWIQSFL GVP+IVVGFR  +G LV T+ + T+ I + V  +    W   +
Sbjct  244   NFNR-KLMKFWIQSFLLGVPHIVVGFRTRDGVLVSTQDIETHRIPETVNAQPNPKWNADM  302

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ FA  VL WL   + +   + +Q  P S  +EL +
Sbjct  303   CVNFAATVLEWLTQNINDEGVWRIQRRPQSPTIELFK  339



>gb|KHE87326.1| RAI1-domain-containing protein [Neurospora crassa]
Length=412

 Score =   159 bits (401),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 112/338 (33%), Positives = 174/338 (51%), Gaps = 35/338 (10%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A KS  ++ P E AC+S   D       +SL+ +    T D+  DL++GF++F +  D 
Sbjct  45    FAGKSELVKRPKEFACFSYDADHKFLLGAQSLKWY---YTPDLNVDLSKGFESFIKHDDS  101

Query  1198  GSQGFGDLLACI----RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVV  1031
               +    LL  I    +  + P+D  H VT+R  + KIMA  +  ++ +EM     +G +
Sbjct  102   VDEHLDSLLTTIADYEQKTSKPID-AHIVTWRGMMTKIMAAPFDDDDGFEMNATLYRGCI  160

Query  1030  YLD-------VHKLPERPKSELDRRRC--YWGYCFESLAT--EDPGRSDGDRI-----HD  899
             +++         +  ERP +    +    YWGY FE+L+T  +  G++  D I     H 
Sbjct  161   FIEENHAYKQASRANERPWNGPIPQEVMQYWGYKFETLSTLPKPWGQTSRDFIESRPDHV  220

Query  898   IDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRF------YVELKTSRELLDHRTE  737
             ++   +YC+V++T IG   + +G E+D     DD  R       +VELKTS  + + R  
Sbjct  221   VNNKEQYCSVVRTGIGKTILCIGGEVDAI--WDDKPRTQGDPINWVELKTSAVIQNERQA  278

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGG  563
               FER KL+KFWIQSFL GVP I+VGFR  +G LV T+  RT EI   VK   +  W G 
Sbjct  279   NNFER-KLMKFWIQSFLLGVPKIIVGFRTQDGLLVETKEFRTMEIPLMVKKNGRPKWDGD  337

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
              C+ FA+  L WL  T+ +   + ++  P S  +E+ +
Sbjct  338   TCVNFANGFLEWLRHTITDEGVWRIKRRPRSAEIEVFK  375



>sp|Q9HE87.4|DXO_NEUCR RecName: Full=Decapping nuclease rai1 [Neurospora crassa OR74A]
 gb|EAA31915.3| rai-1 [Neurospora crassa OR74A]
Length=412

 Score =   159 bits (401),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 112/338 (33%), Positives = 174/338 (51%), Gaps = 35/338 (10%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A KS  ++ P E AC+S   D       +SL+ +    T D+  DL++GF++F +  D 
Sbjct  45    FAGKSELVKRPKEFACFSYDADHKFLLGAQSLKWY---YTPDLNVDLSKGFESFIKHDDS  101

Query  1198  GSQGFGDLLACI----RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVV  1031
               +    LL  I    +  + P+D  H VT+R  + KIMA  +  ++ +EM     +G +
Sbjct  102   VDEHLDSLLTTIADYEQKTSKPID-AHIVTWRGMMTKIMAAPFDDDDGFEMNATLYRGCI  160

Query  1030  YLD-------VHKLPERPKSELDRRRC--YWGYCFESLAT--EDPGRSDGDRI-----HD  899
             +++         +  ERP +    +    YWGY FE+L+T  +  G++  D I     H 
Sbjct  161   FIEENHAYKQASRANERPWNGPIPQEVMQYWGYKFETLSTLPKPWGQTSRDFIESRPDHV  220

Query  898   IDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRF------YVELKTSRELLDHRTE  737
             ++   +YC+V++T IG   + +G E+D     DD  R       +VELKTS  + + R  
Sbjct  221   VNNKEQYCSVVRTGIGKTILCIGGEVDAI--WDDKPRTQGDPINWVELKTSAVIQNERQA  278

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGG  563
               FER KL+KFWIQSFL GVP I+VGFR  +G LV T+  RT EI   VK   +  W G 
Sbjct  279   NNFER-KLMKFWIQSFLLGVPKIIVGFRTQDGLLVETKEFRTMEIPLMVKKNGRPKWDGD  337

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
              C+ FA+  L WL  T+ +   + ++  P S  +E+ +
Sbjct  338   TCVNFANGFLEWLRHTITDEGVWRIKRRPRSAEIEVFK  375



>ref|XP_007383141.1| RAI1-domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN09873.1| RAI1-domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
Length=480

 Score =   159 bits (402),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 109/320 (34%), Positives = 165/320 (52%), Gaps = 22/320 (7%)
 Frame = -2

Query  1414  VSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLN  1235
              S L F  SE T   K+   Q+P  L  +S      + F + +L+ +   I     ++LN
Sbjct  24    ASHLPFTSSERTTPPKNVPFQQPLPLTTFSYTPSRSLEFTNSALKYY---IEPPRNANLN  80

Query  1234  EGFDTFTEKRDLGSQGFGDLLAC----IRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEP  1067
              G+D +   R    +G  D L      +R++  P+  +  +++R  + KI+   Y   + 
Sbjct  81    YGYDRWI--RRPAEKGRIDALLKAWDKVRSEGRPVGDIGVISWRGVMTKILTAPYEERDS  138

Query  1066  WEMGVHKRKGVVYLDVH----KLPERPKSELDRRR--CYWGYCFESLATE-DPGRSD--G  914
             W + V    G +Y + H    KL E   +   R+R   Y+GY FES  T  DP   D  G
Sbjct  139   WALNVMSVNGTLYFEEHLTQAKL-EDNNNMAPRQRMFTYYGYAFESWCTSPDPPTPDTQG  197

Query  913   DRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRFYVELKTSRELLDHRTE  737
                 D+D NV++C+V+KTK+G  R+++G E+DC   +  D     VELKTS  + + + E
Sbjct  198   RWGGDVDTNVQWCSVVKTKLGNTRLVIGGEVDCVRGTYQDTNESLVELKTSMNIRNAQDE  257

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK-SYWQGGV  560
               FE +KLLKF+ QSFL GVP IVVGFR  +G L  T+  RT  + + V+ K   W   V
Sbjct  258   ARFE-QKLLKFYFQSFLLGVPEIVVGFRTPSGHLTTTQSFRTLNLPRLVRGKPKAWDPAV  316

Query  559   CLAFADEVLCWLYGTVKENE  500
             CL +AD+ L W+   + E+E
Sbjct  317   CLEWADKFLGWVKRNIVEDE  336



>gb|EFW99933.1| dhp1-interacting protein [Grosmannia clavigera kw1407]
Length=388

 Score =   156 bits (395),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 113/349 (32%), Positives = 172/349 (49%), Gaps = 47/349 (13%)
 Frame = -2

Query  1369  KSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQ  1190
             +S  ++ P E  C+S   + +++ DDRSLR +   +   + +DL+ GFD F +  D   +
Sbjct  16    QSQPVKRPKEFTCFSYDDNHELHLDDRSLRWYYPPL---LNADLSRGFDQFDKHDDSADE  72

Query  1189  GFGDLLACI----RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLD  1022
                 LL  I    +   +  D    VT+R  + KIMA  +   + +EM     +G ++++
Sbjct  73    HLDSLLKAIAAHEQKTGVKTD-AQVVTWRGMMTKIMAAPFDDRDGFEMNATLYQGCIFIE  131

Query  1021  ---VHKLPERPKSELDRRR-----------------CYWGYCFESLAT--EDPGRSDGDR  908
                 +K   R + E  + R                  +WGY FE+LAT     G +  D 
Sbjct  132   ENHAYKAASRREQEARQNRRPPRANPNQPWFPPDVMSFWGYKFETLATIPTPWGETSRDY  191

Query  907   IHD-----IDANVEYCAVIKTKIGAHRILMGAEMDCC-DSR---DDGRRFYVELKTSREL  755
             I       +    EYC+V++T +G+  + +G E+D   DS+   D     +VELKTS+++
Sbjct  192   IESRDDLRVSNKAEYCSVVRTGVGSTVLCLGGEVDAVWDSKPEKDGAPIRWVELKTSQDI  251

Query  754   LDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEI--TQRVKMK  581
             L  R  + FER KLLKFWIQSFL GVP IVVGFRD  GRL R E + T  I  T R +  
Sbjct  252   LTDRDMKAFER-KLLKFWIQSFLLGVPKIVVGFRDRAGRLRRLEEIETTTIPDTIRARGH  310

Query  580   SYWQGGVCLAFADEVLCWL-----YGTVKENEDYILQFTPHSNRLELLR  449
             + W G  C+ FA   L WL      G    +  + ++  P + R+E+ R
Sbjct  311   AAWDGNTCINFAAAFLAWLPTAMCTGDGDGDGVWRIRRRPGAPRIEVFR  359



>gb|EXX59099.1| Rai1p [Rhizophagus irregularis DAOM 197198w]
Length=370

 Score =   155 bits (391),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 105/332 (32%), Positives = 170/332 (51%), Gaps = 32/332 (10%)
 Frame = -2

Query  1372  RKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGS  1193
             +K    ++P E+ C+S  ++  ++ DDR  R +     ED   +L+ G++   +K + G 
Sbjct  24    KKCVEFKQPVEITCFSYDENRQLHMDDRESRYYYPPNLED--CNLSVGYENLIQKSE-GP  80

Query  1192  QGFGDLL-ACIRNKNIPLD--RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY--  1028
             +    LL A I       D  +   V++R    K++ T Y RNE WE G       ++  
Sbjct  81    EPIHSLLDALIHLNETKGDEVKADIVSWRGIFTKLLCTPYNRNESWEFGATLYNVSIHET  140

Query  1027  --LDVHKLPERPKSELDRRRCYWGYCFESL------ATEDPGRSDGDRIHD----IDANV  884
                 +++    PK++L     YWGY FE+L      ATE     D + +      ++ N+
Sbjct  141   EQTRLYREGSTPKAKL---MGYWGYKFEALCTIGVPATEIQSPDDPELLARKNTIVNTNI  197

Query  883   EYCAVIKTKIGAHRILMGAEMDCC-----DSRDDGRRFYVELKTSRELLDHRTEEIFERE  719
             +YC+V KT +G +R++MGAE+DC         ++    Y+ELKT++ L + R   +FER 
Sbjct  198   QYCSVSKTSLGKNRLIMGAEVDCLIDFNPPYPENPINRYIELKTTKILKNERDNFLFERY  257

Query  718   KLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK-SYWQGGVCLAFAD  542
             KL+KFW QSFL G+P I+VGFRDD+G L   + ++T EI + V+ K   W   +CL F +
Sbjct  258   KLIKFWAQSFLIGLPKIIVGFRDDDGNLCSLKEIKTLEIPRMVRGKDKMWDAVICLNFLN  317

Query  541   EVLCWLYGTV---KENEDYILQFTPHSNRLEL  455
             E   WL   +     N  Y++ F      +E+
Sbjct  318   EFFEWLRRVIDIEDANSSYVISFKEPYQEIEV  349



>ref|XP_003382901.1| PREDICTED: protein Dom3Z-like [Amphimedon queenslandica]
Length=457

 Score =   156 bits (395),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 107/394 (27%), Positives = 175/394 (44%), Gaps = 64/394 (16%)
 Frame = -2

Query  1486  PSPNYPPRQNYGYGRGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGD  1307
             PSP        G      P+    +S+   ++ E+   + +   + P E+  +S  + GD
Sbjct  14    PSPKRSKLHTEGEAHQQQPKPLGKISDFVVSRLED-FYKPNPPFRLPVEIGSFSFDRKGD  72

Query  1306  VYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMH-  1130
             +  D   L+   +     +G DL  G+D+F  K +        L     N N  L +M  
Sbjct  73    LTLDRSGLKYLTQ--PGKLGFDLKVGYDSFQPKLNQTPDLTVILNWISHNWNCFLPKMKG  130

Query  1129  -----------------------------------------FVTYRNNLNKIMATAYIRN  1073
                                                      F+ +R  + K++ T Y ++
Sbjct  131   QSSLDGKPPEDLNGSAPIVQTANQSSVTTSFHSRPDNLLTDFICWRGLMTKLLCTPYNKS  190

Query  1072  EPWEMGVHKRKGVVYLDVHKLPERPKSEL-----DRRRCYWGYCFESLATED-----PGR  923
             EPW+M   +    +YL   + PE+ + E      +++ CYWG  FE   T       P  
Sbjct  191   EPWKMIATRHNDTIYLRELETPEKAEKEANMSLAEKQMCYWGLKFEDYMTRKDPKVPPPS  250

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCD--SRDDGRRFYVELKTSRELLD  749
                D+   I+    +C V++T++  H ++M  E+DC D  SR+   + YVELKTSR +  
Sbjct  251   QQQDKSGTINPLEAFCCVVRTRLNTHSLVMVGEVDCIDPASREKVPQSYVELKTSRVIYT  310

Query  748   HRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK----  581
              R +  F+R KL+K+W QSFL G+P IV GFRD+ G +   ++ +T +I +  ++K    
Sbjct  311   DRNKASFKRHKLMKWWAQSFLVGIPKIVCGFRDNEGIVQHIQQFKTVDIPRESQVKELQA  370

Query  580   ---SYWQGGVCLAFADEVLCWLYGTVKENEDYIL  488
                S WQG VCL F DE+L W+  TV +++   L
Sbjct  371   SDLSLWQGNVCLNFLDELLKWIKETVVKDDSQTL  404



>ref|NP_001174410.1| Os05g0392100 [Oryza sativa Japonica Group]
 dbj|BAH93138.1| Os05g0392100, partial [Oryza sativa Japonica Group]
Length=113

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = -2

Query  676  PYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYGTVKENED  497
            PYI    R+D G L+RTERLRT EITQ+VK K+YWQGGVCLAFADEVLCWLYGTV+ENED
Sbjct  17   PYIFFTCRNDAGVLIRTERLRTKEITQKVKAKNYWQGGVCLAFADEVLCWLYGTVRENED  76

Query  496  YILQFTPHSNRLELLRGPS-CPDAITHHVQQL  404
            YILQF    NRLELLR  S CPDAITHHV+QL
Sbjct  77   YILQFVHPFNRLELLRAQSPCPDAITHHVEQL  108



>ref|XP_002905188.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY53570.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=293

 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 100/289 (35%), Positives = 146/289 (51%), Gaps = 23/289 (8%)
 Frame = -2

Query  1252  IGSDLNEGFDTFTEKRDLGSQGFGDLLAC-------IRNKNIPLDRMHFVTYRNNLNKIM  1094
             IG++L +GF+ +T K +         +A         +  +   ++ HFVTYRNNLNKIM
Sbjct  4     IGANLLDGFEEYTAKDEANPTAPPAPIAPLLAALEHFQGDSKDREKAHFVTYRNNLNKIM  63

Query  1093  ATAYIRNEPWEMGVHKRKGVVYLDVHKLPE-----RPKSELDRRRCYWGYCFESLATEDP  929
              T Y     W   V KR G VYLDV +  E     R   E  RR  + G  FE  AT  P
Sbjct  64    GTPYNSKNAWTFEVEKRAGCVYLDVRRTQEDIDSNRNPHENQRRGAFAGRRFEIYATH-P  122

Query  928   GRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLD  749
              + D +R   ++ + E+C++    +G  R+++ AE+DC + +    R YVELKT R L  
Sbjct  123   KQDDEER--KVNEDEEFCSISAMALGDKRLVVAAEIDCYEDKGHNEREYVELKTFRLLQR  180

Query  748   HRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYW-  572
              + + +FER KLL FWIQSFL G P IV  FR D+ ++ + +  R  +I      + +W 
Sbjct  181   EKDQLVFERFKLLAFWIQSFLVGTPKIVCAFRSDDFQVRKLQSFRVTDIPSFC--RQHWV  238

Query  571   ---QGGVCLAFADEVLCWLYGTVKENEDYILQFTP--HSNRLELLRGPS  440
                   VCL F   +L W+Y   +E   + + + P  H   +EL   PS
Sbjct  239   RCRSPIVCLNFTKALLDWIYDHAQEGRAHRVTYIPQRHVVEMELSSEPS  287



>ref|XP_008079284.1| Protein RAI1 [Glarea lozoyensis ATCC 20868]
 gb|EPE34132.1| Protein RAI1 [Glarea lozoyensis ATCC 20868]
Length=381

 Score =   154 bits (389),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 173/338 (51%), Gaps = 40/338 (12%)
 Frame = -2

Query  1369  KSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQ  1190
             +S AI+ P E+AC+S         DD S+R +       IG+DL++GFDTF +  D    
Sbjct  16    QSAAIKRPREIACFSYDDKHTFRLDDSSIRYY---YPPTIGADLSKGFDTFEKMDDTADD  72

Query  1189  GFGDLLACI---RNKNIPLDRMHFVTYRNNLNKIMATAYI-RNEPWEMGVHKRKGVVYLD  1022
                 LL  I     K        F+T+R  + K MA  +  R+ P +    + KG ++L+
Sbjct  73    HLDSLLKTIMAHEEKTGERVEADFITWRGMMTKFMAAIFSDRDRPADK--TRFKGTIFLE  130

Query  1021  V---HKL------------PERPKSELDRRRCYWGYCFESLATEDPGRSDGDR--IHDID  893
                 +KL            P RP  ++     +WGY FE+L       S+  R  I + +
Sbjct  131   ENHEYKLESQQRQSQQFTQPGRPSQDM---MSFWGYKFETLCLLPAPWSETSRDYIENRE  187

Query  892   ANV-----EYCAVIKTKIGAHRILMGAEMDCC-DSR--DDGRRFYVELKTSRELLDHRTE  737
             A V     +YC+V++T IG + +++G E+D   DS+  D G   +VELKTS ++   R  
Sbjct  188   AEVVTNYAQYCSVVRTGIGNNILILGGEVDAVWDSKPVDGGPINWVELKTSMDIRGERDM  247

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGG  563
               FER KL+KFWIQSFL GVP I+VGFR  NG L R E + T  I  +VK   +  W G 
Sbjct  248   VTFER-KLMKFWIQSFLLGVPKIIVGFRSPNGILQRIEEISTASIPSKVKREGRGTWDGN  306

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             +C+ FA E+L +L  T+ E   + ++    S+ +E+ +
Sbjct  307   MCINFASELLGFLKATITEEGVWRIRRKERSSTIEVYK  344



>ref|XP_007868728.1| RAI1-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ52575.1| RAI1-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
Length=431

 Score =   155 bits (392),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 107/331 (32%), Positives = 171/331 (52%), Gaps = 35/331 (11%)
 Frame = -2

Query  1387  EETLARKSTAI---------QEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLN  1235
             E TL+  ST+I         Q+P  L  +S     ++ +DD +++ +   +    G++L+
Sbjct  28    ESTLSYPSTSIPPKISPVPIQQPTSLLTFSYTPSRELVWDDSAMKYY---VDPPPGAELS  84

Query  1234  EGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMG  1055
              G++ + +K +   +    LL       +P   +  V++R  + KI+   Y   + W++ 
Sbjct  85    YGYERWVKKPEERGR-IDSLLRAWSKARMP--GIGLVSWRGVMTKILTAPYEERDSWDLN  141

Query  1054  VHKRKGVVYLDVHKLPERPKSELD-----RRRCYWGYCFESLATED-PGRSDGDRIH---  902
             V    G +YL+ H    R K + D     R + Y+GY FES  T   P R +    H   
Sbjct  142   VMCVNGTLYLEEHSSDARLKEKDDMNPRQRMQTYYGYAFESWCTSSSPDRPESLPGHRAG  201

Query  901   ---DIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRR-FYVELKTSRELLDHRTEE  734
                D+D NV++C VIKTK+G  R+++G E+DC   R DG+   +VELKTS  + D R E 
Sbjct  202   WGGDVDTNVQWCNVIKTKLGDVRMVIGGEVDCIRGRKDGKHDAFVELKTSLAIRDQRDEA  261

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK-SYWQGGVC  557
              FE+ KLLKF+ QSFL GVP I+VGFR  +GRL   +  +T ++ + V+ K   W   +C
Sbjct  262   RFEK-KLLKFYFQSFLLGVPEIIVGFRTPSGRLTTIQTFKTVQLPRLVRGKPGAWDPQLC  320

Query  556   LAFADEVLCWLYGTVKENEDYILQFTPHSNR  464
             L +    L +L  TV+ + +     TP  N+
Sbjct  321   LDWGRRFLTFLKSTVQTDPN-----TPEENK  346



>gb|EFQ27901.1| hypothetical protein GLRG_03045 [Colletotrichum graminicola M1.001]
Length=385

 Score =   154 bits (389),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 102/315 (32%), Positives = 160/315 (51%), Gaps = 31/315 (10%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             S  ++ P E +C+S   + D + DD SLR +    T  +G+DL++G+DTF +  D   + 
Sbjct  17    SQPVKRPKEFSCFSYDDNHDFHLDDSSLRYY---YTPALGTDLSKGYDTFIKHDDSKPEH  73

Query  1186  FGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDV-  1019
              G LL  I+       +      VT+R  + KIMAT +   + +EM     +  +Y++  
Sbjct  74    LGALLKTIKAHEEETGQRIDAQIVTWRGMMTKIMATPFEDRDGFEMNATLYQDCIYIEEN  133

Query  1018  --HKLPERPKSELDRRRC--------YWGYCFESLATEDPGRSDGDRIHD-------IDA  890
               +K+  + +    +RR         +WGY FE+LAT      D  R +        ++ 
Sbjct  134   HEYKVASQKQQNASQRRGPIPPEVMQFWGYKFETLATLPAPWGDTPREYIEKRDEEIVNN  193

Query  889   NVEYCAVIKTKIGAHRILMGAEMDCC----DSRDDGRRFYVELKTSRELLDHRTEEIFER  722
               +YC+V++T IG   I +G E+D       ++      +VELKTS  + D R  + F R
Sbjct  194   KAQYCSVVRTGIGQTVICIGGEVDAVWDSKPAKPGAPTNWVELKTSLAIRDDRDVDNFHR  253

Query  721   EKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGVCLAF  548
              KL+KFWIQSFL GVP I+VGFR+  G L   E + T +I   V+   K+ W   +C+ F
Sbjct  254   -KLMKFWIQSFLLGVPKIIVGFRNRQGILTGVEEIETEKIPDTVQRRGKASWNADMCVNF  312

Query  547   ADEVLCWLYGTVKEN  503
             A E L WL  T+ ++
Sbjct  313   AAEFLVWLRQTIDDD  327



>ref|XP_006676458.1| hypothetical protein BATDEDRAFT_85178 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF84475.1| hypothetical protein BATDEDRAFT_85178 [Batrachochytrium dendrobatidis 
JAM81]
Length=267

 Score =   150 bits (379),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/254 (33%), Positives = 135/254 (53%), Gaps = 24/254 (9%)
 Frame = -2

Query  1117  RNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSEL-----DRRRCYWGYCF  953
             R  +NKI    Y  NE WE GV   KG +Y++ H+  E+ KS+      D    YWGY F
Sbjct  5     RGIMNKIAQVPYASNETWEFGVTLHKGTIYIEEHESIEKQKSKFGATDRDAMFTYWGYKF  64

Query  952   ESLAT----------EDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCC---  812
             ESL+T          +DP   + +    ++ N+++C+V KT  G+H ++MGAE+DC    
Sbjct  65    ESLSTIPIPPNQLEHDDPVLKNRETAV-VNTNIQFCSVFKTNYGSHSVVMGAEVDCVTRE  123

Query  811   -DSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRL  635
              ++    +  Y ELKT++ +   R    FE+ KLL+ W+QS+LAGVP +++GFR  +G +
Sbjct  124   IETGTSPQSVYAELKTTQVIDTDRKRHSFEKFKLLRIWLQSYLAGVPKVIIGFRTGDGHI  183

Query  634   VRTERLRTNEITQRVKMK-SYWQGGVCLAFADEVLCWLYGTVK---ENEDYILQFTPHSN  467
                +   T+E+ + V+ K   W    C+AF D+ L W+   V     N  Y ++F  +  
Sbjct  184   SHVQEFDTSELPRLVRGKPGMWDPNRCIAFGDQFLAWVKQVVTIDDWNTVYTVRFDSNKQ  243

Query  466   RLELLRGPSCPDAI  425
              +E+L   +  D +
Sbjct  244   MIEMLAPVTGGDQV  257



>ref|XP_008618449.1| hypothetical protein SDRG_14120 [Saprolegnia diclina VS20]
 gb|EQC28163.1| hypothetical protein SDRG_14120 [Saprolegnia diclina VS20]
Length=345

 Score =   152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 108/351 (31%), Positives = 167/351 (48%), Gaps = 46/351 (13%)
 Frame = -2

Query  1420  RFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSD  1241
             R +  L    +   LA     + +P +++ YS   DG + FD  SL   K L    IG++
Sbjct  5     RALHVLHVPSTSALLAHDKIRLSKPEQVSGYSLHPDGHLTFDRASL---KELRPAKIGAN  61

Query  1240  LNEGFDTFTEKRDLGSQGFGDLLACIRNKN---------IPLDRM----HFVTYRNNLNK  1100
             L  GF+   E  +  S     +L  +   N         +PL R+      VT+RNNLNK
Sbjct  62    LLHGFEHHVETNEDASPSLQPILDAMLPANRHAHHADAHLPLPRLPAAIDIVTFRNNLNK  121

Query  1099  IMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKS----ELDRRRCYWGYCFESLATE-  935
             I+ T Y  N P+   V +R   ++ ++    ER  +        +  Y G  +E++A+  
Sbjct  122   ILGTPYNSNSPYAFHVQRRGRTLFFNIQH--ERDTNGDMHPAQAKGAYAGRQYEAIASHG  179

Query  934   DPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSREL  755
              PG              EYC +    +G+ ++L+GAE+D  D R D    YVELKT + L
Sbjct  180   SPG--------------EYCGLFTMLLGSTQLLVGAELDGVDVRGD----YVELKTYKLL  221

Query  754   LDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSY  575
                +    FER K L FWIQS+L GV  I  GFR  + +LV+ +   T+++        Y
Sbjct  222   QTSKDRFSFERFKCLAFWIQSYLVGVGRIRCGFRSTDCKLVKEQTFATSQLP--AFGAKY  279

Query  574   WQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDAIT  422
             WQ  VCL+FA  V  WL+  V +++ Y +++ P +  L LL   + PD++ 
Sbjct  280   WQPNVCLSFAKLVFAWLHDKVPDDKTYEVRYDPRARALSLL---ALPDSMA  327



>gb|EUC57011.1| RAI1-Rat1p interacting protein, required for pre-rRNA processing-like 
protein, putative [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP53067.1| putative RAI1-Rat1p interacting protein, required for pre-rRNA 
processing-like protein [Rhizoctonia solani 123E]
Length=412

 Score =   154 bits (388),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 120/377 (32%), Positives = 189/377 (50%), Gaps = 47/377 (12%)
 Frame = -2

Query  1438  NAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLIT  1259
             N  R+ ++   L+ + ++ T      A  +P +L C+S   D ++ FD  +L+ +   + 
Sbjct  31    NKTRESQYTLPLETSPTDPT-----PAFGQPQQLTCFSYTPDRELRFDTSALKYY---VP  82

Query  1258  EDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDRMH--FVTYRNNLNKIMATA  1085
               I +DL   ++ +  KR         LL  I  ++I  +R    F+++R  + K++   
Sbjct  83    APINADLGYRYEHWI-KRPEERGRIDSLLQAIGQEHIIQERKKGAFISWRGVMTKLLTAP  141

Query  1084  YIRNEPWEMGVHKRKGVVYLDVHK----------LPERPKSELDRRRCYWGYCFESLATE  935
                 +P  + +    G +Y + H           +P R      R   Y+GY FES +T 
Sbjct  142   VESRDPVNLNLMFLDGCIYAEEHATNAVIAEKENIPPR-----QRLMMYYGYSFESFSTW  196

Query  934   DPGR------SDGDRIH----DIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGR-R  788
             D         ++ DR+     D+D NV++C+V+KTKIGA R+++G E+DCC  R  G+  
Sbjct  197   DESLQRREQYAERDRVRCWSGDVDTNVQFCSVVKTKIGAERMILGGEVDCCKDRYTGQPN  256

Query  787   FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTN  608
              YVELKTS  +   + EE FER KLLKFW QSFL G+P IVVGFR   GR+   +   T 
Sbjct  257   SYVELKTSMVIRKSQDEERFER-KLLKFWAQSFLLGIPEIVVGFRTHQGRISTLQTFETL  315

Query  607   EITQRVKMK-SYWQGGVCLAFADEVLCWLYGTVKENE--DYIL-QFTPHSNRLELLRGPS  440
              + + V+ K   W    CL FA+++L ++  T+ E++  DY L Q      RLE+     
Sbjct  316   ALPRMVRGKPGAWDPKPCLVFAEKLLRFIRSTLMEDKQSDYGLDQRDVAVWRLEIR----  371

Query  439   CPDAITHHVQQLESF*V  389
              P A T  + +LE F V
Sbjct  372   -PGAQTVTLYKLEPFEV  387



>gb|EWG47941.1| protein RAI1 [Fusarium verticillioides 7600]
 gb|EWG47942.1| protein RAI1 [Fusarium verticillioides 7600]
Length=384

 Score =   152 bits (383),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 104/337 (31%), Positives = 170/337 (50%), Gaps = 31/337 (9%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E AC+S   + + + DD SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  23    FAGASQPVKRPKEFACFSYDDNHEFHLDDSSLKYY---YTPQLGADLSKGFDTFQKLDDT  79

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
             G      LL  I        +    + VT+R  + KIMA  + + + +EM     +G ++
Sbjct  80    GDDHLDSLLKTIAAHEQETGKKIDANVVTWRGMMTKIMAAPFDQMDGFEMNATLYQGCIF  139

Query  1027  LD---VHKLPERPKSELDRRR--------CYWGYCFESLATEDPGRSDGDR--IHD----  899
             ++    +K+  R     ++RR         +WGY FE+L+T     ++  R  I +    
Sbjct  140   IEENNAYKIASRSNEGNNKRRRGPPLEVMQFWGYKFETLSTLPAPWAETSRDFIENRENE  199

Query  898   -IDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRTEE  734
              ++   +YC+V++T IG   + +G E+D   DS+ + +     +VELKTS E+ +    E
Sbjct  200   VVNNKAQYCSVVRTGIGKSVLCLGGEVDAIWDSKPEEKGSPINWVELKTSAEIRNAGGME  259

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGV  560
              F+R KL+K+WIQSFL GVP IVVGFR  +G LV    + T+ I   V       W   +
Sbjct  260   NFKR-KLMKYWIQSFLLGVPRIVVGFRTQDGILVEAREMETHRIPDMVNADPNPKWNADM  318

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ FA   L WL   + +   + ++  P S  +EL +
Sbjct  319   CVNFAATFLEWLTENINDEGVWRIRREPQSPTIELFK  355



>emb|CEG77966.1| hypothetical protein RMATCC62417_12635 [Rhizopus microsporus]
Length=283

 Score =   149 bits (377),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 132/235 (56%), Gaps = 33/235 (14%)
 Frame = -2

Query  1108  LNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRC--YWGYCFESLAT-  938
             + KI+ T Y R + WE+   +  G ++++   L +  K + DR++   YWGY FE+L T 
Sbjct  1     MTKILCTPYSRRDAWELRATRYNGTIFIEEQSLKDNSK-DTDRQKLMGYWGYRFETLCTV  59

Query  937   -EDPGRSDGDRIHDID-----ANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRF---  785
              + P + + + +   D      NV+YC V+KTK+G + I+MGAE+DCC   D    F   
Sbjct  60    SQPPHKVNKEELKKRDNESANTNVQYCVVVKTKLGNNSIIMGAEVDCCRGIDALFYFTKY  119

Query  784   -------------------YVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVV  662
                                Y+ELKTSR +   R +  F+R KLLKFW QSFL GVP I+ 
Sbjct  120   THKDRKDVKPKDPTAQLSNYIELKTSRVIETGRHDYSFQRYKLLKFWAQSFLVGVPRIIC  179

Query  661   GFRDDNGRLVRTERLRTNEITQRVK-MKSYWQGGVCLAFADEVLCWLYGTVKENE  500
             GFR+D+G L+  ++ +T EI ++V+  K+ W   VCL FA+++L W+   + E++
Sbjct  180   GFRNDDGLLMEVKQYKTLEIPRQVRNTKNTWNPAVCLNFANQLLDWIQHNITEDD  234



>ref|XP_004338880.1| DOM3 exoribonuclease, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR16867.1| DOM3 exoribonuclease, putative [Acanthamoeba castellanii str. 
Neff]
Length=422

 Score =   152 bits (385),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 109/327 (33%), Positives = 164/327 (50%), Gaps = 31/327 (9%)
 Frame = -2

Query  1399  FAKSEETLAR-KSTAIQEPCELACYSRVQDGDVYFD-DRSLRLFKRLITEDIGSDLNEGF  1226
             FA S +   R K     +P E+ C SR  D   + D D+ LR FK       G DL+ GF
Sbjct  36    FAVSAQAYHRWKFPHYSQPREVGCMSRDADHQWHNDSDQELRYFKEPAP---GCDLSAGF  92

Query  1225  DTFTEKRDLGSQG--FGDLLACIRNKNIPLDRM--------------HFVTYRNNLNKIM  1094
             DTF +K +   +      +L+ + ++     R                FV +R +  +++
Sbjct  93    DTFVKKDEEKEKQEHITPILSWLHHQRAGGSRASSYKRREMDVIAHPQFVAWRGSFARLL  152

Query  1093  ATAYIRNEPWEMGVHKRKGVVYLDVHKLPE-----RPKSELDRRRCYWGYCFESLATEDP  929
                Y R+E W + V + KG +Y+     PE     R +++ +    YWGY FE  +T  P
Sbjct  153   CAPYNRSESWRLLVCRFKGTIYIADKDTPETQARRRNQTQREELMGYWGYKFEDYSTR-P  211

Query  928   GRSDGDRIHDIDANVE-YCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRFYVELKTSREL  755
                  +      +N+  YC V++ ++G+H +LM  E DCC + +      YVELKT++ L
Sbjct  212   RTGLQEPNEGPVSNIPCYCTVVRARLGSHLLLMSGETDCCMEGQAKPPDNYVELKTNKVL  271

Query  754   LDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK-S  578
             +  R    FER KLLKFW QSFLAGVP +VVGFRDD G +   +  +T E+ + V+ K +
Sbjct  272   MTERDRTSFERYKLLKFWSQSFLAGVPRVVVGFRDDEGIVRTVQHFKTLELPRFVEGKRN  331

Query  577   YWQGGVCLAFADEVLCWLYGTVKENED  497
              W   VC+ F D+ L W+   + E ED
Sbjct  332   MWDSAVCMNFCDQFLTWV-AWLFEQED  357



>ref|XP_003662146.1| hypothetical protein MYCTH_2143293 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO56901.1| hypothetical protein MYCTH_2143293 [Myceliophthora thermophila 
ATCC 42464]
Length=392

 Score =   152 bits (383),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 116/374 (31%), Positives = 178/374 (48%), Gaps = 60/374 (16%)
 Frame = -2

Query  1489  LPSPNYPPRQNYGYGRGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDG  1310
             L  P YPP +   YG G  P                        ++ P E AC+S  +D 
Sbjct  3     LKFPVYPPSR---YGGGTEP------------------------VKRPKEFACFSYDKDH  35

Query  1309  DVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIR----NKNIPL  1142
                 DD SL+ +      D+G DL+ G DTF +  D   +    LL  I+        P+
Sbjct  36    KFRLDDSSLKWY---YPPDLGVDLSRGSDTFIQHDDSIDEHLDSLLKTIKAYEEQTGEPI  92

Query  1141  DRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRRC---  971
             D  H VT+R  L KIMA  +  +E +EM     +G ++++ H   +  K +++  R    
Sbjct  93    D-AHVVTWRGMLTKIMAAPF-DDEAFEMNATLYRGCIFIEEHHGFKEQKRQMENSRTGQR  150

Query  970   -------YWGYCFESLAT--EDPGRSDGDRIHDIDANV-----EYCAVIKTKIGAHRILM  833
                    YWGY FE+L+T       +  D I + D  V     +YC+V++T  G   + +
Sbjct  151   ILPSLMQYWGYKFETLSTLPRPWAETSRDYIENRDQEVVNNKEQYCSVVRTGFGKSIVCL  210

Query  832   GAEMDCC-DSR--DDGRRF-YVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIV  665
             G E+D   D++    G    +VELKTS E+ +H  +  F+R KL+++WIQSFL GVP I+
Sbjct  211   GGEVDAIWDAKPATPGDPINWVELKTSAEIRNHNDQFKFDR-KLMRYWIQSFLLGVPKII  269

Query  664   VGFRDDNGRLVRTERLRTNEITQRVKMK--SYWQGGVCLAFADEVLCWLYGTVKENEDYI  491
             VGFR  +G L R E  RT  I   V+ +  + W G VC+ F    L WL  ++ +   + 
Sbjct  270   VGFRTQDGILSRVEEFRTMSIPHEVQRRGLAKWDGNVCIRFTSLFLDWLRRSIDDEGVWR  329

Query  490   LQFTPHSNRLELLR  449
             ++    S+ +EL +
Sbjct  330   IRRRQKSDFIELFK  343



>ref|XP_009255547.1| hypothetical protein FPSE_04154 [Fusarium pseudograminearum CS3096]
 gb|EKJ75653.1| hypothetical protein FPSE_04154 [Fusarium pseudograminearum CS3096]
Length=374

 Score =   151 bits (382),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 109/339 (32%), Positives = 172/339 (51%), Gaps = 35/339 (10%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A +S  ++ P E AC+S   + +   DD SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  13    FAGESQPVKRPKEFACFSYDDNHEFRLDDSSLKYY---YTPQLGADLSKGFDTFQKLDDT  69

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
             G      LL  I        +    + VT+R  + KIMAT +   + +EM     +  ++
Sbjct  70    GDDHLDSLLKTIVAHEQETGKKIDANVVTWRGMMTKIMATPFDNMDGFEMNATLYQDCIF  129

Query  1027  LD---VHKLPERPKSELDRRR--------CYWGYCFESLAT------EDPGRSDGDRIHD  899
             ++    +K+  R     +RRR         +WGY FE+L+T      E P     +R  +
Sbjct  130   IEENNAYKVASRSNEGSNRRRRGPPLEVMQFWGYKFETLSTLPAPWAETPREFIENREDE  189

Query  898   IDAN-VEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRTEE  734
             +  N  +YC+V++T IG   + +G E+D   DS+ + +     +VELKTS E+ +    E
Sbjct  190   VVNNKAQYCSVVRTGIGKSVLCLGGEVDAIWDSKPEEKGSPINWVELKTSAEIRNAGDME  249

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSY----WQG  566
              F R KL+K+WIQSFL GVP IVVGFR  +G LV  + + T+ I + V   SY    W  
Sbjct  250   NFNR-KLMKYWIQSFLLGVPRIVVGFRTRDGILVEAKDVETHRIPETV--NSYPNPKWNA  306

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
              +C+ FA   L WL   + +   + ++  P S  +EL +
Sbjct  307   DMCVNFAATFLDWLSANITDEGVWRIKREPQSPTIELFK  345



>ref|XP_005706350.1| glycine-rich protein [Galdieria sulphuraria]
 gb|EME29830.1| glycine-rich protein [Galdieria sulphuraria]
Length=332

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/296 (31%), Positives = 155/296 (52%), Gaps = 23/296 (8%)
 Frame = -2

Query  1369  KSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQ  1190
             K   +  P E+AC+SR+     ++   S +  K L    + S LN+G+++F  K    S 
Sbjct  23    KKVPVSSPVEVACFSRLSAS--HYVPCSRQALKTLKIPQVPSCLNQGYESFIPKDQSSSI  80

Query  1189  GFGDLLACIRNKNIPLD-RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHK  1013
                 +   +    + +D  + F+T+RNNLNKI  T Y   E W+M  H    ++ L++  
Sbjct  81    SLSPVRESLEKAFVNVDDSIQFLTFRNNLNKIALTPYNTEESWKMTSHLENNLIVLNICP  140

Query  1012  LPE-RPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRIL  836
               E  P ++ D+   Y GY FE L  E       D +  +DAN E+C+++KT IG H +L
Sbjct  141   SEELEPVTDRDKYFAYCGYKFEHLCCES-----DDVV--VDANQEFCSIVKTSIGKHTLL  193

Query  835   MGAEMDCCD-----SRDDGRRF----YVELKTSRELLDHRTEEIFEREKLLKFWIQSFLA  683
             + A++DC D     S+D+   +    YVELKT ++    +    F + K L++W+Q FLA
Sbjct  194   ISAQVDCWDAYHLWSKDNRAEYPICHYVELKTMKKWKKEQVIPDFYQRKYLRYWVQCFLA  253

Query  682   GVPYIVVGFRDDNGR-LVRTERLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLYG  518
             G+P++ +G+RDD  + L+ TE +  + + +  +    W+  +CL F D  L +++ 
Sbjct  254   GIPHLFIGYRDDRRKMLMETEYIPVDRLPEICRES--WEPHICLGFMDSFLYFVFS  307



>gb|EQL02699.1| Dhp1-interacting protein Din1 [Ophiocordyceps sinensis CO18]
Length=385

 Score =   150 bits (380),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 107/340 (31%), Positives = 174/340 (51%), Gaps = 37/340 (11%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E AC+S  ++ +   DD SL+ +    T  +G+DL++GFD F +  D 
Sbjct  13    FAGPSHPVKRPKEFACFSYDKNHEFRLDDSSLKWY---YTPRMGADLSKGFDKFQKCDDS  69

Query  1198  GSQGFGDLLACI----RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVV  1031
               +    LL  I    +     +D  +FVT+R  + KI+A  + +N+ +EM     +G +
Sbjct  70    RDEHLDSLLRAIMAHEQQTGTKID-ANFVTWRGMMTKILAAVFEQNDGFEMNATLYQGCI  128

Query  1030  YLD---VHKLPERPKSELDRRR---------CYWGYCFESLATEDPGRSD--------GD  911
             +++    +K+  R +SE  R R          +WGY FE+L+T  P   D        G 
Sbjct  129   FIEENHAYKMAMR-RSETQRHRRGGPPPEVMQFWGYKFETLSTM-PATWDETPRNFLEGR  186

Query  910   RIHDIDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHR  743
               H ++ N +YC++++T I    + +G E+D   DS+   +     +VELKTS E+    
Sbjct  187   ENHVVNNNEQYCSIVRTGIDKAILCLGGEVDAIWDSKPQEQGAPTNWVELKTSAEIRSQW  246

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRV--KMKSYWQ  569
               + F R KL+K+WIQSFL GVP I+VGFR  +G LV  + + T+ I + V  +  + W 
Sbjct  247   DMDAFHR-KLMKYWIQSFLLGVPKIIVGFRTADGILVGIQEIETHRIPETVNSRANARWN  305

Query  568   GGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
               +C+ FA   L WL  T+ +   + +    HS  +EL R
Sbjct  306   ADMCVNFASAFLEWLSNTITDEGVWRITRRQHSPVIELSR  345



>gb|EAS37451.2| rai1 protein [Coccidioides immitis RS]
Length=368

 Score =   149 bits (377),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 107/323 (33%), Positives = 165/323 (51%), Gaps = 40/323 (12%)
 Frame = -2

Query  1384  ETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKR  1205
             +  A  + AI+ P E+AC+S   D +   D+ SLR +       +  DLN GF+TF +  
Sbjct  12    QRFAGSNAAIRRPKEIACFSYDDDHNFLLDESSLRYY---YPPRLPVDLNGGFETFKKLD  68

Query  1204  DLGSQGFGDLLACIRNKNIPLDR-------MHFVTYRNNLNKIMATAYIRNEPWEMGVHK  1046
             D   +    LL  I    I L++          +T+R  + K+M  ++     +EM    
Sbjct  69    DSADEHLDALLDTI----IALEKSTGAKCEADVITWRGMMTKLMTASFDNWNGFEMNATY  124

Query  1045  RKGVVYLDVH----------KLPER--PKSELDRRRCYWGYCFESLATED------PGRS  920
              +G ++++ +          +L +R  P +    R  YWGY FE+L+  D         +
Sbjct  125   YQGSIFIEENNEYKNAQKKIQLEQRMPPGAPSQDRMMYWGYKFETLSLIDEPWDAVSRET  184

Query  919   DGDRIHDI-DANVEYCAVIKTKIGAHRILMGAEMD----CCDSRDDGRRFYVELKTSREL  755
                R H I + N +YC+V++T IG  ++++G E+D    C   R D    +VELKTS E+
Sbjct  185   IESREHKIVNNNSQYCSVVRTGIGGVKLVIGGEVDAVWDCKPDRKDDPINWVELKTSAEI  244

Query  754   LDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--K  581
              + R    FER KLLKFW QSFL GVP IVVGFR+++G L R E  +T+EI   VK   +
Sbjct  245   RNDRDMLKFER-KLLKFWAQSFLLGVPKIVVGFRNEHGILQRLEEFQTHEIPGFVKRQGR  303

Query  580   SYWQGGVCLAFADEVLCWLYGTV  512
               W G +C+ F  ++L W+ G +
Sbjct  304   GNWDGNICINFTAQLLEWIRGII  326



>ref|XP_003060209.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56161.1| predicted protein [Micromonas pusilla CCMP1545]
Length=714

 Score =   154 bits (390),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 150/296 (51%), Gaps = 25/296 (8%)
 Frame = -2

Query  1369  KSTAIQEPCELACYSRVQD-GDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGS  1193
             ++   +EP ELAC+S+ ++ GDVY D  +L+ + R    D+  DL+ G D F + RD G 
Sbjct  23    RAAPYREPVELACFSKSRERGDVY-DASNLKAYAR---PDVPFDLSRGHDAFRD-RDRGE  77

Query  1192  QGFGD---LLACIRNKNI---PLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVV  1031
             +   D   +   +R   +    L     +T+R N +KI+AT +   + W +      GV 
Sbjct  78    RRPADVTPIFESLRRAGVDERELAAADVLTWRGNFSKILATPWNARDAWHLECELVDGVC  137

Query  1030  YLDVHKLPERPKSELDRR------RCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAV  869
              L+V +  E  + E +R         YWGY FE   T       GD    +D    YC V
Sbjct  138   VLNVLEPEECVRREANREGTRQGLMAYWGYSFEEACT------GGDYSSPVDCLDAYCVV  191

Query  868   IKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSF  689
             ++T +G HR++MG E+DC D    G   Y+ELKT+R +        FER+KLLK+W QSF
Sbjct  192   VRTGVGRHRLIMGGEVDCWDGEKSGLGGYIELKTTRVMDTASQVARFERDKLLKWWAQSF  251

Query  688   LAGVPYIVVGFRDDNGRLVRTERLRTNEITQ-RVKMKSYWQGGVCLAFADEVLCWL  524
               G   I+VGFRDD+G + + + L T ++     +    W     L FAD +L WL
Sbjct  252   SIGCRRILVGFRDDDGFVRKLQTLETLKLPGYAARHPGAWDPKTALQFADRLLAWL  307



>emb|CEG01060.1| RAI1-like [Ostreococcus tauri]
Length=523

 Score =   152 bits (384),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 111/327 (34%), Positives = 166/327 (51%), Gaps = 24/327 (7%)
 Frame = -2

Query  1354  QEPCELACYSRVQDGDVY-FDDRSLRLFKRLITEDIGSDLNEGFDTFTEK--RDLGSQGF  1184
             +EP E    S+ +D  +  +D  +LR   R      G+DLN GF TF ++  R++     
Sbjct  66    EEPLECGQVSKRRDERLTTYDASNLRRL-RGPNAGAGADLNRGFGTFKDRDRREIYPAPV  124

Query  1183  GDLLACIR--NKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKL  1010
              D+   I    +   L+ +  VT+R N++K++ TA+ +++ W M        + L+V + 
Sbjct  125   NDIFGAIEASGQTKVLEDVDVVTWRGNVSKLLTTAWNKSDSWTMEAELVNKTIVLNVKET  184

Query  1009  PERPKS-----ELDRRRCYWGYCFESLA-TEDPGRSDGDRIHDIDANVEYCAVIKTKIGA  848
              E  +      E + R CYWGY FE  A +E P          +D    +C VIKTK+G 
Sbjct  185   EEGMRKVLVRDECEERMCYWGYAFEEAACSEKPFE------EPVDCMENFCCVIKTKLGD  238

Query  847   HRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYI  668
               ILM  E+DC D  D     +VELKTSR + + R  + FEREKLLK+W QSF  GV  I
Sbjct  239   LNILMCGEVDCFDGGDAELANFVELKTSRVMTNEREVKRFEREKLLKWWAQSFAMGVRRI  298

Query  667   VVGFRDDNGRLVRTERLRTNEITQRV-KMKSYWQGGVCLAFADEVLCWLYGTVKENEDYI  491
             +VGFRDD GR+V+T+ L T ++   V K  + W     L  A  VL  L   +      +
Sbjct  299   MVGFRDDRGRVVKTQMLETLKLPGYVAKHPNAWNSKDALRCALVVLTKLKELLSHEPSGV  358

Query  490   ---LQFTPH--SNRLELLRGPSCPDAI  425
                +++ P   ++R+  +R  S PD I
Sbjct  359   RVRVEYEPKKVAHRVNFIRDNSIPDFI  385



>ref|XP_002173580.1| Dhp1p-interacting protein Din1 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB07287.1| Dhp1p-interacting protein Din1 [Schizosaccharomyces japonicus 
yFS275]
Length=335

 Score =   148 bits (374),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 96/318 (30%), Positives = 165/318 (52%), Gaps = 35/318 (11%)
 Frame = -2

Query  1387  EETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEK  1208
             E     ++ A+  P E+ CYS   + D+ ++D +LR +       +G+DLN GF     K
Sbjct  6     ENVKPARTPAVAYPKEITCYSVDGNRDILYNDSNLRFY---YPPPLGTDLNIGF----PK  58

Query  1207  RDLGSQGFGDLLACIRNKNI-----PLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKR  1043
             R        D ++ + N  +      +     V++R  L K++         W++ V+K+
Sbjct  59    RYTKPLNQPDSISIVENALLNNCKDVISSAEIVSWRGLLTKLLCAPVDYKSSWDILVYKK  118

Query  1042  KGVVYLD-VHKLPERPKSELDRRRCYWGYCFESLAT------EDPGRSDGDRIHD-IDAN  887
             +  ++ +   + PE+P +    R C+WGY FE+++T      E    S   R +D ++ N
Sbjct  119   ESTLFFEEPPRAPEKPYAN-QERMCFWGYKFETVSTLPKIWDECSRSSIEQRDYDHVNPN  177

Query  886   VEYCAVIKTKIGAHRILMGAEMDCC------DSRDDGRRFYVELKTSREL-LDHRTEEIF  728
              +YC+++KT IG+H +++G E+DC          D+    YVELK +++L L+H    + 
Sbjct  178   EQYCSIVKTSIGSHSMILGGEVDCVWDIKPDYEEDNPCTHYVELKVTKKLPLNH----VG  233

Query  727   EREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVK---MKSYWQGGVC  557
              R KL+K+W QSFL G+P IVVGFRDDNG +V  + + T EI + +K    ++ W     
Sbjct  234   MRRKLIKYWAQSFLLGIPRIVVGFRDDNGVIVEIKEMSTTEIPKLLKPAVSRNEWTPSRL  293

Query  556   LAFADEVLCWLYGTVKEN  503
             L   +++L WL   V+ +
Sbjct  294   LVHLEQLLTWLKSIVQND  311



>ref|XP_005712646.1| unnamed protein product [Chondrus crispus]
 emb|CDF32845.1| unnamed protein product [Chondrus crispus]
Length=360

 Score =   149 bits (376),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 97/334 (29%), Positives = 162/334 (49%), Gaps = 24/334 (7%)
 Frame = -2

Query  1363  TAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGF  1184
             T +  P E++ YSR  + +V F  +            +  +L E F+++  KRD    G 
Sbjct  30    THVSAPFEVSSYSRDGNRNVTFGSK--EQLATYTEPKLNVNLGEKFESYIPKRD-EDVGV  86

Query  1183  GDLLACIRNKNIPLD-RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLP  1007
               ++  +++K   +D +   VTYRNN+NKI  T Y   + WE+        VYLD+ K  
Sbjct  87    ETVVKALQSKQFDIDTQADIVTYRNNMNKIGGTPYENRDGWELDCALVAKTVYLDIRKTN  146

Query  1006  ERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGA  827
             +       +R  Y+GY FESL T       G     ++AN EYC++ + +I  HRILM +
Sbjct  147   KESTDPQQQRFMYYGYRFESLCT-------GLEDEPVNANSEYCSISRLRIANHRILMAS  199

Query  826   EMDCCDSRDDG----RRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVG  659
             E+DC     D        Y+ELKT R + + R      R + LK+W+QS+L GVP I++G
Sbjct  200   EIDCSSGAPDKGGNPLNGYIELKTMRVIENERALNSMYRFRFLKYWLQSYLGGVPTIMLG  259

Query  658   FRDDNGRLVRTERLRTNEITQ-------RVKMKSYWQGGVCLAFADEVLCWLYGTVKENE  500
              R D G L+  ++++T+EI +       + +  + W   VC+ F D +L  +     ++ 
Sbjct  260   LRSDAGDLLHVKKVKTHEIPREARHHFDKTRSNNRWDPFVCINFLDCILASIREVCHDHP  319

Query  499   DYIL--QFTPHSNRLELLRGPSCPDAITHHVQQL  404
                +  +F P S ++  ++       +   + QL
Sbjct  320   GCTIRVRFDPSSKQVTAVKVTGVDAGLAPRISQL  353



>ref|XP_001396563.1| protein rai1 [Aspergillus niger CBS 513.88]
 emb|CAK42193.1| unnamed protein product [Aspergillus niger]
Length=368

 Score =   149 bits (376),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 105/338 (31%), Positives = 171/338 (51%), Gaps = 40/338 (12%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             S AI+ P E+AC+S   +   +  D S++ +       + +DLN GF++F +  D   + 
Sbjct  18    SAAIRRPKEIACFSYDDEHKFHLGDSSMKYY---YPPCLPADLNRGFESFQKLDDSADEH  74

Query  1186  FGDLLACIRNKNIPLDR-------MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
                LL  +    I L++          +T+R  + KI+A  +     +EM     +G ++
Sbjct  75    LDALLETV----IALEQETQKKCEADIITWRGMMTKILAAPFDNLNGFEMNATCFQGTIF  130

Query  1027  LDVHKLPERPKSELDRRR------------CYWGYCFESLATED------PGRSDGDRIH  902
             ++ +   +  +  + + +             YWGY FE+L+  +      P R   +R  
Sbjct  131   IEENNSYKNEQKRIQKNQRMPPGMASQDLMAYWGYKFETLSVLNEPWDPTPRREIENREE  190

Query  901   DI-DANVEYCAVIKTKIGAHRILMGAEMD----CCDSRDDGRRFYVELKTSRELLDHRTE  737
              I + N +YC+V++T IG  R+++G E+D    C   R +    +VELKTS E+ + R  
Sbjct  191   LIVNNNAQYCSVVRTAIGRARLVIGGEVDAIWDCKPERKEDPIHWVELKTSAEIRNDRDM  250

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGG  563
               +ER KLLKFW QSFL GVP IVVGFRD +G + R E L T  I  +VK   +S W G 
Sbjct  251   VKYER-KLLKFWAQSFLLGVPKIVVGFRDQHGIVHRLEELETAAIPGKVKKLGRSTWDGN  309

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             +C+ FA   L WL  T++E   + ++    S+ +E+ R
Sbjct  310   ICINFAATFLEWLKTTIQEEGTWRIRKREKSSLIEVFR  347



>gb|EMT65096.1| Protein RAI1 [Fusarium oxysporum f. sp. cubense race 4]
Length=374

 Score =   149 bits (376),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 167/337 (50%), Gaps = 31/337 (9%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E AC+S   + + + DD SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  13    FAGASQPVKRPKEFACFSYDDNHEFHLDDSSLKYY---YTPQLGADLSKGFDTFQKLDDT  69

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
             G      LL  I        +    + VT+R  + KIMA  + + + +EM     +  ++
Sbjct  70    GDDHLDSLLKTIAAHEQETGKKIDANIVTWRGMMTKIMAAPFDQMDGFEMNATLYQDCIF  129

Query  1027  LD---VHKLPERPKSELDRRR--------CYWGYCFESLATEDPGRSDGDRI-------H  902
             ++    +K+  R     ++RR         +WGY FE+L+T     ++  R         
Sbjct  130   IEENNAYKIASRSNEGNNKRRRGPPLEVMQFWGYKFETLSTLPAPWAETSRDFIENRENE  189

Query  901   DIDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRTEE  734
              ++   +YC+V++T IG   + +G E+D   DS+ + +     +VELKTS E+ +    E
Sbjct  190   AVNNKAQYCSVVRTGIGKSVLCLGGEVDAIWDSKPEEKGSPINWVELKTSAEIRNPGGME  249

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGV  560
              F+R KL+K+WIQSFL GVP IVVGFR  +G LV    + T+ I   V       W   +
Sbjct  250   NFKR-KLMKYWIQSFLLGVPRIVVGFRTQDGILVEAREMETHRIPDMVNADPNPKWNADM  308

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ FA   L WL   + +   + ++  P S  +EL +
Sbjct  309   CVNFAATFLEWLTENINDEGVWRIRREPQSPTIELFK  345



>ref|XP_664118.1| hypothetical protein AN6514.2 [Aspergillus nidulans FGSC A4]
 sp|Q5AYW6.3|DXO_EMENI RecName: Full=Decapping nuclease rai1 [Aspergillus nidulans FGSC 
A4]
 gb|EAA57854.1| hypothetical protein AN6514.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF70893.1| TPA: Protein rai1 [Source:UniProtKB/Swiss-Prot;Acc:Q5AYW6] [Aspergillus 
nidulans FGSC A4]
Length=357

 Score =   149 bits (375),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 103/321 (32%), Positives = 157/321 (49%), Gaps = 21/321 (7%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQ-  1190
             +TAI+ P E+AC+S       +  D SLR +       + +DLN GFDTF +  D   + 
Sbjct  18    NTAIRRPREIACFSYDDQHKFHLGDSSLRYY---YPPQLPADLNRGFDTFQKLDDAADEH  74

Query  1189  --GFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
                  D +A +  +         +T+R  + KI+   +     +EM     +G +   + 
Sbjct  75    IDALLDTIAAMEKETGKRCEADIITWRGMMTKILTAPFDDMNGFEMNATCFQGTMCKQLQ  134

Query  1015  KLPERPKSELDR-RRCYWGYCFESLATEDPGRSDGDRIHD-------IDANVEYCAVIKT  860
             +    P     +    YWGY FE+++  D    +  R          ++ N +YC+V++T
Sbjct  135   RQQRMPPGMASQDLMAYWGYKFETISVLDKTWDEASREEIEGRENLVVNNNAQYCSVVRT  194

Query  859   KIGAHRILMGAEMDCC-DSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQS  692
              IG  ++++G E+D   DS+ + +     +VELKTS E+        FER KLLKFW QS
Sbjct  195   GIGRTKLVLGGEVDAIWDSKPERKEDPINWVELKTSAEIRKDWDMVKFER-KLLKFWAQS  253

Query  691   FLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGVCLAFADEVLCWLYG  518
             FL GVP IVVGFRD  G L R E L T  I  RV+   +  W G +C+ FA   L WL  
Sbjct  254   FLLGVPKIVVGFRDQGGILRRLEELETANIPNRVRKSGRGTWDGNICINFAATFLEWLKS  313

Query  517   TVKENEDYILQFTPHSNRLEL  455
              +KE   + L+    S+ +E+
Sbjct  314   VIKEGGTWRLRKAEKSSVIEV  334



>gb|EXA50700.1| protein RAI1 [Fusarium oxysporum f. sp. pisi HDV247]
Length=384

 Score =   149 bits (376),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 167/337 (50%), Gaps = 31/337 (9%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E AC+S   + + + DD SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  23    FAGASQPVKRPKEFACFSYDDNHEFHLDDSSLKYY---YTPQLGADLSKGFDTFQKLDDT  79

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
             G      LL  I        +    + VT+R  + KIMA  + + + +EM     +  ++
Sbjct  80    GDDHLDSLLKTIAAHEQETGKKIDANIVTWRGMMTKIMAAPFDQMDGFEMNATLYQDCIF  139

Query  1027  LD---VHKLPERPKSELDRRR--------CYWGYCFESLATEDPGRSDGDRI-------H  902
             ++    +K+  R     ++RR         +WGY FE+L+T     ++  R         
Sbjct  140   IEENNAYKIASRSNEGNNKRRRGPPLEVMQFWGYKFETLSTLPATWAETSRDFIENRENE  199

Query  901   DIDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRTEE  734
              ++   +YC+V++T IG   + +G E+D   DS+ + +     +VELKTS E+ +    E
Sbjct  200   AVNNKAQYCSVVRTGIGKSVLCLGGEVDAIWDSKPEEKGSPINWVELKTSAEIRNPGGME  259

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGV  560
              F+R KL+K+WIQSFL GVP IVVGFR  +G LV    + T+ I   V       W   +
Sbjct  260   NFKR-KLMKYWIQSFLLGVPRIVVGFRTQDGILVEAREMETHRIPDMVNADPNPKWNADM  318

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ FA   L WL   + +   + ++  P S  +EL +
Sbjct  319   CVNFAATFLEWLTENINDEGVWRIRREPQSPTIELFK  355



>gb|EWY99359.1| protein RAI1 [Fusarium oxysporum FOSC 3-a]
Length=384

 Score =   149 bits (376),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 167/337 (50%), Gaps = 31/337 (9%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E AC+S   + + + DD SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  23    FAGASQPVKRPKEFACFSYDDNHEFHLDDSSLKYY---YTPQLGADLSKGFDTFQKLDDT  79

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
             G      LL  I        +    + VT+R  + KIMA  + + + +EM     +  ++
Sbjct  80    GDDHLDSLLKTIAAHEQETGKKIDANIVTWRGMMTKIMAAPFDQMDGFEMNATLYQDCIF  139

Query  1027  LD---VHKLPERPKSELDRRR--------CYWGYCFESLATEDPGRSDGDRI-------H  902
             ++    +K+  R     ++RR         +WGY FE+L+T     ++  R         
Sbjct  140   IEENNAYKIASRSNEGNNKRRRGPPLEVMQFWGYKFETLSTLPAPWAETSRDFIENRENE  199

Query  901   DIDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRTEE  734
              ++   +YC+V++T IG   + +G E+D   DS+ + +     +VELKTS E+ +    E
Sbjct  200   AVNNKAQYCSVVRTGIGKSVLCLGGEVDAIWDSKPEEKGSPINWVELKTSAEIRNPGGME  259

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGV  560
              F+R KL+K+WIQSFL GVP IVVGFR  +G LV    + T+ I   V       W   +
Sbjct  260   NFKR-KLMKYWIQSFLLGVPRIVVGFRTQDGILVEAREMETHRIPDMVNADPNPKWNADM  318

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ FA   L WL   + +   + ++  P S  +EL +
Sbjct  319   CVNFAATFLEWLTENINDEGVWRIRREPQSPTIELFK  355



>gb|EWZ45434.1| protein RAI1 [Fusarium oxysporum Fo47]
 gb|EWZ97746.1| protein RAI1 [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXK42834.1| protein RAI1 [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK99916.1| protein RAI1 [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL62783.1| protein RAI1 [Fusarium oxysporum f. sp. radicis-lycopersici 26381]
 gb|EXL82228.1| protein RAI1 [Fusarium oxysporum f. sp. conglutinans race 2 54008]
 gb|EXM07898.1| protein RAI1 [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
Length=384

 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 167/337 (50%), Gaps = 31/337 (9%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E AC+S   + + + DD SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  23    FAGASQPVKRPKEFACFSYDDNHEFHLDDSSLKYY---YTPQLGADLSKGFDTFQKLDDT  79

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
             G      LL  I        +    + VT+R  + KIMA  + + + +EM     +  ++
Sbjct  80    GDDHLDSLLKTIAAHEQETGKKIDANIVTWRGMMTKIMAAPFDQMDGFEMNATLYQDCIF  139

Query  1027  LD---VHKLPERPKSELDRRR--------CYWGYCFESLATEDPGRSDGDRI-------H  902
             ++    +K+  R     ++RR         +WGY FE+L+T     ++  R         
Sbjct  140   IEENNAYKIASRSNEGNNKRRRGPPLEVMQFWGYKFETLSTLPAPWAETSRDFIENRENE  199

Query  901   DIDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRTEE  734
              ++   +YC+V++T IG   + +G E+D   DS+ + +     +VELKTS E+ +    E
Sbjct  200   AVNNKAQYCSVVRTGIGKSVLCLGGEVDAIWDSKPEEKGSPINWVELKTSAEIRNPGGME  259

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGV  560
              F+R KL+K+WIQSFL GVP IVVGFR  +G LV    + T+ I   V       W   +
Sbjct  260   NFKR-KLMKYWIQSFLLGVPRIVVGFRTQDGILVEAREMETHRIPDMVNADPNPKWNADM  318

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ FA   L WL   + +   + ++  P S  +EL +
Sbjct  319   CVNFAATFLEWLTENINDEGVWRIRREPQSPTIELFK  355



>dbj|GAD99307.1| protein rai1 [Byssochlamys spectabilis No. 5]
Length=371

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 108/344 (31%), Positives = 169/344 (49%), Gaps = 40/344 (12%)
 Frame = -2

Query  1384  ETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKR  1205
             E     + AI+ P E+AC+S   +   + DD SLR +       + +DL+ GFDTF +  
Sbjct  12    ERFQGSNAAIRRPREIACFSYDDEHRFHLDDSSLRYY---YPPTLPADLSRGFDTFQQLD  68

Query  1204  DLGSQGFGDLLACIRNKNIPLD---RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGV  1034
             D G +    LL  I               +T+R  + KIM + +     +EM V   +G 
Sbjct  69    DSGDEHLDALLDTIMAHEKSTGSKCEADIITWRGMMTKIMTSPFDIMNGFEMNVTNFQGT  128

Query  1033  VYLDVHKL--PERPKSELDRRR----------CYWGYCFESLAT-----------EDPGR  923
             V+++ +     E+ +++ ++R            +WGY FE+L+            E  GR
Sbjct  129   VFIEENNAYKNEQKRAQRNQRMPPGMPSQDMMSFWGYKFETLSVLSRPWDPTTREEIEGR  188

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMD----CCDSRDDGRRFYVELKTSREL  755
              D      ++   +YC+V++T IG  ++++G E+D    C   R +    +VELKTS E+
Sbjct  189   VD----QIVNNKAQYCSVVRTGIGKSKMIIGGEVDAVWDCKPERKEDPINWVELKTSAEI  244

Query  754   LDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--K  581
              + R    +ER KLLKFW QSFL GVP I+VGFR+ +G L R E L T+ I  +VK   K
Sbjct  245   HNDRDMLKYER-KLLKFWAQSFLLGVPKIIVGFRNRDGILQRLEELETHSIPGKVKRFGK  303

Query  580   SYWQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
               W G +C+ F  E L WL   V+    + ++    S  +EL +
Sbjct  304   GTWDGNICINFTAEFLEWLKTKVQGEGLWRIRKREKSPVIELFK  347



>emb|CCT66699.1| related to C.elegans dom-3 protein [Fusarium fujikuroi IMI 58289]
Length=374

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 103/337 (31%), Positives = 169/337 (50%), Gaps = 31/337 (9%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E AC+S   + + + DD SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  13    FAGASQPVKRPKEFACFSYDDNHEFHLDDSSLKYY---YTPQLGADLSKGFDTFQKLDDT  69

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
             G      LL  I        +    + VT+R  + KIMA  + + + +EM     +  ++
Sbjct  70    GDDHLDSLLKTIAAHEQETGKKIDANVVTWRGMMTKIMAAPFDQMDGFEMNATLYQDCIF  129

Query  1027  LD---VHKLPERPKSELDRRR--------CYWGYCFESLATEDPGRSDGDR--IHD----  899
             ++    +K+  R     ++RR         +WGY FE+L+T     ++  R  I +    
Sbjct  130   IEENNAYKIASRSNEGNNKRRRGPPLEVMQFWGYKFETLSTLPAPWAEMSRDFIENRENE  189

Query  898   -IDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRTEE  734
              ++   +YC+V++T IG   + +G E+D   DS+ + +     +VELKTS E+ +    E
Sbjct  190   VVNNKAQYCSVVRTGIGKSVLCLGGEVDAIWDSKPEEKGSPINWVELKTSAEIRNPGGME  249

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGV  560
              F+R KL+K+WIQSFL GVP IVVGFR  +G LV    + T+ I   V       W   +
Sbjct  250   NFKR-KLMKYWIQSFLLGVPRIVVGFRTQDGILVEAREMETHRIPDMVNADPNPKWNADM  308

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ FA   L WL   + +   + ++  P S  +EL +
Sbjct  309   CVNFAATFLEWLTENINDEGVWRIRREPQSPTIELFK  345



>ref|XP_007723543.1| hypothetical protein A1O1_04461 [Capronia coronata CBS 617.96]
 gb|EXJ91349.1| hypothetical protein A1O1_04461 [Capronia coronata CBS 617.96]
Length=399

 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 106/339 (31%), Positives = 166/339 (49%), Gaps = 34/339 (10%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A ++ AI+ P EL  +S  +D  +  D  SLR +       +  DLN GF+TF +  D 
Sbjct  15    FAGQNAAIRRPRELTFFSYDEDHQLRHDASSLRYY---YPPALPCDLNRGFETFRQLDDS  71

Query  1198  GSQGFGDLLACI----RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVV  1031
                    LL  +    + K   L+    +T+R  + KIM   Y   + WEM     +G +
Sbjct  72    ADDHLDGLLDALMLYEKEKGQKLE-TDVITWRGMMTKIMVAPYSSFDDWEMNATCFQGTI  130

Query  1030  YLDVH------------KLPERPKSELDRRRCYWGYCFESLA------TEDPGRSDGDRI  905
             +++ +              P RP +       +WGY FE+++      +E P      R 
Sbjct  131   FIEENHNKKIASRQEQFSTPARPGAMSQDIMSFWGYKFETVSLLPEPWSETPREYIDSRE  190

Query  904   HDIDAN-VEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRT  740
              +I +N  +YC++++T  G  ++++G E+D   D + + +     +VELKT+  + + R 
Sbjct  191   DEIVSNYAQYCSIVRTGFGKVKMIIGGEVDAVMDFKPEDKSQPINWVELKTTAAVTNERA  250

Query  739   EEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEI--TQRVKMKSYWQG  566
             +  FER KLLKFW QSFL GVP IVVG+R   G L R E L T  I  T R++ K+ W G
Sbjct  251   QVKFER-KLLKFWAQSFLLGVPKIVVGYRTSQGILERLEELDTQAIPETVRLRGKNLWDG  309

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
               C+ FA   L WL G + E   + ++    S RLE+ +
Sbjct  310   QTCINFASSFLEWLKGVITEGGVWRIRKREKSPRLEIFK  348



>ref|XP_006820314.1| PREDICTED: decapping and exoribonuclease protein-like [Saccoglossus 
kowalevskii]
Length=394

 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 165/337 (49%), Gaps = 46/337 (14%)
 Frame = -2

Query  1357  IQEPCELACYSRVQDGDVYFDDRSLRL-FKRLITEDIGSDLNEGFDTFTEKRDLGSQGFG  1181
              ++P E+ C+S   D + + D R LR  F    T+ +  DL +G++ + ++ D   +   
Sbjct  43    FRQPREIGCFSLDIDREFHNDARQLRYYFPPDDTKRVKFDLTKGYEKYIKRDDDVKERLD  102

Query  1180  DLLACI----------------------RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEP  1067
              LL  +                      ++ N+  D   F+T+R +L KI+ T Y   E 
Sbjct  103   ILLKWVLANREKFNLHKKPETKEEIHTQKDGNLHTD---FITWRGHLTKILCTPYENRED  159

Query  1066  WEMGVHKRKGVVYLDVHKLPE-----RPKSELDRRRCYWGYCFESLATEDPGR---SDGD  911
             W+M V    G  Y+   +  E     +  +   +   YWGY FE       G    S  D
Sbjct  160   WKMAVSLFNGTYYISEVETEESRDRRKNMTSAHKEMTYWGYKFEQYVVSADGHTPPSTED  219

Query  910   RIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDG---RRFYVELKTSRELLDHRT  740
              +++I+    YC V++T++  + ++   E+DCC  R D     + YVELKTSRE+   R 
Sbjct  220   TVNNIEG---YCTVVRTRLNENSLVFSGEVDCC--RGDNTKPSKNYVELKTSREIYTDRQ  274

Query  739   EEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSY-WQGG  563
                F+R KL+K+W QSFL G+P IV GFRDD+G + + E   T +I   VK   Y W   
Sbjct  275   YRNFKRFKLIKWWAQSFLPGLPTIVAGFRDDDGVVTKLETYETMKIPDLVKDDPYMWNPS  334

Query  562   VCLAFADEVLCWLYGTVKENED---YILQFTPHSNRL  461
             VC+ F D+ LC++   V++++    Y+ ++ P S R+
Sbjct  335   VCVNFCDKFLCFVKQVVQKDDPRCVYLFEWNPSSKRI  371



>gb|EQL32293.1| protein rai1 [Blastomyces dermatitidis ATCC 26199]
Length=368

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 105/321 (33%), Positives = 163/321 (51%), Gaps = 32/321 (10%)
 Frame = -2

Query  1384  ETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKR  1205
             E  A  + AI+ P E+A +S     + + D+ SLR +    T  + +DLN+GFDTF +  
Sbjct  12    ERFAGFNAAIRRPKEIAYFSYDDQHNFHLDESSLRYY---YTPRLPADLNKGFDTFEQLD  68

Query  1204  DLGSQGFGDLLACI---RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGV  1034
             D G +    LL  I     K         +T+R  + KIM   +     +EM     +G 
Sbjct  69    DTGDEHLDALLDTIIDMEKKTGTQCEADIITWRGMMTKIMTAPFDNMNGFEMNATCYQGS  128

Query  1033  VYLD---VHKLPER---------PKSELDRRRCYWGYCFESLATEDPG-------RSDGD  911
             ++++    +KL ++         P         +WGY FE+L+  D         + +G 
Sbjct  129   IFIEENNAYKLAQKQSQRNQKMPPGVPSQDMMAFWGYKFETLSLLDQPWDATPREKIEGR  188

Query  910   RIHDIDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRR---FYVELKTSRELLDHR  743
                 ++   +YC+V++T IG  +I++G E+D   DS+ + +     +VELKTS E+ + R
Sbjct  189   EDQVVNNKAQYCSVVRTGIGGCKIVLGGEVDAVWDSKPERKEDPINWVELKTSAEIRNDR  248

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRV--KMKSYWQ  569
                 +ER KLLKFW QSFL GVP I+VGFRD++G L R E + T +I   V  K K  W 
Sbjct  249   DMFKYER-KLLKFWAQSFLLGVPKIIVGFRDEHGILRRLEEMATRDIPGLVSRKGKGTWD  307

Query  568   GGVCLAFADEVLCWLYGTVKE  506
             G VC+ F  ++L WL   +K+
Sbjct  308   GNVCINFTAKLLEWLKLVIKD  328



>gb|EXM35919.1| protein RAI1 [Fusarium oxysporum f. sp. vasinfectum 25433]
Length=384

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 103/337 (31%), Positives = 167/337 (50%), Gaps = 31/337 (9%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E AC+S   + + + DD SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  23    FAGASQPVKRPKEFACFSYDDNHEFHLDDSSLKYY---YTPQLGADLSKGFDTFQKLDDT  79

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
             G      LL  I        +    + VT+R  + KIMA  + + + +EM     +  ++
Sbjct  80    GDDHLDSLLKTIAAHEQETGKKIDANIVTWRGMMTKIMAAPFDQMDGFEMNATLYQDCIF  139

Query  1027  LD---VHKLPERPKSELDRRR--------CYWGYCFESLATEDPGRSDGDRI-------H  902
             ++    +K+  R     ++RR         +WGY FE+L+T     ++  R         
Sbjct  140   IEENNAYKIAFRSNEGNNKRRRGPPLEVMQFWGYKFETLSTLPAPWAETSRDFIENRENE  199

Query  901   DIDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRTEE  734
              I+   +YC+V++T IG   + +G E+D   DS+ + +     +VELKTS E+ +    E
Sbjct  200   AINNKAQYCSVVRTGIGKSVLCLGGEVDAIWDSKPEEKGSPINWVELKTSAEIRNPGGME  259

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGV  560
              F+R KL+K+WIQSFL GVP IVVGFR  +G LV    + T+ I   V       W   +
Sbjct  260   NFKR-KLMKYWIQSFLLGVPRIVVGFRTQDGILVEAREMETHRIPDMVNADPNPKWNADM  318

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ FA   L WL   + +   + ++  P S  +EL +
Sbjct  319   CVNFAATFLEWLTENINDEGVWRIRREPQSPTIELFK  355



>ref|XP_001270042.1| HLA class III protein Dom3z [Aspergillus clavatus NRRL 1]
 gb|EAW08616.1| HLA class III protein Dom3z [Aspergillus clavatus NRRL 1]
Length=356

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 106/324 (33%), Positives = 163/324 (50%), Gaps = 24/324 (7%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             +T I+ P E+AC+S   +   +  D SLR +    T  + +DLN GFDTF +  D   + 
Sbjct  18    NTTIRRPREVACFSYDDEHQFHLGDSSLRYY---YTPRLPADLNRGFDTFQKLNDAPDEH  74

Query  1186  FGDLLACIRNKNIPLDRMH---FVTYRNNLNKIMATAY--IRNEPWEMGVHKRKGVVYLD  1022
                LL  I        + +    +T+R  + KI+   +  +     E   +K +      
Sbjct  75    LDALLDTIMAFEKETGKKYEADIITWRGMMTKILTAPFDNLNGFIEENNAYKNQQKQIQQ  134

Query  1021  VHKLPERPKSELDRRRCYWGYCFESLAT----EDPG-RSDGDRIHD--IDANVEYCAVIK  863
               ++P  P         YWGY FE+L       DP  R++ +   D  ++ N +YC+V++
Sbjct  135   NQRMP--PGMASQELMAYWGYKFETLCLLQKPWDPTPRAEIESREDLVVNNNAQYCSVVR  192

Query  862   TKIGAHRILMGAEMD----CCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQ  695
             T IG  ++++G E+D    C   R +    +VELKTS E+ + R    +ER KLLKFW Q
Sbjct  193   TGIGNSKLIIGGEVDAVWDCKPDRAEDPINWVELKTSAEIKNDRDMVKYER-KLLKFWAQ  251

Query  694   SFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGVCLAFADEVLCWLY  521
             SFL GVP I+VGFRD NG + R E L T  I  +VK   K  W G +C+ F   +L WL 
Sbjct  252   SFLLGVPKIIVGFRDQNGIVHRLEELETATIPNKVKKVGKGTWDGNICINFTAALLGWLK  311

Query  520   GTVKENEDYILQFTPHSNRLELLR  449
              T++E   + ++    S+ +E+ R
Sbjct  312   STIQEGGTWRIRKREKSSLIEVFR  335



>ref|XP_003075116.1| Nuclear 5'-3' exoribonuclease-interacting protein, Rai1p (ISS) 
[Ostreococcus tauri]
Length=503

 Score =   150 bits (378),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 151/291 (52%), Gaps = 22/291 (8%)
 Frame = -2

Query  1249  GSDLNEGFDTFTEK--RDLGSQGFGDLLACIR--NKNIPLDRMHFVTYRNNLNKIMATAY  1082
             G+DLN GF TF ++  R++      D+   I    +   L+ +  VT+R N++K++ TA+
Sbjct  81    GADLNRGFGTFKDRDRREIYPAPVNDIFGAIEASGQTKVLEDVDVVTWRGNVSKLLTTAW  140

Query  1081  IRNEPWEMGVHKRKGVVYLDVHKLPERPKS-----ELDRRRCYWGYCFESLA-TEDPGRS  920
              +++ W M        + L+V +  E  +      E + R CYWGY FE  A +E P   
Sbjct  141   NKSDSWTMEAELVNKTIVLNVKETEEGMRKVLVRDECEERMCYWGYAFEEAACSEKPFE-  199

Query  919   DGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRT  740
                    +D    +C VIKTK+G   ILM  E+DC D  D     +VELKTSR + + R 
Sbjct  200   -----EPVDCMENFCCVIKTKLGDLNILMCGEVDCFDGGDAELANFVELKTSRVMTNERE  254

Query  739   EEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRV-KMKSYWQGG  563
              + FEREKLLK+W QSF  GV  I+VGFRDD GR+V+T+ L T ++   V K  + W   
Sbjct  255   VKRFEREKLLKWWAQSFAMGVRRIMVGFRDDRGRVVKTQMLETLKLPGYVAKHPNAWNSK  314

Query  562   VCLAFADEVLCWLYGTVKENEDYI---LQFTPH--SNRLELLRGPSCPDAI  425
               L  A  VL  L   +      +   +++ P   ++R+  +R  S PD I
Sbjct  315   DALRCALVVLTKLKELLSHEPSGVRVRVEYEPKKVAHRVNFIRDNSIPDFI  365



>ref|XP_007806144.1| hypothetical protein EPUS_05246 [Endocarpon pusillum Z07020]
 gb|ERF68165.1| hypothetical protein EPUS_05246 [Endocarpon pusillum Z07020]
Length=453

 Score =   149 bits (375),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 108/345 (31%), Positives = 166/345 (48%), Gaps = 39/345 (11%)
 Frame = -2

Query  1384  ETLAR---KSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTF-  1217
             E +AR    S  I+ P E+ C+S        +DD SLR +       + +DLN GFDTF 
Sbjct  10    EPIARFNGASAGIRRPKEITCFSFDDQHKYRWDDSSLRYYH---PPTLPADLNRGFDTFR  66

Query  1216  --TEKRDLGSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKR  1043
                  RD    G  D +A    +         +T+R  + KIMAT + + E WEM     
Sbjct  67    ALDNTRDDHLDGLVDTIALHEKEKGAKVDADIITWRGMMTKIMATPFSKLESWEMNATCF  126

Query  1042  KGVVYLDV-HKLPERPKSELDRRRC-----------YWGYCFESLA----TEDPG-----  926
             +G ++++  H      K + ++++            +WGY FE+L+    T DP      
Sbjct  127   QGSIFIEENHATKLFSKQQQNQQKMPAGTPSQDIMGFWGYKFETLSLIPDTWDPTSREYI  186

Query  925   RSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCC-----DSRDDGRRFYVELKTSR  761
              S  D I  +D + +YC++++T  G  ++++G E+D                Y+ELKT+ 
Sbjct  187   ESREDEI--VDNHAQYCSIVRTGFGKIKMILGGEVDAVWDVKPTHPSSTAINYIELKTAA  244

Query  760   ELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-  584
             ++   R +  FER KLLKFW QSFL GVP I+VGFR  +G L   E + T  I + VK  
Sbjct  245   KIHTDRDQVKFER-KLLKFWAQSFLLGVPKIIVGFRTKDGILTDLEEMETQAIPEMVKRG  303

Query  583   KSYWQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             K  W G  C+ FA   L WL   + E   + ++    S+RL++ +
Sbjct  304   KGLWDGNTCINFAAAFLEWLKTIITEEGVWRIRKVEKSSRLDVFK  348



>gb|KDR76133.1| hypothetical protein GALMADRAFT_462464 [Galerina marginata CBS 
339.88]
Length=483

 Score =   149 bits (376),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 103/331 (31%), Positives = 170/331 (51%), Gaps = 35/331 (11%)
 Frame = -2

Query  1369  KSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQ  1190
             K+   Q+P +L  +S   +    F D +LR +   +   +GS+L+ G+D +  K D   +
Sbjct  100   KAIPFQQPSQLISFSYTPEHVQEFTDSALRYY---VDPPLGSNLSYGYDRWVRKPDQRGR  156

Query  1189  GFGDLLACIRN------KNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
                 LL  I N      + + L  +  V++R  + KI+   Y   + WE+ V    G +Y
Sbjct  157   -IDALLKAISNIKHDPKRGVGLPEIGVVSWRGVMTKILTAPYENRDGWELNVMSLNGTLY  215

Query  1027  LDVHKLPER--PKSELD---RRRCYWGYCFESLATED--PGRSDGDRIH---------DI  896
             L+ H   +R   K+ +D   R + Y+GY FES  T D  PGR+  +  +         D+
Sbjct  216   LEEHLTEDRLSEKNNMDARQRSQTYYGYAFESYCTSDAPPGRAPHNNPNPGAPPSWGGDV  275

Query  895   DANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRR-FYVELKTSRELLDHRTEEIFERE  719
             D +V++C+V++TK+G  R+++G E+DC   +  G+   +VELKTS  +     E  FER 
Sbjct  276   DTSVQWCSVVRTKLGDTRMIIGGEVDCVRGKYTGQTDTFVELKTSLTIRGQHDESKFER-  334

Query  718   KLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK-SYWQGGVCLAFAD  542
             KLLKF+ QSFL GVP IVVGFR   G +   +  +T ++ + V+ K   W   +CL +  
Sbjct  335   KLLKFYFQSFLLGVPEIVVGFRTPAGVVTTVQSFKTIQLPRLVRGKPGAWDPVLCLDWGY  394

Query  541   EVLCWLYGTVK------ENEDYILQFTPHSN  467
             + L +L   V+      ++  + ++F P S 
Sbjct  395   KFLTFLKDLVRSTAGDSDSSVWRVKFVPASG  425



>ref|XP_009544713.1| hypothetical protein HETIRDRAFT_68507 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW83458.1| hypothetical protein HETIRDRAFT_68507 [Heterobasidion irregulare 
TC 32-1]
Length=461

 Score =   149 bits (375),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 103/332 (31%), Positives = 164/332 (49%), Gaps = 33/332 (10%)
 Frame = -2

Query  1432  PRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITED  1253
             P        L +  + +  AR +   Q+P  L  +S     ++ F D  +R ++      
Sbjct  35    PSTPAVSQSLPYPSTSQPAAR-TVPFQQPLPLLTFSYTPAHELEFTDSGMRYYR---DPP  90

Query  1252  IGSDLNEGFDTFTEKRDLGSQGFGDLL----ACIRNKNIP----LDRMHFVTYRNNLNKI  1097
              G+DL   ++ +  + +   +G  D L    A +R +N      +D +  V++R  + KI
Sbjct  91    RGADLGNAYERWVRRGE--EKGRIDSLLRAYAKVRRENTAGMAGVD-VGVVSWRGVMTKI  147

Query  1096  MATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELD-----RRRCYWGYCFESLATED  932
             +   Y   + WE+ V    GV+YL+ H    R + + D     RR+ Y+GY FES  T  
Sbjct  148   LTAPYEERDGWELNVMLVDGVLYLEEHVSDARLQEKNDMPANQRRQMYYGYAFESWCTAS  207

Query  931   PGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDC-----CDSRDDGRRF------  785
                S      D+D NV++C+V+KTKIG+ R+++G E+DC     C    D   +      
Sbjct  208   SPSSPPGWGGDVDTNVQWCSVVKTKIGSTRLVIGGEVDCVRDRACVRSSDAGGYSGKNDT  267

Query  784   YVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNE  605
              VELKTS  +   + E  FE+ KLLKF+ QSFL GVP IVVGFR   G++   +  +T +
Sbjct  268   MVELKTSMNIRGAQDEARFEK-KLLKFYFQSFLLGVPEIVVGFRTPKGQVTTVQSFKTMQ  326

Query  604   ITQRVKMK-SYWQGGVCLAFADEVLCWLYGTV  512
             + + ++ K   W   VCL + DE L W+ G+ 
Sbjct  327   LPRMIRGKPGAWDAQVCLQWGDEFLSWVRGSA  358



>ref|XP_747571.1| Dhp1-interacting protein Din1 [Aspergillus fumigatus Af293]
 sp|Q4WDK5.3|DXO_ASPFU RecName: Full=Decapping nuclease rai1 [Aspergillus fumigatus 
Af293]
 gb|EAL85533.1| Dhp1-interacting protein Din1, putative [Aspergillus fumigatus 
Af293]
 gb|EDP47478.1| HLA class III protein Dom3z [Aspergillus fumigatus A1163]
 gb|KEY81428.1| Dhp1 interacting protein Din1 [Aspergillus fumigatus var. RP-2014]
Length=365

 Score =   147 bits (370),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 105/331 (32%), Positives = 167/331 (50%), Gaps = 29/331 (9%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             +T I+ P E+ C+S   +   +  D SLR +    T  + +DLN GFDTF +  D   + 
Sbjct  18    NTTIRRPREITCFSYDAEHKFHLGDSSLRYY---YTPRLPADLNRGFDTFQKLDDTADEH  74

Query  1186  FGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
                LL  I        +      +T+R  + KI+   +     +EM     +     +++
Sbjct  75    LDALLETIMALEKETGKRCEADIITWRGMMTKILTAPFDNLNGFEMNATCFQVGGENNLY  134

Query  1015  KLPERPKSELDRR---------RCYWGYCFESLAT----EDPG-RSDGDRIHD--IDANV  884
             K+ ++   E  R            YWGY FE+L       DP  R++ +   D  ++ N 
Sbjct  135   KIQQKQIQENQRMPPGMASQDLMAYWGYKFETLCLLQQPWDPTPRAEIESREDLVVNNNA  194

Query  883   EYCAVIKTKIGAHRILMGAEMD----CCDSRDDGRRFYVELKTSRELLDHRTEEIFEREK  716
             +YC+V++T IG+ R+++G E+D    C   R +    +VELKTS E+ + R    +ER K
Sbjct  195   QYCSVVRTGIGSTRLIIGGEVDAVWDCKPDRKEDPINWVELKTSAEIRNDRDMIKYER-K  253

Query  715   LLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGVCLAFAD  542
             LLKFW QSFL GVP I+VGFRD++G + R E L T  I  +VK   +  W G +C+ FA 
Sbjct  254   LLKFWAQSFLLGVPKIIVGFRDNHGIVHRLEELETASIPNKVKKLGRGTWDGNICINFAA  313

Query  541   EVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
               L WL  T+KE   + ++    S+ +++ +
Sbjct  314   AFLEWLKSTIKEGGTWRIRKLEKSSLIQVFK  344



>gb|EEH16876.2| hypothetical protein PABG_06963 [Paracoccidioides brasiliensis 
Pb03]
Length=368

 Score =   146 bits (369),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 104/338 (31%), Positives = 170/338 (50%), Gaps = 40/338 (12%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             + AI+ P E+AC+S     +   D+ SLR +       + +DLN+GFDTF +  D G + 
Sbjct  18    NAAIRRPKEIACFSYDDQHNFRLDESSLRYY---YPPRLPADLNKGFDTFEKLDDSGDEH  74

Query  1186  FGDLLACIRNKNIPLDR-------MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
                LL  I    I L+R          VT+R  + KIM   +     +EM     +  ++
Sbjct  75    LDALLDTI----IDLERRTGNKCEADIVTWRGMMTKIMTAPFDNMNGFEMNATCYQESIF  130

Query  1027  LD---VHKLPER---------PKSELDRRRCYWGYCFESLATEDPG-------RSDGDRI  905
             ++    +KL ++         P +       +WGY FE+L+  D         + +G   
Sbjct  131   IEENNAYKLSQKESQRNQRMPPGAPSQDMMAFWGYKFETLSLIDEPWDATSREKIEGREN  190

Query  904   HDIDANVEYCAVIKTKIGAHRILMGAEMD----CCDSRDDGRRFYVELKTSRELLDHRTE  737
               ++   +YC+V++T IG  +I++G E+D    C   + D    +VELKTS E+ + R  
Sbjct  191   EIVNNKAQYCSVVRTGIGGFKIVLGGEVDAVWDCKPEKKDEPINWVELKTSAEIRNDRDM  250

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRV--KMKSYWQGG  563
               +ER KLLKFW QSFL GVP I+VGFR+++G L+R E + T++I   V  + K  W G 
Sbjct  251   LKYER-KLLKFWAQSFLLGVPKIIVGFREEHGILLRLEEMSTHDIPGLVARRGKGTWDGN  309

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             +C+ F  ++L WL   + +   + ++    S  +E+ R
Sbjct  310   ICINFTAKLLGWLKLVINDEGLWRIRRQEKSPVIEVFR  347



>gb|KDQ14966.1| hypothetical protein BOTBODRAFT_131994 [Botryobasidium botryosum 
FD-172 SS1]
Length=405

 Score =   147 bits (371),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 95/307 (31%), Positives = 161/307 (52%), Gaps = 24/307 (8%)
 Frame = -2

Query  1357  IQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGD  1178
             +Q P  L  +S   + ++ F++ +++ F     +   +DLN G+D +  K +   +    
Sbjct  43    LQRPKCLLTFSYNANHELEFNNSAMKYFSPPPAQ---ADLNWGYDRWVHKEEGIVRLDSL  99

Query  1177  LLACIRNK-NIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPER  1001
             L A +R++      R H VT+R  + KIM   Y   + W++ +    G +YL+ +   ++
Sbjct  100   LQATLRDEARYEAGRAHLVTWRGIMTKIMMAPYEERDSWDLNLMYLNGTMYLEENLTEQQ  159

Query  1000  PKSE-----LDRRRCYWGYCFESLATEDPGRSDGDRIH-----------DIDANVEYCAV  869
              +++       R   Y+GY FES  T     +D    +           D++ NV++C +
Sbjct  160   IQAKGTMTAEHRTMSYYGYAFESYCTSSSPSADSQAPNTHPEAPPGWGGDVNTNVQWCQI  219

Query  868   IKTKIGAHRILMGAEMDCC-DSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQS  692
             +KTK+ +HR+++G E+DC  DS +     +VELKTS  ++  + + +   +KLLKFW QS
Sbjct  220   VKTKLNSHRLILGGEVDCVRDSYNGTTENFVELKTSL-VIKTKPDRVRFEKKLLKFWAQS  278

Query  691   FLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKS--YWQGGVCLAFADEVLCWLYG  518
             FL GVP I+VG+R  +G +  TE  RT +I Q V+ K    W  GVCL FAD  L +L G
Sbjct  279   FLLGVPEILVGYRFRSGIVEYTESFRTLDIPQIVRGKGAHAWDAGVCLNFADAFLNFLDG  338

Query  517   TVKENED  497
              +  + +
Sbjct  339   IIATSTN  345



>ref|XP_008598193.1| RAI1-like protein [Beauveria bassiana ARSEF 2860]
 gb|EJP66381.1| RAI1-like protein [Beauveria bassiana ARSEF 2860]
Length=376

 Score =   146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 107/337 (32%), Positives = 171/337 (51%), Gaps = 31/337 (9%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E+AC+S  ++ +    D SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  13    FAGASQPVRRPKEIACFSYDENHEFSIGDASLKWY---YTPQLGADLSKGFDTFEKLDDS  69

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
               +    LL  I +      +    HFVT+R  + KIMAT +   + +EM     +  ++
Sbjct  70    KDEHLDSLLTTIMSHEKETGKRIDAHFVTWRGMMTKIMATPFDNQDGFEMNATLYQDCIF  129

Query  1027  LD---VHKLPERPKSELDRRRC--------YWGYCFESLAT-----EDPGRS--DGDRIH  902
             ++    +K+  R     +RRR         +WGY FE+LAT      D  RS  +G    
Sbjct  130   IEENNAYKVASRRNEGQNRRRHGPPLEVMQFWGYKFETLATIPAPWGDTERSVIEGREDA  189

Query  901   DIDANVEYCAVIKTKIGAHRILMGAEMDCC-DS--RDDGRRF-YVELKTSRELLDHRTEE  734
              ++   +YC+V++T IG   + +G E+D   DS  R  G    +VELKTS E+      E
Sbjct  190   VVNNKAQYCSVVRTGIGRSILCLGGEVDALWDSKPRQQGSPVQWVELKTSAEIRGPGDVE  249

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK--SYWQGGV  560
              F R KL+K+WIQSFL GVP I+VGFR  +G L+  + + T  I + V  +    W   +
Sbjct  250   NFHR-KLMKYWIQSFLLGVPKIIVGFRSRDGILLDVQEIETQRIPETVNAQPNPSWNADM  308

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ FA   L +L  T+ +   + ++  P S  +E+ +
Sbjct  309   CVNFAAIFLEFLTHTINDEGVWRIRRQPKSPVIEVYK  345



>ref|XP_003190244.1| protein rai1 [Aspergillus oryzae RIB40]
Length=368

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 101/337 (30%), Positives = 163/337 (48%), Gaps = 38/337 (11%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             +T I+ P E+ C+S       +  D SLR +       + +DLN G+DTF +  D   + 
Sbjct  18    NTTIRRPREITCFSYDDQHSFHLGDSSLRYY---YPPRLPADLNRGYDTFQKLDDSADEH  74

Query  1186  FGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
                LL  I        +      +T+R  + KI+   +     +EM   + +  ++++ +
Sbjct  75    LDALLETIMALEKETGKKCEADIITWRGMMTKILTAPFDNLNGFEMNATRFQDTIFIEEN  134

Query  1015  KL---------------PERPKSELDRRRCYWGYCFESLAT----EDPGRSDGDRIHD--  899
              L               P  P  ++     YWGY FE+L+      DP   +     D  
Sbjct  135   NLYKNQQKQLQKNQRMPPGMPSQDM---MAYWGYKFETLSLLNQPWDPTTREEIESRDEL  191

Query  898   -IDANVEYCAVIKTKIGAHRILMGAEMD----CCDSRDDGRRFYVELKTSRELLDHRTEE  734
              ++ N +YC++++T IG  R+++G E+D    C  +R +    +VELKTS E+ + R   
Sbjct  192   VVNNNAQYCSIVRTGIGKTRLIIGGEVDAVWDCKPARKEDVIHWVELKTSAEIRNDRDMV  251

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVK--MKSYWQGGV  560
              +ER KLLKFW QSFL GVP I+VGFRD+ G + R E L T  I  +VK   +  W G +
Sbjct  252   KYER-KLLKFWAQSFLLGVPKIIVGFRDERGIVHRLEELETASIPNKVKNGGRVTWDGNI  310

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ F    L WL  T+ E+  + ++    S+ +E+ R
Sbjct  311   CINFTSAFLEWLKSTINEDGMWRIRKLEKSSIIEVFR  347



>gb|KGQ04299.1| Protein RAI1 [Beauveria bassiana D1-5]
Length=376

 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 107/337 (32%), Positives = 171/337 (51%), Gaps = 31/337 (9%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E+AC+S  ++ +    D SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  13    FAGASQPVRRPKEIACFSYDENHEFSIGDASLKWY---YTPQLGADLSKGFDTFEKLDDS  69

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
               +    LL  I +      +    HFVT+R  + KIMAT +   + +EM     +  ++
Sbjct  70    KDEHLDSLLTTIMSHEKETGKRIDAHFVTWRGMMTKIMATPFDNQDGFEMNATLYQDCIF  129

Query  1027  LD---VHKLPERPKSELDRRRC--------YWGYCFESLAT-----EDPGRS--DGDRIH  902
             ++    +K+  R     +RRR         +WGY FE+LAT      D  RS  +G    
Sbjct  130   IEENNAYKVASRRNEGQNRRRHGPPLEVMQFWGYKFETLATIPAPWGDTERSVIEGREDA  189

Query  901   DIDANVEYCAVIKTKIGAHRILMGAEMDCC-DS--RDDGRRF-YVELKTSRELLDHRTEE  734
              ++   +YC+V++T IG   + +G E+D   DS  R  G    +VELKTS E+      E
Sbjct  190   VVNNKAQYCSVVRTGIGRSILCLGGEVDALWDSKPRQQGSPVQWVELKTSAEIRGPGDVE  249

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK--SYWQGGV  560
              F R KL+K+WIQSFL GVP I+VGFR  +G L+  + + T  I + V  +    W   +
Sbjct  250   NFHR-KLMKYWIQSFLLGVPKIIVGFRSRDGILLDVQEIETQRIPETVNAQPNPSWNADM  308

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ FA   L +L  T+ +   + ++  P S  +E+ +
Sbjct  309   CVNFAAIFLEFLTYTINDEGVWRIRRQPKSPVIEVYK  345



>ref|XP_003008466.1| RAI1 [Verticillium alfalfae VaMs.102]
 gb|EEY14040.1| RAI1 [Verticillium alfalfae VaMs.102]
Length=389

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 109/347 (31%), Positives = 169/347 (49%), Gaps = 46/347 (13%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             S  ++ P E AC+S   + + + DD S+R +       IG+DL++G+DTF +  + G + 
Sbjct  17    SQPVKRPKEFACFSYDDNHEFHLDDSSMRYY---YNPTIGADLSKGYDTFVKADESGDEH  73

Query  1186  FGDLLACIR---NKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
                LL  I+    K+        VT+R  + KIM+T +   + +EM     + V  L   
Sbjct  74    LVSLLKTIQAHEQKSGQKIDAQLVTWRGMMTKIMSTPFDDRDGFEMNATLYQ-VRRLSQP  132

Query  1015  KLPERPKSEL-----------------DRRRC--------YWGYCFESLATEDPGRSDGD  911
              L + P  +                   +RR         +WGY FE+LAT      D  
Sbjct  133   SLEQAPWPDFIEENNAYKKASQQQQNAQQRRGPHAPEVMQFWGYKFETLATLPKPWGDTP  192

Query  910   RIHD-------IDANVEYCAVIKTKIGAHRILMGAEMDCC-DSR--DDGRRF-YVELKTS  764
             R +        ++   +YC+V++T IGA  I +G E+D   DS+    G    +VELKTS
Sbjct  193   REYIENREDEVVNNKAQYCSVVRTGIGATTICIGGEVDAIWDSKPAQPGTPINWVELKTS  252

Query  763   RELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM  584
              ++   R    F+R KLLKFW+QSFL GVP I+VGFR   G L R + ++T EI   +  
Sbjct  253   VDIRSDRDAATFDR-KLLKFWLQSFLLGVPRIIVGFRTHAGILARVQEIQTAEIPDTIAR  311

Query  583   KSY--WQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             +    W G +C+ FA E L WL  T+ ++  + ++  P S  +E+ R
Sbjct  312   RPNPPWNGDMCVNFAGEFLDWLRQTINDDGVWRIRRKPGSPTIEVFR  358



>ref|XP_009658456.1| RAI1 protein [Verticillium dahliae VdLs.17]
 gb|EGY18102.1| RAI1 protein [Verticillium dahliae VdLs.17]
Length=389

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 109/353 (31%), Positives = 166/353 (47%), Gaps = 58/353 (16%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             S  ++ P E AC+S   + + + DD S+R +       IG+DL++G+DTF +  + G + 
Sbjct  17    SQPVKRPKEFACFSYDDNHEFHLDDSSMRYY---YNPTIGADLSKGYDTFVKADESGDEH  73

Query  1186  FGDLLACIR---NKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
                LL  I+    K+        VT+R  + KIM+T +   + +EM          L   
Sbjct  74    LVSLLKTIQAHEQKSGQKIDAQLVTWRGMMTKIMSTPFDDRDGFEMNAT-------LYQV  126

Query  1015  KLPERPKSELDRRR-------------------------------CYWGYCFESLATEDP  929
             + P RP  E    R                                +WGY FE+LAT   
Sbjct  127   RQPSRPSLEQAPWRDFIEENNAYKKASQQQQNAQQRRGPHAPEVMQFWGYKFETLATLPK  186

Query  928   GRSDGDRIHD-------IDANVEYCAVIKTKIGAHRILMGAEMDCC-DSR--DDGRRF-Y  782
                D  R +        ++   +YC+V++T IGA  I +G E+D   DS+    G    +
Sbjct  187   PWGDTPREYIENRENEVVNNKAQYCSVVRTGIGATTICIGGEVDAIWDSKPAQPGTPINW  246

Query  781   VELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEI  602
             VELKTS ++   R    F+R KLLKFW+QSFL GVP I+VGFR   G L R + ++T EI
Sbjct  247   VELKTSVDIRSDRDAATFDR-KLLKFWLQSFLLGVPRIIVGFRTHAGILARVQEIQTAEI  305

Query  601   TQRVKMKSY--WQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
                +  +    W G +C+ FA E L WL  T+ ++  + ++  P S  +E+ R
Sbjct  306   PDTIARRPNPPWNGDMCVNFAGEFLDWLRQTINDDGVWRIRRKPGSPTIEVFR  358



>ref|XP_007294987.1| Protein RAI1 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
 gb|EKD14887.1| Protein RAI1 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
Length=393

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 112/330 (34%), Positives = 165/330 (50%), Gaps = 30/330 (9%)
 Frame = -2

Query  1369  KSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQ  1190
             +S AI+ P E+AC+S  +      DD S+R +       +G++L+ GFDTF +  D   +
Sbjct  16    QSAAIKRPREIACFSYDEKHQFRLDDSSIRHY---YPPKLGANLSMGFDTFEKLDDAADE  72

Query  1189  GFGDLLACI------RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGV-----HKR  1043
                 LL  I        K +  D    +T+R  + K MA  +   +  E G      H+ 
Sbjct  73    HLDSLLKTIIALEQETGKRVEAD---VITWRGMMTKFMAAIFSDRDGTETGSFIEENHEY  129

Query  1042  KGVVYLDVHKLPERPKSELDRRRCYWGYCFESL----ATEDPGRSD--GDRIHDIDAN-V  884
             K        + P  P         YWGY FE+L    AT D    D   +R ++I  N  
Sbjct  130   KRQSQARQMRQPSHPGRPSQDMMSYWGYKFETLCLIPATWDETTRDYIENRENEIVNNYA  189

Query  883   EYCAVIKTKIGAHRILMGAEMDCC-DSR--DDGRRFYVELKTSRELLDHRTEEIFEREKL  713
             +YC+V+KT IG   +++G E+D   DS+  D G   +VELKTS ++      + FER KL
Sbjct  190   QYCSVVKTGIGNTNMILGGEVDALWDSKPADGGPINWVELKTSADIRHDGDMKNFER-KL  248

Query  712   LKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGVCLAFADE  539
             +KFWIQSFL GVP I+VGFR  +G L R E + T  I   VK   K  W G +C+ FA  
Sbjct  249   MKFWIQSFLLGVPKIIVGFRTQDGFLTRIEEMDTASIPGTVKRRGKGTWDGNMCINFAAT  308

Query  538   VLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             +L +L  T+ E+  + ++    S+ +E+ R
Sbjct  309   LLDFLKATITEDGVWRIRRKERSSSIEVFR  338



>ref|XP_010761641.1| hypothetical protein PADG_06192 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH50113.2| hypothetical protein PADG_06192 [Paracoccidioides brasiliensis 
Pb18]
Length=368

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 100/313 (32%), Positives = 160/313 (51%), Gaps = 40/313 (13%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             + AI+ P E+AC+S     +   D+ SLR +       + +DLN+GFDTF +  D G + 
Sbjct  18    NAAIRRPKEIACFSYDDQHNFRLDESSLRYY---YPPRLPADLNKGFDTFEKLDDSGDEH  74

Query  1186  FGDLLACIRNKNIPLDR-------MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
                LL  I    + L+R          VT+R  + KIM   +     +EM     +  ++
Sbjct  75    LDALLDTI----VDLERRTGNKCEADIVTWRGMMTKIMTAPFDNMNGFEMNATCYQESIF  130

Query  1027  LD---VHKLPER---------PKSELDRRRCYWGYCFESLATEDPG-------RSDGDRI  905
             ++    +KL ++         P +       +WGY FE+L+  D         + +G   
Sbjct  131   IEENNAYKLSQKESQRNQRMPPGAPSQDMMAFWGYKFETLSLIDEPWDATSREKIEGREN  190

Query  904   HDIDANVEYCAVIKTKIGAHRILMGAEMD----CCDSRDDGRRFYVELKTSRELLDHRTE  737
               ++   +YC+V++T IG  +I++G E+D    C   + D    +VELKTS E+ + R  
Sbjct  191   EIVNNKAQYCSVVRTGIGGFKIVLGGEVDAVWDCKPEKKDEPINWVELKTSAEIRNDRDM  250

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRV--KMKSYWQGG  563
               +ER KLLKFW QSFL GVP I+VGFR+++G L+R E + T++I   V  + K  W G 
Sbjct  251   LKYER-KLLKFWAQSFLLGVPKIIVGFREEHGILLRLEEMSTHDIPGLVARRGKGTWDGN  309

Query  562   VCLAFADEVLCWL  524
             +C+ F  ++L WL
Sbjct  310   ICINFTAKLLGWL  322



>emb|CCA72856.1| related to RAI1-Rat1p Interacting Protein, required for pre-rRNA 
processing [Piriformospora indica DSM 11827]
Length=413

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 154/290 (53%), Gaps = 17/290 (6%)
 Frame = -2

Query  1363  TAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGF  1184
              A Q+P +L  +S     ++ F+D +LR +   +     +DLN  +  + ++++   +  
Sbjct  52    VAFQKPYQLVSFSYTPQRELVFNDSALRFW---VEPPRNADLNYRYAHWIKRKEERGRLD  108

Query  1183  GDLLACIRNK-NIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLP  1007
             G L A I  + +    R   + +R  L KI+   Y   + WE+ V +    +YL+ H   
Sbjct  109   GLLKAAIHARCDETRSRARTICWRGVLCKILIAPYEERDKWELNVMRLGDTIYLEEHATD  168

Query  1006  E-----RPKSELDRRRCYWGYCFESLATEDPGRSDGDRIH---DIDANVEYCAVIKTKIG  851
             +        +E  R++ Y+GY FES  T+   R    +     D+D NV++C+V+KTKIG
Sbjct  169   QALAQKENMNEHQRKQTYYGYSFESWCTDVRPRGHDQQPRWGGDVDTNVQWCSVVKTKIG  228

Query  850   AHRILMGAEMDCCDSR-DDGRRFYVELKTSRELL--DHRTEEIFEREKLLKFWIQSFLAG  680
              HR+L+G E+DC   R  +    +VELKTS  +   +   E  FE+ KLLKF+ QSFL G
Sbjct  229   QHRLLIGGEVDCVRGRYTEQPDTFVELKTSMTIRPGNGWDEAKFEK-KLLKFYFQSFLLG  287

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK-SYWQGGVCLAFADEVL  533
             VP IVVGFR   GRL   +  +T EI + V+ K S W  GVCL++ D  +
Sbjct  288   VPEIVVGFRTPQGRLQTVQTFKTLEIPRMVRGKPSEWNPGVCLSWGDNFI  337



>gb|EHA24413.1| hypothetical protein ASPNIDRAFT_209964 [Aspergillus niger ATCC 
1015]
Length=356

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 106/329 (32%), Positives = 165/329 (50%), Gaps = 34/329 (10%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             S AI+ P E+AC+S   +   +  D S++ +       + +DLN GF++F +  D   + 
Sbjct  18    SAAIRRPKEIACFSYDDEHKFHLGDSSMKYY---YPPCLPADLNRGFESFQKLDDSADEH  74

Query  1186  FGDLLACIRNKNIPLDR-------MHFVTYRNNLNKIMATAYIRNEPWEMGV---HKRKG  1037
                LL  +    I L++          +T+R  + KI+A  +     +EM        + 
Sbjct  75    LDALLETV----IALEQETQKKCEADIITWRGMMTKILAAPFDNLNGFEMNATCFQNEQK  130

Query  1036  VVYLDVHKLPERPKSELDRRRCYWGYCFESLATED------PGRSDGDRIHDI-DANVEY  878
              +  +    P     +L     YWGY FE+L+  +      P R   +R   I + N +Y
Sbjct  131   RIQKNQRMPPGMASQDL---MAYWGYKFETLSVLNEPWDPTPRREIENREELIVNNNAQY  187

Query  877   CAVIKTKIGAHRILMGAEMD----CCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLL  710
             C+V++T IG  R+++G E+D    C   R +    +VELKTS E+ + R    +ER KLL
Sbjct  188   CSVVRTAIGRARLVIGGEVDAIWDCKPERKEDPIHWVELKTSAEIRNDRDMVKYER-KLL  246

Query  709   KFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGVCLAFADEV  536
             KFW QSFL GVP IVVGFRD +G + R E L T  I  +VK   +S W G +C+ FA   
Sbjct  247   KFWAQSFLLGVPKIVVGFRDQHGIVHRLEELETAAIPGKVKKLGRSTWDGNICINFAATF  306

Query  535   LCWLYGTVKENEDYILQFTPHSNRLELLR  449
             L WL  T++E   + ++    S+ +E+ R
Sbjct  307   LEWLKTTIQEEGTWRIRKREKSSLIEVFR  335



>ref|XP_007730025.1| hypothetical protein A1O3_01692 [Capronia epimyces CBS 606.96]
 gb|EXJ93135.1| hypothetical protein A1O3_01692 [Capronia epimyces CBS 606.96]
Length=395

 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 112/388 (29%), Positives = 183/388 (47%), Gaps = 48/388 (12%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A ++ AI+ P E+  +S  +D  +  D  SLR +       +  DLN+GFDTF +  D 
Sbjct  15    FAGQNAAIRRPREITFFSFDEDHRLRHDASSLRYY---YPPAVPCDLNKGFDTFRQLDDS  71

Query  1198  GSQGFGDLLACI----RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVV  1031
                    LL  +    + K   +D    +T+R  + KIM   +   + WEM     +G +
Sbjct  72    ADDHLDGLLDALILYEKEKGNKVD-TDIITWRGMMTKIMVAPFSSFDDWEMNATLFQGTI  130

Query  1030  YLDV----------HKLPE--RPKSELDRRRCYWGYCFESLA------TEDPGRSDGDRI  905
             +++           H+  E  RP +       +WGY FE+++      +  P      R 
Sbjct  131   FIEENHSKKVASREHQFSEVARPGAMSQDLMSFWGYKFETVSLLPEPWSATPREYIDSRE  190

Query  904   HDIDAN-VEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRT  740
               I +N  +YC++++T  G  ++++G E+D   D + + +     +VELKT+  + + R 
Sbjct  191   DQIVSNYAQYCSIVRTGFGKVKMIIGGEVDAVMDFKPEDKSQPVNWVELKTTAAVTNERE  250

Query  739   EEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK--SYWQG  566
             +  FER KLLKFW QSFL GVP IVVG+R   G L   E L T  I ++V++K  + W G
Sbjct  251   QIKFER-KLLKFWAQSFLLGVPKIVVGYRTSQGILEYLEELDTQSIPEKVRVKGNNLWDG  309

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR----------GPSCPDAITHH  416
               C+ FA   L WL G + E   + +Q    S RLE+ +           P+  +  TH 
Sbjct  310   QTCINFASSFLEWLKGVITEGGVWRIQKRDKSPRLEIFKVEETGHGDILSPAFVEWRTHG  369

Query  415   VQQLESF*VCRRMKTTDLNIQRTGIRSD  332
             ++  +     ++    D N+  TG  S+
Sbjct  370   LKDQQQ----KQATAADNNVNGTGTVSE  393



>gb|EYB27590.1| hypothetical protein FG05_13131 [Fusarium graminearum]
Length=375

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 108/340 (32%), Positives = 172/340 (51%), Gaps = 36/340 (11%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A +S  ++ P E AC+S   + +   DD SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  13    FAGESQPVKRPKEFACFSYDDNHEFRLDDSSLKYY---YTPQLGADLSKGFDTFQKLDDT  69

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
             G      LL  I        +    + VT+R  + KIMAT +   + +EM     +  ++
Sbjct  70    GDDHLDSLLKTIVAHEQETGKKIDANVVTWRGMMTKIMATPFDNMDGFEMNATLYQDCIF  129

Query  1027  LD---VHKLPERPKSELDRRRC---------YWGYCFESLAT------EDPGRSDGDRIH  902
             ++    +K+  R     + RR          +WGY FE+L+T      E P     +R +
Sbjct  130   IEENNAYKVASRSNEGNNNRRRRGPPLEVMQFWGYKFETLSTLLAPWAETPREFIENREN  189

Query  901   DIDAN-VEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRTE  737
             ++  N  +YC+V++T IG   + +G E+D   DS+ + +     +VELKTS E+ +    
Sbjct  190   EVVNNKAQYCSVVRTGIGKSVLCLGGEVDAIWDSKPEEKGSPINWVELKTSAEIRNTGDM  249

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSY----WQ  569
             E F R KL+K+WIQSFL GVP IVVGFR  +G LV  + + T+ I + V   SY    W 
Sbjct  250   ENFNR-KLMKYWIQSFLLGVPRIVVGFRTRDGILVEAKDIETHRIPETV--NSYPNPKWN  306

Query  568   GGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
               +C+ FA   L WL   + +   + ++  P S  +EL +
Sbjct  307   ADMCVNFAATFLDWLSANITDEGVWRIKREPQSPTIELFK  346



>ref|XP_010772061.1| PREDICTED: decapping and exoribonuclease protein [Notothenia 
coriiceps]
 ref|XP_010772062.1| PREDICTED: decapping and exoribonuclease protein [Notothenia 
coriiceps]
Length=423

 Score =   145 bits (366),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 104/363 (29%), Positives = 170/363 (47%), Gaps = 39/363 (11%)
 Frame = -2

Query  1480  PNYPPRQNYGYGRGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVY  1301
             PN P  Q+ G  RG  P      S L  +   E   R     ++P E+ C+S   +   +
Sbjct  38    PNRPQNQS-GPSRGQNPH-----SSLSLSTRRELYERDFPVYKQPVEVGCFSLDSERRFF  91

Query  1300  FDDRSLRLFKRLITEDIGS--DLNEGF-DTFTEKRDLGSQGFGDLLACIRNKNIPLDR--  1136
              D R +R +   +  D     DL +G+ D F ++ D   +    +L  I      L    
Sbjct  92    NDGRQMRYY---VEPDRSPNFDLRDGYKDRFIKRDDSVKEKLDHMLRWILANRSKLSARG  148

Query  1135  ---------MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYL-----DVHKLPERP  998
                      + FVT+R +L K++   Y   E W++ V + +G +Y+     +  +  +  
Sbjct  149   TTASSCDLDIDFVTWRGHLTKLLTAPYETREGWQLAVTRFRGTLYISEVETEAARRDQEN  208

Query  997   KSELDRRRCYWGYCFE--SLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAE  824
             ++E      YWGY FE  + A  D GR D   +  ++ N  +C V++T++  HR+L   E
Sbjct  209   RTERHEEMMYWGYKFEQYTCADTDHGRPDPGGV--LNTNEAFCTVVQTRLADHRLLFSGE  266

Query  823   MDCCDSRDDGRRF---YVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFR  653
             +DC D   +       Y+ELKTS E+   +    F R KLLK+W QSFL GVP +V GFR
Sbjct  267   VDCRDKDPNAPAAPACYIELKTSAEICTPKQRSNFHRFKLLKWWAQSFLPGVPRVVAGFR  326

Query  652   DDNGRLVRTERLRTNEITQRVKMK-SYWQGGVCLAFADEVLCWLYGTVKENED---YILQ  485
             D+ G +V  E    ++I+  +K + + W+  VC+ F  + L ++     E+     Y+L 
Sbjct  327   DEEGVVVAVETFPISKISHLIKNEHNCWKPTVCMNFCSDFLSFVKHIATEDNPSVVYLLS  386

Query  484   FTP  476
             + P
Sbjct  387   WEP  389



>ref|XP_009838520.1| hypothetical protein, variant 1 [Aphanomyces astaci]
 gb|ETV72077.1| hypothetical protein, variant 1 [Aphanomyces astaci]
Length=316

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 139/294 (47%), Gaps = 27/294 (9%)
 Frame = -2

Query  1444  RGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRL  1265
             R    R    V  L      E + R    I +P +++ +S+  DG V +D   L+L K+ 
Sbjct  14    RSKQARMHDGVLVLPIPSMRELMQRSKQRISKPVQVSGFSKYPDGHVTYDRSLLKLLKK-  72

Query  1264  ITEDIGSDLNEGFDTFTEKRDLG--SQGFGDLLACIRNKN------IPLDRMHFVTYRNN  1109
                 + SDL EG D + E  +          +L   R+ +       PL + H VTYRNN
Sbjct  73    -AAPLNSDLLEGMDAYAEPPNTAPLEHVIDAMLPANRHLHNHTTDAQPLPKYHVVTYRNN  131

Query  1108  LNKIMATAYIRNEPWEMGVHKRKGVVYLDV--HKLPERPKSELDRRRCYWGYCFESLATE  935
             LNKIM T Y  N  + M + + +G VYL+V    +P    S    +  Y G  +E L++ 
Sbjct  132   LNKIMGTPYNTNSAYTMQMQRIQGCVYLNVTLSHIPPSSFSSNQAQGAYAGRRYEVLSSA  191

Query  934   DPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSR---DDGRRFYVELKTS  764
               G              EYC V    +G  ++L+GAEMD   +    DD    YVELKT 
Sbjct  192   AVGGG------------EYCGVFSVSLGQKKLLIGAEMDGVTASKDDDDDTTNYVELKTF  239

Query  763   RELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEI  602
             R L   +    FER KLL FWIQS+L GVP I VGFR+++  L + +   T ++
Sbjct  240   RILNTPKDRFTFERYKLLAFWIQSYLVGVPTIRVGFRNESFILTKEQAFETADL  293



>ref|XP_003071171.1| hypothetical protein CPC735_037320 [Coccidioides posadasii C735 
delta SOWgp]
 gb|EER29026.1| hypothetical protein CPC735_037320 [Coccidioides posadasii C735 
delta SOWgp]
Length=380

 Score =   144 bits (362),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 108/335 (32%), Positives = 167/335 (50%), Gaps = 52/335 (16%)
 Frame = -2

Query  1384  ETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKR  1205
             +  A  + AI+ P E+AC+S   D +   D+ SLR +       +  DLN GF+TF +  
Sbjct  12    QRFAGSNAAIRRPKEIACFSYDDDHNFLLDESSLRYY---YPPRLPVDLNGGFETFKKLD  68

Query  1204  DLGSQGFGDLLACIRNKNIPLDR-------MHFVTYRNNLNKIMATAYIRNEPWEMG---  1055
             D   +    LL  I    I L++          +T+R  + K+M  ++     +EM    
Sbjct  69    DSADEHLDALLDTI----IALEKSTGAKCEADVITWRGMMTKLMTASFDNWNGFEMNATY  124

Query  1054  ---------VHKRKGVVYLDVH----------KLPER--PKSELDRRRCYWGYCFESLAT  938
                      +  +KG ++++ +          +L +R  P +    R  YWGY FE+L+ 
Sbjct  125   YQIMIGTDDLFIKKGSIFIEENNEYKNAQKKIQLEQRMPPGAPSQDRMMYWGYKFETLSL  184

Query  937   ED------PGRSDGDRIHDI-DANVEYCAVIKTKIGAHRILMGAEMD----CCDSRDDGR  791
              D         +   R H I + N +YC+V++T IG  ++++G E+D    C   R D  
Sbjct  185   IDEPWDAVSRETIESREHKIVNNNSQYCSVVRTGIGGVKLVIGGEVDAVWDCKPDRKDDP  244

Query  790   RFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRT  611
               +VELKTS E+ + R    FER KLLKFW QSFL GVP IVVGFR+++G L R E  +T
Sbjct  245   INWVELKTSAEIRNDRDMLKFER-KLLKFWAQSFLLGVPKIVVGFRNEHGILQRLEEFQT  303

Query  610   NEITQRVKMKSY--WQGGVCLAFADEVLCWLYGTV  512
             +EI   VK +    W G +C+ F  ++L W+ G +
Sbjct  304   HEIPGFVKRQGRRNWDGNICINFTAQLLEWIRGII  338



>ref|XP_002607257.1| hypothetical protein BRAFLDRAFT_88205 [Branchiostoma floridae]
 gb|EEN63267.1| hypothetical protein BRAFLDRAFT_88205 [Branchiostoma floridae]
Length=414

 Score =   144 bits (363),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 109/360 (30%), Positives = 162/360 (45%), Gaps = 51/360 (14%)
 Frame = -2

Query  1354  QEPCELACYSRVQDGDVYFDDRSLRLFKRLITED---IGSDLNEGFDTFTEKRDLGSQGF  1184
             ++P E+  +S   + + + D R LR +  ++  D   +  DL EG+DT  ++ +   +  
Sbjct  54    RQPSEVGVFSLDAEREFHNDGRKLRYY--IVPPDPKHVSFDLTEGYDTLIKRDEDEKERL  111

Query  1183  GDLLACI-RNKNIPL-------------------------DRMH--FVTYRNNLNKIMAT  1088
               LL  I +N+   L                          ++H  F+ +R +  KI+ T
Sbjct  112   DHLLRWILKNRRKFLLARRSISTSSETSDQEPGADHAESDSQLHTDFIAWRGHFTKILCT  171

Query  1087  AYIRNEPWEMGVHKRKGVVYLDVHKLPE---RPKSELDRRR--CYWGYCFESLATEDPGR  923
              Y   + W M V K  G  Y+   + PE   R  +  DR+R   YWGY FE   T     
Sbjct  172   PYENQDGWTMAVSKFNGTWYISEVETPEQRDRRVNMADRQREMTYWGYKFEQYLTAGEPH  231

Query  922   SDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDC--CDSRDDGRRFYVELKTSRELLD  749
                +    ++ N  +C VI+T++  H ++   E+DC   D      + Y+ELKTSRE+  
Sbjct  232   GKPEMSDPVNTNEAFCTVIRTRLNTHSLVFSGEVDCRLADGHMRAPQCYIELKTSREMYK  291

Query  748   HRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKS-YW  572
                +  F R KLLK+W QSFL GVP IV GFRDD G +   E  +T EI   +K  S  W
Sbjct  292   PNQQRNFRRFKLLKWWAQSFLPGVPRIVCGFRDDGGVVHFLETFKTMEIPNIIKADSPTW  351

Query  571   QGGVCLAFADEVLCWLYGTVKE-NEDYILQFTPHSNRLELLRGPSCPDAITHHVQQLESF  395
                VC+ F D+ L  +   V+E N   +  FT           P+CP   T H     SF
Sbjct  352   NASVCVNFCDQFLSHVKKVVQEDNPRLVYLFTWR---------PNCPVTHTVHRDSENSF  402



>emb|CCF39257.1| RAI1, partial [Colletotrichum higginsianum]
Length=371

 Score =   143 bits (361),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 103/314 (33%), Positives = 160/314 (51%), Gaps = 35/314 (11%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             S  ++ P E AC+S   + D +  D S+R +    T  +G+DL++G+D+F +  D   + 
Sbjct  9     SQPVKRPKEFACFSYDDNHDFHLGDSSVRYY---YTPALGTDLSKGYDSFIKHDDSKPEH  65

Query  1186  FGDLLACIR----NKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDV  1019
              G LL  I+     K   +D    VT+R  + KIMA+ +   + +EM     +   Y   
Sbjct  66    LGALLKTIKAHEEEKGEKID-AQIVTWRGMMTKIMASPFEDRDGFEMNATLYQNHEY---  121

Query  1018  HKLPERPKSELDRRRC--------YW-GYCFESLATEDPGRSDG------DRIHDIDAN-  887
              K+  + +    +RR         +W GY FE+LAT      D       +RI ++  N 
Sbjct  122   -KVASQKQQNAQQRRGPIPPEVMQFWAGYKFETLATLPAPWGDTSREYIDNRIEEVVNNK  180

Query  886   VEYCAVIKTKIGAHRILMGAEMDCC----DSRDDGRRFYVELKTSRELLDHRTEEIFERE  719
              +YC+V++T IG   I +G E+D       S+      +VELKTS  + D R  + F R 
Sbjct  181   AQYCSVVRTGIGPTVICIGGEVDAVWDSKPSKPGAPTNWVELKTSLAIRDDRDVDNFHR-  239

Query  718   KLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGVCLAFA  545
             KL+KFWIQSFL GVP I+VGFR+  G L   E + T +I + V+   K+ W   +C+ FA
Sbjct  240   KLMKFWIQSFLLGVPKIIVGFRNRQGILTGLEEIETEKIPETVQRRGKATWNADMCVNFA  299

Query  544   DEVLCWLYGTVKEN  503
              + L WL  T+ ++
Sbjct  300   ADFLVWLRQTINDD  313



>gb|KDO32131.1| hypothetical protein SPRG_03348, partial [Saprolegnia parasitica 
CBS 223.65]
Length=345

 Score =   142 bits (359),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 107/352 (30%), Positives = 164/352 (47%), Gaps = 51/352 (14%)
 Frame = -2

Query  1420  RFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSD  1241
             R +  L    +   LA     + +P +++ YS   DG + FD   L   K L    IG++
Sbjct  5     RALHVLHVPSTSALLANDKIRLSKPEQVSGYSLHPDGRLTFDRACL---KELRPAKIGAN  61

Query  1240  LNEGFDTFTEKRDLGSQGFGDLLACIRNKNIPLDR-----------------MHFVTYRN  1112
             L +GF++   +    S+     L  I +  +P +R                 +  VT+RN
Sbjct  62    LLDGFESHHVEP---SEDASPSLQPILDAMLPANREAHHADAHLSPPRLPAAIDVVTFRN  118

Query  1111  NLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSEL----DRRRCYWGYCFESL  944
             NLNKI+ T Y  N P+   V +R   ++L++    ER    +      +  Y G  +E++
Sbjct  119   NLNKILGTPYNSNSPYVFHVQRRGRTLFLNIQH--ERDADGVMHPAQAKGAYAGRQYEAI  176

Query  943   ATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTS  764
             A+  P               EYC V    +G+ ++L+GAE+D  D R D    YVELKT 
Sbjct  177   ASHGP-------------RGEYCGVFAMLLGSTQLLVGAELDGVDGRGD----YVELKTY  219

Query  763   RELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM  584
             + L   +    FER K L FWIQS+L GV  I  GFR  + +LV+ +   T+++      
Sbjct  220   KLLQTSKDRFSFERYKCLAFWIQSYLVGVGRIRCGFRSADCKLVKEQTFATSQLP--AFG  277

Query  583   KSYWQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLRGPSCPDA  428
               YWQ  VCL+FA  V  WL   V ++  Y +++ P +  L LL   + PDA
Sbjct  278   AKYWQPNVCLSFAKLVFAWLEDKVPDDTAYEVRYDPRARALSLL---ALPDA  326



>gb|KDE09864.1| hypothetical protein MVLG_00262 [Microbotryum violaceum p1A1 
Lamole]
Length=484

 Score =   145 bits (365),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 99/336 (29%), Positives = 161/336 (48%), Gaps = 52/336 (15%)
 Frame = -2

Query  1369  KSTAIQEPCELACYSRVQDGDVYFD----DRSLRLFKRLITEDIGSDLNEGFDTFTEKRD  1202
             +  A Q+P  L  +S      +       D SL ++       IGSDLN GF+    + D
Sbjct  73    RPIAFQQPLHLTSFSYSPTRQLLLTPQDRDASLAVY---TPPRIGSDLNTGFEQAVWRDD  129

Query  1201  LGSQGFGDLLACIRN--KNIP-------LDRMHFVTYRNNLNKIMATAY-----------  1082
              G +G   LL  +++  ++ P       LD+++ +T+R  + K++   Y           
Sbjct  130   SGDEGLDALLDTLQHYVESDPAGAAGEMLDKVNIITWRGMITKLLLAVYEVEAAHNDAAN  189

Query  1081  ---IRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDR-----RRCYWGYCFESLATEDPG  926
                 R E WEM V      +YL+  K P R +++        R+ Y+GY FE+ +T  P 
Sbjct  190   SRRTRAEGWEMNVMLLGNTLYLEESKTPARLEAKAASEKSYLRQSYYGYSFEAFSTRSPQ  249

Query  925   RSDG---DRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDS---------RDDGRRFY  782
              +           + NV++C+++KT  G  R+ +G E+DC  +          DD    +
Sbjct  250   STSSYTSPTFETPNTNVQWCSIVKTNFGGFRMFLGGEVDCLRAGWTEADPIRTDD----F  305

Query  781   VELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEI  602
             VELKT+  +   R E +FER+KLLK + QSFL GVP I+VGFR   G L   +  +T EI
Sbjct  306   VELKTNIVISSQRDEMMFERQKLLKHYTQSFLLGVPTIIVGFRTRTGHLTALQSFKTLEI  365

Query  601   TQRVKMKSY-WQGGVCLAFADEVLCWLYGTVKENED  497
              + V+ KS+ W     L  A +++ ++  T+  +E+
Sbjct  366   PRLVRNKSHAWSPTTSLTSAFDLIQFIISTLSSDEN  401



>ref|XP_006738496.1| PREDICTED: decapping and exoribonuclease protein isoform X2 [Leptonychotes 
weddellii]
Length=397

 Score =   144 bits (362),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 94/307 (31%), Positives = 148/307 (48%), Gaps = 18/307 (6%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGS--DLNEGFDTFTEKRDLGSQ-GFGD  1178
             P EL C+S       + D ++LR +    T D G   DL +G+    + RD   Q G   
Sbjct  46    PSELGCFSLDAQRQYHGDAQALRYYSPPPTNDQGPHFDLRDGYPDRYQPRDEEVQEGLDH  105

Query  1177  LLACIRNKNIPLD------RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  + +    L+          VT+R +L K++ T Y + E W++   + +G +YL   
Sbjct  106   LLRWLLDHGGKLEGGPGWLAGAIVTWRGHLTKLLTTPYEQQEGWQLAASRFQGTLYLSEV  165

Query  1015  KLPER-----PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P        +  L R   Y GY FE     D   S  D   +++ NV +C+V+++++G
Sbjct  166   ETPAARAQRLARPPLLRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLG  225

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
              HR+L   E+DC D R    +    YVELKTS+E+        F R KLLK+W QSFL G
Sbjct  226   NHRLLFSGEVDCTDPRAPSTQPPACYVELKTSKEMHRPGHWRSFYRHKLLKWWAQSFLLG  285

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             VP +V GFR+  G +   +   T E+ + V+  +  W   VC+ F    L +   TV ++
Sbjct  286   VPNVVAGFRNPEGFVCSLKTFPTMEMFEYVRNDRDGWNPSVCMNFCATFLSFAQNTVVQD  345

Query  502   EDYILQF  482
             +  ++  
Sbjct  346   DPRLVHL  352



>gb|KFA76337.1| hypothetical protein S40288_02978 [Stachybotrys chartarum IBT 
40288]
Length=378

 Score =   143 bits (361),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 101/337 (30%), Positives = 166/337 (49%), Gaps = 31/337 (9%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E+AC+S   +   + DD SL+ +    T  +G DL+EGF TF ++ D 
Sbjct  14    FAGASPPVKRPKEIACFSYDDEHKFHLDDSSLKYY---YTPQLGVDLSEGFKTFQKQDDS  70

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
               +    LL  I+       +    + VT+R  + KIMA  + + + +EM     +  ++
Sbjct  71    PDEHLDSLLKTIKAHEQETGKRIDANVVTWRGMMTKIMAAPFEQFDGFEMNATLYQDCIF  130

Query  1027  LD---VHKLPERPKSELDRRR--------CYWGYCFESLAT--EDPGRSDGDRIHD----  899
             ++    HK+  +      + R         +WGY FE+LAT  +    +  D I +    
Sbjct  131   IEENHAHKIASKAAEGQGKPRRGPPLEVMQFWGYKFETLATLPKPWAETSRDYIENRENE  190

Query  898   -IDANVEYCAVIKTKIGAHRILMGAEMDCC-DSR--DDGRRF-YVELKTSRELLDHRTEE  734
              ++   +YC+V++T I      +G E+D   DS+  + G    +VELKTS E+      E
Sbjct  191   IVNNKAQYCSVVRTGINKTVFCLGGEVDAIWDSKPLNKGSPINWVELKTSTEIRGQGDME  250

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK--SYWQGGV  560
              F R KL+K+WIQSFL GVP I+VGFR  +G LV  + + T+ I + V  +    W   +
Sbjct  251   AFHR-KLMKYWIQSFLLGVPKIIVGFRTRDGILVDIKEIETHTIPETVNSQPNPKWNADI  309

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ FA   L WL  T+ +   + +   P S  +E+ +
Sbjct  310   CVNFAASFLEWLATTINDEGVWRISRQPRSPTIEVYK  346



>gb|KEY69881.1| hypothetical protein S7711_06437 [Stachybotrys chartarum IBT 
7711]
 gb|KFA54816.1| hypothetical protein S40293_00815 [Stachybotrys chartarum IBT 
40293]
Length=378

 Score =   143 bits (361),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 101/337 (30%), Positives = 166/337 (49%), Gaps = 31/337 (9%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E+AC+S   +   + DD SL+ +    T  +G DL+EGF TF ++ D 
Sbjct  14    FAGASPPVKRPKEIACFSYDDEHKFHLDDSSLKYY---YTPQLGVDLSEGFKTFQKQDDS  70

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
               +    LL  I+       +    + VT+R  + KIMA  + + + +EM     +  ++
Sbjct  71    PDEHLDSLLKTIKAHEQETGKRIDANVVTWRGMMTKIMAAPFEQFDGFEMNATLYQDCIF  130

Query  1027  LD---VHKLPERPKSELDRRR--------CYWGYCFESLAT--EDPGRSDGDRIHD----  899
             ++    HK+  +      + R         +WGY FE+LAT  +    +  D I +    
Sbjct  131   IEENHAHKIASKAAEGQGKPRRGPPLEVMQFWGYKFETLATLPKPWAETSRDYIENRENE  190

Query  898   -IDANVEYCAVIKTKIGAHRILMGAEMDCC-DSR--DDGRRF-YVELKTSRELLDHRTEE  734
              ++   +YC+V++T I      +G E+D   DS+  + G    +VELKTS E+      E
Sbjct  191   IVNNKAQYCSVVRTGINKTVFCLGGEVDAIWDSKPLNKGSPINWVELKTSTEIRGQGDME  250

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK--SYWQGGV  560
              F R KL+K+WIQSFL GVP I+VGFR  +G LV  + + T+ I + V  +    W   +
Sbjct  251   AFHR-KLMKYWIQSFLLGVPKIIVGFRTRDGILVDIKEIETHTIPETVNSQPNPKWNADI  309

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ FA   L WL  T+ +   + +   P S  +E+ +
Sbjct  310   CVNFAASFLEWLATTINDEGVWRISRQPRSPTIEVYK  346



>gb|EGU79322.1| hypothetical protein FOXB_10151 [Fusarium oxysporum Fo5176]
Length=374

 Score =   143 bits (360),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 100/337 (30%), Positives = 164/337 (49%), Gaps = 31/337 (9%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E AC+S   + + + DD SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  13    FAGASQPVKRPKEFACFSYDDNHEFHLDDSSLKYY---YTPQLGADLSKGFDTFQKLDDT  69

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
             G      LL  I        +    + VT+R  + KIMA  + + +         +  ++
Sbjct  70    GDDHLDSLLKTIAAHEQETGKKIDANIVTWRGMMTKIMAAPFDQMDGKSTDKPTTQDCIF  129

Query  1027  LD---VHKLPERPKSELDRRR--------CYWGYCFESLATEDPGRSDGDRI-------H  902
             ++    +K+  R     ++RR         +WGY FE+L+T     ++  R         
Sbjct  130   IEENNAYKIASRSNEGNNKRRRGPPLEVMQFWGYKFETLSTLPAPWAETSRDFIENRENE  189

Query  901   DIDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRTEE  734
              ++   +YC+V++T IG   + +G E+D   DS+ + +     +VELKTS E+ +    E
Sbjct  190   AVNNKAQYCSVVRTGIGKSVLCLGGEVDAIWDSKPEEKGSPINWVELKTSAEIRNPGGME  249

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGV  560
              F+R KL+K+WIQSFL GVP IVVGFR  +G LV    + T+ I   V       W   +
Sbjct  250   NFKR-KLMKYWIQSFLLGVPRIVVGFRTQDGILVEAREMETHRIPDMVNADPNPKWNADM  308

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ FA   L WL   + +   + ++  P S  +EL +
Sbjct  309   CVNFAATFLEWLTENINDEGVWRIRREPQSPTIELFK  345



>ref|XP_007602653.1| hypothetical protein CFIO01_02455 [Colletotrichum fioriniae PJ7]
 gb|EXF73685.1| hypothetical protein CFIO01_02455 [Colletotrichum fioriniae PJ7]
Length=368

 Score =   142 bits (359),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 100/312 (32%), Positives = 160/312 (51%), Gaps = 34/312 (11%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             S  ++ P E AC+S   + D +  D SLR +       +G+DL++G+DTF +  D   + 
Sbjct  17    SQPVKRPKEFACFSYDDNHDFHLGDSSLRYY---YPPTLGADLSKGYDTFIKHDDSKPEH  73

Query  1186  FGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDV---H  1016
              G LL  I+       +      + +   IMA+ +   + +EM     +  +Y++    +
Sbjct  74    LGALLKTIKAHEEETGQ------KIDAQIIMASPFEDRDGFEMNATLYQDCIYIEENHEY  127

Query  1015  KLPERPKSELDRRRC--------YWGYCFESLAT------EDPGRSDGDR-IHDIDANVE  881
             K+  + +    +RR         +WGY FE+LAT      E P     +R +  ++   +
Sbjct  128   KVASQKQQNAQQRRGPIPPEVMQFWGYKFETLATLPNTWGETPREYIENRDVEVVNNKAQ  187

Query  880   YCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRTEEIFEREKL  713
             YC+V++T IG   I +G E+D   DS+   +     +VELKTS  + D R  + F R KL
Sbjct  188   YCSVVRTGIGQTVICIGGEVDAVWDSKPQKQGAPTNWVELKTSLAIRDDRDVDNFHR-KL  246

Query  712   LKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGVCLAFADE  539
             +KFWIQSFL GVP I+VGFR+ +G L   E + T +I   V+   K+ W G +C+ FA E
Sbjct  247   MKFWIQSFLLGVPKIIVGFRNRHGILTDVEEIETEKIPDTVQRRGKATWNGDMCVNFAAE  306

Query  538   VLCWLYGTVKEN  503
              L WL  T+ ++
Sbjct  307   FLVWLRQTINDD  318



>gb|KFA68221.1| hypothetical protein S40285_01551 [Stachybotrys chlorohalonata 
IBT 40285]
Length=375

 Score =   143 bits (360),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 101/337 (30%), Positives = 167/337 (50%), Gaps = 31/337 (9%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E+AC+S   +   + DD SL+ +    T  +G DL+EGF TF ++ D 
Sbjct  14    FAGASPPVKRPKEIACFSYDDEHKFHLDDSSLKYY---YTPQLGVDLSEGFKTFQKQDDS  70

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
               +    LL  I+     + +    + VT+R  + KIMA  + + + +EM     +  ++
Sbjct  71    PDEHLDSLLKTIKAHEQEIGKRIDANVVTWRGMMTKIMAAPFEQFDGFEMNATLYQDCIF  130

Query  1027  LD---VHKLPERPKSELDRRR--------CYWGYCFESLAT--EDPGRSDGDRIHD----  899
             ++    HK+  +      + R         +WGY FE+LAT  +    +  D I +    
Sbjct  131   IEENHAHKIASKAAEGQGKPRRGPPLEVMQFWGYKFETLATLPKPWAETSRDYIENRENE  190

Query  898   -IDANVEYCAVIKTKIGAHRILMGAEMDCC-DSR--DDGRRF-YVELKTSRELLDHRTEE  734
              ++   +YC+V++T I      +G E+D   DS+  + G    +VELKTS E+      E
Sbjct  191   IVNNKAQYCSVVRTGINKIVFCLGGEVDAIWDSKPLNKGSPINWVELKTSTEIRGQGDME  250

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK--SYWQGGV  560
              F R KL+K+WIQSFL GVP I+VGFR  +G LV  + + T+ I + V  +    W   +
Sbjct  251   AFHR-KLMKYWIQSFLLGVPKIIVGFRTRDGILVDIKEIETHTIPETVNSQPNPKWNADM  309

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ FA   L WL  T+ +   + +   P S  +E+ +
Sbjct  310   CVNFAAAFLEWLATTINDEGVWRISRQPRSPTIEVYK  346



>ref|XP_006738495.1| PREDICTED: decapping and exoribonuclease protein isoform X1 [Leptonychotes 
weddellii]
Length=443

 Score =   144 bits (363),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/307 (31%), Positives = 148/307 (48%), Gaps = 18/307 (6%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGS--DLNEGFDTFTEKRDLGSQ-GFGD  1178
             P EL C+S       + D ++LR +    T D G   DL +G+    + RD   Q G   
Sbjct  92    PSELGCFSLDAQRQYHGDAQALRYYSPPPTNDQGPHFDLRDGYPDRYQPRDEEVQEGLDH  151

Query  1177  LLACIRNKNIPLD------RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  + +    L+          VT+R +L K++ T Y + E W++   + +G +YL   
Sbjct  152   LLRWLLDHGGKLEGGPGWLAGAIVTWRGHLTKLLTTPYEQQEGWQLAASRFQGTLYLSEV  211

Query  1015  KLPER-----PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P        +  L R   Y GY FE     D   S  D   +++ NV +C+V+++++G
Sbjct  212   ETPAARAQRLARPPLLRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLG  271

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
              HR+L   E+DC D R    +    YVELKTS+E+        F R KLLK+W QSFL G
Sbjct  272   NHRLLFSGEVDCTDPRAPSTQPPACYVELKTSKEMHRPGHWRSFYRHKLLKWWAQSFLLG  331

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             VP +V GFR+  G +   +   T E+ + V+  +  W   VC+ F    L +   TV ++
Sbjct  332   VPNVVAGFRNPEGFVCSLKTFPTMEMFEYVRNDRDGWNPSVCMNFCATFLSFAQNTVVQD  391

Query  502   EDYILQF  482
             +  ++  
Sbjct  392   DPRLVHL  398



>ref|XP_009838523.1| hypothetical protein, variant 2 [Aphanomyces astaci]
 ref|XP_009838524.1| hypothetical protein, variant 3 [Aphanomyces astaci]
 gb|ETV72078.1| hypothetical protein, variant 2 [Aphanomyces astaci]
 gb|ETV72079.1| hypothetical protein, variant 3 [Aphanomyces astaci]
Length=274

 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 123/244 (50%), Gaps = 20/244 (8%)
 Frame = -2

Query  1147  PLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDV--HKLPERPKSELDRRR  974
             PL + H VTYRNNLNKIM T Y  N  + M + + +G VYL+V    +P    S    + 
Sbjct  36    PLPKYHVVTYRNNLNKIMGTPYNTNSAYTMQMQRIQGCVYLNVTLSHIPPSSFSSNQAQG  95

Query  973   CYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSR---  803
              Y G  +E L++   G              EYC V    +G  ++L+GAEMD   +    
Sbjct  96    AYAGRRYEVLSSAAVGGG------------EYCGVFSVSLGQKKLLIGAEMDGVTASKDD  143

Query  802   DDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTE  623
             DD    YVELKT R L   +    FER KLL FWIQS+L GVP I VGFR+++  L + +
Sbjct  144   DDDTTNYVELKTFRILNTPKDRFTFERYKLLAFWIQSYLVGVPTIRVGFRNESFILTKEQ  203

Query  622   RLRTNEITQRVKMKSYWQGGVCLAFADEVLCWLY-GTVKENEDYILQFTPHSNRLELLRG  446
                T ++ +      +W   VC+AF D VL W     ++E   Y +++ P +  + +   
Sbjct  204   AFETADLPRY--GDKHWHPSVCVAFTDLVLSWFVEQPLQEMAVYTVEYKPQTKCMTMSLS  261

Query  445   PSCP  434
              + P
Sbjct  262   TTPP  265



>ref|XP_003964681.1| PREDICTED: protein Dom3Z-like [Takifugu rubripes]
Length=411

 Score =   143 bits (360),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 107/365 (29%), Positives = 166/365 (45%), Gaps = 38/365 (10%)
 Frame = -2

Query  1477  NYPPRQNYGYGRGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYF  1298
             N  P+ +Y Y     P     +S  K     E   R     ++P E+  +S       + 
Sbjct  30    NRHPKTDYQYDSRQIPGRPECLSTRK-----ELYERNFPVYKQPAEVGSFSLDSKRRFFN  84

Query  1297  DDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLG-SQGFGDLLACI------------RN  1157
             D R +R + +L       DL +G+     KRD    +    LL  I              
Sbjct  85    DSRQIRYYAKL-DRRPNFDLTDGYRDRHVKRDESVKENLNHLLQWILANRAAVGSSQAAA  143

Query  1156  KNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYL-----DVHKLPERPKS  992
                P+D   FVT+R +L K++ T Y   E W + V K KG +Y+     +  +   + ++
Sbjct  144   SPCPID-TDFVTWRGHLTKLLTTPYENREGWLLAVTKFKGTLYVSEVETEAARTQRQTRT  202

Query  991   ELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCC  812
             E      YWGY FE     D  +S  +    ++ N  +CAV+KT++  HR+L   E+D  
Sbjct  203   EKHEEMMYWGYKFEQYMCADDAQSLPNPGGVVNTNEAFCAVVKTRLADHRLLFSGEVD--  260

Query  811   DSRDDGRRF------YVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRD  650
               RD   R       Y+ELKTS E+   +    F R KLLK+W QSFL GVP I+ GFR 
Sbjct  261   -GRDKDPRAPPPPECYIELKTSAEICTPKQRSNFHRFKLLKWWAQSFLLGVPRIIAGFRT  319

Query  649   DNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKENED---YILQF  482
              +G +V  E +  +EI+  +K  ++ W+  VC+ F    L ++  TV E++    Y+  +
Sbjct  320   HDGVVVDVETISVSEISHIIKAERNCWKPTVCMNFCCAFLSFVKRTVTEDDPSVVYLFSY  379

Query  481   TPHSN  467
              PH +
Sbjct  380   EPHGD  384



>gb|EWG47943.1| protein RAI1 [Fusarium verticillioides 7600]
Length=333

 Score =   141 bits (356),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 98/309 (32%), Positives = 157/309 (51%), Gaps = 31/309 (10%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E AC+S   + + + DD SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  23    FAGASQPVKRPKEFACFSYDDNHEFHLDDSSLKYY---YTPQLGADLSKGFDTFQKLDDT  79

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
             G      LL  I        +    + VT+R  + KIMA  + + + +EM     +G ++
Sbjct  80    GDDHLDSLLKTIAAHEQETGKKIDANVVTWRGMMTKIMAAPFDQMDGFEMNATLYQGCIF  139

Query  1027  LD---VHKLPERPKSELDRRR--------CYWGYCFESLATEDPGRSDGDR--IHD----  899
             ++    +K+  R     ++RR         +WGY FE+L+T     ++  R  I +    
Sbjct  140   IEENNAYKIASRSNEGNNKRRRGPPLEVMQFWGYKFETLSTLPAPWAETSRDFIENRENE  199

Query  898   -IDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRTEE  734
              ++   +YC+V++T IG   + +G E+D   DS+ + +     +VELKTS E+ +    E
Sbjct  200   VVNNKAQYCSVVRTGIGKSVLCLGGEVDAIWDSKPEEKGSPINWVELKTSAEIRNAGGME  259

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGV  560
              F+R KL+K+WIQSFL GVP IVVGFR  +G LV    + T+ I   V       W   +
Sbjct  260   NFKR-KLMKYWIQSFLLGVPRIVVGFRTQDGILVEAREMETHRIPDMVNADPNPKWNADM  318

Query  559   CLAFADEVL  533
             C+ FA   L
Sbjct  319   CVNFAATFL  327



>ref|XP_008728022.1| hypothetical protein G647_05469 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI23667.1| hypothetical protein G647_05469 [Cladophialophora carrionii CBS 
160.54]
Length=399

 Score =   142 bits (359),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 99/329 (30%), Positives = 155/329 (47%), Gaps = 34/329 (10%)
 Frame = -2

Query  1402  KFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFD  1223
             +FA     + R    I    E+  +S  +D     DD SLR +       +  DLN+GF+
Sbjct  14    RFASLHAAVRRPRACIANAAEITFFSFDEDHQFRHDDSSLRYY---YPPALPCDLNKGFE  70

Query  1222  TFTEKRDLGSQGFGDLLACI----RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMG  1055
             TF +  D G      LL  +    + K    D + FVT+R  + KIM   + + + WEM 
Sbjct  71    TFRQLDDSGDDHLDGLLEALIAHEKEKGSKTD-IDFVTWRGMMTKIMVAPFSKLDDWEMN  129

Query  1054  VHKRKGVVYLDVHKLPE------------RPKSELDRRRCYWGYCFESLATEDPGRSDGD  911
                 +G +YL+ +   +            RP +       +WGY FES++       +  
Sbjct  130   ATLFQGTIYLEENHTKKISSRQQQYSSAVRPGALSQDLMSFWGYKFESVSLMPTPWPETS  189

Query  910   RIH-------DIDANVEYCAVIKTKIGAHRILMGAEMDCCDS---RDDGRRF-YVELKTS  764
             R +        +    +YC++++T  G  ++++G E+D   +    D  R   +VELKT+
Sbjct  190   REYIESREDEPVSNYAQYCSIVRTGFGKVKMILGGEVDAVMAFKPEDKSRPIDWVELKTT  249

Query  763   RELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM  584
               + + + +  +ER KLLKFW QSFL GVP IVVG+R   G L R E L    I ++VK+
Sbjct  250   AIVTNEKEQIKYER-KLLKFWAQSFLLGVPRIVVGYRTQQGILERIEELDVQTIPEKVKL  308

Query  583   --KSYWQGGVCLAFADEVLCWLYGTVKEN  503
               K+ W G  C+ FA   L WL G +  +
Sbjct  309   KGKALWDGQTCINFAASFLEWLKGIITSD  337



>gb|EGE82944.1| HLA class III protein Dom3z [Blastomyces dermatitidis ATCC 18188]
Length=388

 Score =   142 bits (357),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 100/307 (33%), Positives = 156/307 (51%), Gaps = 32/307 (10%)
 Frame = -2

Query  1342  ELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACI  1163
             E+A +S     + + D+ SLR +    T  + +DLN+GFDTF +  D G +    LL  I
Sbjct  46    EIAYFSYDDQHNFHLDESSLRYY---YTPRLPADLNKGFDTFEQLDDTGDEHLDALLDTI  102

Query  1162  ---RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLD---VHKLPER  1001
                  K         +T+R  + KIM   +     +EM     +G ++++    +KL ++
Sbjct  103   IDMEKKTGTQCEADIITWRGMMTKIMTAPFDNMNGFEMNATCYQGSIFIEENNAYKLAQK  162

Query  1000  ---------PKSELDRRRCYWGYCFESLATEDPG-------RSDGDRIHDIDANVEYCAV  869
                      P         +WGY FE+L+  D         + +G     ++   +YC+V
Sbjct  163   QSQRNQKMPPGVPSQDMMAFWGYKFETLSLLDQPWDATPREKIEGREDQVVNNKAQYCSV  222

Query  868   IKTKIGAHRILMGAEMDCC-DSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFW  701
             ++T IG  +I++G E+D   DS+ + +     +VELKTS E+ + R    +ER KLLKFW
Sbjct  223   VRTGIGGCKIVLGGEVDAVWDSKPERKEDPINWVELKTSAEIRNDRDMFKYER-KLLKFW  281

Query  700   IQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRV--KMKSYWQGGVCLAFADEVLCW  527
              QSFL GVP I+VGFRD++G L R E + T +I   V  K K  W G VC+ F  ++L W
Sbjct  282   AQSFLLGVPKIIVGFRDEHGILRRLEEMATRDIPGLVSRKGKGTWDGNVCINFTAKLLEW  341

Query  526   LYGTVKE  506
             L   +K+
Sbjct  342   LKLVIKD  348



>ref|XP_002504149.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65407.1| predicted protein [Micromonas sp. RCC299]
Length=791

 Score =   146 bits (369),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 105/317 (33%), Positives = 149/317 (47%), Gaps = 28/317 (9%)
 Frame = -2

Query  1426  DERFVSELKFAKSEETL----ARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLIT  1259
             D+R+++ L     EE L      ++   +EP ELA +S+ ++    +D   L   KR + 
Sbjct  3     DQRWLAPLSV--REEPLPDGQVPRAAPYREPVELASFSKSREVPNIYDRSRL---KRYVH  57

Query  1258  EDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIRNKNIP------LDRMHFVTYRNNLNKI  1097
               +  DL+EG  TF + RD        L+    +  +       L     VT+R N  KI
Sbjct  58    PSVPFDLSEGHATFLD-RDRNVPRPASLVPIFESLRVAGLDERELAAADVVTWRGNFAKI  116

Query  1096  MATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRR-----RCYWGYCFESLATED  932
             + T +   + W M      GV  L+V + P     E  R+       YWGY FE   T  
Sbjct  117   LGTPWNARDAWHMEAELVHGVAVLNVLEPPASLARESQRQGRDALMAYWGYSFEEACT--  174

Query  931   PGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELL  752
                  G     ID    +CAV++T +G HR++MG E+DC D    G   YVELKT+R + 
Sbjct  175   ----GGMYDEPIDCLDAFCAVVRTGVGRHRLIMGGEVDCWDGERTGLAGYVELKTTRVMD  230

Query  751   DHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQ-RVKMKSY  575
             +      FER+KLLK+W QSF  GV  IVVGFRDD G   + + L T ++     +    
Sbjct  231   NPSQVARFERDKLLKWWAQSFPIGVRRIVVGFRDDAGFCRKLQTLETLKLPGYAARHPRA  290

Query  574   WQGGVCLAFADEVLCWL  524
             W     L FAD +L WL
Sbjct  291   WDPKTALRFADRLLTWL  307



>ref|XP_004415323.1| PREDICTED: protein Dom3Z [Odobenus rosmarus divergens]
Length=397

 Score =   142 bits (357),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 94/307 (31%), Positives = 148/307 (48%), Gaps = 18/307 (6%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGS--DLNEGFDTFTEKRDLGSQ-GFGD  1178
             P EL C+S       + D ++LR +    T D G   DL +G+    + RD   Q G   
Sbjct  46    PSELGCFSLDAQRQYHGDAQALRYYSPPPTNDQGPHFDLRDGYPDRYQPRDEEVQEGLDH  105

Query  1177  LLACIRNKNIPLD------RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  + +    L+          VT+R +L K++ T Y + E W++   + +G +YL   
Sbjct  106   LLRWLLDHRGKLEGGPGWLAGAIVTWRGHLTKLLTTPYEQQEGWQLAASRFQGTLYLSEV  165

Query  1015  KLPER-----PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P        +  L R   Y GY FE     D   S  D   +++ NV +C+V+++++G
Sbjct  166   ETPAARAQRLARPPLLRELMYMGYKFEQYMCADKPGSFPDPSGEVNTNVAFCSVLRSRLG  225

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
              HR+L   E+DC D R    +    YVELKTS+E+        F R KLLK+W QSFL G
Sbjct  226   NHRLLFSGEVDCTDPRAPSTQPPACYVELKTSKEMHRPGHWRSFYRHKLLKWWAQSFLLG  285

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             VP +V GFR+  G +   +   T E+ + V+  +  W   VC+ F    L +   TV ++
Sbjct  286   VPNVVAGFRNPEGFVCSLKTFPTMEMFEYVRNDRDGWNPSVCMNFCAAFLSFAQNTVVQD  345

Query  502   EDYILQF  482
             +  ++  
Sbjct  346   DPRLVHL  352



>dbj|GAM40798.1| hypothetical protein TCE0_041r13421 [Talaromyces cellulolyticus]
Length=371

 Score =   141 bits (356),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 97/317 (31%), Positives = 156/317 (49%), Gaps = 37/317 (12%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             + AI+ P E+A +S   + +   D  SL+ +    +  +  DL+ GFDTF +  D   + 
Sbjct  18    NAAIRRPREIAYFSYDDEHNFRLDGSSLKYYYPPQSSQLPLDLSAGFDTFQKLNDAPDEH  77

Query  1186  FGDLLACIRNKNIPLDR-------MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
                LL  I    + L++          VT+R  + KIM   +     +EM     +G ++
Sbjct  78    LDALLDTI----VALEQNTEKKCEADIVTWRGMMTKIMTAPFDMLNGFEMNATYFQGTIF  133

Query  1027  LDVHKLPERPKSELDRRR------------CYWGYCFESLAT------EDPGRSDGDRIH  902
             ++ +   +  + E+ R +             YWGY FE+++       E        RIH
Sbjct  134   IEENNSYKNAQKEIQRNQRMPPGMPSQDMMAYWGYKFEAVSVLSNTWGETSREKIEGRIH  193

Query  901   DIDAN-VEYCAVIKTKIGAHRILMGAEMD----CCDSRDDGRRFYVELKTSRELLDHRTE  737
             ++  N  +YC+V++T  G  ++++G E+D    C   R +    +VELKT+ EL + + +
Sbjct  194   EVVNNKAQYCSVVRTGFGKAKLVIGGEVDAIWDCKPVRKEDPINWVELKTTAELFNDKEK  253

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGG  563
               +ER KLLKFW QSFL GVP IVVGFRD +G L+R E L T  +  +VK   +  W G 
Sbjct  254   LKYER-KLLKFWAQSFLLGVPKIVVGFRDRDGMLLRLEELETQGLPGKVKREGRGSWDGN  312

Query  562   VCLAFADEVLCWLYGTV  512
             +C+ F    L WL   +
Sbjct  313   ICINFTAAFLEWLQTVI  329



>ref|XP_001621771.1| hypothetical protein NEMVEDRAFT_v1g143699 [Nematostella vectensis]
 gb|EDO29671.1| predicted protein [Nematostella vectensis]
Length=356

 Score =   140 bits (354),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 98/324 (30%), Positives = 159/324 (49%), Gaps = 35/324 (11%)
 Frame = -2

Query  1357  IQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGD  1178
              ++P E+  +S   D D  F D S +L       +I  DL+EG+  F  + +   +G G 
Sbjct  8     FRKPSEIGHFSL--DVDRKFHDDSHQLKYFCPPHEIHFDLSEGYKEFKARDEDVKEGLGH  65

Query  1177  LLACI---RNK-NIPLDR------------------MHFVTYRNNLNKIMATAYIRNEPW  1064
             LL  I   R K  +P +                    +FVT+R +L K++ T Y   EPW
Sbjct  66    LLEWISAHREKFALPGEERVENGQAADARPATKSLNTNFVTWRGHLTKLLCTPYETKEPW  125

Query  1063  EMGVHKRKGVVYL---DVHKLPERPKSELDRRR--CYWGYCFESLATEDPGRSDGDRIHD  899
             +M     KG +YL   +  +  +R K+  +R +  CYWG+ FE+  T+      G R   
Sbjct  126   QMAATLFKGTIYLSEVETQEAYDRRKNMEERHKEMCYWGHKFETYVTKLVSER-GKRETP  184

Query  898   IDANVEYCAVIKTKIGAHRILMGAEMDCCDSR-DDGRRFYVELKTSRELLDHRTEEIFER  722
             ++ +  Y +V+++++  H ++ GAE+DCC    ++    Y+ELKTS    +H+    F R
Sbjct  185   VNNSEAYVSVVRSRLERHSLVFGAEIDCCTKETEESPGNYIELKTSHAPHNHQQHWSFNR  244

Query  721   EKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVK-MKSYWQGGVCLAFA  545
              KLLK+W QS+LAGVP I+ GFR  +  + + +   T EI   ++  ++ W   +C  F 
Sbjct  245   YKLLKWWAQSYLAGVPKIIAGFRHHHSHVDKLQTYNTLEIPHLLENQQNMWDSTICFNFL  304

Query  544   DEVLCWLYGTV---KENEDYILQF  482
             ++ L WL   V     N  Y+  F
Sbjct  305   EKFLRWLRSVVVLDDPNRVYLFSF  328



>ref|XP_008383039.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
isoform X4 [Malus domestica]
Length=125

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 72/81 (89%), Gaps = 1/81 (1%)
 Frame = -2

Query  934  DPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSREL  755
            DPGR DG  IH++DANVEYC+VIKTK+GAHRILMGAEMDCCDS DDGRRFYVELKTS EL
Sbjct  46   DPGRGDGP-IHNVDANVEYCSVIKTKLGAHRILMGAEMDCCDSTDDGRRFYVELKTSHEL  104

Query  754  LDHRTEEIFEREKLLKFWIQS  692
             +H+ E  FE+EKLLKFWI++
Sbjct  105  DNHKIEYEFEKEKLLKFWIKA  125



>gb|KFX94110.1| hypothetical protein V490_04517 [Pseudogymnoascus pannorum VKM 
F-3557]
 gb|KFY58184.1| hypothetical protein V497_04998 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=384

 Score =   141 bits (355),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 105/324 (32%), Positives = 158/324 (49%), Gaps = 50/324 (15%)
 Frame = -2

Query  1375  ARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLG  1196
             A  S  ++ P E+AC+S     +   DD  LR +       +G+DL +GF++F +  D  
Sbjct  17    AGTSAPMKRPREIACFSYTNTHEYRPDDSGLRYY---YPPRLGADLCKGFESFEKLDDTP  73

Query  1195  SQGFGDLLACI------RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGV  1034
                   LL  I      R + + +D    VT+R  + K++A+ +   + +EM     +G 
Sbjct  74    DDHLDALLKTIMGVERERGEKVDVD---VVTWRGMMTKLLASPFSDRDGFEMNATFYQGT  130

Query  1033  VYLD---------------VHKLPERPKSELDRRRCYWGYCFESLA----TEDP------  929
             +Y++                   P RP  ++     YWGY FE+L     T D       
Sbjct  131   IYIEENHEYKVASQARQSRTQTAPGRPTQDM---MSYWGYKFETLCLLPDTWDATSREYI  187

Query  928   -GRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRDDG---RRFYVELKTS  764
              GR D      ++ + +YC++++T IG   +++G E+D   DS+      +  +VELKTS
Sbjct  188   EGRED----QIVNNSAQYCSIVQTGIGNTSLIIGGEVDAVWDSKPTPPTPQTNWVELKTS  243

Query  763   RELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM  584
              +    R  + FER KLLKFW+QSFL GVP I+VGFRD  GRL R E L T +I   VK 
Sbjct  244   LDPSSPRDLQAFER-KLLKFWLQSFLLGVPKIIVGFRDHAGRLRRLEELETAKIPGIVKK  302

Query  583   KSYWQGGVCLAFADEVLCWLYGTV  512
             +  W G V + F   VL +L G V
Sbjct  303   RGGWDGNVAVNFGAGVLDFLKGVV  326



>gb|EPE04225.1| protein rai1 [Ophiostoma piceae UAMH 11346]
Length=391

 Score =   141 bits (356),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 109/328 (33%), Positives = 160/328 (49%), Gaps = 57/328 (17%)
 Frame = -2

Query  1369  KSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQ  1190
             +S  ++ P E  C+S      ++ DDRSLR +     ++  +DL+ GF+TF +  D G +
Sbjct  15    QSQPVRRPKEFTCFSYDGTHTLHLDDRSLRWY--YPPQEPNADLSRGFETFDKHDDSGDE  72

Query  1189  GFGDLLACI----RNKNIPLDRMHFVTYRNNLNK-IMATAYIRNEPWEMGVHKRKGVVYL  1025
                 LL  I    +     +D    VT+R  + K IMAT Y            R G +  
Sbjct  73    HLDSLLEAITAHEQTTQAKID-AQVVTWRGMMTKVIMATPY----------DDRDGYIE-  120

Query  1024  DVHKLPERPKSELDRRR-------------------CYWGYCFESLAT--EDPGRSDGDR  908
             + H+     + E + R+                    +WGY FE+L+T     G    D+
Sbjct  121   ENHEYKAASRREQEARQNRPPPRPHPDRPWFPPDVMSFWGYKFETLSTLPRPWGEMTRDQ  180

Query  907   IH-----DIDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRD--DGRRF-YVELKTSREL  755
             I       +    +YC+V++T IG++ + +G E+D   DS+    G+   +VELKTS+++
Sbjct  181   IEGRGAETVSNKAQYCSVVRTGIGSNILCLGGEVDAVWDSKPAVPGKPIRWVELKTSQDI  240

Query  754   LDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSY  575
                R  E FER KLLKFWIQSFL GVP IVVGFR  +GRLVR E + T  I   VKM++ 
Sbjct  241   QSPRDLEFFER-KLLKFWIQSFLLGVPTIVVGFRSRHGRLVRLEEISTETIPGNVKMRAA  299

Query  574   -------WQGGVCLAFADEVLCWLYGTV  512
                    W G  C+ FA   + WL  T+
Sbjct  300   SSNSPVPWDGDTCINFAAAFMDWLRATM  327



>ref|XP_009847658.1| hypothetical protein NEUTE1DRAFT_119557 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO60362.1| hypothetical protein NEUTE1DRAFT_119557 [Neurospora tetrasperma 
FGSC 2508]
Length=358

 Score =   140 bits (354),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 104/327 (32%), Positives = 158/327 (48%), Gaps = 35/327 (11%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A KS  ++ P E AC+S   D   +   +SL+ +    T D+  DL++GF++F +  D 
Sbjct  13    FAGKSELVKRPKEFACFSYDADHKFHLGAQSLKWY---YTPDLNVDLSKGFESFIKHDDS  69

Query  1198  GSQGFGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDV  1019
               +    LL  I +            Y    +K +    I   P++      +   Y   
Sbjct  70    VDEHLDSLLTTIAD------------YEQKTSKPIDAHIIMAAPFDDDGFIEENHAYKQA  117

Query  1018  HKLPERPKSELDRRRC--YWGYCFESLAT--EDPGRSDGDRI-----HDIDANVEYCAVI  866
              +  ERP +    +    YWGY FE+L+T     G++  D I     H ++   +YC+V+
Sbjct  118   SRANERPWNGPIPQEVMQYWGYKFETLSTLPRPWGQTSRDFIESRPDHVVNNKEQYCSVV  177

Query  865   KTKIGAHRILMGAEMDCCDSRDDGRRF------YVELKTSRELLDHRTEEIFEREKLLKF  704
             +T IG   + +G E+D     DD  R       +VELKTS  + + R    FER KL+KF
Sbjct  178   RTGIGKTILCIGGEVDAI--WDDKPRTQGDPINWVELKTSAVIQNERQANNFER-KLMKF  234

Query  703   WIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGVCLAFADEVLC  530
             WIQSFL GVP I+VGFR  +G LV T+  RT EI   VK   +  W G  C+ FA+  L 
Sbjct  235   WIQSFLLGVPKIIVGFRTQDGLLVETKEFRTMEIPLMVKKNGRPKWDGDTCVNFANGFLE  294

Query  529   WLYGTVKENEDYILQFTPHSNRLELLR  449
             WL  T+ +   + ++  P S  +E+ +
Sbjct  295   WLRHTITDEGVWRIKRRPRSAEIEVFK  321



>ref|XP_001416237.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94530.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=547

 Score =   143 bits (361),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 115/343 (34%), Positives = 177/343 (52%), Gaps = 34/343 (10%)
 Frame = -2

Query  1393  KSEETLARKSTAIQEPCELACYSRVQDGDVY-FDDRSLRLFKRLITEDIGSDLNEGFDTF  1217
             +S +  A ++   +EP E    S+ +D  +  +D  +LR   R +    G+DLN+GF TF
Sbjct  50    RSLDAAAVRAPKYEEPLECGQVSKRRDERLTTYDATNLRRL-RGVNAGAGADLNQGFGTF  108

Query  1216  TEK--RDLGSQG----FGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMG  1055
              ++  R++        FG + A  + K   L+ +  +T+R N++K++ TA+  +E W M 
Sbjct  109   RDRDRREIYPAPVHVIFGAIEASGQTK--VLEDVDVITWRGNMSKLLTTAWNVSEAWTME  166

Query  1054  ---VHKRKGVVYLDVHKLPERPKSEL-----DRRRCYWGYCFESLA-TEDPGRSDGDRIH  902
                V+ R   + L+V +  E  +  L     D R CYWGY FE  A +E P         
Sbjct  167   AELVNNR--TIVLNVKETEEGLRKALTRDGRDERMCYWGYAFEEAACSEKPFE------E  218

Query  901   DIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFER  722
              +D    +C V+KTK+G   +LM  E+DC +  D     YVELKTSR + D R  + FE+
Sbjct  219   PVDCMECFCCVVKTKMGDLNVLMAGEVDCFEG-DAELANYVELKTSRVMNDERQVKRFEK  277

Query  721   EKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQR-VKMKSYWQGGVCLAFA  545
             EKLLK+W QSF  GV  I+VGFRDD+GR+V+T+ L T ++    VK  + W     L  A
Sbjct  278   EKLLKWWAQSFALGVRRIMVGFRDDHGRVVKTQMLETLKLPGYVVKHANSWTPKDALRCA  337

Query  544   DEVLCWLYGTVKENEDYI---LQFTPH--SNRLELLRGPSCPD  431
               VL  L   + +        +++ P    +R+  +R  S PD
Sbjct  338   SAVLTKLKELLADEPSGTRVRVEYEPKKAKHRVNFIRDDSIPD  380



>gb|EGZ75663.1| RAI1-domain-containing protein, partial [Neurospora tetrasperma 
FGSC 2509]
Length=370

 Score =   140 bits (354),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 106/338 (31%), Positives = 166/338 (49%), Gaps = 45/338 (13%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A KS  ++ P E AC+S   D   +   +SL+ +    T D+  DL++GF++F +  D 
Sbjct  13    FAGKSELVKRPKEFACFSYDADHKFHLGAQSLKWY---YTPDLNVDLSKGFESFIKHDDS  69

Query  1198  GSQGFGDLLACI----RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVV  1031
               +    LL  I    +  + P+D             I+  A   ++ +EM     +G +
Sbjct  70    VDEHLDSLLTTIADYEQKTSKPIDA-----------HIIMAAPFDDDGFEMNATLYRGCI  118

Query  1030  YLD-------VHKLPERPKSELDRRRC--YWGYCFESLAT--EDPGRSDGDRI-----HD  899
             +++         +  ERP +    +    YWGY FE+L+T     G++  D I     H 
Sbjct  119   FIEENHAYKQASRANERPWNGPIPQEVMQYWGYKFETLSTLPRPWGQTSRDFIESRPDHV  178

Query  898   IDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRF------YVELKTSRELLDHRTE  737
             ++   +YC+V++T IG   + +G E+D     DD  R       +VELKTS  + + R  
Sbjct  179   VNNKEQYCSVVRTGIGKTILCIGGEVDAI--WDDKPRTQGDPINWVELKTSAVIQNERQA  236

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGG  563
               FER KL+KFWIQSFL GVP I+VGFR  +G LV T+  RT EI   VK   +  W G 
Sbjct  237   NNFER-KLMKFWIQSFLLGVPKIIVGFRTQDGLLVETKEFRTMEIPLMVKKNGRPKWDGD  295

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
              C+ FA+  L WL  T+ +   + ++  P S  +E+ +
Sbjct  296   TCVNFANGFLEWLRHTITDEGVWRIKRRPRSAEIEVFK  333



>ref|XP_008710087.1| PREDICTED: decapping and exoribonuclease protein isoform X1 [Ursus 
maritimus]
Length=397

 Score =   141 bits (355),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 94/307 (31%), Positives = 149/307 (49%), Gaps = 18/307 (6%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGS--DLNEGFDTFTEKRDLGSQGFGD-  1178
             P EL C+S       + D ++LR +    T D G   DL +G+    + RD   Q   D 
Sbjct  46    PSELGCFSLDAQRQYHGDAQALRYYSPPPTNDQGPNFDLRDGYPDRYQPRDEEVQERLDH  105

Query  1177  LLACIRNKNIPLD------RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  + +    L+          VT+R +L K++ T Y + E W++   + +G +YL   
Sbjct  106   LLRWLLDHRGKLEGGPGWLAGAIVTWRGHLTKLLTTPYEQQEGWQLAASRFQGTLYLSEV  165

Query  1015  KLPER-----PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P        +  L R   Y GY FE     D   S  D   +++ NV +C+V+++++G
Sbjct  166   ETPAARAQRLARPPLLRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLG  225

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
             +HR+L   E+DC D R    +    YVELKTS+E+        F R KLLK+W QSFL G
Sbjct  226   SHRLLFSGEVDCTDPRAASTQPPACYVELKTSKEMHRPGHWRSFYRHKLLKWWAQSFLLG  285

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             VP +V GFR+  G +   +   T E+ + V+  +  W   VC+ F    L +   TV ++
Sbjct  286   VPNVVAGFRNPEGFVCSLKTFPTMEMFEYVRNDRDGWNPSVCMNFCAAFLSFAQNTVVQD  345

Query  502   EDYILQF  482
             +  ++  
Sbjct  346   DPRLVHL  352



>sp|Q4I613.3|DXO_GIBZE RecName: Full=Decapping nuclease RAI1 [Fusarium graminearum PH-1]
Length=368

 Score =   140 bits (353),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 106/336 (32%), Positives = 166/336 (49%), Gaps = 35/336 (10%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A +S  ++ P E AC+S   + +   D  SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  13    FAGESQPVKRPKEFACFSYDDNHEFRLDGSSLKYY---YTPQLGADLSKGFDTFQKLDDT  69

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
             G      LL  I        +    + VT+R  + KIMAT +   + +EM     +   Y
Sbjct  70    GDDHLDSLLKTIVAHEQETGKKIDANVVTWRGMMTKIMATPFDNMDGFEMNATLYQNNAY  129

Query  1027  LDVHK--------LPERPKSELDRRRCYWGYCFESLAT------EDPGRSDGDRIHDIDA  890
                 +            P  E+ +   +WGY FE+L+T      E P     +R +++  
Sbjct  130   KVASRSNEGNNNRRRRGPPLEVMQ---FWGYKFETLSTLPAPWAETPREFIENRENEVVN  186

Query  889   N-VEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRTEEIFE  725
             N  +YC+V++T IG   + +G E+D   DS+ + +     +VELKTS E+ +    E F 
Sbjct  187   NKAQYCSVVRTGIGKSVLCLGGEVDAIWDSKPEEKGSPINWVELKTSAEIRNTGDMENFN  246

Query  724   REKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSY----WQGGVC  557
             R KL+K+WIQSFL GVP IVVGFR  +G LV  + + T+ I + V   SY    W   +C
Sbjct  247   R-KLMKYWIQSFLLGVPRIVVGFRTRDGILVEAKDIETHRIPETV--NSYPNPKWNADMC  303

Query  556   LAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             + FA   L WL   + +   + ++  P S  +EL +
Sbjct  304   VNFAATFLDWLSANITDEGVWRIKREPQSPTIELFK  339



>gb|EFB21207.1| hypothetical protein PANDA_019916 [Ailuropoda melanoleuca]
Length=396

 Score =   140 bits (354),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 94/307 (31%), Positives = 149/307 (49%), Gaps = 18/307 (6%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGS--DLNEGFDTFTEKRDLGSQGFGD-  1178
             P EL C+S       + D ++LR +    T D G   DL +G+    + RD   Q   D 
Sbjct  46    PSELGCFSLDAQRQYHGDAQALRYYSPPPTNDQGPNFDLRDGYPDRYQPRDEEVQERLDH  105

Query  1177  LLACIRNKNIPLD------RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  + +    L+          VT+R +L K++ T Y + E W++   + +G +YL   
Sbjct  106   LLRWLLDHRGKLEGGPGWLAGAIVTWRGHLTKLLTTPYEQQEGWQLAASRFQGTLYLSEV  165

Query  1015  KLPER-----PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P        +  L R   Y GY FE     D   S  D   +++ NV +C+V+++++G
Sbjct  166   ETPAARAQRLARPPLLRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLG  225

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
             +HR+L   E+DC D R    +    YVELKTS+E+        F R KLLK+W QSFL G
Sbjct  226   SHRLLFSGEVDCTDPRAASTQPPACYVELKTSKEMHRPGHWRSFYRHKLLKWWAQSFLLG  285

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             VP +V GFR+  G +   +   T E+ + V+  +  W   VC+ F    L +   TV ++
Sbjct  286   VPNVVAGFRNPEGFVCSLKTFPTMEMFEYVRNDRDGWNPSVCMNFCAAFLSFAQNTVVQD  345

Query  502   EDYILQF  482
             +  ++  
Sbjct  346   DPRLVHL  352



>ref|XP_002929678.1| PREDICTED: protein Dom3Z-like [Ailuropoda melanoleuca]
Length=397

 Score =   140 bits (354),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 94/307 (31%), Positives = 149/307 (49%), Gaps = 18/307 (6%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGS--DLNEGFDTFTEKRDLGSQGFGD-  1178
             P EL C+S       + D ++LR +    T D G   DL +G+    + RD   Q   D 
Sbjct  46    PSELGCFSLDAQRQYHGDAQALRYYSPPPTNDQGPNFDLRDGYPDRYQPRDEEVQERLDH  105

Query  1177  LLACIRNKNIPLD------RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  + +    L+          VT+R +L K++ T Y + E W++   + +G +YL   
Sbjct  106   LLRWLLDHRGKLEGGPGWLAGAIVTWRGHLTKLLTTPYEQQEGWQLAASRFQGTLYLSEV  165

Query  1015  KLPER-----PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P        +  L R   Y GY FE     D   S  D   +++ NV +C+V+++++G
Sbjct  166   ETPAARAQRLARPPLLRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLG  225

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
             +HR+L   E+DC D R    +    YVELKTS+E+        F R KLLK+W QSFL G
Sbjct  226   SHRLLFSGEVDCTDPRAASTQPPACYVELKTSKEMHRPGHWRSFYRHKLLKWWAQSFLLG  285

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             VP +V GFR+  G +   +   T E+ + V+  +  W   VC+ F    L +   TV ++
Sbjct  286   VPNVVAGFRNPEGFVCSLKTFPTMEMFEYVRNDRDGWNPSVCMNFCAAFLSFAQNTVVQD  345

Query  502   EDYILQF  482
             +  ++  
Sbjct  346   DPRLVHL  352



>emb|CDO74212.1| hypothetical protein BN946_scf185043.g264 [Trametes cinnabarina]
Length=461

 Score =   142 bits (357),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 104/324 (32%), Positives = 160/324 (49%), Gaps = 30/324 (9%)
 Frame = -2

Query  1405  LKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGF  1226
             L++  +      K    Q+P  L  +S      + F + +LR +   I    G+DL  G+
Sbjct  42    LRYPPTNSAQVIKPVPFQQPTALLTFSYTPQRVLEFTNSALRYY---IDPPPGADLRYGY  98

Query  1225  DTFTEKRDLGSQGFGDLLACIR------------NKNIPLDRMHFVTYRNNLNKIMATAY  1082
             + + ++ +  ++  G L A  R            + +  L  +  VT+R  + KI+   Y
Sbjct  99    ERWIKRPEERTRLDGLLRAIKRVMQKADASAGPGSGSKWLQDIAVVTWRGIMTKILTAPY  158

Query  1081  IRNEPWEMGVHKRKGVVYLDVHKLPERPKSELD-----RRRCYWGYCFESLATED----P  929
                +  E+ V    G +Y++ H    R   + D     R + Y+GY FES  T      P
Sbjct  159   EERDRCELNVMYVNGTLYIEEHLSDARLLEKEDLAPKQRVQSYYGYSFESWCTSSRPGVP  218

Query  928   GRSDGDRIH---DIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRR-FYVELKTSR  761
              R +G  +    D+D NV++C+VIKTK+G  R+++G E+DC   R DGR   +VELKTS 
Sbjct  219   ERMEGHPVGWGGDVDTNVQWCSVIKTKLGDDRLIIGGEVDCVRERFDGRTDTFVELKTSM  278

Query  760   ELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK  581
              + +   E  FE+ KLLKF++QSFL GVP IVVGFR   GRL  T+  +T +I + V+ K
Sbjct  279   SIRNAGDEARFEK-KLLKFYMQSFLLGVPEIVVGFRTPAGRLTTTQTFKTVQIPRLVRGK  337

Query  580   -SYWQGGVCLAFADEVLCWLYGTV  512
                W   VC ++    L  L   V
Sbjct  338   PGAWDPQVCFSWGHHFLTTLKSIV  361



>ref|XP_005339021.1| PREDICTED: decapping and exoribonuclease protein [Ictidomys tridecemlineatus]
Length=397

 Score =   140 bits (354),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 90/307 (29%), Positives = 145/307 (47%), Gaps = 18/307 (6%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGS--DLNEGF-DTFTEKRDLGSQGFGD  1178
             P EL C+S       + D R+LR +    T   G   DL +G+ D +  + +   +G   
Sbjct  46    PSELGCFSLDAQRQYHGDARALRYYSPPPTNGPGPEFDLRDGYPDRYLPRDEEVREGLDH  105

Query  1177  LLACIRNKNIPLD------RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  +      L+          VT+R +L K++ T Y R E W++   + +G +YL   
Sbjct  106   LLRWLLEHRGQLEGGPGWLAGAIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEV  165

Query  1015  KLPER-----PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P        +  L R   Y GY FE     D      D   +++ NV +C+V+++++G
Sbjct  166   ETPAARAQRLARPPLLRELMYMGYKFEQYMCADKPGGSPDPSGEVNTNVAFCSVLRSRLG  225

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
              H +L   E+DC D +    +    YVELKTS+E+        F R KLLK+W QSFL G
Sbjct  226   NHPLLFSGEVDCTDPQAPSTQPPTCYVELKTSKEMYSPGQWRSFYRHKLLKWWAQSFLPG  285

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             VP +V GFR+  G +   +   T E+ + V+  +  W   VC+ F    L +   TV ++
Sbjct  286   VPKVVAGFRNPEGFVCSLKTFPTMEMFEHVRNDRDGWNPSVCMNFCAAFLSFAQSTVVQD  345

Query  502   EDYILQF  482
             +  ++  
Sbjct  346   DSRLVHL  352



>ref|XP_007557390.1| PREDICTED: decapping and exoribonuclease protein [Poecilia formosa]
Length=421

 Score =   141 bits (355),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 104/363 (29%), Positives = 167/363 (46%), Gaps = 35/363 (10%)
 Frame = -2

Query  1477  NYPPRQNYGYGRGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYF  1298
             N+   Q+    R   PR +        +   E   R     ++P E+ C+S       + 
Sbjct  41    NHHLHQSSATPRQTPPRSQ------TLSTRREAYERDFPLYKQPVEVGCFSLDSRRRFFN  94

Query  1297  DDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLG-SQGFGDLLACI------------RN  1157
             D R +R +          DL +G+     KRD    +    +L  I             N
Sbjct  95    DSRQMRYYVE-PERSPNFDLRDGYKERYVKRDENVKEKLDHILRWIIANRSKLTSKLTTN  153

Query  1156  KNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYL-----DVHKLPERPKS  992
              + PLD   FVT+R +L K++ T Y   E W + V +  G +Y+     +  +     + 
Sbjct  154   ASCPLD-FDFVTWRGHLTKLLTTPYETREGWLLAVTRFNGTLYISEVETEAARRERENRP  212

Query  991   ELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCC  812
             E ++   YWGY FE     D   S+ D    ++ N  +C V++T++  H++L   E+DC 
Sbjct  213   ERNKEMMYWGYKFEQYMCADDTNSEPDPSGVVNTNEAFCTVVQTRLTDHKLLFSGEVDCR  272

Query  811   DSRDDGR----RFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDN  644
             D RD G       YVELKTS E+   +    F R KLLK+W QSFL GVP +V GFRD +
Sbjct  273   D-RDPGAPPPPACYVELKTSAEICTPKQRSNFHRFKLLKWWAQSFLPGVPRVVAGFRDHD  331

Query  643   GRLVRTERLRTNEITQRVKMK-SYWQGGVCLAFADEVLCWLYGTVKENED---YILQFTP  476
             G +V  E  + ++I+Q +K + + W+  VC+ F  + L ++     E+     Y+  + P
Sbjct  332   GTVVSVETFQISKISQLIKNEYNCWKPTVCMNFCCDFLSFVKREATEDNPSVVYLFSWEP  391

Query  475   HSN  467
             H++
Sbjct  392   HND  394



>ref|XP_006696508.1| hypothetical protein CTHT_0061920 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS18177.1| hypothetical protein CTHT_0061920 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=396

 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 106/332 (32%), Positives = 163/332 (49%), Gaps = 35/332 (11%)
 Frame = -2

Query  1357  IQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGD  1178
             ++ P E  C+S  ++   +  DRSL+ F       I SDL+ G+  +    D   +    
Sbjct  20    VKRPREFTCFSYDRERRFHLGDRSLKWF---YPAYIPSDLSRGYQNWQRHDDSIDEHLDG  76

Query  1177  LLACI----RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKL  1010
             LLA I    +    P+D  H  T+R  + KIMAT Y + E WEM     +G ++++ +  
Sbjct  77    LLAAIADYEKQTGKPID-AHVTTWRGMMTKIMATPYDQEE-WEMNATFYRGCIFIEENHA  134

Query  1009  PERPKSELDRRR------------CYWGYCFESLAT--EDPGRSDGDRIHDIDANV----  884
               R K  ++  R             YWGY FE+L+T     G    D I   D  +    
Sbjct  135   FARRKKMMESSRPARSDGISPNLMQYWGYKFETLSTIPRPWGEVSRDEIESRDDEIVNNM  194

Query  883   -EYCAVIKTKIGAHRILMGAEMDCC-DSRDD--GRRF-YVELKTSRELLDHRTEEIFERE  719
              +YC+V++T  G   + +G E+D   D++ +  G    +VELKTSR + +   +  F+ +
Sbjct  195   EQYCSVVRTGFGNTIVCLGGEVDAIWDAKPETPGEPINWVELKTSRMITNTGIQTAFD-Q  253

Query  718   KLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK--SYWQGGVCLAFA  545
             KLLK+WIQSFL GVP I+VGFRD +G L   E   T  I   V+ +  + W G VC+ FA
Sbjct  254   KLLKYWIQSFLLGVPRIIVGFRDQDGILRSMEEYETLNIPYEVRRRGLAKWDGNVCIRFA  313

Query  544   DEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
                L WL   + E   + ++     +R+EL +
Sbjct  314   ALFLQWLRLNITEEGVWRIRRPFRGSRIELTK  345



>gb|KDQ53161.1| hypothetical protein JAAARDRAFT_137557 [Jaapia argillacea MUCL 
33604]
Length=440

 Score =   141 bits (355),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 103/322 (32%), Positives = 160/322 (50%), Gaps = 23/322 (7%)
 Frame = -2

Query  1414  VSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLN  1235
             + +L +  +    A K    Q+P  L  +S   D  + F++ ++   K  +    G++L+
Sbjct  38    LHKLSYPPTTTPTASKPIPFQQPSTLLTFSYTPDRVLEFNNSAM---KHYVDPPQGAELS  94

Query  1234  EGFDTFTEKRDLGSQGFGDLLA---CIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPW  1064
              G+D + ++ D   +G  D L               +  V +R  + KI+   Y   E W
Sbjct  95    YGYDRWIKRPD--EKGRIDHLLKAWVKVRGGGSGGGIGVVLWRGVMTKILIAPYEDREGW  152

Query  1063  EMGVHKRKGVVYLDVHKLPERPKSELD-----RRRCYWGYCFESLATE-DPGRSDGDRIH  902
             ++ V    G ++ + H   ER K + D     R + Y+GY FES  T  +P R +    H
Sbjct  153   DLNVMCINGTMFFEEHLWDERLKEKNDMAPRQRTQTYYGYAFESWCTSSNPKRPEALPGH  212

Query  901   ------DIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRR-FYVELKTSRELLDHR  743
                   D+D NV++C VIKTK+G  R+++G E+DC     +GR    VELKTS  +   +
Sbjct  213   RRGWGGDVDTNVQWCNVIKTKLGDTRMVIGGEVDCVRGDYNGRNDNLVELKTSMSIRGPQ  272

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK-SYWQG  566
              E  FE+ KLLKF+ QSFL GVP IVVGFR  NG+L   +  +T  + + V+ K   W  
Sbjct  273   DEARFEK-KLLKFYFQSFLLGVPEIVVGFRTPNGKLTTIQSFKTLHLPRLVRGKPGAWDP  331

Query  565   GVCLAFADEVLCWLYGTVKENE  500
              +CL + D  L +L G V + E
Sbjct  332   SICLDWGDRFLSFLKGHVGQKE  353



>gb|KID99328.1| Protein RAI1, partial [Metarhizium majus ARSEF 297]
Length=377

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 105/338 (31%), Positives = 171/338 (51%), Gaps = 36/338 (11%)
 Frame = -2

Query  1369  KSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQ  1190
             +S  ++ P E AC+S  ++ +   DD S++ +    T  +G+DL++GFD F +  D G +
Sbjct  16    QSQPVKRPKEFACFSYDENHEFRLDDSSMKYY---YTPQLGTDLSKGFDKFQKLDDSGDE  72

Query  1189  GFGDLLACI----RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLD  1022
                 LL  I    R     +D  + VT+R  + KIMA  + + + +EM     +  ++++
Sbjct  73    HLDSLLKTILAHERETGKKID-ANVVTWRGMMTKIMAALFEQQDGFEMNATLYQDCIFIE  131

Query  1021  V---HKLPERPKSELDRRR--------CYWGYCFESLAT------EDPGRSDGDRIHDID  893
                 +KL  R K      R         YWGY FE+L+T      E       +R + I 
Sbjct  132   ENNEYKLQSRAKENHRGPRRGPPLEVMQYWGYKFETLSTLPKIWAETSREYIENRENQIV  191

Query  892   ANVE-YCAVIKTKIGAHRILMGAEMDCC-----DSRDDGRR--FYVELKTSRELLDHRTE  737
              N E YC+V++T IG   + +G E+D       DS+    +   +VELKT+ E+      
Sbjct  192   NNKEQYCSVVRTGIGKTVLCLGGEVDASIKPVWDSKPQPSQPINWVELKTTAEIRSDHDM  251

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRV--KMKSYWQGG  563
             + F R KL+KFWIQSFL GVP I+VGFR  +G LV  + + T+ I Q V  +  + W   
Sbjct  252   DNFHR-KLMKFWIQSFLLGVPKIIVGFRTRDGILVDVKEIETHNIPQTVNSRQGARWNAD  310

Query  562   VCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             +C+ FA E L +L  T+ +   + ++  P S  +++ +
Sbjct  311   MCVNFAGEFLEFLQSTINDEGVWRIRRHPASPTIKVFK  348



>ref|XP_009160703.1| hypothetical protein HMPREF1120_08210 [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY60242.1| hypothetical protein HMPREF1120_08210 [Exophiala dermatitidis 
NIH/UT8656]
Length=403

 Score =   140 bits (353),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 101/339 (30%), Positives = 165/339 (49%), Gaps = 34/339 (10%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A ++ AI+ P E+  +S  +D  +  D  SLR +       +  DLN+GF+TF +  D 
Sbjct  15    FATQNAAIRRPREITYFSFDEDHVLRHDASSLRYY---YPPALPCDLNKGFETFRQLDDS  71

Query  1198  GSQGFGDLLACI----RNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVV  1031
                    LL  +    + K   +D    +T+R  + KIM + +   + WEM     +G +
Sbjct  72    ADDHLDGLLEALILYEKEKGQKVD-TDLITWRGMMTKIMVSPFSLFDDWEMNATLFQGTI  130

Query  1030  YLDVH------------KLPERPKSELDRRRCYWGYCFESLAT-EDPGRSDG-----DRI  905
             Y++ +              P  P +       +WGY FE+++   +P  S        R 
Sbjct  131   YIEENHEKKVMSRQNQFSRPAHPGAMSQDLMSFWGYKFETVSLLPEPWSSASREYIESRE  190

Query  904   HDIDAN-VEYCAVIKTKIGAHRILMGAEMDCC---DSRDDGRRF-YVELKTSRELLDHRT  740
               I +N  +YC++++T  G  ++++G E+D      S D  +   +VELKT+  + + R 
Sbjct  191   EQIVSNYAQYCSIVRTGFGKVKMIIGGEVDAVVDFKSEDKSQPTNWVELKTTAAVTNERE  250

Query  739   EEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQG  566
             +  FER KLLKFW QSFL GVP IVVG+R   G L R E L T  I ++V++  K+ W G
Sbjct  251   QVKFER-KLLKFWAQSFLLGVPKIVVGYRTSQGILERLEELETQSIPEKVRLRGKNLWDG  309

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
               C+ FA   L WL   +  +  + ++    S R+E+ +
Sbjct  310   QTCINFASSFLEWLKTIITSDGVWRIRKREKSPRVEVFK  348



>ref|XP_007949520.1| PREDICTED: decapping and exoribonuclease protein [Orycteropus 
afer afer]
Length=395

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/307 (29%), Positives = 146/307 (48%), Gaps = 18/307 (6%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGS--DLNEGF-DTFTEKRDLGSQGFGD  1178
             P E+ C+S       + D R+LR +        G   DL +G+ D +  + +   +G   
Sbjct  46    PSEIGCFSLDAQRQYHGDGRALRYYSPPPINGPGPNFDLRDGYPDRYQPRDEEIREGLDH  105

Query  1177  LLACIRNKNIPLD------RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  + +    L+          VT+R +L K++ T Y R E W++   + +G +YL   
Sbjct  106   LLRWLLDHQGQLEGGPGWLAGAIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEV  165

Query  1015  KLPERPKSELDR-----RRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P      L R        Y GY FE     D      D   +++ NV +C+V+++++G
Sbjct  166   ETPAARAQRLARPPVLRELMYMGYKFEQYMCADKPGGSPDPSGEVNTNVAFCSVLRSRLG  225

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
              H +L   E+DC D +    +    YVELKTS+E+  H     F R KLLK+W QSFL G
Sbjct  226   NHPLLFSGEVDCTDPQAPSTQPPACYVELKTSKEMHSHGQWRSFYRHKLLKWWAQSFLPG  285

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             VP +V GFR+  G +   +   T E+ + V+  +  W   VC+ F    L ++  TV E+
Sbjct  286   VPNVVAGFRNPEGFICSLKTFPTMEMFENVRNDRDGWNPSVCMNFCAAFLSFVQNTVVED  345

Query  502   EDYILQF  482
             +  ++  
Sbjct  346   DPRLIHL  352



>ref|XP_010728964.1| PREDICTED: decapping and exoribonuclease protein [Larimichthys 
crocea]
Length=429

 Score =   140 bits (353),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 101/357 (28%), Positives = 165/357 (46%), Gaps = 35/357 (10%)
 Frame = -2

Query  1456  YGYGRGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRL  1277
             Y Y  G  P  +   S    +   E   R     ++P E+ C+S   +   + D R +R 
Sbjct  47    YQYQSGPTP-GKNPPSSRGLSTRRENYERDFPVYKQPVEVGCFSLDSERRFFNDSRQMRY  105

Query  1276  FKRLITEDIGS---DLNEGF-DTFTEKRDLGSQGFGDLLACIRNKNIPLDR---------  1136
             +    +E  G+   DL +G+ D + ++ +   +    +L  I      L           
Sbjct  106   Y----SEPDGNPHFDLKDGYKDRYIKRDESVKEKLDHILRWILANRSKLSSKLATTASPC  161

Query  1135  ---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDRRR---  974
                + FVT+R +L K++ T Y   E W + V + +  +Y+   +  E  + EL+ R    
Sbjct  162   ALDVDFVTWRGHLTKLLTTPYETREGWLLAVTRFRNTLYISEVET-EAARRELENRTERH  220

Query  973   ---CYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSR  803
                 YWGY FE     D   S  D    ++ N  +C V++T++  HR+L   E+DC D  
Sbjct  221   QEMMYWGYKFEQYTCADNVDSSPDPGGVVNTNEAFCTVVQTRLADHRLLFSGEVDCRDKD  280

Query  802   DDGR---RFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLV  632
              +       YVELKTS E+   +    F R KLLK+W QSFL GVP ++ GFRD +G +V
Sbjct  281   PNAPGPPACYVELKTSAEICTPKQRSNFHRFKLLKWWAQSFLPGVPRVIAGFRDHDGVVV  340

Query  631   RTERLRTNEITQRVKMK-SYWQGGVCLAFADEVLCWLYGTVKENED---YILQFTPH  473
               E   T++I+  +K + + W+  VC+ F  + L ++  T  E+     Y+  + PH
Sbjct  341   TVETFPTSKISHLIKSEPNCWKPTVCMNFCSDFLTFVKRTATEDNPSVVYLFSYEPH  397



>ref|XP_387521.1| hypothetical protein FG07345.1 [Fusarium graminearum PH-1]
Length=443

 Score =   140 bits (354),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 108/337 (32%), Positives = 167/337 (50%), Gaps = 37/337 (11%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A +S  ++ P E AC+S   + +   D  SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  88    FAGESQPVKRPKEFACFSYDDNHEFRLDGSSLKYY---YTPQLGADLSKGFDTFQKLDDT  144

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
             G      LL  I        +    + VT+R  + KIMAT +   + +EM     +   Y
Sbjct  145   GDDHLDSLLKTIVAHEQETGKKIDANVVTWRGMMTKIMATPFDNMDGFEMNATLYQNNAY  204

Query  1027  LDVHKLPERPKSELDRRRC---------YWGYCFESLAT------EDPGRSDGDRIHDID  893
                 K+  R     + RR          +WGY FE+L+T      E P     +R +++ 
Sbjct  205   ----KVASRSNEGNNNRRRRGPPLEVMQFWGYKFETLSTLPAPWAETPREFIENRENEVV  260

Query  892   AN-VEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRTEEIF  728
              N  +YC+V++T IG   + +G E+D   DS+ + +     +VELKTS E+ +    E F
Sbjct  261   NNKAQYCSVVRTGIGKSVLCLGGEVDAIWDSKPEEKGSPINWVELKTSAEIRNTGDMENF  320

Query  727   EREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSY----WQGGV  560
              R KL+K+WIQSFL GVP IVVGFR  +G LV  + + T+ I + V   SY    W   +
Sbjct  321   NR-KLMKYWIQSFLLGVPRIVVGFRTRDGILVEAKDIETHRIPETV--NSYPNPKWNADM  377

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ FA   L WL   + +   + ++  P S  +EL +
Sbjct  378   CVNFAATFLDWLSANITDEGVWRIKREPQSPTIELFK  414



>ref|XP_004424385.1| PREDICTED: protein Dom3Z [Ceratotherium simum simum]
Length=397

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 92/307 (30%), Positives = 143/307 (47%), Gaps = 18/307 (6%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGS--DLNEGFDTFTEKRDLG-SQGFGD  1178
             P EL C+S       + D R+LR +    T   G   DL +G+    + RD    +G   
Sbjct  46    PSELGCFSLDAQRQYHGDARALRYYSPPPTNGQGPNFDLRDGYPDHYQPRDEEIREGLDH  105

Query  1177  LLACIRNKNIPLD------RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  +      L+          VT+R +L K+M T Y R E W++   + +G +YL   
Sbjct  106   LLRWVLEHRGQLEGGPGWLAGAIVTWRGHLTKLMTTPYERQEGWQLAASRFQGTLYLSEV  165

Query  1015  KLPERPKSELDRRRC-----YWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P      L R        Y GY FE     D      D   +++ NV +C+V+++++G
Sbjct  166   ETPAARVQRLARPPLLQEFMYMGYKFEQYMCADKPGGSPDPSGEVNTNVAFCSVLRSRLG  225

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
              H +L   E+DC D +    +    YVELKTS+E+        F R KLLK+W QSFL G
Sbjct  226   NHPLLFSGEVDCTDPQAPSTQPPTCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPG  285

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             VP +V GFR+  G +   +   T E+ + V+  +  W   VC+ F    L +   TV ++
Sbjct  286   VPKVVAGFRNPEGFVCSLKTFPTMEMFEHVRNDRDGWNPSVCMNFCAAFLSFAQNTVVQD  345

Query  502   EDYILQF  482
             +  ++  
Sbjct  346   DPRLVHL  352



>ref|XP_006005733.1| PREDICTED: decapping and exoribonuclease protein [Latimeria chalumnae]
Length=413

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 103/330 (31%), Positives = 162/330 (49%), Gaps = 39/330 (12%)
 Frame = -2

Query  1354  QEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGS----DLNEGF-DTFTEKRDLGSQ  1190
             ++P E+ C+S   +   + D R L+ +   +  + G     +L +G+ D + ++ D   +
Sbjct  65    KQPMEVGCFSLDSERRFFNDARQLKYY---VPPENGKSPNFNLPDGYKDRYIKRDDNVKE  121

Query  1189  GFGDLLACIRNKN----IPLDRMH-----------FVTYRNNLNKIMATAYIRNEPWEMG  1055
                 LL  I N      IPL +             FVT+R +L KI+ T Y  NE W M 
Sbjct  122   NLDHLLRWILNNKRFFKIPLQQHEKTDASCSVKRDFVTWRGHLTKILTTPYEYNEGWLMA  181

Query  1054  VHKRKGVVYL-----DVHKLPERPKSELDRRRCYWGYCFES-LATEDP-GRSDGDRIHDI  896
             V    G  Y+     +  K     + E   +  Y GY FE  +   DP G+ +   I  +
Sbjct  182   VTLFNGTYYISEVETEAAKKKREMRPEYLDKMMYMGYKFEQYMCASDPQGKPNPAGI--V  239

Query  895   DANVEYCAVIKTKIGAHRILMGAEMDCCD-SRDDGR--RFYVELKTSRELLDHRTEEIFE  725
             + N  YC VI+ K+  H +L   E+DC D S   G+   +YVELKTS+E+   + +    
Sbjct  240   NTNEAYCTVIQAKLKWHSLLFSGEVDCKDQSYHTGKAPSYYVELKTSKEVYTQKEQRNLY  299

Query  724   REKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVK-MKSYWQGGVCLAF  548
             R KLLK+W QSFL GVP I+VGFRD++G +V  +   T +I   +K  K+ W+  VC+ F
Sbjct  300   RYKLLKWWAQSFLPGVPRIIVGFRDNDGTVVSLQTFETMKIFHVIKNEKNMWKPTVCVNF  359

Query  547   ADEVLCWLYGTVKENE---DYILQFTPHSN  467
              D  L ++   V +++    Y+  + PH +
Sbjct  360   CDAFLSFIKKVVTQDDYRMVYLFSWEPHQD  389



>ref|XP_008573238.1| PREDICTED: decapping and exoribonuclease protein [Galeopterus 
variegatus]
Length=398

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/307 (29%), Positives = 146/307 (48%), Gaps = 18/307 (6%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSD--LNEGF-DTFTEKRDLGSQGFGD  1178
             P EL C+S       + D R+LR +    T   G D  L +G+ D +  + +   +G   
Sbjct  46    PSELGCFSLDAQRQYHGDARALRYYSPPPTNGPGPDFDLRDGYPDRYQPRDEEVREGLDH  105

Query  1177  LLACIRNKNIPLD------RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  +      L+          VT+R +L K++ T Y R E W++   + +G +YL   
Sbjct  106   LLRWLLEHRGELEGGPGWLAGATVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEV  165

Query  1015  KLPER-----PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P        +  L R   Y GY FE     D      D   +++ NV +C+V+++++G
Sbjct  166   ETPAARAQRLARPPLLRELMYMGYKFEQYMCADKPGGSPDPSGEVNTNVAFCSVLRSRLG  225

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
              HR+L   E+DC D +    +    YVELKTS+E+        F R KLLK+W QSFL G
Sbjct  226   NHRLLFSGEVDCTDPQAPSTQPPTCYVELKTSKEMHSPSQWRSFYRHKLLKWWAQSFLPG  285

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             VP +V GFR+  G +   +   T E+ + ++  +  W   VC+ F    L +   TV ++
Sbjct  286   VPKVVAGFRNPEGFVCSLKIFPTMEMFEYIRNDRGGWNPSVCMNFCAAFLSFAQSTVVQD  345

Query  502   EDYILQF  482
             +  ++  
Sbjct  346   DPRLVHL  352



>ref|XP_005965411.1| PREDICTED: LOW QUALITY PROTEIN: decapping and exoribonuclease 
protein [Pantholops hodgsonii]
Length=381

 Score =   139 bits (350),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 100/350 (29%), Positives = 162/350 (46%), Gaps = 32/350 (9%)
 Frame = -2

Query  1423  ERFVSELKFAKSEETLARKSTAI--------------QEPCELACYSRVQDGDVYFDDRS  1286
             +R   E++ A+ +  L R + ++              + P EL C+S       + D R+
Sbjct  7     KREAGEIEVAEPQNKLPRPAPSLPTHPALYSGPFPFYRRPSELGCFSLDAQRQYHGDARA  66

Query  1285  LRLFKRLIT--EDIGSDLNEGFDTFTEKRDLGSQGFGD-LLACIRNKNIPLD------RM  1133
             LR +    T  +    DL +G+    + RD   Q   D LL  +      L+        
Sbjct  67    LRYYSPPPTNGQSPNFDLRDGYPDRYQPRDEEVQERLDHLLRWLLAHRGQLEGGPGWLAG  126

Query  1132  HFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPER-----PKSELDRRRCY  968
               VT+R +L K++ T Y R E W++   + +G +YL   + P        +  L R   Y
Sbjct  127   AIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPAARVQRLTRPPLLRELMY  186

Query  967   WGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRR  788
              GY FE     D      D   D++ NV +C+V+++++G H +L   E+DC D +    +
Sbjct  187   MGYKFEQYMCADKPGVSPDPSGDVNTNVAFCSVLRSRLGNHPLLFSGEVDCTDPQAPSTQ  246

Query  787   ---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERL  617
                 YVELKTS+E+      + F R KLLK+W QSFL GVP +V GFR+  G +   +  
Sbjct  247   PPTCYVELKTSKEMHSPGQWKSFYRHKLLKWWAQSFLPGVPNVVAGFRNPEGFVCSLKTF  306

Query  616   RTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHS  470
              T E+ + V+  +  W   VC+ F    L +   TV E++  ++  +P S
Sbjct  307   PTMEMFEYVRNDRDGWNPSVCMNFCAAFLSFAQNTVVEDDPRLVYSSPGS  356



>ref|XP_007300226.1| RAI1-domain-containing protein, partial [Stereum hirsutum FP-91666 
SS1]
 gb|EIM91529.1| RAI1-domain-containing protein, partial [Stereum hirsutum FP-91666 
SS1]
Length=388

 Score =   139 bits (350),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 117/369 (32%), Positives = 178/369 (48%), Gaps = 61/369 (17%)
 Frame = -2

Query  1471  PPRQNYGYGRGNA---PRDERFVSELKFAK------SEETLARKSTAIQEPCELACYSRV  1319
             PP+++Y   R N    P   R ++ +  AK      SE  +   +   Q+P  L  +S  
Sbjct  27    PPKKHYEKSRHNKRPKPGALRSLASIPTAKLLYPRISEPQIT--NVPFQQPLPLLTFSYT  84

Query  1318  QDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLAC---IRNKNI  1148
              D  ++FD+ +LR    L+     +DL+ G  T+ +K D G      LL     +R +++
Sbjct  85    PDRVLHFDNSALRY---LVPPPPEADLHYGLKTWEKKPD-GKGRIDALLRAWTKVRKEDV  140

Query  1147  PLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELD--  983
                R   +  V +R  + KI+ T Y   + WEM V    G +YL+ H  P+R K + +  
Sbjct  141   CGMRNVDVGVVCWRGVMTKILTTPYETMDNWEMNVMLVDGTLYLEEHLTPQRLKVKNNLV  200

Query  982   ---RRRCYWGYCFESLATED-----------------------PGRSDGDRIH------D  899
                R   Y GY FES  T +                       PG + G+ +       D
Sbjct  201   GKQRAMTYTGYAFESWCTSESPPPPPPPPGTGTGTDEPVAPVAPGWA-GEPVAPPGWGGD  259

Query  898   IDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRR-FYVELKTSRELLDHRTEEIFER  722
             +D NV++C+V+KTK+G  R+++G E+DC      G     VELKTS+ +     +  FE+
Sbjct  260   VDTNVQWCSVVKTKLGNTRMVIGGEVDCVRGEYKGTNDTMVELKTSQVIRWPDDQRKFEK  319

Query  721   EKLLKFWIQSFLAGVPYIVVGFRD--DNGRLVRTERLRTNEITQRVK-MKSYWQGGVCLA  551
              KLLKF+ QSFL GVP I+VGFR   DNG L   +  +T EI + V+  +  W   VCL 
Sbjct  320   -KLLKFYFQSFLLGVPDILVGFRSDKDNGALQLLQSFKTLEIPRMVRGQRKAWDPRVCLG  378

Query  550   FADEVLCWL  524
             + +EVL W+
Sbjct  379   WGEEVLGWI  387



>ref|XP_008383038.1| PREDICTED: decapping nuclease DXO homolog, chloroplastic-like 
isoform X3 [Malus domestica]
Length=131

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = -2

Query  934  DPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSREL  755
            DPGR DG  IH++DANVEYC+VIKTK+GAHRILMGAEMDCCDS DDGRRFYVELKTS EL
Sbjct  46   DPGRGDGP-IHNVDANVEYCSVIKTKLGAHRILMGAEMDCCDSTDDGRRFYVELKTSHEL  104

Query  754  LDHRTEEIFEREKLLKFWIQ  695
             +H+ E  FE+EKLLKFW+ 
Sbjct  105  DNHKIEYEFEKEKLLKFWVH  124



>emb|CDM37618.1| Protein rai1 [Penicillium roqueforti FM164]
Length=373

 Score =   139 bits (349),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 96/315 (30%), Positives = 158/315 (50%), Gaps = 32/315 (10%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             +T+I+ P E+AC+S  ++      D S+  +    T  + +DLN G++TF +  D+  + 
Sbjct  18    NTSIRRPREIACFSYDENRRFSLGDSSMAYY---YTPALPADLNIGYETFQKLNDVPDEH  74

Query  1186  FGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
                LL  +       ++   +  VT+R  + KI+   +     +EM     +G ++++ +
Sbjct  75    LDALLDTLVAHEKETEKKCDVDIVTWRGMMTKILTAPFDNMNGFEMNATCFQGTIFIEEN  134

Query  1015  KLPERPKSELDRRR------------CYWGYCFESLAT-----EDPGRSD--GDRIHDID  893
                +  + E+ R+R             YWGY FE LA      ++  R +  G +   ++
Sbjct  135   NEYKNQQKEIQRKRGSPPGMAPQELMMYWGYKFEKLAVLPKTWDESTREEIEGRQNEVVN  194

Query  892   ANVEYCAVIKTKIGAHRILMGAEMDCC----DSRDDGRRFYVELKTSRELLDHRTEEIFE  725
                +YC+V++T IG  R+++G E+D       SR +    +VELKTS ++ + R    +E
Sbjct  195   NAAQYCSVVRTGIGNVRMILGGEVDAIWDSKPSRKESPINWVELKTSAQICNERDMIKYE  254

Query  724   REKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGVCLA  551
             R KLLKFW QSFL GVP I+VGFRD+NG     E L T  I  +V    +  W G VC+ 
Sbjct  255   R-KLLKFWAQSFLLGVPKIIVGFRDENGICHSLEELDTASIPGKVLSVGRRSWDGNVCIN  313

Query  550   FADEVLCWLYGTVKE  506
             F    L WL  T+ +
Sbjct  314   FTGAFLEWLKQTINQ  328



>ref|XP_006668966.1| Dhp1-interacting protein Din1 [Cordyceps militaris CM01]
 gb|EGX92382.1| Dhp1-interacting protein Din1 [Cordyceps militaris CM01]
Length=373

 Score =   139 bits (349),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 104/337 (31%), Positives = 166/337 (49%), Gaps = 31/337 (9%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E+AC+S   +      D SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  13    FAGASQPVRRPKEIACFSYDDNHVFSLGDASLKWY---YTPQLGADLSKGFDTFEKLDDS  69

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
               +    LL  I        +    H VT+R  + KIMAT +   + +EM     +  ++
Sbjct  70    KDEHLDSLLRTITAHEQDTGKRIDAHVVTWRGMMTKIMATPFDNQDGFEMNATLYQDCLF  129

Query  1027  LD---VHKLPERPKSELDRRRC--------YWGYCFESLATEDPGRSDGDRI------HD  899
             ++    +K+  R      RRR         +WGY FE+LAT      D +R       H 
Sbjct  130   IEENNAYKVASRRNEGQTRRRHGPPLEVMQFWGYKFETLATLPAPWGDTERAVIDGREHA  189

Query  898   IDAN-VEYCAVIKTKIGAHRILMGAEMDCC-DSR--DDGRRF-YVELKTSRELLDHRTEE  734
             +  N  +YC+V++T IG   + +G E+D   DS+    G    +VELKTS E+      +
Sbjct  190   VVNNKAQYCSVVRTGIGKTILCLGGEVDAIWDSKPVQQGSPINWVELKTSAEMRGPGDVD  249

Query  733   IFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK--SYWQGGV  560
              F R KL+K+WIQSFL GVP I+VGFR  +G L+  + + T+ I + V  +    W   +
Sbjct  250   NFHR-KLMKYWIQSFLLGVPKIIVGFRSRDGILLDVQEIETHRIPETVNGRPNPSWNADM  308

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ FA   L +L  T+ +   + ++  P S  +E+ +
Sbjct  309   CVNFAAAFLEFLMHTINDEGVWRIRRQPQSPMIEVYK  345



>ref|XP_003719891.1| rai-1 [Magnaporthe oryzae 70-15]
 gb|EHA47524.1| rai-1 [Magnaporthe oryzae 70-15]
Length=377

 Score =   139 bits (349),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 105/337 (31%), Positives = 171/337 (51%), Gaps = 32/337 (9%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A  S  ++ P E AC+S   D     DD S++ +       +G+DL+EGF++F +K D 
Sbjct  15    FAGPSEPVRRPKEFACFSYDADHKFRLDDSSMKWY---YPPRLGADLSEGFESF-DKLDE  70

Query  1198  GSQG--FGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGV  1034
             G+       LL  I      + +    H VT+R  + K+MA+ Y   + +++     +  
Sbjct  71    GASAEHIDSLLQTIIAHEQRIGKKIDAHVVTWRGIVTKLMASPYEDRDGFDLNATLYQDC  130

Query  1033  VYLD----------VHKLPERPKSELDRR-RCYWGYCFESLAT--EDPGRS-----DGDR  908
             V+++            +  E  KS + R    +WGY FE+L+T  +  G +     +G  
Sbjct  131   VFIEEDYASRMESKKAQDSEPWKSPIPREVMTFWGYKFETLSTIPKPWGETSRDYIEGRE  190

Query  907   IHDIDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRDD--GRRFYVELKTSRELLDHRTE  737
             +   +   +YC+V++T IG   + +G E+D   DS+    G   +VELKTS E+ + R  
Sbjct  191   LEPTNNKEQYCSVVRTGIGKTILCIGGEVDAIWDSKPSTPGPINWVELKTSAEVRNDRDA  250

Query  736   EIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKS-YWQGGV  560
               FER KLLK+WIQSFL GVP IVVGFR  +G L R + + TN I   V+ +   W G  
Sbjct  251   ANFER-KLLKWWIQSFLLGVPKIVVGFRTRDGHLTRVDEMETNVIPANVQQRGRSWNGDT  309

Query  559   CLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
             C+ F   VL W+  T+ ++  + ++    S+ +E+ +
Sbjct  310   CINFCSAVLDWIRSTMDDDGVWRIRRRARSSVIEMFK  346



>ref|XP_007845329.1| protein rai1 [Moniliophthora roreri MCA 2997]
 gb|ESK95351.1| protein rai1 [Moniliophthora roreri MCA 2997]
Length=381

 Score =   139 bits (349),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 108/330 (33%), Positives = 162/330 (49%), Gaps = 35/330 (11%)
 Frame = -2

Query  1369  KSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGS---------DLNEGFDTF  1217
             K    Q+P  L  +S   +    F D +LR F  +    +G+         DL  G++ +
Sbjct  22    KPPPFQQPTPLTSFSYTPEHVQEFADSALRYFAPIPPSLLGNPRGGPSRGLDLGYGYERW  81

Query  1216  TEKRDLGSQGFGDLL------ACIRN------KNIPLDRMHFVTYRNNLNKIMATAYIRN  1073
               K +   +G  D L       C R       K + L  +  V +R  + +IM   Y   
Sbjct  82    VRKPE--DRGRIDSLLNAVNMVCERGTGNGEGKLMRLKDVSVVAWRGVITRIMTAPYEER  139

Query  1072  EPWEMGVHKRKGVVYLDVH----KLPERPK-SELDRRRCYWGYCFESLATEDPGRSDGDR  908
             + WEM V    G +YL+ H    KL E+    E  RR  Y+GY FES +T +   +D   
Sbjct  140   DGWEMNVMVMDGTMYLEEHLTDDKLHEKNNVEERHRRAMYYGYAFESYSTWETPFNDNPA  199

Query  907   IH----DIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRR-FYVELKTSRELLDHR  743
              +    D++ NV++C+V++TK+G  R+++G E+DC   +  GR   +VELKTS  +    
Sbjct  200   PNKWGGDVNTNVQWCSVVRTKLGDMRMVIGGEVDCVRGKYSGRTDEFVELKTSLTIRGPS  259

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK-SYWQG  566
              E  FE+ KLLKF+ QSFL GVP IVVGFR   G+L+ T+  +T EI + V+ K   W  
Sbjct  260   DEVKFEK-KLLKFYFQSFLLGVPEIVVGFRTPRGQLISTKSYKTIEIPRMVRGKPGGWDP  318

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTP  476
              VCL +    L  L  T +    + ++F P
Sbjct  319   SVCLDWGYRFLRKLKETCEPGGVWRVKFVP  348



>gb|KDN65734.1| hypothetical protein CSUB01_09173 [Colletotrichum sublineola]
Length=469

 Score =   140 bits (353),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 100/307 (33%), Positives = 154/307 (50%), Gaps = 31/307 (10%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             S  ++ P E AC+S   + D + DD SLR +    T  +G+DL++G+D+F    D   + 
Sbjct  84    SQPVKRPKEFACFSYDDNHDFHQDDSSLRYY---YTPALGADLSKGYDSFIRHDDSKPEH  140

Query  1186  FGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDV-  1019
                LL  I+       +      VT+R  + KIMAT +   + +EM     +  +Y++  
Sbjct  141   LEALLKTIKAHEEETGQKIDAQIVTWRGMMTKIMATPFEDRDGFEMNATLYQDCIYIEEN  200

Query  1018  --HKLPERPKSELDRRRC--------YWGYCFESLATEDPGRSDGDRIHD-------IDA  890
               +K+  + +    +RR         +WGY FE+LAT      D  R +        ++ 
Sbjct  201   HEYKVASQKQQNASQRRGPIPPEVMQFWGYKFETLATLPAPWGDISREYIEKRDEEVVNN  260

Query  889   NVEYCAVIKTKIGAHRILMGAEMDCC-DSRD---DGRRFYVELKTSRELLDHRTEEIFER  722
               +YC+V++T IG   I +G E+D   DS+         +VELKTS  + D R  + F R
Sbjct  261   KAQYCSVVRTGIGQTVICIGGEVDAVWDSKPMKPGTPTNWVELKTSLAIRDDRDVDNFHR  320

Query  721   EKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGVCLAF  548
              KL+KFWIQSFL GVP I+VGFR+  G L   E + T +I   V+   K+ W   +C+ F
Sbjct  321   -KLMKFWIQSFLLGVPKIIVGFRNRQGILTGVEEIETEKIPDTVQRRGKATWNADMCVNF  379

Query  547   ADEVLCW  527
             A E L +
Sbjct  380   AAEFLVF  386



>ref|XP_001248853.1| hypothetical protein CIMG_02624 [Coccidioides immitis RS]
Length=358

 Score =   138 bits (347),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 105/319 (33%), Positives = 158/319 (50%), Gaps = 42/319 (13%)
 Frame = -2

Query  1384  ETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKR  1205
             +  A  + AI+ P E+AC+S   D +   D+ SLR +       +  DLN GF+TF +  
Sbjct  12    QRFAGSNAAIRRPKEIACFSYDDDHNFLLDESSLRYY---YPPRLPVDLNGGFETFKKLD  68

Query  1204  DLGSQGFGDLLACIRNKNIPLDR-------MHFVTYRNNLNKIMAT--------AYIRNE  1070
             D   +    LL  I    I L++          +T+R  + K+  +        ++I   
Sbjct  69    DSADEHLDALLDTI----IALEKSTGAKCEADVITWRGMMTKVWCSLAFVSRWLSFIEEN  124

Query  1069  PWEMGVHKRKGVVYLDVHKLPERPKSELDRRRCYWGYCFESLATED------PGRSDGDR  908
                    K+   + L+    P  P  +   R  YWGY FE+L+  D         +   R
Sbjct  125   NEYKNAQKK---IQLEQRMPPGAPSQD---RMMYWGYKFETLSLIDEPWDAVSRETIESR  178

Query  907   IHDI-DANVEYCAVIKTKIGAHRILMGAEMD----CCDSRDDGRRFYVELKTSRELLDHR  743
              H I + N +YC+V++T IG  ++++G E+D    C   R D    +VELKTS E+ + R
Sbjct  179   EHKIVNNNSQYCSVVRTGIGGVKLVIGGEVDAVWDCKPDRKDDPINWVELKTSAEIRNDR  238

Query  742   TEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQ  569
                 FER KLLKFW QSFL GVP IVVGFR+++G L R E  +T+EI   VK   +  W 
Sbjct  239   DMLKFER-KLLKFWAQSFLLGVPKIVVGFRNEHGILQRLEEFQTHEIPGFVKRQGRGNWD  297

Query  568   GGVCLAFADEVLCWLYGTV  512
             G +C+ F  ++L W+ G +
Sbjct  298   GNICINFTAQLLEWIRGII  316



>ref|XP_005808926.1| PREDICTED: decapping and exoribonuclease protein-like [Xiphophorus 
maculatus]
Length=424

 Score =   139 bits (350),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 104/368 (28%), Positives = 163/368 (44%), Gaps = 42/368 (11%)
 Frame = -2

Query  1477  NYPPRQNYGYGRGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYF  1298
             N+   Q+    R   PR +        +   E   R     ++P E+ C+S       + 
Sbjct  41    NHHLHQSSSTPRQTPPRSQ------TLSTRREVYERDFPLYKQPVEVGCFSLDSQRRFFN  94

Query  1297  DDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLG----------------SQGFGDLLAC  1166
             D R +R +          DL +G+     KRD                  S+    L   
Sbjct  95    DSRQMRYYVE-PERSPSFDLRDGYRERYVKRDENVKEKLDHILRWIVANRSKLKSKLTTT  153

Query  1165  IRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLD-------VHKLP  1007
                   PLD   FVT+R +L K++ T Y   E W + V +  G +Y+          +  
Sbjct  154   TSAPRSPLD-FDFVTWRGHLTKLLTTPYETREGWLLAVTRFNGTLYISEVETEAACRERE  212

Query  1006  ERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGA  827
              RP  E ++   YWGY FE     D   S  D    ++ N  +C V++T++  H++L   
Sbjct  213   NRP--ERNKEMMYWGYKFEQYMCADSTNSTPDPSGVVNTNEAFCTVVQTRLTDHKLLFSG  270

Query  826   EMDCCDSRDDGR----RFYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVG  659
             E+DC D RD G       Y+ELKTS E+   +    F R KLLK+W QSFL GVP +V G
Sbjct  271   EVDCRD-RDPGAPPPPACYMELKTSAEICTPKQRSNFHRFKLLKWWAQSFLPGVPRVVAG  329

Query  658   FRDDNGRLVRTERLRTNEITQRVKMK-SYWQGGVCLAFADEVLCWLYGTVKENED---YI  491
             FRD +G +V  E  + ++I+Q +K + + W+  VC+ F  + L ++     E+     Y+
Sbjct  330   FRDHDGTVVSVETFQISKISQVIKNEYNCWKPTVCMNFCCDFLSFVKREATEDNPSVVYL  389

Query  490   LQFTPHSN  467
               + PH++
Sbjct  390   FSWEPHND  397



>gb|ENH88240.1| protein rai1 [Colletotrichum orbiculare MAFF 240422]
Length=356

 Score =   138 bits (347),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 99/328 (30%), Positives = 167/328 (51%), Gaps = 42/328 (13%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             S  ++ P E AC+S     + + DD SLR +    T  +G DL+ G+D+F ++ D  ++ 
Sbjct  17    SQPVKRPKEFACFSYDDKHEYHQDDSSLRYY---YTPSLGVDLSAGYDSFIKRDDSEAEH  73

Query  1186  FGDLLACIRNKNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLD-VHKL  1010
              G LL  I++            +     + +    I   P+E     R G +  +  +K+
Sbjct  74    LGALLKTIKH------------HEEQTGQKIDAQIILGTPFE----DRDGFIEENHEYKV  117

Query  1009  PERPKSELDRRRC--------YWGYCFESLATEDP--GRSDGDRIHD-----IDANVEYC  875
               + +   ++RR         YWGY FE+LAT     G +  + I +     ++ N +YC
Sbjct  118   ASQKQQNANQRRGPIPPEVMQYWGYKFETLATIPAPWGETSREYIENRATEVVNNNAQYC  177

Query  874   AVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLDHRTEEIFEREKLLK  707
             +V++T IG   I +G E+D   DS+ + +     +VELKTS  + D R  + F R KL+K
Sbjct  178   SVVRTGIGQTVICIGGEVDAVWDSKPEKQGSPTNWVELKTSLAIRDGRDVDNFHR-KLMK  236

Query  706   FWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK--SYWQGGVCLAFADEVL  533
             FWIQSFL GVP I+VGFR + G L   + + T +I + V+ +  + W   +C+ FA + L
Sbjct  237   FWIQSFLLGVPKIIVGFRSNRGVLTSVDEIETEKIPETVQRRGGAAWNADMCVNFAADFL  296

Query  532   CWLYGTVKENEDYILQFTPHSNRLELLR  449
              WL  T+ ++  + ++  P +  +E+ R
Sbjct  297   VWLRQTINDDGVWRIRRRPGNPVIEVFR  324



>gb|KGO63743.1| hypothetical protein PITC_071950 [Penicillium italicum]
Length=373

 Score =   138 bits (348),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 99/332 (30%), Positives = 163/332 (49%), Gaps = 32/332 (10%)
 Frame = -2

Query  1366  STAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQG  1187
             +T+I+ P E+AC+S          D S+  +    T  + +DLN+G++TF +  D+  + 
Sbjct  18    NTSIRRPREIACFSYDDQHRFSLGDSSMAYY---YTPALPADLNKGYETFQKLNDVPDEH  74

Query  1186  FGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
                LL  +       +R   +  VT+R  + KI+   +     +EM     +G ++++ +
Sbjct  75    LDALLDTLVAHEKETERKCDVDIVTWRGMMTKILTAPFDNMNGFEMNATCFQGTIFIEEN  134

Query  1015  KLPERPKSELDRRR------------CYWGYCFESLAT-----EDPGRSD--GDRIHDID  893
                +  + E+ R+R             YWGY FE LA      ++  R +  G     ++
Sbjct  135   NEYKNQQKEIQRKRGSPPGMAPQELMMYWGYKFEKLAVLPKTWDESTREEIEGRENEVVN  194

Query  892   ANVEYCAVIKTKIGAHRILMGAEMDCC----DSRDDGRRFYVELKTSRELLDHRTEEIFE  725
                +YC+V++T IG  R+++G E+D       SR +    +VELKTS ++ + R    +E
Sbjct  195   NAAQYCSVVRTGIGNVRMILGGEVDAIWDSKPSRKESPINWVELKTSAQIRNERDMIKYE  254

Query  724   REKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKM--KSYWQGGVCLA  551
             R KLLKFW QSFL GVP I+VGFRD+NG     E L T  I  +V    +  W G VC+ 
Sbjct  255   R-KLLKFWAQSFLLGVPKIIVGFRDENGICRSLEELDTASIPGKVLSVGRRSWDGNVCIN  313

Query  550   FADEVLCWLYGTVKENEDYILQFTPHSNRLEL  455
             F    L WL  T+ +   + ++    S  +E+
Sbjct  314   FTGAFLEWLKQTINQEGTWRIRKKEKSPVIEV  345



>ref|XP_009064515.1| hypothetical protein LOTGIDRAFT_54612, partial [Lottia gigantea]
 gb|ESO84783.1| hypothetical protein LOTGIDRAFT_54612, partial [Lottia gigantea]
Length=339

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 87/321 (27%), Positives = 159/321 (50%), Gaps = 26/321 (8%)
 Frame = -2

Query  1360  AIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFG  1181
             + ++P E+ C+S+  +   + D R L+    L ++    DLN+G+     + ++  +   
Sbjct  3     SFRDPREIGCFSQDFERKFHADKRQLKYVINLPSK-TEFDLNKGYKEMIRRDEISPEQIN  61

Query  1180  DLLACIRNKNIPLDRMH-------------FVTYRNNLNKIMATAYIRNEPWEMGVHKRK  1040
             DLL  I +K     ++H             FV +R  L +++ T Y   + W++ V + +
Sbjct  62    DLLRWIMHKPEKF-KLHPEKPSLEDLLNTDFVCWRGLLTRLVCTPYEYRDDWKIAVIRFR  120

Query  1039  GVVYLDVHKLPERPKSELDR------RRCYWGYCFESLATEDPGRSDGDRIHDIDANVEY  878
                +L    + E  K ++D          YWG+ FE   T        D    I+ N  +
Sbjct  121   NTYFL-CESMTEDRKKQVDNTTPRQDEMSYWGWKFEQYITSSENGGTPDINRPINTNEAF  179

Query  877   CAVIKTKIGAHRILMGAEMDCCDSRDDGRRFYVELKTSRELLDHRTEEIFEREKLLKFWI  698
             C+V+++++G H ++ G E+D  D        YVE KTSR++   +    F R KL+K+W 
Sbjct  180   CSVVRSRLGEHSLVYGGEIDGIDDSLQSNSKYVEFKTSRQIEYKKQNINFHRHKLIKYWA  239

Query  697   QSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVK-MKSYWQGGVCLAFADEVLCWLY  521
             QS L G+  I+ GFRDD G +   +  +T EI   +K + + W+  VC+ F +++L ++ 
Sbjct  240   QSHLVGISKIICGFRDDYGIVHELKEFQTEEIPNNLKILYNPWKPNVCMNFLNDILGFIK  299

Query  520   GTVKENED---YILQFTPHSN  467
              ++K N+    Y+L++ PHS+
Sbjct  300   RSIKTNDSKTVYLLEWRPHSD  320



>ref|XP_004071492.1| PREDICTED: protein Dom3Z-like [Oryzias latipes]
Length=422

 Score =   139 bits (350),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 93/320 (29%), Positives = 155/320 (48%), Gaps = 25/320 (8%)
 Frame = -2

Query  1354  QEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGD-  1178
             ++P E+ C+S       + D R +R +     ++   DL +G+     +RD   +   D 
Sbjct  74    RQPVEVGCFSLDSQRRFFNDGRQMRYYVE-PDKNPNFDLKDGYKDRYVRRDENVKEKLDH  132

Query  1177  -LLACIRNKNIPLDR----------MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVV  1031
              L   + NK     +          + FVT+R +L K++ T Y   E W +   K  G V
Sbjct  133   ILRWILANKETLKSKGTADSPRALDVDFVTWRGHLTKLLTTPYETKEGWLLAATKFNGTV  192

Query  1030  YL-----DVHKLPERPKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVI  866
             Y+     +  ++    + E ++   YWGY FE     D   S  D    ++ N  +C V+
Sbjct  193   YISEVETEAARIEREKRPERNKEMMYWGYKFEQYTCADNADSLPDPSGVVNTNEAFCTVV  252

Query  865   KTKIGAHRILMGAEMDCCDSRDDGR---RFYVELKTSRELLDHRTEEIFEREKLLKFWIQ  695
             +T++  H++L   E+DC D   +       YVELKTS E+   +    F R KLLK+W Q
Sbjct  253   QTRLADHKLLFSGEVDCRDKDPNAPPPPACYVELKTSPEICTPKQRSNFHRFKLLKWWAQ  312

Query  694   SFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMK-SYWQGGVCLAFADEVLCWLYG  518
             SFL GVP IV GF+D +G +V TE    ++++Q +K + + W+  VC+ F  + L ++  
Sbjct  313   SFLPGVPRIVAGFKDHDGVVVSTETFLVSKVSQLIKNEYNCWRPTVCMNFCCDFLSFVKA  372

Query  517   TVKENED---YILQFTPHSN  467
              V EN+    Y+  + P+ +
Sbjct  373   IVTENDHSLVYLFSWEPYKD  392



>gb|ESZ97787.1| hypothetical protein SBOR_1796 [Sclerotinia borealis F-4157]
Length=421

 Score =   139 bits (350),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 101/327 (31%), Positives = 169/327 (52%), Gaps = 33/327 (10%)
 Frame = -2

Query  1405  LKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGF  1226
             L   + E +    ++AI  P E+A +S   +   + +D S+R +      DIG+DLN+GF
Sbjct  18    LPLTQFERSRDAGNSAITRPQEIAHFSYDDEHKFHLNDSSIRWY---YPPDIGTDLNQGF  74

Query  1225  DTFTEKRDLGSQGFGDLLACIRNKNIPLD---RMHFVTYRNNLNKIMATAYIRNEPWEMG  1055
             +TF +  D   +    LL  +  +   ++     + VT+R  + KI+A+ +   + ++M 
Sbjct  75    ETFRKHDDSKDEHLESLLRALMEREKVMNVKTEANVVTWRGMMTKIIASLFDSRDGFQMN  134

Query  1054  VHKRKGVVYLDV-HKLPERPKSELDRRR------------CYWGYCFESLATEDPG--RS  920
                 +G V+++  H+     +++ D R+             +WGY FE+L         +
Sbjct  135   ATCFEGTVFVEEDHQYKVTSRAKQDARQQPRPGRPSGDAMSFWGYKFETLCLMPAPWPET  194

Query  919   DGDRIHDIDANV-----EYCAVIKTKIGAHRILMGAEMDCC---DSRDDGRRF-YVELKT  767
               D I + D  V     +YC+V+KTKIG++ +++G E+D        +DG+   +VELKT
Sbjct  195   SRDYIENRDKEVVNNHAQYCSVVKTKIGSNSLVIGGEVDGIYKGSKFEDGKSTEWVELKT  254

Query  766   SRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVK  587
             +        E+ FE+ KLLKFW+QSFL GVP+I+VG R   G L   ER+ T +I   VK
Sbjct  255   TVTPRHRGDEQNFEK-KLLKFWLQSFLLGVPHIIVGQRSPEGILQNIERINTAQIPGMVK  313

Query  586   MK--SYWQGGVCLAFADEVLCWLYGTV  512
              +  + W G +C+ FAD  L +L  T+
Sbjct  314   KRGNNSWDGDMCINFADRFLEFLKVTI  340



>ref|XP_003986005.1| PREDICTED: decapping and exoribonuclease protein isoform X1 [Felis 
catus]
 ref|XP_006931643.1| PREDICTED: decapping and exoribonuclease protein isoform X2 [Felis 
catus]
 ref|XP_006931644.1| PREDICTED: decapping and exoribonuclease protein isoform X3 [Felis 
catus]
Length=397

 Score =   139 bits (349),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 92/314 (29%), Positives = 150/314 (48%), Gaps = 21/314 (7%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGS--DLNEGF-DTFTEKRDLGSQGFGD  1178
             P EL C+S       + D ++LR +    T   G   DL +G+ D +  + +   +G   
Sbjct  46    PSELGCFSLDAQRQYHGDAQALRYYSPPPTNGQGPNFDLRDGYPDRYQPRDEEIREGLDH  105

Query  1177  LLACIRNKNIPLD------RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  + +    L+          VT+R +L K++ T Y R E W++   + +G +YL   
Sbjct  106   LLRWLLDHRGQLEGGPGWLAGAIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEV  165

Query  1015  KLPER-----PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P        +  L R   Y GY FE     D   S  D   +++ NV +C+V+++++G
Sbjct  166   ETPAARAQRLARPPLLRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLG  225

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
              H +L   E+DC D +    +    YVELKTS+E+        F R KLLK+W QSFL G
Sbjct  226   NHPLLFSGEVDCIDPQAPSTQPPTCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLLG  285

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             +P +V GFR+  G +   +   T E+ + V+  +  W   VC+ F    L +   TV ++
Sbjct  286   IPNVVAGFRNPEGFICSLKTFPTMEMFEYVRNDRDGWNPSVCMNFCAAFLSFAQNTVVQD  345

Query  502   ED---YILQFTPHS  470
             +    Y+  + P S
Sbjct  346   DPRLVYLFSWEPGS  359



>ref|XP_008035940.1| RAI1-domain-containing protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW62327.1| RAI1-domain-containing protein [Trametes versicolor FP-101664 
SS1]
Length=459

 Score =   139 bits (351),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 101/351 (29%), Positives = 172/351 (49%), Gaps = 30/351 (9%)
 Frame = -2

Query  1486  PSPNYPPRQNYGYGRGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGD  1307
             P+ + PP+Q        +         L +  +  +L  +    Q+P  L  +S      
Sbjct  10    PAESKPPKQRQEVDPEPSSPSRTACHTLAYPDTRSSLTSQPVPFQQPTGLLTFSYTPKRV  69

Query  1306  VYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLGSQGFGDLLACIR-----NKNIP-  1145
             + F D +LR +   +    G+DL  G+D + ++ +  ++  G L    R     + N+  
Sbjct  70    LQFTDSALRYY---VDPPPGADLKYGYDRWIKRPEERTRLDGLLRGVERVMSKADANVGP  126

Query  1144  ------LDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELD  983
                   L  +  VT+R  + KI+   Y   +  E+      G +Y++ H    R   + D
Sbjct  127   GSGGKWLKDISVVTWRGIMTKILTAPYEERDRCELNAMYVGGTLYIEEHLSDARLHEKED  186

Query  982   -----RRRCYWGYCFESLATED----PGRSDGDRIH---DIDANVEYCAVIKTKIGAHRI  839
                  R+  Y+GY FES  T      P R+ G  +    D+D NV++C++IKTK+G +R+
Sbjct  187   LAPRQRQMTYYGYSFESWCTSSRPGIPERAKGHPVGWGGDVDTNVQWCSLIKTKLGDNRL  246

Query  838   LMGAEMDCCDSRDDGRR-FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVV  662
             ++G E+DC   + +GR   +VELKTS  + +   E  FE+ K+LKF++QSFL GVP IVV
Sbjct  247   VIGGEVDCVRDKFNGRTDTFVELKTSIMIRNAGDEARFEK-KMLKFYMQSFLLGVPEIVV  305

Query  661   GFRDDNGRLVRTERLRTNEITQRVKMK-SYWQGGVCLAFADEVLCWLYGTV  512
             GFR   G++  T+  +T ++ + V+ K   W   +C ++A + L  L  T+
Sbjct  306   GFRTPAGQITTTQSFKTVQLPRLVRGKPGAWDPQICFSWAQQFLTTLKSTL  356



>gb|KFY52962.1| hypothetical protein V496_08020 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=389

 Score =   138 bits (348),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 104/339 (31%), Positives = 162/339 (48%), Gaps = 40/339 (12%)
 Frame = -2

Query  1375  ARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDLG  1196
             A  S  ++ P E+AC+S   + +   D   LR +       +G+DL +GF++F +  D  
Sbjct  17    AGPSAPMKRPREIACFSYTSNHEYRPDASGLRYY---YPPRLGADLCKGFESFEKLDDSP  73

Query  1195  SQGFGDLLACIRN------KNIPLDRMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGV  1034
                   LL  I        K + +D    VT+R  + K++A  +   + +EM     +G 
Sbjct  74    DDHLDSLLKTIMGVEKEGGKKVEVD---VVTWRGMMTKLLACPFEERDGFEMNATFYQGT  130

Query  1033  VYLD---------------VHKLPERPKSELDRRRCYWGYCFESLA----TEDPGRSD--  917
             +Y++               +   P RP  ++     YWGY FE+L     T D    +  
Sbjct  131   IYIEENHSYKVQSQARQSKIQTAPGRPSQDM---MSYWGYKFETLCLLPDTWDATSREYI  187

Query  916   -GDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRR-FYVELKTSRELLDH  746
              G     ++   +YC+V++T IG   +++G E+D   DS+       +VELKTS +    
Sbjct  188   EGREEQIVNNAAQYCSVVQTGIGKTSLIIGGEVDAIWDSKSPTTPPNWVELKTSLDPSSP  247

Query  745   RTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSYWQG  566
             R  + FER KLLKFW+QSFL GVP I+VGFR+ +G L R E L T +I   VK +  W G
Sbjct  248   RALQTFER-KLLKFWLQSFLLGVPKIIVGFRNADGLLRRLEELETAKIPGIVKKRGGWDG  306

Query  565   GVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
              V + F  EVL +L   V     + ++    S  LE+ +
Sbjct  307   NVAVNFGAEVLRFLKAVVNSEGVWRIRRAERSGVLEVFK  345



>ref|XP_004452439.1| PREDICTED: protein Dom3Z [Dasypus novemcinctus]
Length=407

 Score =   138 bits (348),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 89/307 (29%), Positives = 145/307 (47%), Gaps = 18/307 (6%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSD--LNEGF-DTFTEKRDLGSQGFGD  1178
             P EL C+S       + D R+LR +    T   G D  L +G+ D +  + +   +G   
Sbjct  56    PSELGCFSLDAQRQYHGDARALRYYSPPPTHGPGPDFDLRDGYADRYQPRDEEAREGLDH  115

Query  1177  LLACIRNKNIPLD------RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  +      L+          VT+R +L K++ T Y R E W++   + +G +YL   
Sbjct  116   LLRWLLEHRGQLEGGPGWLAGAVVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEV  175

Query  1015  KLPER-----PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P        +  L R   Y GY FE     D      D   +++ NV +C+V+++++G
Sbjct  176   ETPAARAQRLARPPLLRELMYMGYKFEQYMCADKPGGSPDPSGEVNTNVAFCSVLRSRLG  235

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
             +H +L   E+DC D +    +    YVELKT +E+        F R KLLK+W QSFL G
Sbjct  236   SHALLFSGEVDCRDPQAASTQPPGCYVELKTCKEMHSPGQRRSFYRHKLLKWWAQSFLPG  295

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             VP +V GFR+  G +   +   T E+ + V+  +  W   VC+ F    L +   TV ++
Sbjct  296   VPTVVAGFRNPEGFVCSLKTFPTMEMFEYVRNDRDGWSPSVCMNFCAAFLSFAQDTVVQD  355

Query  502   EDYILQF  482
             +  ++  
Sbjct  356   DPRLIHL  362



>gb|EMD33871.1| hypothetical protein CERSUDRAFT_97807 [Ceriporiopsis subvermispora 
B]
Length=455

 Score =   139 bits (350),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 106/334 (32%), Positives = 165/334 (49%), Gaps = 39/334 (12%)
 Frame = -2

Query  1414  VSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLN  1235
             + E   A    +   KS   Q+P  L  +S      + F D +LR +   +   +G++L 
Sbjct  42    IPERHLAYPSTSSPAKSVPFQQPTPLLTFSYDTSRTLSFTDSALRYY---VDPPLGAELR  98

Query  1234  EGFDTFTEKRDLGSQGFGDLL--ACIRNKNIP-----------LDRMHFVTYRNNLNKIM  1094
              G++ + ++   G +G  D L  A  R K              L  +  V++R  + KI+
Sbjct  99    YGYERWIKRP--GEKGRIDSLLKAVSRAKQTMGGGGGDGGSEWLKGIGVVSWRGVMTKIL  156

Query  1093  ATAYIRNEPWEMGVHKRKGVVYLDVH----KLPE----RPKSELDRRRCYWGYCFESLAT  938
                Y   + WE+ V    G +Y + H    KL E    RP   L     Y+GY FES +T
Sbjct  157   IAPYENRDAWELNVMLVDGTLYFEEHVSDAKLLEMEDMRPHHRLS---TYYGYSFESWST  213

Query  937   ED-PGRSDGDRIH------DIDANVEYCAVIKTKIGAHRILMGAEMDCCDSRDDGRRF-Y  782
                P R +    H      D+D +V++C+V+KTK+G  R+++G E+DC   +  G+   +
Sbjct  214   SSRPDRMEELSGHPPGWGGDVDTSVQWCSVVKTKLGDMRMVIGGEVDCVRDKFSGQTASF  273

Query  781   VELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEI  602
             VELKTS  +   + E  FE+ KLLKF+ QSFL GVP IVVGFR  +GRL   +  +T +I
Sbjct  274   VELKTSLAIRGPQDEAKFEK-KLLKFYFQSFLLGVPEIVVGFRTPSGRLTTIQSFKTIQI  332

Query  601   TQRVKMKS-YWQGGVCLAFADEVLCWLYGTVKEN  503
              + V+ K   W   +CL + +  L  L  T++E+
Sbjct  333   PRLVRGKPDAWDPTICLHWGNHFLNILKSTLQES  366



>ref|XP_007098807.1| PREDICTED: decapping and exoribonuclease protein isoform X1 [Panthera 
tigris altaica]
 ref|XP_007098808.1| PREDICTED: decapping and exoribonuclease protein isoform X2 [Panthera 
tigris altaica]
 ref|XP_007098809.1| PREDICTED: decapping and exoribonuclease protein isoform X3 [Panthera 
tigris altaica]
Length=397

 Score =   138 bits (348),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 92/314 (29%), Positives = 149/314 (47%), Gaps = 21/314 (7%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGS--DLNEGF-DTFTEKRDLGSQGFGD  1178
             P EL C+S       + D ++LR +    T   G   DL +G+ D +  + +   +G   
Sbjct  46    PSELGCFSLDAQRQYHGDAQALRYYSPPPTNGQGPNFDLRDGYPDRYQPRDEEIREGLDH  105

Query  1177  LLACIRNKNIPLD------RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  + +    L+          VT+R +L K++ T Y R E W++     +G +YL   
Sbjct  106   LLRWLLDHRGQLEGGPGWLAGAIVTWRGHLTKLLTTPYERQEGWQLAASPFQGTLYLSEV  165

Query  1015  KLPER-----PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P        +  L R   Y GY FE     D   S  D   +++ NV +C+V+++++G
Sbjct  166   ETPAARAQRLARPPLLRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLG  225

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
              H +L   E+DC D +    +    YVELKTS+E+        F R KLLK+W QSFL G
Sbjct  226   NHPLLFSGEVDCIDPQAPSTQPPTCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLLG  285

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             +P +V GFR+  G +   +   T E+ + V+  +  W   VC+ F    L +   TV ++
Sbjct  286   IPNVVAGFRNPEGFICSLKTFPTMEMFEYVRNDRDGWNPSVCMNFCAAFLSFAQNTVVQD  345

Query  502   ED---YILQFTPHS  470
             +    Y+  + P S
Sbjct  346   DPRLVYLFSWEPGS  359



>ref|XP_004390831.1| PREDICTED: protein Dom3Z [Trichechus manatus latirostris]
Length=397

 Score =   138 bits (347),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 91/307 (30%), Positives = 146/307 (48%), Gaps = 18/307 (6%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGS--DLNEGF-DTFTEKRDLGSQGFGD  1178
             P EL C+S       + D R+LR +    T   G   DL +G+ D +  + +   +G   
Sbjct  46    PSELGCFSLDAQRQYHGDARALRYYSPPPTNGPGPNFDLRDGYPDRYQPRDEEIREGLDH  105

Query  1177  LLACIRNKNIPLDR------MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  +      L+R         VT+R +L K++ T Y R E W++   + +G +YL   
Sbjct  106   LLRWLLEHRGQLERDPGWLAGAIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEI  165

Query  1015  KLPER-----PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P        +  L R   Y GY FE     D      D   +++ NV +C+V+++++G
Sbjct  166   ETPAARAQRLARPPLLRELMYMGYKFEQYMCADKPTGSPDPSGEVNTNVAFCSVLRSRLG  225

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
              H +L   E+DC D +    +    YVELKTS+E+        F R KLLK+W QSFL G
Sbjct  226   NHPLLFSGEVDCTDPQAPSTQPPACYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPG  285

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             VP +V GFR+  G +   +   T E+ + V+  +  W   VC+ F    L +   TV ++
Sbjct  286   VPNVVTGFRNPEGFICSLKTFPTMEMFENVRNDRDGWNPSVCMNFCAAFLSFAQSTVVQD  345

Query  502   EDYILQF  482
             +  ++  
Sbjct  346   DPRLVHL  352



>ref|XP_007527510.1| PREDICTED: decapping and exoribonuclease protein [Erinaceus europaeus]
Length=391

 Score =   138 bits (347),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 97/347 (28%), Positives = 158/347 (46%), Gaps = 21/347 (6%)
 Frame = -2

Query  1453  GYGRGNAPRDERFVSELKFAKSEETLARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLF  1274
             G  +G+ P  +R   E          +      + P +L C+S  +    + D R+LR +
Sbjct  5     GTKKGDEPLSKRPHLEPSLPTDPALYSGPFPFYRLPSQLGCFSLDEQRQYHGDARALRYY  64

Query  1273  KRLITEDIGS--DLNEGFDTFTEKRDLGSQ-GFGDLLACIRNKNIPLD------RMHFVT  1121
                 T   G   DL +G+    + RD   Q     LL  +      L+          VT
Sbjct  65    SPPPTSSQGPNFDLRDGYPDRYQPRDETVQEKLDHLLHWLMEHRGQLEGGPGWLAGATVT  124

Query  1120  YRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVHKLPERPKSELDR-----RRCYWGYC  956
             +R +L K++ T Y R E W++   + +G +YL   + P      L R        Y GY 
Sbjct  125   WRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPAARAQRLSRPPHLRELMYMGYK  184

Query  955   FESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIGAHRILMGAEMDCCDSR---DDGRRF  785
             FE     D      D   +++ NV +C+V+++++G H +L   E+DC DS+    +    
Sbjct  185   FEQYMCADKPGGSPDPSGEVNTNVAFCSVLRSRLGNHPLLFSGEVDCTDSKAPSPEPPTC  244

Query  784   YVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNE  605
             YVELKTS+E+     +  F R KLLK+W QSFL GVP +V GFR+  G +   +   T +
Sbjct  245   YVELKTSKEMHSLGQKRSFYRYKLLKWWAQSFLPGVPNVVAGFRNPEGFISSLKTFPTMK  304

Query  604   ITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKENED---YILQFTP  476
             + + V+  +  W   VC+ F    L + + TV +++    Y+  + P
Sbjct  305   MFEYVRNDREGWNPSVCMNFCAAFLTFAHNTVVQDDPRLVYLFSWEP  351



>ref|XP_006896224.1| PREDICTED: decapping and exoribonuclease protein [Elephantulus 
edwardii]
Length=397

 Score =   138 bits (347),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 90/307 (29%), Positives = 148/307 (48%), Gaps = 18/307 (6%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGS--DLNEGF-DTFTEKRDLGSQGFGD  1178
             P EL C+S       + D R+LR +    T   G   DL +G+ D +  + +   +G   
Sbjct  46    PSELGCFSLDAQRQYHGDARALRYYSPPPTNGTGPNFDLRDGYPDRYQPRDEEIREGLDH  105

Query  1177  LLACIRNKNIPLD------RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  +      L+          VT R +L K++ T Y + E W+    + +G +YL   
Sbjct  106   LLRWLLEHRGQLEGGPGWLAGAIVTLRGHLTKLLTTPYEQKEGWQFAASRFQGTLYLSEV  165

Query  1015  KLPER-----PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P        +S L +   Y GY FE     D   +  D   +++ NV +C+VI++++G
Sbjct  166   ETPAARAQRLAQSPLLQELKYMGYKFEQYMCADKPGASPDPSGEVNTNVAFCSVIRSRLG  225

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
              H +L  AE+DC D +   ++    YVELKTS+E+      + F R KLLK+W QSFL G
Sbjct  226   DHPLLFSAEVDCTDPQASPKQPPACYVELKTSKEMHTPGHWKSFYRHKLLKWWAQSFLPG  285

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             VP +V GFR+  G +   +   T ++ + V+  +  W   VC+ F    L +   TV ++
Sbjct  286   VPKVVAGFRNSEGFICSLKTFPTMKMFENVRYDRDGWNPSVCMNFCAAFLKFAQSTVVQD  345

Query  502   EDYILQF  482
             +  ++  
Sbjct  346   DPRLIHL  352



>emb|CEF83313.1| unnamed protein product [Fusarium graminearum]
Length=376

 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 107/344 (31%), Positives = 169/344 (49%), Gaps = 43/344 (13%)
 Frame = -2

Query  1378  LARKSTAIQEPCELACYSRVQDGDVYFDDRSLRLFKRLITEDIGSDLNEGFDTFTEKRDL  1199
              A +S  ++ P E AC+S   + +   D  SL+ +    T  +G+DL++GFDTF +  D 
Sbjct  13    FAGESQPVKRPKEFACFSYDDNHEFRLDGSSLKYY---YTPQLGADLSKGFDTFQKLDDT  69

Query  1198  GSQGFGDLLACIRNKNIPLDR---MHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVY  1028
             G      LL  I        +    + VT+R  + KIMAT +   + +EM     +    
Sbjct  70    GDDHLDSLLKTIVAHEQETGKKIDANVVTWRGMMTKIMATPFDNMDGFEMNATLYQVCPS  129

Query  1027  L----DVHKLPER------------PKSELDRRRCYWGYCFESLAT------EDPGRSDG  914
                  + +K+  R            P  E+ +   +WGY FE+L+T      E P     
Sbjct  130   FIEENNAYKVASRSNEGNNNRRRRGPPLEVMQ---FWGYKFETLSTLPAPWAETPREFIE  186

Query  913   DRIHDIDAN-VEYCAVIKTKIGAHRILMGAEMDCC-DSRDDGRRF---YVELKTSRELLD  749
             +R +++  N  +YC+V++T IG   + +G E+D   DS+ + +     +VELKTS E+ +
Sbjct  187   NRENEVVNNKAQYCSVVRTGIGKSVLCLGGEVDAIWDSKPEEKGSPINWVELKTSAEIRN  246

Query  748   HRTEEIFEREKLLKFWIQSFLAGVPYIVVGFRDDNGRLVRTERLRTNEITQRVKMKSY--  575
                 E F R KL+K+WIQSFL GVP IVVGFR  +G LV  + + T+ I + V   SY  
Sbjct  247   TGDMENFNR-KLMKYWIQSFLLGVPRIVVGFRTRDGILVEAKDIETHRIPETV--NSYPN  303

Query  574   --WQGGVCLAFADEVLCWLYGTVKENEDYILQFTPHSNRLELLR  449
               W   +C+ FA   L WL   + +   + ++  P S  +EL +
Sbjct  304   PKWNADMCVNFAATFLDWLSANITDEGVWRIKREPQSPTIELFK  347



>ref|XP_004695211.1| PREDICTED: protein Dom3Z [Condylura cristata]
Length=396

 Score =   137 bits (346),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 92/307 (30%), Positives = 146/307 (48%), Gaps = 18/307 (6%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLIT--EDIGSDLNEGFDTFTEKRDLGSQGFGD-  1178
             P EL C+S  +    + D R+LR +    T  +  G DL +G+    + RD   Q   D 
Sbjct  46    PSELGCFSLDEQRQYHGDARALRYYSPPPTNGQGPGFDLRDGYPDRYQPRDEAIQERLDH  105

Query  1177  LLACIRNKNIPLD------RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  +      L+          VT+R +L K++ T Y R E W++   + +G +YL   
Sbjct  106   LLRWLLEHRGQLEGGPGWLAGAIVTWRGHLTKLLTTPYERQEGWQLAATRFQGTLYLSEV  165

Query  1015  KLPER-----PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P        +  L R   Y GY FE     D   S  D   +++ NV +C+V+++++G
Sbjct  166   ETPAARAQRLSRPPLLREFMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLG  225

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
              H +L   E+DC D +    +    YVELKTS+E+      + F R KLLK+W QSFL G
Sbjct  226   NHPLLFSGEVDCTDPKAPSPQPPTCYVELKTSKEMHSPGQWKNFYRHKLLKWWAQSFLPG  285

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             VP +V GFR+  G +   +   T  + + V+     W   VC+ F    L +   TV ++
Sbjct  286   VPNVVAGFRNPEGFVCSLKTFPTMRMFEYVRNDHDGWNPSVCMNFCAAFLSFAQNTVVQD  345

Query  502   EDYILQF  482
             +  ++  
Sbjct  346   DPRLVHL  352



>ref|XP_005696616.1| PREDICTED: LOW QUALITY PROTEIN: decapping and exoribonuclease 
protein [Capra hircus]
Length=381

 Score =   137 bits (346),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 94/311 (30%), Positives = 149/311 (48%), Gaps = 18/311 (6%)
 Frame = -2

Query  1348  PCELACYSRVQDGDVYFDDRSLRLFKRLIT--EDIGSDLNEGFDTFTEKRDLGSQGFGD-  1178
             P EL C+S       + D R+LR +    T  +    DL +G+    + RD   Q   D 
Sbjct  46    PSELGCFSLDAQRQYHGDARALRYYSPPPTNGQSPNFDLRDGYPDRYQPRDEEVQERLDH  105

Query  1177  LLACIRNKNIPLD------RMHFVTYRNNLNKIMATAYIRNEPWEMGVHKRKGVVYLDVH  1016
             LL  +      L+          VT+R +L K++ T Y R E W++   + +G +YL   
Sbjct  106   LLRWLLAHRGQLEGGPGWLAGAIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEV  165

Query  1015  KLPER-----PKSELDRRRCYWGYCFESLATEDPGRSDGDRIHDIDANVEYCAVIKTKIG  851
             + P        +  L R   Y GY FE     D      D   +++ NV +C+V+++++G
Sbjct  166   ETPAARVQRLTRPPLLRELMYMGYKFEQYMCADKPGVSPDPSGEVNTNVAFCSVLRSRLG  225

Query  850   AHRILMGAEMDCCDSRDDGRR---FYVELKTSRELLDHRTEEIFEREKLLKFWIQSFLAG  680
              H +L   E+DC + +    +    YVELKTS+E+      + F R KLLK+W QSFL G
Sbjct  226   NHPLLFSGEVDCTNPQVPSTQPPTCYVELKTSKEMHSPGQWKSFYRHKLLKWWAQSFLPG  285

Query  679   VPYIVVGFRDDNGRLVRTERLRTNEITQRVKM-KSYWQGGVCLAFADEVLCWLYGTVKEN  503
             VP +V GFR+  G +   +  RT E+ + V+  +  W   VC+ F    L +   TV E+
Sbjct  286   VPNVVAGFRNPEGFVCSLKTFRTMEMFEYVRNDRDSWNPSVCMNFCAAFLSFAQNTVVED  345

Query  502   EDYILQFTPHS  470
             +  ++  +P S
Sbjct  346   DPRLVYSSPGS  356



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6434880733968