BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14726_g1_i2 len=1846 path=[2374:0-1378 @246@!:1379-1762
4135:1763-1845]

Length=1846
                                                                      Score     E

ref|XP_009617769.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      738   0.0      
ref|XP_009794224.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    735   0.0      
ref|XP_004236643.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      733   0.0      
gb|AFU52653.1|  beta-1,3-glucanase 20                                   733   0.0      
ref|XP_006350242.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    733   0.0      
ref|XP_011095873.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      727   0.0      
ref|XP_006449987.1|  hypothetical protein CICLE_v10014935mg             727   0.0      
ref|XP_006467225.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    724   0.0      
ref|XP_010252866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    719   0.0      
gb|EYU27631.1|  hypothetical protein MIMGU_mgv1a005395mg                718   0.0      
gb|KDP35551.1|  hypothetical protein JCGZ_08989                         711   0.0      
ref|XP_007048775.1|  Glucanase like protein                             707   0.0      
ref|XP_002307845.2|  hypothetical protein POPTR_0006s00420g             700   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010538439.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      699   0.0      
ref|XP_008384211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      696   0.0      
ref|XP_008464286.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    693   0.0      
ref|XP_009374821.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      694   0.0      
ref|XP_009354031.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    693   0.0      
ref|XP_002525026.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    691   0.0      Ricinus communis
ref|XP_011005766.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    691   0.0      
ref|XP_010052494.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      691   0.0      
ref|XP_010647335.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      691   0.0      
ref|XP_006373567.1|  glycosyl hydrolase family 17 family protein        690   0.0      
ref|XP_011040111.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    690   0.0      
ref|XP_010096495.1|  Glucan endo-1,3-beta-glucosidase 5                 689   0.0      
ref|XP_008782991.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      689   0.0      
gb|KGN64983.1|  hypothetical protein Csa_1G171050                       687   0.0      
ref|XP_008224651.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      689   0.0      
ref|XP_004139598.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    687   0.0      
emb|CAN82722.1|  hypothetical protein VITISV_034466                     687   0.0      Vitis vinifera
gb|EPS65725.1|  hypothetical protein M569_09051                         684   0.0      
ref|XP_007211994.1|  hypothetical protein PRUPE_ppa004783mg             685   0.0      
ref|XP_009407926.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    681   0.0      
ref|XP_004293418.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    680   0.0      
ref|XP_010929013.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    682   0.0      
ref|XP_010246560.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    671   0.0      
ref|XP_006414264.1|  hypothetical protein EUTSA_v10024947mg             671   0.0      
gb|KHN40227.1|  Glucan endo-1,3-beta-glucosidase 5                      668   0.0      
ref|XP_003528714.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    669   0.0      
ref|XP_007147571.1|  hypothetical protein PHAVU_006G135700g             669   0.0      
gb|AIR93902.1|  glucanase                                               667   0.0      
gb|KHN14405.1|  Glucan endo-1,3-beta-glucosidase 5                      667   0.0      
ref|XP_011005767.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    665   0.0      
ref|XP_002459936.1|  hypothetical protein SORBIDRAFT_02g017290          665   0.0      Sorghum bicolor [broomcorn]
ref|XP_009395841.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    664   0.0      
ref|NP_001141759.1|  uncharacterized protein LOC100273895 precursor     664   0.0      Zea mays [maize]
tpg|DAA60836.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    663   0.0      
ref|XP_003534750.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    662   0.0      
gb|KHN40768.1|  Glucan endo-1,3-beta-glucosidase 5                      661   0.0      
ref|XP_006857659.1|  hypothetical protein AMTR_s00061p00152190          660   0.0      
ref|XP_010440044.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    660   0.0      
ref|XP_007154071.1|  hypothetical protein PHAVU_003G088600g             660   0.0      
emb|CAB10499.1|  glucanase like protein                                 659   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_193451.2|  O-Glycosyl hydrolases family 17 protein               657   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434711.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    657   0.0      
gb|EAZ06546.1|  hypothetical protein OsI_28792                          658   0.0      Oryza sativa Indica Group [Indian rice]
dbj|BAD01673.1|  putative glycosyl hydrolase                            658   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010449654.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    657   0.0      
gb|ABN08871.1|  Glycoside hydrolase, family 17; X8                      656   0.0      Medicago truncatula
ref|XP_002870120.1|  glycosyl hydrolase family 17 protein               657   0.0      
ref|NP_001062739.1|  Os09g0272300                                       657   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006284895.1|  hypothetical protein CARUB_v10006187mg             655   0.0      
gb|EEC84224.1|  hypothetical protein OsI_30642                          656   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_009144687.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      655   0.0      
ref|XP_003594346.1|  Glucan endo-1,3-beta-glucosidase                   655   0.0      
ref|XP_004956438.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    655   0.0      
ref|NP_001061551.2|  Os08g0326500                                       657   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004973213.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    653   0.0      
emb|CDY35595.1|  BnaC01g21170D                                          653   0.0      
gb|ABD65105.1|  glycosyl hydrolase family protein                       650   0.0      Brassica oleracea
gb|AFK40769.1|  unknown                                                 649   0.0      
ref|XP_003568004.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      648   0.0      
gb|EAZ42319.1|  hypothetical protein OsJ_26891                          648   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010686601.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      647   0.0      
gb|KFK32198.1|  hypothetical protein AALP_AA6G210100                    646   0.0      
emb|CDP04554.1|  unnamed protein product                                637   0.0      
ref|XP_003637610.1|  Glucan endo-1,3-beta-glucosidase                   633   0.0      
emb|CBI41064.3|  unnamed protein product                                609   0.0      
ref|XP_009794225.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    603   0.0      
ref|XP_008464288.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    574   0.0      
ref|XP_008464287.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    573   0.0      
ref|XP_006661066.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    560   0.0      
ref|XP_006584113.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    560   0.0      
gb|EMS53962.1|  Glucan endo-1,3-beta-glucosidase 5                      545   0.0      
gb|KEH32712.1|  O-glycosyl hydrolase family 17 protein                  525   2e-179   
gb|AFK35356.1|  unknown                                                 519   1e-177   
gb|EMT28220.1|  Glucan endo-1,3-beta-glucosidase 5                      501   2e-170   
ref|XP_010257050.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 9      486   1e-162   
ref|XP_004288532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    474   6e-158   
ref|XP_004288531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    474   1e-157   
ref|XP_010257709.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    473   2e-157   
ref|XP_011034355.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    472   5e-157   
ref|XP_010657459.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 9      473   9e-157   
gb|EPS71987.1|  hypothetical protein M569_02770                         470   1e-156   
ref|XP_011010121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      469   4e-156   
ref|XP_010276412.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    469   5e-156   
emb|CDP03371.1|  unnamed protein product                                469   6e-156   
ref|XP_002319699.1|  glycosyl hydrolase family 17 family protein        469   8e-156   Populus trichocarpa [western balsam poplar]
ref|XP_009353157.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    469   8e-156   
ref|XP_004972550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    469   9e-156   
ref|XP_004139090.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    468   3e-155   
emb|CCH47219.1|  similar to glucan endo-1,3-beta-glucosidase            467   4e-155   
ref|XP_002277003.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      467   5e-155   Vitis vinifera
gb|KHN00669.1|  Glucan endo-1,3-beta-glucosidase 8                      466   5e-155   
ref|XP_008443646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      467   6e-155   
emb|CDP14258.1|  unnamed protein product                                466   7e-155   
ref|XP_004154666.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    467   7e-155   
ref|XP_008391677.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      466   9e-155   
ref|XP_002968123.1|  hypothetical protein SELMODRAFT_231117             465   1e-154   
ref|XP_006574750.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    466   2e-154   
ref|XP_002525445.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    465   2e-154   Ricinus communis
ref|XP_008806060.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    464   3e-154   
ref|XP_011078775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      465   3e-154   
ref|XP_003548760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    464   4e-154   
ref|XP_002985205.1|  hypothetical protein SELMODRAFT_121927             465   4e-154   
ref|XP_004250551.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      465   4e-154   
ref|XP_009421440.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    465   5e-154   
ref|XP_002966594.1|  hypothetical protein SELMODRAFT_86140              464   5e-154   
ref|XP_007161926.1|  hypothetical protein PHAVU_001G109400g             464   5e-154   
ref|XP_010257791.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      464   7e-154   
ref|XP_004498612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    464   8e-154   
ref|XP_002969872.1|  hypothetical protein SELMODRAFT_171231             464   8e-154   
gb|AAO37977.1|  putative beta-1,3 glucanase                             464   9e-154   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004493147.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    463   9e-154   
gb|KEH32093.1|  glucan endo-1,3-beta-glucosidase-like protein           464   3e-153   
ref|XP_002970359.1|  hypothetical protein SELMODRAFT_231628             462   3e-153   
gb|KEH39797.1|  glucan endo-1,3-beta-glucosidase-like protein           462   3e-153   
ref|XP_011097609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    464   4e-153   
gb|EYU24023.1|  hypothetical protein MIMGU_mgv1a004416mg                464   4e-153   
emb|CDP18694.1|  unnamed protein product                                462   5e-153   
gb|EYU24024.1|  hypothetical protein MIMGU_mgv1a004416mg                463   6e-153   
gb|KHN32753.1|  Glucan endo-1,3-beta-glucosidase 8                      461   7e-153   
ref|XP_006843517.1|  hypothetical protein AMTR_s00007p00020870          461   8e-153   
ref|XP_008386810.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    461   1e-152   
ref|XP_011078347.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      461   1e-152   
ref|XP_009786014.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    461   1e-152   
ref|XP_002982430.1|  hypothetical protein SELMODRAFT_155115             460   1e-152   
ref|XP_010054473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      460   1e-152   
ref|XP_009610199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    460   2e-152   
ref|XP_010672074.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    461   2e-152   
ref|XP_007030700.1|  O-Glycosyl hydrolases family 17 protein            460   2e-152   
ref|XP_004296615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    460   3e-152   
ref|XP_007016969.1|  O-Glycosyl hydrolases family 17 protein            460   3e-152   
ref|XP_006352469.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    460   3e-152   
gb|KDP39719.1|  hypothetical protein JCGZ_02739                         459   4e-152   
ref|XP_007161283.1|  hypothetical protein PHAVU_001G057100g             459   5e-152   
ref|XP_006474357.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    459   5e-152   
ref|XP_008465328.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    459   6e-152   
ref|XP_006299509.1|  hypothetical protein CARUB_v10015679mg             459   6e-152   
gb|KDP39750.1|  hypothetical protein JCGZ_02770                         458   9e-152   
gb|KDO73371.1|  hypothetical protein CISIN_1g011636mg                   458   1e-151   
ref|XP_009366428.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      458   1e-151   
dbj|BAK03700.1|  predicted protein                                      458   2e-151   
ref|XP_010048510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      457   2e-151   
ref|XP_004982257.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    458   2e-151   
ref|XP_010049931.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      458   2e-151   
ref|XP_004249143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    457   2e-151   
ref|XP_002445228.1|  hypothetical protein SORBIDRAFT_07g006340          458   2e-151   Sorghum bicolor [broomcorn]
ref|XP_008224566.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      457   3e-151   
ref|XP_004141142.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    457   3e-151   
ref|XP_006596135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    457   3e-151   
ref|XP_010513396.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    457   3e-151   
ref|XP_003523713.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    457   3e-151   
ref|XP_006476105.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    457   4e-151   
ref|XP_009605785.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    457   4e-151   
ref|XP_009112609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      457   4e-151   
ref|XP_010526287.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    457   4e-151   
gb|KHN10282.1|  Glucan endo-1,3-beta-glucosidase 5                      457   4e-151   
gb|AAQ90287.1|  beta-1,3-glucanase, acidic                              457   4e-151   Coffea arabica [arabica coffee]
ref|NP_189076.1|  O-Glycosyl hydrolases family 17 protein               457   5e-151   Arabidopsis thaliana [mouse-ear cress]
gb|KGN60639.1|  hypothetical protein Csa_2G005360                       456   6e-151   
emb|CBI28434.3|  unnamed protein product                                469   6e-151   
gb|AFU52646.1|  beta-1,3-glucanase 11                                   456   7e-151   
ref|XP_009418954.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    456   8e-151   
ref|XP_006348032.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    456   1e-150   
ref|XP_010536989.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      456   1e-150   
ref|XP_009376335.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      456   1e-150   
ref|XP_006488579.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    456   1e-150   
ref|XP_003624610.1|  Glucan endo-1,3-beta-glucosidase                   456   1e-150   
gb|KDO67009.1|  hypothetical protein CISIN_1g011468mg                   456   1e-150   
ref|XP_011082117.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      456   1e-150   
ref|XP_006599436.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    456   1e-150   
ref|XP_010036190.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    456   1e-150   
ref|XP_008812061.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      455   2e-150   
gb|KCW82758.1|  hypothetical protein EUGRSUZ_C04137                     458   2e-150   
ref|XP_004163604.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    455   2e-150   
emb|CDY03359.1|  BnaC09g09890D                                          455   2e-150   
ref|XP_009102513.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      455   2e-150   
ref|XP_008380615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      456   2e-150   
ref|XP_002313970.1|  hypothetical protein POPTR_0009s08030g             455   3e-150   Populus trichocarpa [western balsam poplar]
gb|KFK27342.1|  hypothetical protein AALP_AA8G370600                    454   3e-150   
ref|XP_008242583.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      455   3e-150   
ref|XP_006650710.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    455   3e-150   
dbj|BAK03448.1|  predicted protein                                      454   3e-150   
ref|XP_002281500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      454   3e-150   Vitis vinifera
ref|XP_010921014.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 9      455   3e-150   
ref|XP_010909077.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    454   4e-150   
emb|CDY48710.1|  BnaA09g09850D                                          454   4e-150   
ref|XP_010669627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      454   4e-150   
ref|XP_006418767.1|  hypothetical protein EUTSA_v10002822mg             456   4e-150   
ref|XP_006280397.1|  hypothetical protein CARUB_v10026324mg             454   4e-150   
ref|XP_002866250.1|  glycosyl hydrolase family 17 protein               454   4e-150   
gb|KDO80436.1|  hypothetical protein CISIN_1g047337mg                   454   5e-150   
ref|XP_008234046.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 9      454   5e-150   
ref|XP_008458070.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      454   5e-150   
ref|XP_009769717.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      453   5e-150   
ref|XP_010688142.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      454   6e-150   
ref|XP_007222660.1|  hypothetical protein PRUPE_ppa004964mg             454   6e-150   
ref|XP_010525845.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    454   7e-150   
ref|XP_010314012.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    453   7e-150   
ref|NP_200617.2|  glucan endo-1,3-beta-glucosidase 6                    453   7e-150   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011017570.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      454   8e-150   
ref|XP_006409040.1|  hypothetical protein EUTSA_v10022665mg             453   8e-150   
ref|XP_008240488.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    453   1e-149   
ref|XP_007204529.1|  hypothetical protein PRUPE_ppa017632mg             453   1e-149   
emb|CDX77431.1|  BnaA07g05690D                                          453   1e-149   
emb|CDY43882.1|  BnaC09g33610D                                          453   1e-149   
ref|XP_006372260.1|  hypothetical protein POPTR_0018s14730g             453   1e-149   
ref|XP_007207749.1|  hypothetical protein PRUPE_ppb004066mg             453   1e-149   
ref|XP_009760964.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 9      453   1e-149   
ref|XP_004239309.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      453   1e-149   
ref|XP_002888279.1|  glycosyl hydrolase family 17 protein               452   1e-149   
ref|XP_010470322.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    452   2e-149   
ref|XP_006362259.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    452   2e-149   
ref|XP_006483661.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    453   2e-149   
ref|XP_006355982.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    453   2e-149   
ref|XP_010488537.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    453   2e-149   
ref|XP_010496623.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    452   2e-149   
ref|NP_001130924.1|  putative O-Glycosyl hydrolase superfamily pr...    452   2e-149   Zea mays [maize]
gb|ACG29689.1|  glucan endo-1,3-beta-glucosidase 5 precursor            452   2e-149   Zea mays [maize]
ref|XP_009792149.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    452   2e-149   
ref|XP_010088872.1|  Glucan endo-1,3-beta-glucosidase 8                 452   2e-149   
ref|XP_002530371.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    452   3e-149   Ricinus communis
ref|XP_003526446.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    452   3e-149   
gb|KHG15443.1|  hypothetical protein F383_00171                         452   3e-149   
ref|XP_006283637.1|  hypothetical protein CARUB_v10004695mg             452   3e-149   
gb|KHG29709.1|  hypothetical protein F383_09866                         452   3e-149   
ref|XP_003619009.1|  Glucan endo-1,3-beta-glucosidase                   451   4e-149   
ref|XP_009793269.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    452   4e-149   
gb|KHN16471.1|  Glucan endo-1,3-beta-glucosidase 5                      452   4e-149   
ref|XP_006401129.1|  hypothetical protein EUTSA_v10013422mg             452   4e-149   
ref|XP_006826313.1|  hypothetical protein AMTR_s00004p00082670          452   4e-149   
gb|KHG03269.1|  hypothetical protein F383_27500                         452   4e-149   
gb|EYU23029.1|  hypothetical protein MIMGU_mgv1a006384mg                450   4e-149   
gb|KDP32321.1|  hypothetical protein JCGZ_13246                         452   5e-149   
ref|XP_010483379.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      451   6e-149   
gb|AAL24251.1|  AT5g58090/k21l19_70                                     451   7e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004513603.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    451   7e-149   
ref|XP_002869343.1|  glycosyl hydrolase family 17 protein               451   8e-149   
ref|XP_010252157.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    451   8e-149   
ref|XP_010086599.1|  Glucan endo-1,3-beta-glucosidase 8                 451   9e-149   
gb|EAZ06041.1|  hypothetical protein OsI_28283                          451   9e-149   Oryza sativa Indica Group [Indian rice]
ref|XP_009120323.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      451   1e-148   
gb|AIR93903.1|  glucanase                                               451   1e-148   
emb|CDY62695.1|  BnaA10g29270D                                          451   1e-148   
emb|CDM83452.1|  unnamed protein product                                451   1e-148   
ref|XP_009352686.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    450   1e-148   
emb|CDY66442.1|  BnaCnng50870D                                          451   1e-148   
ref|XP_010655026.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      451   1e-148   
ref|XP_010453200.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    450   1e-148   
ref|XP_006338109.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    450   1e-148   
gb|KHN10411.1|  Glucan endo-1,3-beta-glucosidase 8                      449   2e-148   
ref|XP_009388996.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    450   2e-148   
ref|XP_004508564.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    450   2e-148   
ref|XP_004955566.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    450   3e-148   
ref|XP_006657484.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   3e-148   
ref|NP_176656.1|  O-glycosyl hydrolases family 17 protein               449   3e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009623324.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   3e-148   
ref|XP_010443524.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   3e-148   
ref|XP_003550844.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   3e-148   
gb|AFU52650.1|  beta-1,3-glucanase 16                                   449   3e-148   
ref|XP_009369562.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   3e-148   
ref|XP_010913808.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   4e-148   
ref|XP_009797292.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   4e-148   
gb|KDO67128.1|  hypothetical protein CISIN_1g010789mg                   450   4e-148   
ref|XP_010438078.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      449   4e-148   
ref|XP_009395879.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    450   4e-148   
ref|NP_194843.1|  glucan endo-1,3-beta-glucosidase 5                    449   5e-148   Arabidopsis thaliana [mouse-ear cress]
gb|EPS74227.1|  beta-1,3-glucanase, acidic                              447   5e-148   
ref|XP_011009207.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      449   6e-148   
ref|XP_009781628.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   7e-148   
ref|XP_002991155.1|  hypothetical protein SELMODRAFT_132967             449   7e-148   
gb|KFK39737.1|  hypothetical protein AALP_AA3G281400                    447   7e-148   
ref|XP_010447615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    448   9e-148   
ref|XP_010432901.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    448   1e-147   
ref|XP_002459388.1|  hypothetical protein SORBIDRAFT_02g003910          448   1e-147   
ref|XP_007151834.1|  hypothetical protein PHAVU_004G079100g             448   1e-147   
ref|XP_008466353.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      448   1e-147   
ref|NP_001061277.1|  Os08g0224500                                       448   1e-147   
ref|XP_002515573.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    448   1e-147   
ref|XP_010553811.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    448   1e-147   
ref|XP_003574453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      448   2e-147   
ref|XP_003557824.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    448   2e-147   
ref|NP_001045844.1|  Os02g0139300                                       448   2e-147   
emb|CDM86682.1|  unnamed protein product                                448   2e-147   
ref|XP_009392760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    447   2e-147   
gb|EAY84415.1|  hypothetical protein OsI_05789                          448   2e-147   
ref|NP_179534.1|  O-Glycosyl hydrolases family 17 protein               447   2e-147   
ref|XP_010436174.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    441   2e-147   
ref|XP_006382223.1|  hypothetical protein POPTR_0006s29500g             448   2e-147   
ref|XP_009626950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    448   2e-147   
ref|XP_009390478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    447   3e-147   
ref|XP_006297581.1|  hypothetical protein CARUB_v10013602mg             447   3e-147   
ref|XP_004239361.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    447   3e-147   
ref|XP_006450066.1|  hypothetical protein CICLE_v10008079mg             447   3e-147   
ref|XP_009601131.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    447   4e-147   
ref|XP_002324127.1|  hypothetical protein POPTR_0018s04200g             447   4e-147   
ref|XP_004951931.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    447   4e-147   
dbj|BAJ98060.1|  predicted protein                                      447   4e-147   
dbj|BAJ90806.1|  predicted protein                                      447   5e-147   
ref|XP_010929423.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    446   5e-147   
ref|XP_008362938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    446   6e-147   
gb|AAS99718.1|  At1g64760                                               446   6e-147   
ref|XP_008787369.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      446   6e-147   
ref|XP_001754617.1|  predicted protein                                  446   6e-147   
ref|XP_002324967.2|  hypothetical protein POPTR_0018s06250g             446   6e-147   
ref|XP_009595444.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 9      446   7e-147   
ref|XP_009126789.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    446   7e-147   
ref|XP_004136331.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    446   8e-147   
ref|XP_006601109.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    446   8e-147   
ref|XP_006837787.1|  hypothetical protein AMTR_s00104p00085600          445   1e-146   
dbj|BAD31779.1|  putative 3-glucanase                                   445   1e-146   
ref|XP_003573567.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    446   1e-146   
ref|XP_002325410.1|  hypothetical protein POPTR_0019s04850g             446   2e-146   
dbj|BAK05853.1|  predicted protein                                      445   3e-146   
gb|EYU37424.1|  hypothetical protein MIMGU_mgv1a005873mg                444   3e-146   
ref|XP_009354235.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    444   3e-146   
ref|XP_010048500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      444   3e-146   
ref|XP_002970933.1|  hypothetical protein SELMODRAFT_267465             444   3e-146   
gb|AES75227.2|  O-glycosyl hydrolase family 17 protein                  442   3e-146   
ref|XP_008349548.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    444   4e-146   
ref|XP_010672072.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      444   4e-146   
ref|XP_006412625.1|  hypothetical protein EUTSA_v10025047mg             444   5e-146   
ref|XP_002466725.1|  hypothetical protein SORBIDRAFT_01g012900          444   5e-146   
ref|XP_009336879.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    444   7e-146   
ref|XP_004296055.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    443   7e-146   
gb|EPS66439.1|  hypothetical protein M569_08338                         441   8e-146   
ref|XP_004288682.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    443   8e-146   
gb|KDP45782.1|  hypothetical protein JCGZ_17389                         443   9e-146   
dbj|BAJ85378.1|  predicted protein                                      443   1e-145   
gb|ADN34155.1|  glucan endo-13-beta-glucosidase                         443   1e-145   
ref|XP_011003008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    444   1e-145   
emb|CDX68724.1|  BnaC01g07290D                                          443   1e-145   
gb|EYU25788.1|  hypothetical protein MIMGU_mgv1a027166mg                442   1e-145   
ref|XP_008463840.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 9      443   1e-145   
ref|XP_002883518.1|  glycosyl hydrolase family 17 protein               441   1e-145   
gb|KHN05785.1|  Glucan endo-1,3-beta-glucosidase 8                      442   2e-145   
ref|XP_009127212.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      442   2e-145   
ref|XP_007204344.1|  hypothetical protein PRUPE_ppa005641mg             441   2e-145   
ref|XP_008467025.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      443   2e-145   
ref|XP_009776006.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    442   2e-145   
ref|XP_006578454.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    443   2e-145   
ref|XP_006451059.1|  hypothetical protein CICLE_v10007363mg             457   4e-145   
ref|XP_011003475.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    441   6e-145   
emb|CDY28246.1|  BnaA01g06030D                                          441   6e-145   
gb|AAT42176.1|  putative 3-glucanase                                    441   6e-145   
emb|CDY02795.1|  BnaC02g10940D                                          441   7e-145   
ref|XP_008678187.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    441   7e-145   
ref|XP_010528719.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    441   8e-145   
ref|NP_001058984.2|  Os07g0168600                                       443   8e-145   
ref|XP_010415342.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    440   1e-144   
ref|XP_004981482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    441   1e-144   
ref|XP_010549610.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    440   1e-144   
ref|XP_008781699.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    440   1e-144   
ref|XP_007012497.1|  O-Glycosyl hydrolases family 17 protein            440   1e-144   
ref|XP_004982258.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    440   1e-144   
ref|XP_007013263.1|  O-Glycosyl hydrolases family 17 protein            440   2e-144   
ref|XP_010517383.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    440   2e-144   
gb|KFK29702.1|  hypothetical protein AALP_AA7G168000                    439   2e-144   
ref|XP_003541322.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    440   2e-144   
ref|XP_008361509.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    439   2e-144   
gb|EMT08496.1|  Glucan endo-1,3-beta-glucosidase 5                      440   2e-144   
dbj|BAJ95993.1|  predicted protein                                      440   2e-144   
ref|XP_010278473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      439   3e-144   
ref|XP_004143223.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    439   3e-144   
ref|XP_009388760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    440   3e-144   
gb|KEH41651.1|  O-glycosyl hydrolase family 17 protein                  439   3e-144   
ref|XP_010273788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    440   3e-144   
ref|XP_006425144.1|  hypothetical protein CICLE_v10027796mg             452   3e-144   
ref|XP_002463758.1|  hypothetical protein SORBIDRAFT_01g005610          439   4e-144   
ref|XP_010939839.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    439   4e-144   
ref|XP_008338651.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    439   4e-144   
ref|XP_002528007.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    439   5e-144   
ref|XP_008354799.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    439   5e-144   
ref|XP_006850025.1|  hypothetical protein AMTR_s00022p00188990          439   6e-144   
ref|NP_001147672.1|  glucan endo-1,3-beta-glucosidase 5                 439   6e-144   
ref|XP_004246072.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      438   7e-144   
ref|NP_001151032.1|  glucan endo-1,3-beta-glucosidase 6 precursor       438   8e-144   
ref|XP_010463871.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    438   1e-143   
ref|XP_007155137.1|  hypothetical protein PHAVU_003G176600g             454   1e-143   
ref|XP_004979540.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    438   1e-143   
emb|CDP09239.1|  unnamed protein product                                454   1e-143   
ref|XP_004500308.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    437   1e-143   
ref|XP_002884423.1|  glycosyl hydrolase family 17 protein               438   1e-143   
ref|XP_010685906.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    438   1e-143   
ref|XP_007222346.1|  hypothetical protein PRUPE_ppa004814mg             437   1e-143   
ref|XP_003559620.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    437   2e-143   
ref|XP_010032975.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 9      437   2e-143   
ref|XP_009418582.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    437   2e-143   
ref|XP_010485770.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    437   3e-143   
ref|XP_010467891.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    436   3e-143   
gb|AAD38251.1|AC006193_7  Similar to glucan endo-1,3-beta-glucosi...    435   4e-143   
gb|EPS63303.1|  hypothetical protein M569_11481                         435   5e-143   
gb|KFK37837.1|  hypothetical protein AALP_AA3G035600                    438   6e-143   
ref|XP_009363574.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    436   6e-143   
ref|XP_010454046.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    436   7e-143   
gb|EPS65796.1|  hypothetical protein M569_08979                         436   7e-143   
gb|ABK25447.1|  unknown                                                 435   8e-143   
ref|XP_006580871.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    435   8e-143   
ref|XP_006297514.1|  hypothetical protein CARUB_v10013538mg             436   8e-143   
ref|XP_009336373.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    435   8e-143   
ref|XP_006289696.1|  hypothetical protein CARUB_v10003257mg             436   9e-143   
ref|XP_006851012.1|  hypothetical protein AMTR_s00025p00220320          436   9e-143   
ref|XP_010928748.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    435   1e-142   
ref|XP_011093909.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    436   1e-142   
ref|XP_006400369.1|  hypothetical protein EUTSA_v10015448mg             436   1e-142   
ref|XP_010261306.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    435   1e-142   
ref|XP_007207576.1|  hypothetical protein PRUPE_ppa018453mg             434   2e-142   
ref|XP_009412333.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    433   2e-142   
gb|KHG25475.1|  hypothetical protein F383_09937                         433   2e-142   
ref|XP_006659939.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    434   2e-142   
ref|XP_006836569.1|  hypothetical protein AMTR_s00131p00072670          435   2e-142   
ref|XP_003550587.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    435   2e-142   
ref|XP_010495273.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    435   2e-142   
ref|XP_006355222.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    435   2e-142   
ref|XP_003575938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    435   2e-142   
ref|XP_010528707.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    435   2e-142   
gb|KDP33989.1|  hypothetical protein JCGZ_07560                         434   3e-142   
ref|XP_007146823.1|  hypothetical protein PHAVU_006G072800g             434   3e-142   
ref|XP_004150617.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    435   3e-142   
gb|ACG41694.1|  glucan endo-1,3-beta-glucosidase 5 precursor            434   3e-142   
ref|NP_001068140.2|  Os11g0577800                                       434   3e-142   
gb|KHN38236.1|  Glucan endo-1,3-beta-glucosidase 8                      434   3e-142   
ref|XP_008219823.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    434   4e-142   
ref|XP_009121000.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      434   4e-142   
ref|XP_010099734.1|  Glucan endo-1,3-beta-glucosidase 6                 434   4e-142   
ref|XP_009618025.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    434   5e-142   
ref|NP_001140660.1|  putative O-Glycosyl hydrolase superfamily pr...    434   5e-142   
ref|XP_007048158.1|  O-Glycosyl hydrolases family 17 protein, put...    433   5e-142   
ref|XP_007154528.1|  hypothetical protein PHAVU_003G126100g             434   5e-142   
ref|XP_004168772.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    434   5e-142   
gb|AFU52639.1|  beta-1,3-glucanase 4                                    433   6e-142   
ref|XP_010669543.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      434   8e-142   
gb|EAZ18823.1|  hypothetical protein OsJ_34360                          433   8e-142   
ref|XP_009130411.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      433   8e-142   
gb|KHN46790.1|  Glucan endo-1,3-beta-glucosidase 8                      431   8e-142   
ref|XP_003537313.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    433   9e-142   
ref|XP_010420566.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    433   1e-141   
ref|XP_009407893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      433   1e-141   
ref|XP_002449743.1|  hypothetical protein SORBIDRAFT_05g022490          433   1e-141   
gb|KHN22800.1|  Glucan endo-1,3-beta-glucosidase 9                      432   1e-141   
ref|XP_008232375.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    432   1e-141   
ref|XP_003599335.1|  Glucan endo-1,3-beta-glucosidase                   432   2e-141   
ref|XP_002873877.1|  predicted protein                                  432   2e-141   
ref|XP_002530257.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    432   2e-141   
ref|NP_197323.1|  O-Glycosyl hydrolases family 17 protein               432   2e-141   
ref|XP_004303439.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    432   2e-141   
emb|CDP19937.1|  unnamed protein product                                432   3e-141   
ref|XP_007138338.1|  hypothetical protein PHAVU_009G200400g             432   3e-141   
ref|XP_004242904.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    432   3e-141   
ref|XP_002976170.1|  hypothetical protein SELMODRAFT_104523             434   3e-141   
emb|CDY42897.1|  BnaC05g47540D                                          432   3e-141   
ref|XP_009369739.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    431   5e-141   
gb|KDO55074.1|  hypothetical protein CISIN_1g048257mg                   431   7e-141   
ref|XP_006443394.1|  hypothetical protein CICLE_v10023781mg             431   7e-141   
gb|EAY81406.1|  hypothetical protein OsI_36575                          431   7e-141   
ref|XP_004508054.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    431   7e-141   
ref|XP_010687609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    431   8e-141   
gb|KHN20653.1|  Glucan endo-1,3-beta-glucosidase 8                      431   8e-141   
ref|XP_008391995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    431   8e-141   
ref|XP_008776624.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    430   9e-141   
ref|XP_010914019.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      430   9e-141   
ref|XP_008800518.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    431   1e-140   
ref|XP_008392630.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    430   1e-140   
gb|KFK26060.1|  hypothetical protein AALP_AA8G198000                    430   1e-140   
ref|XP_003528268.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    430   1e-140   
ref|XP_002968207.1|  hypothetical protein SELMODRAFT_89756              432   2e-140   
ref|XP_001775842.1|  predicted protein                                  430   2e-140   
gb|KDO55075.1|  hypothetical protein CISIN_1g011532mg                   429   2e-140   
ref|XP_006443393.1|  hypothetical protein CICLE_v10019922mg             429   2e-140   
ref|XP_008373974.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      429   2e-140   
ref|XP_009783390.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    429   3e-140   
ref|XP_006408232.1|  hypothetical protein EUTSA_v10020592mg             429   3e-140   
ref|NP_187051.3|  O-glycosyl hydrolases family 17 protein               429   3e-140   
ref|XP_003561381.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    429   4e-140   
ref|XP_002275701.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      428   5e-140   
ref|XP_010095481.1|  Glucan endo-1,3-beta-glucosidase 5                 429   5e-140   
ref|XP_010543745.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 9      428   6e-140   
emb|CAN62816.1|  hypothetical protein VITISV_031885                     428   6e-140   
ref|XP_009610855.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    427   7e-140   
ref|XP_008804107.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    429   8e-140   
ref|XP_003552935.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    428   8e-140   
ref|XP_006648298.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    426   1e-139   
ref|XP_011025580.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    427   1e-139   
ref|XP_009393970.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    427   2e-139   
ref|XP_010681060.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    427   2e-139   
gb|AFK43211.1|  unknown                                                 427   2e-139   
ref|XP_009786880.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    427   2e-139   
ref|XP_002277217.3|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      426   4e-139   
ref|XP_010453760.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    426   4e-139   



>ref|XP_009617769.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Nicotiana tomentosiformis]
Length=479

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/455 (79%), Positives = 402/455 (88%), Gaps = 1/455 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ES IGVNWGTI++H++ PSTVVDLL++N IQKVKLFDADP V+  LMGSG+EVMVGIPN+
Sbjct  24    ESDIGVNWGTISLHRMSPSTVVDLLKDNKIQKVKLFDADPDVMKGLMGSGLEVMVGIPND  83

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA +SSS +A+DLWV+QN++RY+V GGVNI+YVAVGNEPFL SYSGQ+QSYVVPA+TN+
Sbjct  84    MLALLSSSVAASDLWVSQNVSRYMVKGGVNIRYVAVGNEPFLTSYSGQYQSYVVPAMTNL  143

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             Q+SLAKANL   VKLVVPCNADAYESSLPSQG FRPELTQI+TQLVS LNSN SPFVVNI
Sbjct  144   QESLAKANLARNVKLVVPCNADAYESSLPSQGTFRPELTQIITQLVSFLNSNGSPFVVNI  203

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEGT H V DGPNVYSNAFDGNLDTL+AAL+K+GYSQMPIVI
Sbjct  204   YPFLSLYGNSDFPQDYAFFEGTTHAVTDGPNVYSNAFDGNLDTLIAALAKIGYSQMPIVI  263

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA SANLTAAR FNQGL  HVL NKGTPLRPGVPP+DVYLFSLFDE  KS+L
Sbjct  264   GEVGWPTDGAISANLTAARVFNQGLAKHVLSNKGTPLRPGVPPMDVYLFSLFDEGAKSVL  323

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLA  576
             PG+FERHWG+FSFDGQ KYPL+LGNG LKNA+DV YLPYRWC+ NP K+L+  +NH ++A
Sbjct  324   PGNFERHWGIFSFDGQSKYPLNLGNGPLKNAKDVQYLPYRWCVANPYKNLAEAANHFKIA  383

Query  575   CSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDEC  396
             CS ADCTTL YGGSC GIG KGNISYAFNSYYQL KQNP+SCDFDGLG+VTFL+PS+ EC
Sbjct  384   CSYADCTTLNYGGSCYGIGAKGNISYAFNSYYQLQKQNPRSCDFDGLGMVTFLNPSIGEC  443

Query  395   RFLVGVTDTNNSSGFSlpll-tliiiISWGVWLFL  294
             RFLVGV+D   SSGF L      ++II W  WLFL
Sbjct  444   RFLVGVSDHTTSSGFMLHNNWISVLIILWDAWLFL  478



>ref|XP_009794224.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 isoform X1 [Nicotiana 
sylvestris]
Length=478

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/456 (78%), Positives = 404/456 (89%), Gaps = 2/456 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ES IGVNWGTI++HK+ PSTVVDLL++N IQKVKLFDADP V+  LMGSG+EVMVGIPN+
Sbjct  22    ESDIGVNWGTISLHKMSPSTVVDLLKDNKIQKVKLFDADPDVMKGLMGSGLEVMVGIPND  81

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA +SSS+ A+DLWV+QN++RY+V GGVNI+YVAVGNEPFL SYSGQ+QSYVVPA+TN+
Sbjct  82    MLALLSSSTVASDLWVSQNVSRYMVKGGVNIRYVAVGNEPFLTSYSGQYQSYVVPAMTNL  141

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             Q+SLAKANL   VKLVVPCNADAYESSLPSQG FRPELTQI+TQLVS LNSN SPFVVNI
Sbjct  142   QESLAKANLARNVKLVVPCNADAYESSLPSQGTFRPELTQIITQLVSFLNSNGSPFVVNI  201

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEGT H V DGPNVYSNAFDGNLDTL+AAL+K+GY QMPIVI
Sbjct  202   YPFLSLYGNSDFPQDYAFFEGTTHAVTDGPNVYSNAFDGNLDTLIAALAKIGYGQMPIVI  261

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA  ANLTAAR FNQGL+ HVL NKGTPLRPGVPP+DVYLFSLFDE  KS+L
Sbjct  262   GEVGWPTDGAIGANLTAARVFNQGLVKHVLSNKGTPLRPGVPPMDVYLFSLFDEGAKSVL  321

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLA  576
             PG+FERHWG+FSFDGQ KYPL+LGNG LKNA+DV YLPYRWC+ NP K+L+  ++H ++A
Sbjct  322   PGNFERHWGIFSFDGQSKYPLNLGNGPLKNAKDVQYLPYRWCVANPYKNLAEAADHFKIA  381

Query  575   CSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDEC  396
             CS ADCTTL YGGSC GIG KGNISYAFNSYYQL KQNP+SCDFDGLG+VTFL+PS+ EC
Sbjct  382   CSYADCTTLNYGGSCYGIGAKGNISYAFNSYYQLQKQNPRSCDFDGLGMVTFLNPSIGEC  441

Query  395   RFLVGVTDTNNSSGFSlpl--ltliiiISWGVWLFL  294
             RFLVGV+D   SSGF L    +++++I+ W  WLFL
Sbjct  442   RFLVGVSDHTTSSGFRLHNNWISVLLIVLWDAWLFL  477



>ref|XP_004236643.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Solanum lycopersicum]
Length=493

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/455 (79%), Positives = 402/455 (88%), Gaps = 2/455 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ES IGVNWGTI++HK+ P TVVDLL++N IQKVKLFDADPAV+  LMGSG+EVMVGIPN+
Sbjct  39    ESGIGVNWGTISLHKMSPFTVVDLLKQNKIQKVKLFDADPAVMKGLMGSGLEVMVGIPND  98

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA +SSS+SAADLWVAQN++RY+V GGVNIKYVAVGNEPFL SYSGQ+QSYVVPA+TN+
Sbjct  99    MLAGLSSSTSAADLWVAQNVSRYIVKGGVNIKYVAVGNEPFLTSYSGQYQSYVVPAMTNL  158

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
              QSLAKANL   VKLVVPCNADAYESSLPSQG FRPELT I+TQ+VSLLNSN SPFVVNI
Sbjct  159   LQSLAKANLARNVKLVVPCNADAYESSLPSQGTFRPELTPIITQMVSLLNSNGSPFVVNI  218

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEGT H V DGPNVY NAFDGNLDTL+AAL+K+GY QMPIVI
Sbjct  219   YPFLSLYGNSDFPQDYAFFEGTTHAVTDGPNVYYNAFDGNLDTLIAALAKIGYGQMPIVI  278

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA  ANLTAAR FNQGL+ HVL NKGTPLRP VPP+DVYLFSL DE  KS+L
Sbjct  279   GEVGWPTDGALGANLTAARVFNQGLVNHVLSNKGTPLRPQVPPMDVYLFSLLDEGAKSVL  338

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLA  576
             PG+FERHWG+FSFDGQ KYPL+LGNG LKNA+DV YLPYRWCI NP KDL+ V+NH+RLA
Sbjct  339   PGNFERHWGIFSFDGQSKYPLNLGNGLLKNAKDVEYLPYRWCIANPMKDLAEVTNHVRLA  398

Query  575   CSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDEC  396
             CS ADCTTL YGGSCN IG KGNISYAFNSYYQL KQNP+SCDFDGLG+VTFL+PS+ EC
Sbjct  399   CSYADCTTLNYGGSCNEIGAKGNISYAFNSYYQLQKQNPRSCDFDGLGMVTFLNPSIGEC  458

Query  395   RFLVGVTDTNNSSGFSlpll--tliiiISWGVWLF  297
             RFLVGV+D  +SSGF L     ++++I+ W  WLF
Sbjct  459   RFLVGVSDYASSSGFRLQNSWISVLLILLWDAWLF  493



>gb|AFU52653.1| beta-1,3-glucanase 20 [Solanum tuberosum]
Length=490

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/456 (79%), Positives = 403/456 (88%), Gaps = 2/456 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ES IGVNWGTI++HK+ P TVVDLL++N IQKVKLFDADPAV+  LMGSG+EVMVGIPN+
Sbjct  34    ESGIGVNWGTISLHKMSPFTVVDLLKQNKIQKVKLFDADPAVMKGLMGSGLEVMVGIPND  93

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA +SSS+SAADLWVAQN++RY+V GGVNIKYVAVGNEPFL SYSGQ+QSYVVPA+TN+
Sbjct  94    MLAGLSSSTSAADLWVAQNVSRYMVKGGVNIKYVAVGNEPFLTSYSGQYQSYVVPAMTNL  153

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
              QSLAKANL   VKLVVPCNADAYESSLPSQG FRPELT I+TQ+VSLLNSN SPFVVNI
Sbjct  154   LQSLAKANLARNVKLVVPCNADAYESSLPSQGTFRPELTPIITQMVSLLNSNGSPFVVNI  213

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEGT H V DGPNVY NAFDGNLDTL+AAL+K+GY QMPIVI
Sbjct  214   YPFLSLYGNSDFPQDYAFFEGTTHAVTDGPNVYYNAFDGNLDTLIAALAKIGYGQMPIVI  273

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA  ANLTAAR FNQGL+ HVL NKGTPLRP VPP+DVYLFSL DE  KS+L
Sbjct  274   GEVGWPTDGALGANLTAARVFNQGLVNHVLSNKGTPLRPQVPPMDVYLFSLLDEGAKSVL  333

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLA  576
             PG+FERHWG+FSFDGQ KYPL+LGNG LKNA+DV YLPYRWCI NP KDL+ V+NH+RLA
Sbjct  334   PGNFERHWGIFSFDGQSKYPLNLGNGLLKNAKDVEYLPYRWCIANPLKDLAEVTNHVRLA  393

Query  575   CSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDEC  396
             CS ADCTTL YGGSCN IG KGNISYAFNSYYQL KQNP+SCDFDGLG+VTFL+PS+ +C
Sbjct  394   CSYADCTTLNYGGSCNEIGAKGNISYAFNSYYQLQKQNPRSCDFDGLGMVTFLNPSIGKC  453

Query  395   RFLVGVTDTNNSSGFSlpll--tliiiISWGVWLFL  294
             RFLVGV+D  +SSGF L     ++++I+ W  WLFL
Sbjct  454   RFLVGVSDYASSSGFRLQDSWISVLLILLWDAWLFL  489



>ref|XP_006350242.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Solanum tuberosum]
Length=495

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/456 (79%), Positives = 402/456 (88%), Gaps = 2/456 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ES IGVNWGTI++HK+ P TVVDLL++N IQKVKLFDADPAV+  LMGSG+EVMVGIPN+
Sbjct  39    ESGIGVNWGTISLHKMSPFTVVDLLKQNKIQKVKLFDADPAVMKGLMGSGLEVMVGIPND  98

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA +SSS+SAADLWVAQN++RY+V GGVNIKYVAVGNEPFL SYSGQ+QSYVVPA+TN+
Sbjct  99    MLAGLSSSTSAADLWVAQNVSRYMVKGGVNIKYVAVGNEPFLTSYSGQYQSYVVPAMTNL  158

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
              QSLAKANL   VKLVVPCNADAYESSLPSQG FRPELT I+TQ+VSLLNSN SPFVVNI
Sbjct  159   LQSLAKANLARNVKLVVPCNADAYESSLPSQGTFRPELTPIITQMVSLLNSNGSPFVVNI  218

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEGT H V DGPNVY NAFDGNLDTL+AAL+K+GY QMPIVI
Sbjct  219   YPFLSLYGNSDFPQDYAFFEGTTHAVTDGPNVYYNAFDGNLDTLIAALAKIGYGQMPIVI  278

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA  ANLTAAR FNQGL+ HVL NKGTPLRP VPP+DVYLFSL DE  KS+L
Sbjct  279   GEVGWPTDGALGANLTAARVFNQGLVNHVLSNKGTPLRPQVPPMDVYLFSLLDEGAKSVL  338

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLA  576
             PG+FERHWG+FSFDGQ KYPL+LGNG LKNA+ V YLPYRWCI NP KDL+ V+NH+RLA
Sbjct  339   PGNFERHWGIFSFDGQSKYPLNLGNGLLKNAKHVEYLPYRWCIANPLKDLAEVTNHVRLA  398

Query  575   CSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDEC  396
             CS ADCTTL YGGSCN IG KGNISYAFNSYYQL KQNP+SCDFDGLG+VTFL+PS+ EC
Sbjct  399   CSYADCTTLNYGGSCNEIGAKGNISYAFNSYYQLQKQNPRSCDFDGLGMVTFLNPSIGEC  458

Query  395   RFLVGVTDTNNSSGFSlpll--tliiiISWGVWLFL  294
             RFLVGV+D  +SSGF L     ++++I+ W  WLFL
Sbjct  459   RFLVGVSDYASSSGFRLQNSWISVLLILLWDAWLFL  494



>ref|XP_011095873.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Sesamum indicum]
Length=480

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/433 (80%), Positives = 388/433 (90%), Gaps = 0/433 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ES IGVNWGTI+ H+L P TVVDLL++N I KVKLFDADP V+ ALMGSGIEVMVGIPNE
Sbjct  25    ESGIGVNWGTISFHRLSPETVVDLLKDNKIGKVKLFDADPTVMRALMGSGIEVMVGIPNE  84

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA +SSS++A+DLWV+QN++RY+V GGVNIKYVAVGNEPFL SYSGQFQS V+PA+ N+
Sbjct  85    MLAVLSSSTAASDLWVSQNVSRYMVKGGVNIKYVAVGNEPFLTSYSGQFQSLVLPALMNL  144

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL K NL G +KLVVPCNADAYESSLPSQGAFRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  145   QQSLVKVNLAGMIKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSFLNSNGSPFVVNI  204

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFF+GT HPVVDGPNVY NAFDGN DTLVAAL+KLGY QMPIVI
Sbjct  205   YPFLSLYGNSDFPQDYAFFDGTTHPVVDGPNVYYNAFDGNFDTLVAALTKLGYGQMPIVI  264

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA SAN +AA+AFNQGL+  VL N GTPLRPGVPP+DVYLF+L DE  KS+L
Sbjct  265   GEVGWPTDGALSANHSAAKAFNQGLVKRVLSNSGTPLRPGVPPMDVYLFALLDEGAKSVL  324

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLA  576
             PG+FERHWG+FSFDGQ KYPL+LGNG LKNA+ V YLP RWC+ NPN+DLS+V+NH +LA
Sbjct  325   PGNFERHWGIFSFDGQAKYPLNLGNGLLKNAKQVDYLPSRWCVANPNRDLSSVTNHFKLA  384

Query  575   CSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDEC  396
             C++ADCTTL YGGSCN IGE+GNISYAFNSYYQL KQNPQSCDFDGLG+VTFLDPSV +C
Sbjct  385   CNVADCTTLSYGGSCNNIGEQGNISYAFNSYYQLKKQNPQSCDFDGLGMVTFLDPSVGDC  444

Query  395   RFLVGVTDTNNSS  357
             +FLVGVTD N+ S
Sbjct  445   KFLVGVTDNNSLS  457



>ref|XP_006449987.1| hypothetical protein CICLE_v10014935mg [Citrus clementina]
 gb|ESR63227.1| hypothetical protein CICLE_v10014935mg [Citrus clementina]
Length=517

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/456 (79%), Positives = 396/456 (87%), Gaps = 10/456 (2%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWG+++ HKL PSTVVDLL+++ IQKVKLFDADP  L ALM SGI+VMVGIPNE
Sbjct  63    ESAIGVNWGSVSSHKLKPSTVVDLLKDSKIQKVKLFDADPDALVALMRSGIQVMVGIPNE  122

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA +SSS++A+DLWV QN++RYLV GG +I+Y+AVGNEPFL SY+GQFQSYVVPA+ N+
Sbjct  123   MLATLSSSTAASDLWVRQNVSRYLVKGGADIRYIAVGNEPFLTSYAGQFQSYVVPALLNL  182

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLAKANL G VKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVS LNSN SPF+VNI
Sbjct  183   QQSLAKANLAGYVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSFLNSNGSPFIVNI  242

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFP+DYAFFEGT+HPV DGPNVYSNAFDGN DTLVAALSKLGY QMPIVI
Sbjct  243   YPFLSLYGNSDFPEDYAFFEGTSHPVTDGPNVYSNAFDGNFDTLVAALSKLGYGQMPIVI  302

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA SANLTAAR FNQGLI HVL NKGTPLRPG PP+D+YLFSL DE  KSIL
Sbjct  303   GEVGWPTDGAISANLTAARTFNQGLINHVLSNKGTPLRPGAPPMDIYLFSLLDEGAKSIL  362

Query  755   PGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KYPL+  LGN  LKNAR+V YLP RWC+ NP++DLS V+NHI+
Sbjct  363   PGNFERHWGIFSFDGQAKYPLNLGLGNKVLKNARNVQYLPSRWCVANPSQDLSDVANHIK  422

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS+ADCTTL YGGSCNGIG KGNISYAFNSYYQL  QN +SC+FDGLG+VTFLDPSV 
Sbjct  423   LACSVADCTTLNYGGSCNGIGAKGNISYAFNSYYQLQMQNEKSCNFDGLGMVTFLDPSVG  482

Query  401   ECRFLVGVTDTNNSSGFSlplltliiiISWGVWLFL  294
             ECRF VGVT+T NSSGF            W V  FL
Sbjct  483   ECRFPVGVTNT-NSSGFR-------THNRWSVICFL  510



>ref|XP_006467225.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Citrus sinensis]
 gb|KDO78653.1| hypothetical protein CISIN_1g010142mg [Citrus sinensis]
Length=517

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/456 (78%), Positives = 394/456 (86%), Gaps = 10/456 (2%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWG+++ HKL PSTVVDLL++N IQKVKLFDADP  L ALM SGI+VMVGIPNE
Sbjct  63    ESAIGVNWGSVSSHKLKPSTVVDLLKDNKIQKVKLFDADPDALVALMRSGIQVMVGIPNE  122

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA +SSS++A+DLWV QN++RYLV GG +I+Y+AVGNEPFL SY+GQFQSYVVPA+ N+
Sbjct  123   MLATLSSSTAASDLWVRQNVSRYLVKGGADIRYIAVGNEPFLTSYAGQFQSYVVPALLNL  182

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLAKANL G VKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVS LNSN SPF+VNI
Sbjct  183   QQSLAKANLAGYVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSFLNSNGSPFIVNI  242

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFP+DYAFFEGT+HPV DGPNVYSNAFDGN DTLVAALSKLGY QMPIVI
Sbjct  243   YPFLSLYGNSDFPEDYAFFEGTSHPVTDGPNVYSNAFDGNFDTLVAALSKLGYGQMPIVI  302

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDG  SANLTAAR FNQGLI HVL NKGTPLRPG P +D+YLFSL DE  KSIL
Sbjct  303   GEVGWPTDGTISANLTAARTFNQGLINHVLSNKGTPLRPGAPSMDIYLFSLLDEGAKSIL  362

Query  755   PGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KYPL+  LGN  LKNAR+V YLP RWC+ NP++DLS V+NHI+
Sbjct  363   PGNFERHWGIFSFDGQAKYPLNLGLGNKVLKNARNVQYLPSRWCVANPSQDLSDVANHIK  422

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS+ADCTTL YGGSCNGIG KGNISYAFNSYYQL  QN +SC+FDGLG+VTFLDPSV 
Sbjct  423   LACSVADCTTLNYGGSCNGIGAKGNISYAFNSYYQLQMQNEKSCNFDGLGMVTFLDPSVG  482

Query  401   ECRFLVGVTDTNNSSGFSlplltliiiISWGVWLFL  294
             ECRF VGVT+T NSSGF            W V  FL
Sbjct  483   ECRFPVGVTNT-NSSGFR-------THNRWSVICFL  510



>ref|XP_010252866.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Nelumbo nucifera]
Length=482

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/434 (79%), Positives = 387/434 (89%), Gaps = 0/434 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGTI+ H+L PS VVDL++EN I KVK+FDA+P VL +LMGSGIEVMVGIPNE
Sbjct  24    ESAIGVNWGTISSHRLSPSIVVDLIKENKIHKVKIFDAEPDVLLSLMGSGIEVMVGIPNE  83

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA  SSS  AADLWV QN++RY+V GGV+I+Y+AVGNEPFL SYSGQFQ YV+PA+ N+
Sbjct  84    MLAVFSSSPVAADLWVRQNVSRYMVKGGVDIRYIAVGNEPFLTSYSGQFQPYVMPALLNL  143

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLAKANL G VKLVVPCNADAYES+LPSQGAFRPELTQIMTQLVS L++N SPFVVNI
Sbjct  144   QQSLAKANLAGFVKLVVPCNADAYESTLPSQGAFRPELTQIMTQLVSFLSANGSPFVVNI  203

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEGT HPV DG NVY NAFDGN DTLVAAL+++GY QMPIVI
Sbjct  204   YPFLSLYGNSDFPQDYAFFEGTTHPVADGQNVYYNAFDGNFDTLVAALNRIGYGQMPIVI  263

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA SANLTAARAFNQGLI H+L NKGTPLRPGVPP+D+YLFSL DE  KS L
Sbjct  264   GEVGWPTDGALSANLTAARAFNQGLINHILSNKGTPLRPGVPPMDIYLFSLLDEGAKSTL  323

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLA  576
             PG+FERHWG+FSFDGQ KY L++GNG LKNA++V YLP RWCI +P +DLS V +HI+LA
Sbjct  324   PGNFERHWGIFSFDGQAKYSLNMGNGVLKNAKNVQYLPSRWCIADPTRDLSGVVSHIKLA  383

Query  575   CSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDEC  396
             CS+ADCTTL YGGSCNGIG KGNISYAFNSYYQL KQ+ QSCDFDGLGLVTFLDPS+ +C
Sbjct  384   CSVADCTTLVYGGSCNGIGAKGNISYAFNSYYQLQKQDSQSCDFDGLGLVTFLDPSIGDC  443

Query  395   RFLVGVTDTNNSSG  354
             RFLVG++DT++SSG
Sbjct  444   RFLVGISDTSSSSG  457



>gb|EYU27631.1| hypothetical protein MIMGU_mgv1a005395mg [Erythranthe guttata]
Length=485

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/435 (79%), Positives = 388/435 (89%), Gaps = 1/435 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ES IGVNWGT+A+H+L P TVVDLL++NNI KVKLFDADP V+ ALMGSGIEVMVGIPNE
Sbjct  28    ESGIGVNWGTVALHRLAPDTVVDLLKDNNIAKVKLFDADPTVMKALMGSGIEVMVGIPNE  87

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML+ +S+S SA+DLWV+ N++RY+V  GV+IK+VAVGNEPFL+SYSGQFQ YV+PA+ N+
Sbjct  88    MLSLLSTSPSASDLWVSLNVSRYMVKRGVHIKFVAVGNEPFLSSYSGQFQPYVIPALMNL  147

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLAKANL GAVKLVVPCNADAYESSLPSQG FR +LT+I+TQLVS LNSN +PFVVNI
Sbjct  148   QQSLAKANLAGAVKLVVPCNADAYESSLPSQGTFRTDLTEIITQLVSFLNSNNAPFVVNI  207

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLY NSDFPQDYAFF GTAH V DGPNVY NAFDGN DTLVAAL KLG+ QMPIV+
Sbjct  208   YPFLSLYANSDFPQDYAFFNGTAHAVTDGPNVYYNAFDGNFDTLVAALGKLGFPQMPIVV  267

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA SANLTAA++FNQGL+  VL NKGTPLRPGVPP+DVYLFSLFDE GKS+L
Sbjct  268   GEVGWPTDGAPSANLTAAKSFNQGLVRSVLSNKGTPLRPGVPPMDVYLFSLFDEGGKSVL  327

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLA  576
             PG+FERHWG+FSFDGQ KYPL+LGNG LKNAR+V YLP RWC+ NP +DLSAV +H +LA
Sbjct  328   PGNFERHWGIFSFDGQAKYPLNLGNGMLKNAREVGYLPSRWCVANPTRDLSAVEDHFKLA  387

Query  575   CSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDEC  396
             CS ADCTTL YGGSCNGIGEKGN+SYAFNSYYQL KQNP+SC+FDGLGLVTFLDPSV +C
Sbjct  388   CSYADCTTLSYGGSCNGIGEKGNVSYAFNSYYQLQKQNPRSCEFDGLGLVTFLDPSVGDC  447

Query  395   RFLVGVTDTNNSSGF  351
             RFLVGVTD   S GF
Sbjct  448   RFLVGVTDV-KSLGF  461



>gb|KDP35551.1| hypothetical protein JCGZ_08989 [Jatropha curcas]
Length=482

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/457 (75%), Positives = 401/457 (88%), Gaps = 3/457 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGT++ HKL PSTVVDLL++N I+KVKLFDADP V+ +LMGSGI+VMVGI N+
Sbjct  25    ESAIGVNWGTVSFHKLKPSTVVDLLKDNKIEKVKLFDADPEVMRSLMGSGIQVMVGIQND  84

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA +SSS++ +DLWV QN++RY+V GGV+I+YVAVGNEPFL+SYSGQ+QSYV PA+ N+
Sbjct  85    MLAPISSSTAVSDLWVRQNVSRYMVKGGVDIRYVAVGNEPFLSSYSGQYQSYVYPAMVNL  144

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL+KANL G VKLVVPCNADAYESSLPSQGAFRPELT+IMTQ+VS LNSN SPFVVNI
Sbjct  145   QQSLSKANLAGYVKLVVPCNADAYESSLPSQGAFRPELTEIMTQVVSFLNSNGSPFVVNI  204

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYG++DFPQDYAFF G+ HPV DGPNVY+NAFDGN DTLVAALSK+GY QMPIVI
Sbjct  205   YPFLSLYGSTDFPQDYAFFYGSTHPVTDGPNVYNNAFDGNFDTLVAALSKIGYGQMPIVI  264

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA SAN++AA+AFNQGLIYHVL NKGTPLRP  PP+D+YLFSL DE  KS+L
Sbjct  265   GEVGWPTDGAISANISAAKAFNQGLIYHVLSNKGTPLRPNAPPMDIYLFSLLDEGAKSVL  324

Query  755   PGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KYPL+  LGN +LKNA++V YLP RWC+ +P KDLS V+NH+R
Sbjct  325   PGNFERHWGIFSFDGQAKYPLNLGLGNKELKNAKNVEYLPSRWCVADPTKDLSDVANHLR  384

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             +ACS+ADCTTL YGGSCN IG KGNISYAFNSYYQL  QN QSCDFDGLG+VTFLDPSV 
Sbjct  385   IACSVADCTTLNYGGSCNEIGAKGNISYAFNSYYQLKNQNEQSCDFDGLGMVTFLDPSVG  444

Query  401   ECRFLVGVTDTNNS-SGFSlplltliiiISWGVWLFL  294
             +C+FLVGVTDT++S S      + + I++ W +W+ L
Sbjct  445   DCKFLVGVTDTSSSTSRLYHRRIIIWILVEWWIWVSL  481



>ref|XP_007048775.1| Glucanase like protein [Theobroma cacao]
 gb|EOX92932.1| Glucanase like protein [Theobroma cacao]
Length=502

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/455 (76%), Positives = 392/455 (86%), Gaps = 2/455 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ES IGVNWGT++ HKL PSTVVDLL++NNIQKVKLF+ADP VL ALMGSGI+VMVGIPNE
Sbjct  46    ESVIGVNWGTLSFHKLKPSTVVDLLKDNNIQKVKLFEADPLVLRALMGSGIQVMVGIPNE  105

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA +S S +AADLWV QN++ Y+  GG +I+Y+AVGNEPFL SY+GQFQSYVVPA+ N+
Sbjct  106   MLATLSFSPAAADLWVRQNVSTYIGKGGADIRYIAVGNEPFLTSYAGQFQSYVVPAMVNL  165

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLA+ANL G VKLVVPCNADAYES++PSQGAFRPEL+QIMTQLVS LNSN SPFVVNI
Sbjct  166   QQSLARANLAGYVKLVVPCNADAYESNVPSQGAFRPELSQIMTQLVSFLNSNGSPFVVNI  225

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEGT HPV+DG N Y NAFDGN DTLVAALSK+GY QMPIVI
Sbjct  226   YPFLSLYGNSDFPQDYAFFEGTTHPVIDGSNTYYNAFDGNFDTLVAALSKIGYGQMPIVI  285

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA  ANLTAAR FNQGLI HVL NKGTPLRPGVPP+D+YLFSL DE  KS L
Sbjct  286   GEVGWPTDGAVGANLTAARVFNQGLINHVLSNKGTPLRPGVPPMDIYLFSLLDEGAKSTL  345

Query  755   PGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY L+  LGN +LKNAR+V YLP RWC+ +P+KDLS V+NH++
Sbjct  346   PGNFERHWGIFSFDGQAKYALNLGLGNKKLKNARNVQYLPSRWCVASPSKDLSDVANHMK  405

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             +AC++ADCTTL YGGSCN IG KGNISYAFNSYYQL  QN QSC+FDGLG+VTFLDPSV 
Sbjct  406   VACNVADCTTLDYGGSCNSIGAKGNISYAFNSYYQLQMQNEQSCNFDGLGVVTFLDPSVG  465

Query  401   ECRFLVGVTDTNNSSGFSlplltliiiISWGVWLF  297
             +CRFLVGVTDT++S       +   I+I W VW F
Sbjct  466   DCRFLVGVTDTSSSFRPYQRWVMSWILILWQVWAF  500



>ref|XP_002307845.2| hypothetical protein POPTR_0006s00420g [Populus trichocarpa]
 gb|EEE91368.2| hypothetical protein POPTR_0006s00420g [Populus trichocarpa]
Length=485

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/458 (76%), Positives = 390/458 (85%), Gaps = 4/458 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGTI+ H+L PSTVVDLL++N I+KVKLFDADP  L+AL+GSGIEVMVGIPNE
Sbjct  26    ESAIGVNWGTISFHRLKPSTVVDLLKDNKIKKVKLFDADPDALTALVGSGIEVMVGIPNE  85

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA +SSS+ A+DLWV QN++RY+V GG +I+YVAVGNEPFL SYSGQFQS+VVPA+ N+
Sbjct  86    MLAVLSSSTDASDLWVRQNVSRYVVKGGADIRYVAVGNEPFLTSYSGQFQSFVVPALLNL  145

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL G VKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  146   QQSLVKANLAGYVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSFLNSNGSPFVVNI  205

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYG+SDFPQDYAFFEG+ HPV DG NVY NAFDGN DTLV+AL+KLGY QMPIVI
Sbjct  206   YPFLSLYGHSDFPQDYAFFEGSTHPVTDGSNVYYNAFDGNFDTLVSALNKLGYGQMPIVI  265

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA  ANL+AAR FNQGLI HVL NKGTPLRP VPP+D+YLFSL DE  KS+L
Sbjct  266   GEVGWPTDGAFGANLSAARFFNQGLINHVLSNKGTPLRPRVPPVDIYLFSLLDEGAKSVL  325

Query  755   PGDFERHWGVFSFDGQLKYP--LDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY   L LGN  LKNA++V YLP RWC+ +P+KDL+ V+NH+R
Sbjct  326   PGNFERHWGIFSFDGQAKYALNLGLGNRLLKNAKNVEYLPSRWCVADPSKDLTNVANHMR  385

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             +ACS+ADCTTL YGGSCNGIG KGNISYAFNSYYQL  QN QSCDFDGLG+VTFLDPSV 
Sbjct  386   IACSVADCTTLDYGGSCNGIGAKGNISYAFNSYYQLQMQNAQSCDFDGLGMVTFLDPSVG  445

Query  401   ECRFLVGVTDTNNSSGFSlplltliiiIS--WGVWLFL  294
             +CRFLVGVTD   S  F        I  S  W VW FL
Sbjct  446   DCRFLVGVTDHKKSIAFRPTHRRTTIWTSILWWVWFFL  483



>ref|XP_010538439.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Tarenaya hassleriana]
Length=486

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/435 (78%), Positives = 379/435 (87%), Gaps = 2/435 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             +SAIGVNWGT++ H+L PSTVVDLLR+N I KVKLFDADP  L ALMGSGI+VMVGIPNE
Sbjct  25    QSAIGVNWGTVSFHRLKPSTVVDLLRDNKITKVKLFDADPGALGALMGSGIQVMVGIPNE  84

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML+++SSS  A+DLWV QNL+R++   G +I+YVAVGNEPFL SYSGQFQ+YVVPA+ N+
Sbjct  85    MLSSLSSSPLASDLWVRQNLSRFIGKSGADIRYVAVGNEPFLTSYSGQFQNYVVPALLNL  144

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL G VKLVVPCNADAYES+LPSQG FR ELTQIMTQLVS LNSN SPFVVNI
Sbjct  145   QQSLVKANLAGYVKLVVPCNADAYESNLPSQGVFRTELTQIMTQLVSFLNSNGSPFVVNI  204

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEG+ HPVVDGPNVY NAFDGN DTLVAALSKLGY QMPIV+
Sbjct  205   YPFLSLYGNSDFPQDYAFFEGSTHPVVDGPNVYYNAFDGNFDTLVAALSKLGYGQMPIVV  264

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDGA  ANLTAAR FNQGL+  +L NKGTPLRPG+PP+DVYLFSL DE  KS L
Sbjct  265   GEIGWPTDGAVGANLTAARVFNQGLVNRILSNKGTPLRPGMPPMDVYLFSLLDEGAKSTL  324

Query  755   PGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY L   LGN +LKNA++V YLP RWC+ NP++DL+ VSNH R
Sbjct  325   PGNFERHWGIFSFDGQAKYRLSLGLGNKELKNAKNVQYLPSRWCVANPSRDLNEVSNHFR  384

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS+ADCTTL YGGSCN IGEKGNISYAFNSYYQL  QN +SCDFDGLG+VTFLDPSV 
Sbjct  385   LACSVADCTTLNYGGSCNEIGEKGNISYAFNSYYQLQMQNEKSCDFDGLGMVTFLDPSVG  444

Query  401   ECRFLVGVTDTNNSS  357
             ECRFLVGVTD  +SS
Sbjct  445   ECRFLVGVTDKGSSS  459



>ref|XP_008384211.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Malus domestica]
Length=494

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/431 (78%), Positives = 376/431 (87%), Gaps = 2/431 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWG+++ H+L PS VVDL+++N I KVKLFDADP  L ALMGSGI+VMVGIPNE
Sbjct  26    ESAIGVNWGSVSFHRLKPSAVVDLMKDNKISKVKLFDADPDSLRALMGSGIQVMVGIPNE  85

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLAA+SSS+ A+DLWV QN++RY+V  G +I+Y+AVGNEPFL SYSGQFQSYV+P + N+
Sbjct  86    MLAALSSSTDASDLWVRQNVSRYMVKNGADIRYIAVGNEPFLTSYSGQFQSYVMPTLLNL  145

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLAK NL G VKLVVPCNADAYESSLPSQGAFRPELTQIMTQ+VS L SN SPFVVNI
Sbjct  146   QQSLAKVNLAGYVKLVVPCNADAYESSLPSQGAFRPELTQIMTQVVSFLYSNGSPFVVNI  205

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYG+SDFPQDYAFFEGT+HPV DG NVYSNAFDGN DTLVAALSKLGY QMPI I
Sbjct  206   YPFLSLYGSSDFPQDYAFFEGTSHPVTDGSNVYSNAFDGNFDTLVAALSKLGYGQMPIXI  265

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA +ANLTAAR FNQGLI HVL N+GTPLRPG PP+D+Y FSL DE  KS L
Sbjct  266   GEVGWPTDGAINANLTAARVFNQGLINHVLSNRGTPLRPGAPPVDIYXFSLLDEXAKSTL  325

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KYPL+LG G   LKNAR++ YLP RWC+  P+ DLS V+NH++
Sbjct  326   PGNFERHWGIFSFDGQAKYPLNLGLGSTGLKNARNIEYLPSRWCVAKPSGDLSDVANHMK  385

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS+ADCTTL YGGSCNGIG +GNISYAFNSYYQL  QN +SCDFDGLG+VTF DPSV 
Sbjct  386   LACSVADCTTLTYGGSCNGIGARGNISYAFNSYYQLQMQNERSCDFDGLGMVTFQDPSVG  445

Query  401   ECRFLVGVTDT  369
             ECRFLVGVTDT
Sbjct  446   ECRFLVGVTDT  456



>ref|XP_008464286.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 isoform X1 [Cucumis 
melo]
Length=481

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/430 (78%), Positives = 380/430 (88%), Gaps = 2/430 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGTI+ HKL P+TVVDLL+ N IQKVKLF+ADP+VL ALMG+GI+VM+GIPNE
Sbjct  24    ESAIGVNWGTISFHKLKPTTVVDLLKSNRIQKVKLFEADPSVLKALMGTGIQVMIGIPNE  83

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA++SSS  A+DLWV  NL+ Y+V GG +I+YVAVGNEPFL+SY+G++QSY++PA+ N+
Sbjct  84    MLASLSSSLLASDLWVRHNLSSYVVKGGADIRYVAVGNEPFLSSYNGEYQSYIMPALLNL  143

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLA+ANL   VKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  144   QQSLARANLASYVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSFLNSNGSPFVVNI  203

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEGT H V DG NVY NAFDGN DTLV+AL+K+GY QMPIVI
Sbjct  204   YPFLSLYGNSDFPQDYAFFEGTTHAVTDGSNVYYNAFDGNYDTLVSALTKIGYGQMPIVI  263

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA  ANLTAAR FNQGLI HVLGNKGTPLRPG PP+DVYLFSL DE  KS+L
Sbjct  264   GEVGWPTDGAMGANLTAARVFNQGLINHVLGNKGTPLRPGTPPVDVYLFSLLDEGAKSVL  323

Query  755   PGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KYPL+  LGN  LKNA+ V YLP RWCI NP +DL+ V+NHI+
Sbjct  324   PGNFERHWGIFSFDGQAKYPLNLGLGNKVLKNAKHVEYLPSRWCIANPFRDLTDVANHIK  383

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS+ADC+TL YGGSCNGIG KGNISYAFNSYYQL  QN +SC+FDGLG++TFLDPS+ 
Sbjct  384   LACSVADCSTLNYGGSCNGIGAKGNISYAFNSYYQLQMQNEKSCEFDGLGMITFLDPSIG  443

Query  401   ECRFLVGVTD  372
             ECRFLVGVTD
Sbjct  444   ECRFLVGVTD  453



>ref|XP_009374821.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Pyrus x bretschneideri]
Length=494

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/431 (78%), Positives = 378/431 (88%), Gaps = 2/431 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWG+++ HKL PS VVD +++N I KVKLFDADP  L ALMGSGI+VMVGIPNE
Sbjct  26    ESAIGVNWGSVSFHKLKPSAVVDFMKDNKISKVKLFDADPDSLRALMGSGIQVMVGIPNE  85

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLAA+SSS+ ++DLWV QN++RY+V  G +I+Y+AVGNEPFL SYSGQFQSYV+P + N+
Sbjct  86    MLAALSSSTDSSDLWVRQNVSRYMVKNGADIRYIAVGNEPFLTSYSGQFQSYVMPTLLNL  145

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLAK NL G VKLVVPCNADAYESSLPSQGAFRPELTQIMTQ+VS LNSN SPFVVNI
Sbjct  146   QQSLAKVNLAGYVKLVVPCNADAYESSLPSQGAFRPELTQIMTQVVSFLNSNGSPFVVNI  205

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYG+SDFPQDYAFFEGT+HPV DG NVYSNAFDGN DTLVAALSKLGY QMPI+I
Sbjct  206   YPFLSLYGSSDFPQDYAFFEGTSHPVTDGSNVYSNAFDGNFDTLVAALSKLGYGQMPIII  265

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA +ANLTAAR FNQGLI HVL N+GTPLRPG PP+D+Y+FSL DE  KS L
Sbjct  266   GEVGWPTDGAINANLTAARVFNQGLINHVLSNRGTPLRPGAPPVDIYIFSLLDEGAKSTL  325

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KYPL+LG G   LKNAR++ YLP RWC+  P+ DLS V+NH++
Sbjct  326   PGNFERHWGIFSFDGQAKYPLNLGLGSTGLKNARNIEYLPSRWCVAKPSGDLSDVANHMK  385

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS+ADCTTL YGGSCNGIG +GNISYAFNSYYQL  QN +SCDFDGLG+VTF DPSV 
Sbjct  386   LACSVADCTTLAYGGSCNGIGARGNISYAFNSYYQLQMQNERSCDFDGLGMVTFQDPSVG  445

Query  401   ECRFLVGVTDT  369
             ECRFLVGVTDT
Sbjct  446   ECRFLVGVTDT  456



>ref|XP_009354031.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Pyrus x bretschneideri]
Length=498

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/430 (79%), Positives = 377/430 (88%), Gaps = 2/430 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWG+++ HKL PS VVDLL++N I KVKLFDADP  L ALMGSGI+VMVGIPNE
Sbjct  26    ESAIGVNWGSVSFHKLKPSAVVDLLKDNKISKVKLFDADPDSLRALMGSGIQVMVGIPNE  85

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLAA+SSS+ A+DLWV QN++RY+V  G +I+Y+AVGNEPFL SYSGQFQSYV+PA+ N+
Sbjct  86    MLAALSSSTDASDLWVRQNVSRYMVKNGADIRYIAVGNEPFLTSYSGQFQSYVMPALLNL  145

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLAK NL   VKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  146   QQSLAKVNLASYVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSFLNSNGSPFVVNI  205

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYG+SDFPQDYAFFEGT+HPV DG NVYSNAFDGN DTLVAALSKLGY +MPI+I
Sbjct  206   YPFLSLYGSSDFPQDYAFFEGTSHPVTDGSNVYSNAFDGNFDTLVAALSKLGYGEMPIII  265

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA +ANLTAARAFNQGLI HVL N+GTPLRPG PP+DVY+FSL DE  KS L
Sbjct  266   GEVGWPTDGAINANLTAARAFNQGLINHVLSNRGTPLRPGAPPVDVYIFSLHDEGAKSTL  325

Query  755   PGDFERHWGVFSFDGQLKYP--LDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KYP  L LG   LKNAR+V YLP RWC+  P+ DLS V NH++
Sbjct  326   PGNFERHWGIFSFDGQAKYPLNLGLGGRGLKNARNVEYLPSRWCVAKPSGDLSDVVNHMK  385

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS+ADCTTL YGGSCNGIG KGNISYAFNSYYQL  QN +SCDFDGLG+VTFLDPSV 
Sbjct  386   LACSVADCTTLTYGGSCNGIGAKGNISYAFNSYYQLQMQNERSCDFDGLGMVTFLDPSVG  445

Query  401   ECRFLVGVTD  372
             ECRFLVGVTD
Sbjct  446   ECRFLVGVTD  455



>ref|XP_002525026.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF37353.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=480

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/434 (78%), Positives = 381/434 (88%), Gaps = 2/434 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ES IGVNWGT++  KL PSTVVDLL++NNIQKVKLFD DP V+ AL+GSGI+VMVGIPNE
Sbjct  23    ESGIGVNWGTVSFRKLKPSTVVDLLKDNNIQKVKLFDTDPDVMKALVGSGIQVMVGIPNE  82

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA++SSS++ +D+WV QN++ YLV GGV+I+Y+AVGNEPFL+SYSGQFQSYVVPA+ N+
Sbjct  83    MLASLSSSTAVSDMWVRQNISTYLVKGGVDIRYIAVGNEPFLSSYSGQFQSYVVPALQNL  142

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLAKANL G VKLVVPCNADAYESSLPSQG FRPELT IMTQLVS LNSN SPFVVNI
Sbjct  143   QQSLAKANLAGYVKLVVPCNADAYESSLPSQGTFRPELTDIMTQLVSFLNSNGSPFVVNI  202

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYG++DFPQDYAFF G+ HPV DG NVY NAFDGN DTLVAALSK+GY QMPIVI
Sbjct  203   YPFLSLYGSTDFPQDYAFFGGSTHPVTDGNNVYDNAFDGNFDTLVAALSKIGYGQMPIVI  262

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA SANLTAARAFNQGLI  VL NKGTPLRPG PP+D+YLFSL DE  KS L
Sbjct  263   GEVGWPTDGAISANLTAARAFNQGLIKQVLSNKGTPLRPGSPPLDIYLFSLLDEGAKSTL  322

Query  755   PGDFERHWGVFSFDGQLKYP--LDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY   L LGN  LKNAR+V YLP RWC+ +P KDLS V+NH+R
Sbjct  323   PGNFERHWGIFSFDGQAKYSLNLGLGNRLLKNARNVQYLPSRWCVADPAKDLSNVANHLR  382

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             +ACS+ADCTTL YGGSCN IG KGNISYAFNSYYQL  Q+ QSCDFDGLG+VTFLDPSV 
Sbjct  383   IACSVADCTTLNYGGSCNEIGAKGNISYAFNSYYQLQDQDAQSCDFDGLGMVTFLDPSVG  442

Query  401   ECRFLVGVTDTNNS  360
             +CRFLVGVTDT++S
Sbjct  443   DCRFLVGVTDTSSS  456



>ref|XP_011005766.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like isoform X1 
[Populus euphratica]
Length=485

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/458 (76%), Positives = 388/458 (85%), Gaps = 4/458 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGTI+ H+L PSTVVDLL++N I+KVKLFDAD   L+AL+GSGIEVMVGIPNE
Sbjct  26    ESAIGVNWGTISFHRLKPSTVVDLLKDNKIKKVKLFDADSDALTALVGSGIEVMVGIPNE  85

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLAA+SSS+ AADLWV QN++RY+V GG +I+YVAVGNEPFL SYSGQFQS+VVPA+ N+
Sbjct  86    MLAALSSSTEAADLWVRQNVSRYVVKGGADIRYVAVGNEPFLTSYSGQFQSFVVPALLNL  145

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL G VKLVVPCNADAYESSLPSQGAFR ELTQIMTQLVS LNSN SPFVVNI
Sbjct  146   QQSLVKANLAGYVKLVVPCNADAYESSLPSQGAFRSELTQIMTQLVSFLNSNGSPFVVNI  205

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEG+ HPV DG NVY NAFDGN DTLV+AL+KLGY QMPIVI
Sbjct  206   YPFLSLYGNSDFPQDYAFFEGSTHPVTDGSNVYYNAFDGNFDTLVSALNKLGYGQMPIVI  265

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA  ANL+AAR FNQGLI HVL NKGTPLRP VPP+D+YLFSL DE  KS+L
Sbjct  266   GEVGWPTDGAFGANLSAARFFNQGLINHVLSNKGTPLRPRVPPMDIYLFSLLDEGAKSVL  325

Query  755   PGDFERHWGVFSFDGQLKYP--LDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY   L LGN  LKNA++V YLP RWC+ +P+KDL+ V+NH+R
Sbjct  326   PGNFERHWGIFSFDGQAKYALNLGLGNRLLKNAKNVEYLPSRWCVADPSKDLTNVANHMR  385

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             +ACS+ADCTTL YGGSCNGIG KGNISYAFNSYYQL  QN QSCDFDGLG+VTFLDPSV 
Sbjct  386   IACSVADCTTLDYGGSCNGIGAKGNISYAFNSYYQLQMQNAQSCDFDGLGMVTFLDPSVG  445

Query  401   ECRFLVGVTDTNNSSGFSlplltliiiIS--WGVWLFL  294
             +CRFLVGVT    S  F        I  S  W VW FL
Sbjct  446   DCRFLVGVTGHKKSIAFRPTPRRTTIWTSILWWVWSFL  483



>ref|XP_010052494.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Eucalyptus grandis]
 gb|KCW76564.1| hypothetical protein EUGRSUZ_D00955 [Eucalyptus grandis]
Length=482

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/456 (75%), Positives = 392/456 (86%), Gaps = 3/456 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             E AIGVNWGTI+ H+L PSTVVDLL++N IQKVKLFDADP  L AL GSGIEVMVGIPNE
Sbjct  25    EPAIGVNWGTISFHRLRPSTVVDLLQQNKIQKVKLFDADPGALKALEGSGIEVMVGIPNE  84

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML  + SSS A+DLWV QN++ ++  GGV I+YVAVGNEPFL+SY+GQFQ+YV+PA+ N+
Sbjct  85    MLTVLGSSSVASDLWVRQNVSSFVGKGGVAIRYVAVGNEPFLSSYAGQFQNYVMPALLNL  144

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLAKANL G VKLVVPCNADAYE+ LPSQGAFRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  145   QQSLAKANLAGYVKLVVPCNADAYEADLPSQGAFRPELTQIMTQLVSFLNSNGSPFVVNI  204

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYG++DFPQDYAFF GT H V DG NVY+NAFDGN DTLVAAL+KLGY QMPIVI
Sbjct  205   YPFLSLYGSTDFPQDYAFFGGTTHAVTDGANVYTNAFDGNFDTLVAALTKLGYGQMPIVI  264

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA +ANLTAARAFNQGLI HVL N+GTPLRPGVPP+DVYLFSL DE  KS+L
Sbjct  265   GEVGWPTDGALNANLTAARAFNQGLINHVLSNRGTPLRPGVPPMDVYLFSLLDEGAKSVL  324

Query  755   PGDFERHWGVFSFDGQLKYP--LDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY   L LGN  LK+AR+V YLP RWC+ +P+KDLSAV NH++
Sbjct  325   PGNFERHWGIFSFDGQAKYALNLGLGNRLLKDARNVQYLPSRWCVADPSKDLSAVMNHMK  384

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS+ADCTTL YGGSCNGIG KGNISYAFNSYYQL  QN QSCDFDGLG+VTFLDPSV 
Sbjct  385   LACSVADCTTLNYGGSCNGIGAKGNISYAFNSYYQLQMQNSQSCDFDGLGMVTFLDPSVG  444

Query  401   ECRFLVGVTDTNNSS-GFSlplltliiiISWGVWLF  297
             ECRFLVGVT++ +++ G     + + +++ W VW+F
Sbjct  445   ECRFLVGVTESTSAAVGTYWRGVIVWVLVMWSVWVF  480



>ref|XP_010647335.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Vitis vinifera]
Length=492

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/457 (76%), Positives = 394/457 (86%), Gaps = 3/457 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ES IGVNWGT+++HKL PSTVVDL ++N I+KVKLFDADP  L+AL GSGI+VMVGIPNE
Sbjct  35    ESGIGVNWGTLSLHKLSPSTVVDLFKQNKIEKVKLFDADPYCLNALRGSGIQVMVGIPNE  94

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML+  SSS+ A DLWV+QNL+RY+  GGV+I+YVAVGNEPFL SYSGQFQSYVVPA+ N+
Sbjct  95    MLSVFSSSTDACDLWVSQNLSRYMGKGGVDIRYVAVGNEPFLTSYSGQFQSYVVPALLNL  154

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLAKAN+   VKLVVPCNADAYESSLPSQGAFR ELTQIMTQ+VS LN+N SPFVVNI
Sbjct  155   QQSLAKANVANFVKLVVPCNADAYESSLPSQGAFRSELTQIMTQIVSFLNTNGSPFVVNI  214

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFF GT H V DG NVY NAFDGN DTLVAAL+KLGY QMPIVI
Sbjct  215   YPFLSLYGNSDFPQDYAFFGGTNHAVTDGANVYYNAFDGNFDTLVAALNKLGYGQMPIVI  274

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA SANLTAA+AFNQGLI HVL NKGTPLRPGVPP+D+YLFSL DE  KSIL
Sbjct  275   GEVGWPTDGAISANLTAAKAFNQGLINHVLSNKGTPLRPGVPPMDIYLFSLLDEEAKSIL  334

Query  755   PGDFERHWGVFSFDGQLKYP--LDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG FERHWG+FSFDGQ KYP  L LGNG LKNARDV YLP RWC+ NP++DLS V+NH++
Sbjct  335   PGTFERHWGIFSFDGQAKYPLNLGLGNGLLKNARDVEYLPSRWCVANPSRDLSGVANHMK  394

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             +ACS ADCTTL YGGSCN IG KGNISYAFNSYYQ+ KQN QSCDFDGLG+VTFLDPSV 
Sbjct  395   IACSNADCTTLNYGGSCNEIGAKGNISYAFNSYYQVKKQNSQSCDFDGLGIVTFLDPSVG  454

Query  401   ECRFLVGVTDTNNSS-GFSlplltliiiISWGVWLFL  294
             +CRFLVG+TD+++S+   S   +   I+I WG W+++
Sbjct  455   DCRFLVGITDSSSSNVEASGGQVNFWILILWGFWIYI  491



>ref|XP_006373567.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 ref|XP_006373568.1| hypothetical protein POPTR_0016s00460g [Populus trichocarpa]
 gb|ERP51364.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|ERP51365.1| hypothetical protein POPTR_0016s00460g [Populus trichocarpa]
Length=485

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/458 (76%), Positives = 388/458 (85%), Gaps = 4/458 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGTI+ H+L PSTVVDLL++N I++VKLFDADP  L+ALMGSGIEVMVGIPNE
Sbjct  26    ESAIGVNWGTISFHRLKPSTVVDLLKDNKIKRVKLFDADPGSLTALMGSGIEVMVGIPNE  85

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLAA+SSS+ A+DLWV QN++RY+V GG +I+YVAVGNEPFL SYSGQFQS+VVPA+ N+
Sbjct  86    MLAALSSSTDASDLWVRQNVSRYVVKGGADIRYVAVGNEPFLTSYSGQFQSFVVPALLNL  145

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL G VKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  146   QQSLVKANLAGYVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSFLNSNGSPFVVNI  205

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEG+ HPV DG NVY NAFDGN DTLVAAL+KLGY QMPIVI
Sbjct  206   YPFLSLYGNSDFPQDYAFFEGSTHPVTDGSNVYYNAFDGNFDTLVAALNKLGYGQMPIVI  265

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA  ANLTAAR FNQGLI HVL NKGTPLRP  PP+D+YLF+L DE  KS+L
Sbjct  266   GEVGWPTDGAIGANLTAARVFNQGLIKHVLSNKGTPLRPDAPPMDIYLFALLDEGAKSVL  325

Query  755   PGDFERHWGVFSFDGQLKYP--LDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY   L LGN  LKNA++V YLP RWC+ +P+KDL++V+NH+R
Sbjct  326   PGNFERHWGIFSFDGQAKYALNLGLGNKLLKNAKNVEYLPSRWCVADPSKDLTSVANHLR  385

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             +ACS ADCTTL YGGSCN IG KGNISYAFNSYYQL  QN QSCDFDGLG+VTFLDPSV 
Sbjct  386   IACSAADCTTLNYGGSCNEIGAKGNISYAFNSYYQLQMQNAQSCDFDGLGMVTFLDPSVG  445

Query  401   ECRFLVGVTDTNNSSGFSlplltliiiISW--GVWLFL  294
             +CRF VGV D  +S  F        I  S   GVW FL
Sbjct  446   DCRFPVGVNDHKSSLAFRSCHRWTTIWTSILGGVWFFL  483



>ref|XP_011040111.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Populus euphratica]
Length=484

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/458 (76%), Positives = 386/458 (84%), Gaps = 4/458 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGTI+ H+L PSTVVDLL++N I+KVKLFDADP  L+ALMGSGIEVMVG+PNE
Sbjct  25    ESAIGVNWGTISFHRLKPSTVVDLLKDNKIKKVKLFDADPGALTALMGSGIEVMVGVPNE  84

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLAA+SSS+ A+DLWV QN++RY+V GG +I+YVAVGNEPFL SYSGQFQS+VVPA+ N+
Sbjct  85    MLAAISSSTDASDLWVRQNVSRYVVKGGADIRYVAVGNEPFLTSYSGQFQSFVVPALLNL  144

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL   VKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  145   QQSLVKANLASYVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSFLNSNGSPFVVNI  204

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEG+ HPV DG NVY NAFDGN DTLVAAL+KLGY QMPIVI
Sbjct  205   YPFLSLYGNSDFPQDYAFFEGSTHPVTDGSNVYYNAFDGNFDTLVAALNKLGYGQMPIVI  264

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA  ANLTAAR FNQGLI HVL NKGTPLRP  PP+D+YLF+L DE  KS+L
Sbjct  265   GEVGWPTDGAIGANLTAARVFNQGLIKHVLSNKGTPLRPDAPPMDIYLFALLDEGAKSVL  324

Query  755   PGDFERHWGVFSFDGQLKYP--LDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY   L LGN  L+NA++V YLP RWC+ +P+KDL+ V+NH++
Sbjct  325   PGNFERHWGIFSFDGQAKYALNLGLGNKLLQNAKNVEYLPSRWCVADPSKDLTNVANHLK  384

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             +ACS ADCTTL YGGSCN IG KGNISYAFNSYYQL  QN QSCDFDGLG+VTFLDPSV 
Sbjct  385   IACSAADCTTLNYGGSCNEIGAKGNISYAFNSYYQLQMQNAQSCDFDGLGMVTFLDPSVG  444

Query  401   ECRFLVGVTDTNNSSGFSlplltliiiISW--GVWLFL  294
             +CRF VGV D  +S  F        I  S   GVW FL
Sbjct  445   DCRFPVGVNDHKSSLAFRSCHGWTTIWTSILGGVWFFL  482



>ref|XP_010096495.1| Glucan endo-1,3-beta-glucosidase 5 [Morus notabilis]
 gb|EXB64615.1| Glucan endo-1,3-beta-glucosidase 5 [Morus notabilis]
Length=496

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/435 (78%), Positives = 383/435 (88%), Gaps = 2/435 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESA+GVNWGTI++H+L PSTVVDLL++N I KVK+FD DP VL AL+GSGI+VMVG+PNE
Sbjct  3     ESAVGVNWGTISLHRLKPSTVVDLLKDNKISKVKIFDTDPVVLRALIGSGIQVMVGVPNE  62

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA++SSS++A+D WV QN+T Y+  GGV+I+Y+AVGNEPFL SYSGQFQSYVVPA+ N+
Sbjct  63    MLASLSSSAAASDSWVRQNVTAYMGKGGVDIRYIAVGNEPFLTSYSGQFQSYVVPALLNL  122

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLA+ NL   +KLVVPCNADAYESSLPSQGAFRPEL QIMTQ+VS LNSN SPFVVNI
Sbjct  123   QQSLARVNLASYIKLVVPCNADAYESSLPSQGAFRPELMQIMTQIVSFLNSNGSPFVVNI  182

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFF+GT H V DG NVY+NAFDGNLDTLVAAL+KLGY QMPIVI
Sbjct  183   YPFLSLYGNSDFPQDYAFFDGTTHAVTDGANVYTNAFDGNLDTLVAALTKLGYGQMPIVI  242

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA  ANLTAARAFNQGLI  VLGNKGTPLRPGVPP D+YLFSL DE  KSIL
Sbjct  243   GEVGWPTDGAIGANLTAARAFNQGLINRVLGNKGTPLRPGVPPADIYLFSLLDEGAKSIL  302

Query  755   PGDFERHWGVFSFDGQLKYP--LDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KYP  L LGN  LKNARDV Y P RWC+ NP++DLS V NH++
Sbjct  303   PGNFERHWGIFSFDGQAKYPLNLGLGNRLLKNARDVQYFPSRWCVANPSRDLSNVENHMQ  362

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LAC +ADCTTL YGGSCNGIG KGNISYAFNSYYQL  QN +SC+F+GLG+VTFLDPSV 
Sbjct  363   LACGMADCTTLNYGGSCNGIGAKGNISYAFNSYYQLQNQNVRSCNFNGLGMVTFLDPSVG  422

Query  401   ECRFLVGVTDTNNSS  357
             ECRFLVGV++T++SS
Sbjct  423   ECRFLVGVSETSSSS  437



>ref|XP_008782991.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Phoenix dactylifera]
Length=487

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/435 (75%), Positives = 382/435 (88%), Gaps = 3/435 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             + AIGVNWGT++ H+L PS VVDL++EN I KVKLFDADP VL AL GSGI+VMVGIPN+
Sbjct  26    DGAIGVNWGTLSSHRLQPSIVVDLMKENKISKVKLFDADPTVLRALAGSGIQVMVGIPND  85

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML  + SS + +DLWV QN++RY+V GGV+I+Y+AVGNEPFL SY GQ+QS V+PA+ N+
Sbjct  86    MLGILGSSPATSDLWVTQNVSRYMVKGGVDIRYIAVGNEPFLTSYQGQYQSLVLPAMLNL  145

Query  1295  QQSLAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             QQSL KANLGG VKLVVPCNADAY+S +LPSQG FRPELTQIMTQLVS LNSN SPFVVN
Sbjct  146   QQSLTKANLGGYVKLVVPCNADAYQSATLPSQGTFRPELTQIMTQLVSFLNSNGSPFVVN  205

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY +SDFPQDYAFF G++HPVVDGP+VY NAFDGN DTLVAAL+K+G+ QMPI 
Sbjct  206   IYPFLSLYQSSDFPQDYAFFGGSSHPVVDGPSVYYNAFDGNFDTLVAALTKIGFGQMPIA  265

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGEVGWPTDGA SANL+AARAFNQGLI +VL NKGTPLRPGVPP+DVYLFSL DE  KS+
Sbjct  266   IGEVGWPTDGAASANLSAARAFNQGLISNVLNNKGTPLRPGVPPVDVYLFSLLDEEQKSV  325

Query  758   LPGDFERHWGVFSFDGQLKYPL--DLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHI  585
             LPG+FERHWG+FSFDGQ KYPL   LGNG+LKNA++V YLP RWC+ NP++DL AV+NH+
Sbjct  326   LPGNFERHWGIFSFDGQAKYPLVIGLGNGRLKNAKNVQYLPSRWCVANPSRDLDAVANHM  385

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
             +LACS+ADCTTL YGGSCN IG+KGNISYAFNSYYQL KQ  +SCDFDGLG+VTFLDPS+
Sbjct  386   KLACSVADCTTLFYGGSCNAIGDKGNISYAFNSYYQLQKQEARSCDFDGLGMVTFLDPSI  445

Query  404   DECRFLVGVTDTNNS  360
              +CRFLVG++D++ S
Sbjct  446   GDCRFLVGISDSSCS  460



>gb|KGN64983.1| hypothetical protein Csa_1G171050 [Cucumis sativus]
Length=481

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/430 (77%), Positives = 377/430 (88%), Gaps = 2/430 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGTI+ HKL P+TVVDLL+ N IQKVKLF+ADP+VL ALMG+GI+VM+GIPNE
Sbjct  24    ESAIGVNWGTISFHKLKPTTVVDLLKSNRIQKVKLFEADPSVLKALMGTGIQVMIGIPNE  83

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA++SSS  A+DLWV  NL+ Y+V GG +I+YVAVGNEPFL+SY+G++QSY++PA+ N+
Sbjct  84    MLASLSSSLLASDLWVRHNLSSYVVKGGADIRYVAVGNEPFLSSYNGEYQSYIMPALLNL  143

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLAKANL   VKLVVPCNADAYESSLPSQGAFRPEL QIMTQLVS LNSN SPFVVNI
Sbjct  144   QQSLAKANLASYVKLVVPCNADAYESSLPSQGAFRPELIQIMTQLVSFLNSNGSPFVVNI  203

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEGT H V DG NVY NAFDGN DTLV+AL+K+GY QMPIVI
Sbjct  204   YPFLSLYGNSDFPQDYAFFEGTTHAVTDGSNVYYNAFDGNYDTLVSALTKIGYGQMPIVI  263

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA  ANLTAAR FNQGLI HVLGNKGTPLRP  PP+DVYLFSL DE  KS+L
Sbjct  264   GEVGWPTDGAMGANLTAARVFNQGLINHVLGNKGTPLRPATPPVDVYLFSLLDEGAKSVL  323

Query  755   PGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KYPL+  LGN  LKNA+ V YLP RWC+ NP +DL+ V+NHI+
Sbjct  324   PGNFERHWGIFSFDGQAKYPLNLGLGNKVLKNAKHVEYLPSRWCVANPFRDLTDVANHIK  383

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             +ACS+ADC+TL YGGSCNGIG KGNISYAFNSYYQL  QN +SC+FDGL ++TFLDPS+ 
Sbjct  384   VACSVADCSTLNYGGSCNGIGAKGNISYAFNSYYQLQMQNEKSCEFDGLAMITFLDPSIG  443

Query  401   ECRFLVGVTD  372
             ECRFLVGVTD
Sbjct  444   ECRFLVGVTD  453



>ref|XP_008224651.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Prunus mume]
Length=516

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/432 (78%), Positives = 376/432 (87%), Gaps = 2/432 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESA+GVNWGT++ HKL PSTVVDLL++N I KVKLFDADP  L ALMGSGI+VM+G+PNE
Sbjct  54    ESALGVNWGTVSFHKLKPSTVVDLLQDNKISKVKLFDADPDSLQALMGSGIQVMIGVPNE  113

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLAA+SSS++A+D WV QN++RY+   GV+I+Y+AVGNEPFL+SYSGQFQSYV+P + N+
Sbjct  114   MLAALSSSTAASDSWVRQNVSRYMRKNGVDIRYIAVGNEPFLSSYSGQFQSYVMPVLLNL  173

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLAK NL   VKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  174   QQSLAKVNLASYVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSFLNSNGSPFVVNI  233

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYG+SDFPQDYAFFEGT+HPV DG NVY NAFDGN DTLVAALSKLGY QMPI I
Sbjct  234   YPFLSLYGSSDFPQDYAFFEGTSHPVTDGSNVYYNAFDGNFDTLVAALSKLGYGQMPIAI  293

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDGA S NLTAAR FNQGLI HVL NKGTPLRPGVPP+DVYLFSL DE  KS L
Sbjct  294   GEIGWPTDGAISGNLTAARVFNQGLINHVLSNKGTPLRPGVPPVDVYLFSLLDEGAKSTL  353

Query  755   PGDFERHWGVFSFDGQLKYP--LDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KYP  L LG   LKNAR V YLP RWC+ NP+ DLS V+NH++
Sbjct  354   PGNFERHWGIFSFDGQAKYPLNLGLGGRGLKNARKVEYLPSRWCVANPSSDLSGVANHMK  413

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LAC +ADCTTL YGGSCNGIG KGNISYAFNSYYQL  QN +SCDFDGLG+VTFLDPS+ 
Sbjct  414   LACGVADCTTLTYGGSCNGIGAKGNISYAFNSYYQLQMQNERSCDFDGLGMVTFLDPSIG  473

Query  401   ECRFLVGVTDTN  366
             +CRFLVGVTDT 
Sbjct  474   DCRFLVGVTDTR  485



>ref|XP_004139598.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Cucumis sativus]
 ref|XP_004170672.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Cucumis sativus]
Length=494

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/430 (77%), Positives = 377/430 (88%), Gaps = 2/430 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGTI+ HKL P+TVVDLL+ N IQKVKLF+ADP+VL ALMG+GI+VM+GIPNE
Sbjct  24    ESAIGVNWGTISFHKLKPTTVVDLLKSNRIQKVKLFEADPSVLKALMGTGIQVMIGIPNE  83

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA++SSS  A+DLWV  NL+ Y+V GG +I+YVAVGNEPFL+SY+G++QSY++PA+ N+
Sbjct  84    MLASLSSSLLASDLWVRHNLSSYVVKGGADIRYVAVGNEPFLSSYNGEYQSYIMPALLNL  143

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLAKANL   VKLVVPCNADAYESSLPSQGAFRPEL QIMTQLVS LNSN SPFVVNI
Sbjct  144   QQSLAKANLASYVKLVVPCNADAYESSLPSQGAFRPELIQIMTQLVSFLNSNGSPFVVNI  203

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEGT H V DG NVY NAFDGN DTLV+AL+K+GY QMPIVI
Sbjct  204   YPFLSLYGNSDFPQDYAFFEGTTHAVTDGSNVYYNAFDGNYDTLVSALTKIGYGQMPIVI  263

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA  ANLTAAR FNQGLI HVLGNKGTPLRP  PP+DVYLFSL DE  KS+L
Sbjct  264   GEVGWPTDGAMGANLTAARVFNQGLINHVLGNKGTPLRPATPPVDVYLFSLLDEGAKSVL  323

Query  755   PGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KYPL+  LGN  LKNA+ V YLP RWC+ NP +DL+ V+NHI+
Sbjct  324   PGNFERHWGIFSFDGQAKYPLNLGLGNKVLKNAKHVEYLPSRWCVANPFRDLTDVANHIK  383

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             +ACS+ADC+TL YGGSCNGIG KGNISYAFNSYYQL  QN +SC+FDGL ++TFLDPS+ 
Sbjct  384   VACSVADCSTLNYGGSCNGIGAKGNISYAFNSYYQLQMQNEKSCEFDGLAMITFLDPSIG  443

Query  401   ECRFLVGVTD  372
             ECRFLVGVTD
Sbjct  444   ECRFLVGVTD  453



>emb|CAN82722.1| hypothetical protein VITISV_034466 [Vitis vinifera]
Length=498

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/430 (80%), Positives = 378/430 (88%), Gaps = 2/430 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ES IGVNWGT+++HKL PSTVVDL ++N I+KVKLFDADP  L+AL GSGI+VMVGIPNE
Sbjct  3     ESGIGVNWGTLSLHKLSPSTVVDLFKQNKIEKVKLFDADPYCLNALRGSGIQVMVGIPNE  62

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML+  SSS+ A DLWV+QNL+RY+  GGV+I+YVAVGNEPFL SYSGQFQSYVVPA+ N+
Sbjct  63    MLSVFSSSTDACDLWVSQNLSRYMGKGGVDIRYVAVGNEPFLTSYSGQFQSYVVPALLNL  122

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLAKAN+   VKLVVPCNADAYESSLPSQGAFR ELTQIMTQ+VS LN+N SPFVVNI
Sbjct  123   QQSLAKANVANFVKLVVPCNADAYESSLPSQGAFRSELTQIMTQIVSFLNTNGSPFVVNI  182

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFF GT H V DG NVY NAFDGN DTLVAAL+KLGY QMPIVI
Sbjct  183   YPFLSLYGNSDFPQDYAFFGGTNHAVTDGANVYYNAFDGNFDTLVAALNKLGYGQMPIVI  242

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA SANLTAA+AFNQGLI HVL NKGTPLRPGVPP+D+YLFSL DE  KSIL
Sbjct  243   GEVGWPTDGAISANLTAAKAFNQGLINHVLSNKGTPLRPGVPPMDIYLFSLLDEEAKSIL  302

Query  755   PGDFERHWGVFSFDGQLKYP--LDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG FERHWG+FSFDGQ KYP  L LGNG LKNARDV YLP RWC+ NP++DLS V+NH++
Sbjct  303   PGTFERHWGIFSFDGQAKYPLNLGLGNGLLKNARDVEYLPSRWCVANPSRDLSGVANHMK  362

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             +ACS ADCTTL YGGSCN IG KGNISYAFNSYYQ+ KQN QSCDFDGLG+VTFLDPSV 
Sbjct  363   IACSNADCTTLNYGGSCNEIGAKGNISYAFNSYYQVKKQNSQSCDFDGLGIVTFLDPSVG  422

Query  401   ECRFLVGVTD  372
             +CRFLVG+TD
Sbjct  423   DCRFLVGITD  432



>gb|EPS65725.1| hypothetical protein M569_09051, partial [Genlisea aurea]
Length=476

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/437 (75%), Positives = 383/437 (88%), Gaps = 1/437 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             E  IGVNWGT+A+H+L P TVV+LL+ N I+KVKLFD DP VL+ALMGSGIE MVGIPNE
Sbjct  23    ECGIGVNWGTVALHRLSPETVVNLLKANKIEKVKLFDTDPEVLTALMGSGIETMVGIPNE  82

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML+++ +SSSA+D W++QN++R++  GGV+I+Y+AVGNEPFL+SYSGQF+SYV+PA+ N+
Sbjct  83    MLSSLGASSSASDSWISQNVSRFMGKGGVDIRYIAVGNEPFLSSYSGQFESYVMPALINL  142

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL+KANL G VKLVVPCNADAY SS+PS+GAFRP+LT +M QLV+ LNSNASPFVVNI
Sbjct  143   QQSLSKANLVGIVKLVVPCNADAYLSSVPSEGAFRPDLTDLMAQLVTFLNSNASPFVVNI  202

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGN DFPQDYAFFEG++H + DGPNVY+NAFDGN DTLVAALSKLG+ QMPIV+
Sbjct  203   YPFLSLYGNPDFPQDYAFFEGSSHSIADGPNVYTNAFDGNYDTLVAALSKLGFPQMPIVV  262

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDG  SANLT+AR FNQGL+ HVL N+GTPLRPGVPP+DVY+F L DE GKS+L
Sbjct  263   GEVGWPTDGVLSANLTSARVFNQGLVNHVLSNRGTPLRPGVPPVDVYIFGLLDEGGKSVL  322

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLA  576
             PG+FERHWGVFSFDGQ KYPL+LGNG LKNAR V YLP RWC+ NP +DLS VSNH +LA
Sbjct  323   PGNFERHWGVFSFDGQAKYPLNLGNGVLKNARRVEYLPSRWCVANPARDLSTVSNHFKLA  382

Query  575   CSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDEC  396
             CS ADCTTL YGGSCN IGEKGN+SYAFN YYQ+ KQNP SC+FDG+G+VTFLDPS+  C
Sbjct  383   CSYADCTTLSYGGSCNDIGEKGNVSYAFNGYYQMQKQNPASCEFDGVGMVTFLDPSIGNC  442

Query  395   RFLVGVTDTNNSS-GFS  348
             RFLVGV D  NSS GF+
Sbjct  443   RFLVGVKDLANSSVGFA  459



>ref|XP_007211994.1| hypothetical protein PRUPE_ppa004783mg [Prunus persica]
 gb|EMJ13193.1| hypothetical protein PRUPE_ppa004783mg [Prunus persica]
Length=491

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/430 (79%), Positives = 378/430 (88%), Gaps = 2/430 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESA+GVNWGT++ HKL PSTVVDLL++N I KVKLFDADP  L ALMGSGI+VM+G+PNE
Sbjct  31    ESALGVNWGTVSFHKLKPSTVVDLLQDNKISKVKLFDADPDSLQALMGSGIQVMIGVPNE  90

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             +LAA+SSS++A+DLWV QN++RY+   GV+I+Y+AVGNEPFL+SYSGQFQSYV+PA+ N+
Sbjct  91    VLAALSSSTAASDLWVRQNVSRYMRKNGVDIRYIAVGNEPFLSSYSGQFQSYVMPALLNL  150

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLAK NL   VKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  151   QQSLAKVNLASYVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSFLNSNGSPFVVNI  210

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYG+SDFPQDYAFFEGT+HPV DG NVY NAFDGN DTLVAALSKLGY QMPI I
Sbjct  211   YPFLSLYGSSDFPQDYAFFEGTSHPVTDGSNVYYNAFDGNFDTLVAALSKLGYGQMPIAI  270

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDGA S NLTAAR FNQGLI HVL NKGTPLRPGVPP+DVYLFSL DE  KS L
Sbjct  271   GEIGWPTDGAISGNLTAARVFNQGLINHVLSNKGTPLRPGVPPVDVYLFSLLDEGAKSTL  330

Query  755   PGDFERHWGVFSFDGQLKYP--LDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KYP  L LG   LKNAR V YLP RWC+ NP++DLS V+NH++
Sbjct  331   PGNFERHWGIFSFDGQAKYPLNLGLGGRGLKNARKVEYLPSRWCVANPSRDLSDVANHMK  390

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LAC +ADCTTL YGGSCNGIG KGNISYAFNSYYQL  QN +SCDFDGLG+VTFLDPS+ 
Sbjct  391   LACGVADCTTLTYGGSCNGIGAKGNISYAFNSYYQLQMQNERSCDFDGLGMVTFLDPSIG  450

Query  401   ECRFLVGVTD  372
             +CRFLVGVTD
Sbjct  451   DCRFLVGVTD  460



>ref|XP_009407926.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Musa acuminata 
subsp. malaccensis]
Length=485

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/433 (76%), Positives = 385/433 (89%), Gaps = 3/433 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             +SAIGVNWGT++ HKLPPS VVDL+REN I KVKLFDADP VL AL GSGIEVMVGIPN+
Sbjct  24    DSAIGVNWGTLSSHKLPPSVVVDLMRENKIGKVKLFDADPEVLWALRGSGIEVMVGIPND  83

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             +LAA++SS +A+D WV QN++RYLV GGV+I+YVAVGNEPFL +Y G++QS V+PA+ N+
Sbjct  84    LLAALASSIAASDQWVGQNVSRYLVKGGVDIRYVAVGNEPFLTNYQGRYQSLVLPAMLNL  143

Query  1295  QQSLAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             QQSLA+ANL G +KLVVPCNADAY+S S+PSQG FRPELTQIMTQLVS LNSN SPFVVN
Sbjct  144   QQSLARANLAGYIKLVVPCNADAYQSASVPSQGVFRPELTQIMTQLVSFLNSNGSPFVVN  203

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY ++DFPQDYAFFEG++HPVVDG NVY NAFDGN DTLVAALSK+GY QMP+ 
Sbjct  204   IYPFLSLYQSADFPQDYAFFEGSSHPVVDGQNVYYNAFDGNFDTLVAALSKIGYGQMPVA  263

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPT+GA SANL+AARAFNQGLI HVL NKGTP RPG+PP+D+YLFSL DE  K+I
Sbjct  264   VGEVGWPTEGAPSANLSAARAFNQGLISHVLSNKGTPSRPGIPPVDIYLFSLLDEEQKNI  323

Query  758   LPGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHI  585
             LPG+FERHWG++SFDGQ KYPL+  LGNG LKNAR+VPYLP RWCI NP++DL+ V+NH+
Sbjct  324   LPGNFERHWGIYSFDGQAKYPLNLGLGNGWLKNARNVPYLPSRWCIANPSQDLTGVTNHM  383

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
             +LACS ADCTTL YGGSCN IGEKGNISYAFNSYYQL KQ  +SCDFDGLG+VTFLDPSV
Sbjct  384   KLACSFADCTTLYYGGSCNTIGEKGNISYAFNSYYQLQKQESKSCDFDGLGIVTFLDPSV  443

Query  404   DECRFLVGVTDTN  366
              +CRFLVG++D++
Sbjct  444   GDCRFLVGISDSS  456



>ref|XP_004293418.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/458 (73%), Positives = 388/458 (85%), Gaps = 6/458 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             E+AIGVNWG ++ H+L PSTVVDLL++N I KVKLFDADP  L ALMGSGI+VMVGI N+
Sbjct  22    EAAIGVNWGILSFHRLKPSTVVDLLKDNKISKVKLFDADPDSLEALMGSGIQVMVGISND  81

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML  +SSS+ A+DLWV +N++RY+V  GV+I+YVAVGNEPFL SYSGQ+Q YV+PA+ N+
Sbjct  82    MLPFLSSSADASDLWVRRNVSRYVVKNGVDIRYVAVGNEPFLTSYSGQYQPYVMPALLNL  141

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSLAK NL   VKLVVPCNADAYE++LPSQGAFRPELT+IMTQLVS LNSN SPFVVNI
Sbjct  142   QQSLAKVNLASYVKLVVPCNADAYEAALPSQGAFRPELTEIMTQLVSFLNSNGSPFVVNI  201

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYG+SDFPQ+YAFFEGT+H V DG  VY+NAFDGN DTLVAALSKLGY QMPIVI
Sbjct  202   YPFLSLYGSSDFPQEYAFFEGTSHSVTDGSAVYNNAFDGNFDTLVAALSKLGYGQMPIVI  261

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA SANLTAA+ FNQGLI +VL NKGTPLRPGVPP+DVYLF L DE  KS L
Sbjct  262   GEVGWPTDGAISANLTAAKTFNQGLIKNVLSNKGTPLRPGVPPMDVYLFGLLDEGTKSTL  321

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNG--QLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG FERHWG+FSFDGQ KYPL+LG G  QL NAR+V YLP RWC+ +P +DLSAV +H++
Sbjct  322   PGTFERHWGIFSFDGQAKYPLNLGLGSRQLINARNVEYLPSRWCVADPARDLSAVESHMK  381

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS+ADCTTL YGGSCNGIG KGNISYAFNSYYQ+  Q  QSCDFDGLG+VTFLDPS+ 
Sbjct  382   LACSVADCTTLGYGGSCNGIGAKGNISYAFNSYYQVQMQKEQSCDFDGLGMVTFLDPSMG  441

Query  401   ECRFLVGVTDTNNSS----GFSlplltliiiISWGVWL  300
             ECRFLVGVT ++ +S      S  ++ + I+ISW VW+
Sbjct  442   ECRFLVGVTASSATSFSQLQHSSAIVWIWILISWRVWI  479



>ref|XP_010929013.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
5 [Elaeis guineensis]
Length=564

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/435 (75%), Positives = 377/435 (87%), Gaps = 3/435 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ++AIGVNWGT++ H+L PS VVDL++EN I KVKLFDADP VL AL GSGI+VMVGIPN+
Sbjct  103   DAAIGVNWGTLSSHRLQPSIVVDLMKENKISKVKLFDADPTVLRALAGSGIQVMVGIPND  162

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML  + SS + +DLWV QN++RY+V GGVNI Y+AVGNEPFL SY GQ+QS V+PA+ N+
Sbjct  163   MLGILGSSPATSDLWVTQNVSRYMVKGGVNIGYIAVGNEPFLTSYQGQYQSLVLPAMLNL  222

Query  1295  QQSLAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             QQSL KANL G VKLVVPCNADAY+S SLPSQGAFRPELTQIMTQLVS LNSN SPFVVN
Sbjct  223   QQSLTKANLAGYVKLVVPCNADAYQSASLPSQGAFRPELTQIMTQLVSFLNSNGSPFVVN  282

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY +SDFPQDYAFF G++HPVVDGPNVY NAFDGN DTLVAAL+K+G+ Q+PI 
Sbjct  283   IYPFLSLYQSSDFPQDYAFFGGSSHPVVDGPNVYYNAFDGNFDTLVAALTKIGFGQIPIA  342

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGEVGWPTDGA SANL+AARAFNQGLI HV  NKGTPLRPGVPP DVYLFSL DE  KSI
Sbjct  343   IGEVGWPTDGAPSANLSAARAFNQGLISHVWSNKGTPLRPGVPPADVYLFSLLDEEQKSI  402

Query  758   LPGDFERHWGVFSFDGQLKYPLDL--GNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHI  585
             LPG+FERHWG+FSFDGQ KYPL L  G+G LKNA +V YLP RWC+ NP++DL  V+NH+
Sbjct  403   LPGNFERHWGIFSFDGQAKYPLVLGVGHGGLKNAENVQYLPSRWCVANPSQDLGGVANHM  462

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
             +LACS+ADCTTL YGGSCN IGEKGNISYAFNSYYQL KQ+ +SCDFDGLG +TFLDPS+
Sbjct  463   KLACSVADCTTLLYGGSCNAIGEKGNISYAFNSYYQLQKQDARSCDFDGLGXITFLDPSI  522

Query  404   DECRFLVGVTDTNNS  360
              +CRFLVG++D++ S
Sbjct  523   GDCRFLVGISDSSCS  537



>ref|XP_010246560.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Nelumbo nucifera]
Length=502

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/434 (76%), Positives = 377/434 (87%), Gaps = 2/434 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             +SAIGVNWGTI+ H++PPS VVDL++ N IQKVK+FD DP VLSALMGS IEVMVGIPN 
Sbjct  42    DSAIGVNWGTISSHRIPPSVVVDLMKANKIQKVKIFDTDPDVLSALMGSRIEVMVGIPNG  101

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA ++SS  AADLWV+QN++RY+V GGV+I+Y+AVGNEPFL+SYSGQFQSYV+PA+ N+
Sbjct  102   MLALLASSPVAADLWVSQNVSRYMVKGGVDIRYIAVGNEPFLSSYSGQFQSYVMPALLNI  161

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL   VKLVVPCNADAYESSLPSQG FRPELTQIMTQLVS L++N SPFVVNI
Sbjct  162   QQSLVKANLASFVKLVVPCNADAYESSLPSQGTFRPELTQIMTQLVSFLSANGSPFVVNI  221

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLY + DFPQDYAFFEGT H V DG N+Y NAFDGN DTLVAAL+++GY QMPIVI
Sbjct  222   YPFLSLYDDKDFPQDYAFFEGTTHAVTDGQNIYYNAFDGNFDTLVAALNRIGYGQMPIVI  281

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA  ANLTAARAFNQGLI  +L NKGTPLRPGVP +D+YLFSL DE  KSI+
Sbjct  282   GEVGWPTDGALGANLTAARAFNQGLINRILSNKGTPLRPGVPXMDIYLFSLLDEGSKSIV  341

Query  755   PGDFERHWGVFSFDGQLKY--PLDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY   L LGNG L+NA++V YLP RWCI +P +DL  V+NHI+
Sbjct  342   PGNFERHWGIFSFDGQAKYRLNLGLGNGLLRNAKNVQYLPSRWCIADPTRDLLDVTNHIK  401

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LAC +ADCTTL+YGGSCNGIG K NISYAFNSYYQL KQ+ QSCDFDG GLVTFLDPS+ 
Sbjct  402   LACGVADCTTLEYGGSCNGIGAKANISYAFNSYYQLQKQDSQSCDFDGFGLVTFLDPSIG  461

Query  401   ECRFLVGVTDTNNS  360
             +CRFLVG++DT++S
Sbjct  462   DCRFLVGISDTSSS  475



>ref|XP_006414264.1| hypothetical protein EUTSA_v10024947mg [Eutrema salsugineum]
 gb|ESQ55717.1| hypothetical protein EUTSA_v10024947mg [Eutrema salsugineum]
Length=513

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/436 (74%), Positives = 368/436 (84%), Gaps = 7/436 (2%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             +SAIGVNWGT++ HKL PSTVVDLL+ N I KVKLFDA+P  L ALMG+GI+VM+GIPNE
Sbjct  20    QSAIGVNWGTVSFHKLRPSTVVDLLKANKITKVKLFDANPDALRALMGTGIQVMIGIPNE  79

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML+  SS     DL+V QNL+R++  GG +I+Y+AVGNEPFL SY GQFQ+YVVPA+ N+
Sbjct  80    MLSTFSS-----DLFVQQNLSRFMGKGGADIRYIAVGNEPFLTSYGGQFQNYVVPAMLNL  134

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL   VKLVVPCNADAYES++PSQG FRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  135   QQSLVKANLASYVKLVVPCNADAYESNVPSQGMFRPELTQIMTQLVSFLNSNVSPFVVNI  194

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEG++HPV+DGPN Y NAFDGN DTLVAAL+KLGY QMPIVI
Sbjct  195   YPFLSLYGNSDFPQDYAFFEGSSHPVLDGPNAYYNAFDGNFDTLVAALAKLGYGQMPIVI  254

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDGA  ANLTAAR FNQGLI H+L NKGTPLRPG PP DVYLF L DE  KS L
Sbjct  255   GEIGWPTDGAVGANLTAARVFNQGLINHLLSNKGTPLRPGSPPADVYLFGLLDEGAKSTL  314

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY L+LG G   LKNA +V YLP RWC+ +P++D++ V++H+R
Sbjct  315   PGNFERHWGIFSFDGQAKYRLNLGLGNRGLKNAENVQYLPSRWCVAHPSRDMTQVADHLR  374

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS ADCTTL  GGSC+ +GEK NISYAFNSYYQL  QN +SCDFDGLG+VTFLDPSV 
Sbjct  375   LACSQADCTTLNDGGSCSQLGEKENISYAFNSYYQLQMQNEKSCDFDGLGMVTFLDPSVG  434

Query  401   ECRFLVGVTDTNNSSG  354
             +CRFLVGVTD   SSG
Sbjct  435   DCRFLVGVTDKGVSSG  450



>gb|KHN40227.1| Glucan endo-1,3-beta-glucosidase 5 [Glycine soja]
Length=467

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/438 (73%), Positives = 373/438 (85%), Gaps = 2/438 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGT++ HKL PSTVV LL++N I KVK+F+A+  VL ALMGSGI+VM+GIPNE
Sbjct  7     ESAIGVNWGTVSFHKLKPSTVVGLLKDNKIPKVKVFEAEADVLKALMGSGIQVMLGIPNE  66

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML  +S+S +AAD W+ QN++ YL  GG +I+Y+AVGNEPFL SY+GQ+Q+ V+PA+ N+
Sbjct  67    MLPLLSTSPAAADSWLRQNVSAYLGKGGADIRYIAVGNEPFLTSYNGQYQNLVMPAILNI  126

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL G +KLVVPCNADAYESSLPSQGAFRPELTQIMTQLV  LNSN +PF+VNI
Sbjct  127   QQSLVKANLAGYIKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVQFLNSNGTPFIVNI  186

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLY N+DFPQDYAFFEGT HPV DG NVY+NAFDGN DTLVAALSKLGY QMPIVI
Sbjct  187   YPFLSLYDNNDFPQDYAFFEGTTHPVTDGNNVYTNAFDGNYDTLVAALSKLGYGQMPIVI  246

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWP+DGA  A +TAA+ FNQGLI HVL NKGTPLRPG PP+D+YLFSL DE  KSIL
Sbjct  247   GEIGWPSDGAIGAIITAAKVFNQGLISHVLSNKGTPLRPGAPPMDIYLFSLLDEGAKSIL  306

Query  755   PGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG FERHWG+FSFDGQ KYPL+  LGN +LKNA++V YLP RWC+ +P+ D   V+NH+R
Sbjct  307   PGGFERHWGIFSFDGQAKYPLNLGLGNKELKNAKNVQYLPSRWCVASPSTDAQNVANHMR  366

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             +ACS+ADCTTL YGGSCNGIGEKGNISYAFNSYYQL  Q+ +SC+FDGLG++TF DPSV 
Sbjct  367   IACSVADCTTLDYGGSCNGIGEKGNISYAFNSYYQLQMQDSRSCNFDGLGVITFRDPSVG  426

Query  401   ECRFLVGVTDTNNSSGFS  348
             +CRFLVGVTD  + S  S
Sbjct  427   DCRFLVGVTDKGSDSSAS  444



>ref|XP_003528714.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like isoform X1 
[Glycine max]
Length=483

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/438 (73%), Positives = 373/438 (85%), Gaps = 2/438 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGT++ HKL PSTVV LL++N I KVK+F+A+  VL ALMGSGI+VM+GIPNE
Sbjct  23    ESAIGVNWGTVSFHKLKPSTVVGLLKDNKIPKVKVFEAEADVLKALMGSGIQVMLGIPNE  82

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML  +S+S +AAD W+ QN++ YL  GG +I+Y+AVGNEPFL SY+GQ+Q+ V+PA+ N+
Sbjct  83    MLPLLSTSPAAADSWLRQNVSAYLGKGGADIRYIAVGNEPFLTSYNGQYQNLVMPAILNL  142

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL G +KLVVPCNADAYESSLPSQGAFRPELTQIMTQLV  LNSN +PF+VNI
Sbjct  143   QQSLVKANLAGYIKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVQFLNSNGTPFIVNI  202

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLY N+DFPQDYAFFEGT HPV DG NVY+NAFDGN DTLVAALSKLGY QMPIVI
Sbjct  203   YPFLSLYDNNDFPQDYAFFEGTTHPVTDGNNVYTNAFDGNYDTLVAALSKLGYDQMPIVI  262

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWP+DGA  AN+TAA+ FNQGLI HVL NKGTPLRP  PP+D+YLFSL DE  KSIL
Sbjct  263   GEIGWPSDGAIGANITAAKVFNQGLISHVLSNKGTPLRPDAPPMDIYLFSLLDEGAKSIL  322

Query  755   PGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG FERHWG+FSFDGQ KYPL+  LGN +LKNA++V YLP RWC+ +P+ D   V+NH+R
Sbjct  323   PGGFERHWGIFSFDGQAKYPLNLGLGNKELKNAKNVQYLPSRWCVASPSTDAQNVANHMR  382

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             +ACS+ADCTTL YGGSCNGIGEKGNISYAFNSYYQL  Q+ +SC+FDGLG++TF DPSV 
Sbjct  383   IACSVADCTTLDYGGSCNGIGEKGNISYAFNSYYQLQMQDSRSCNFDGLGVITFRDPSVG  442

Query  401   ECRFLVGVTDTNNSSGFS  348
             +CRFLVGVTD  + S  S
Sbjct  443   DCRFLVGVTDKGSDSSAS  460



>ref|XP_007147571.1| hypothetical protein PHAVU_006G135700g [Phaseolus vulgaris]
 gb|ESW19565.1| hypothetical protein PHAVU_006G135700g [Phaseolus vulgaris]
Length=485

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/439 (74%), Positives = 369/439 (84%), Gaps = 3/439 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGTI+ H+L P+TVVDLLREN I KVKLF+AD  VL ALMGSGI+VMVGIPNE
Sbjct  24    ESAIGVNWGTISSHRLKPTTVVDLLRENKISKVKLFEADSDVLRALMGSGIQVMVGIPNE  83

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML  +SSS SAADLWV QN++ Y+  GG +I+YVAVGNEPFL+ Y+GQ+Q+ V+P + N+
Sbjct  84    MLPLLSSSPSAADLWVRQNVSAYVGRGGADIRYVAVGNEPFLSGYNGQYQNLVMPVILNI  143

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESS-LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             QQSL KANLGG VKLVVPCNADAY+SS LPSQGAFRPELTQIMTQLV  LNSN SPFVVN
Sbjct  144   QQSLVKANLGGYVKLVVPCNADAYQSSALPSQGAFRPELTQIMTQLVQFLNSNGSPFVVN  203

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY N DFPQ+YAFFEGT H V DG NVY+NAFDGN DTLVAAL KLGY QMPIV
Sbjct  204   IYPFLSLYDNKDFPQEYAFFEGTTHAVQDGSNVYTNAFDGNYDTLVAALIKLGYGQMPIV  263

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWP+DGA  AN TAA+ FNQG I HV  NKGTPLRP  PP+D YLFSLFDE  KS 
Sbjct  264   IGEIGWPSDGAIGANTTAAKVFNQGFINHVASNKGTPLRPNAPPMDAYLFSLFDEGAKST  323

Query  758   LPGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHI  585
             LPG+FERHWG+FSFDGQ KYPL+  LGN +LKNAR+V YLP RWC+ NP+ DL+ V NH+
Sbjct  324   LPGNFERHWGIFSFDGQAKYPLNLLLGNKELKNARNVEYLPSRWCVANPSSDLTNVVNHM  383

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
             RLACS+ADCTTL YGGSCN IGEKGN+SYAFNSYYQL  Q+ +SC+FDGLG+VTFLDPS+
Sbjct  384   RLACSVADCTTLNYGGSCNEIGEKGNVSYAFNSYYQLQMQDSRSCEFDGLGIVTFLDPSI  443

Query  404   DECRFLVGVTDTNNSSGFS  348
              +CRFLVGVTD    S  S
Sbjct  444   GDCRFLVGVTDKGTDSSSS  462



>gb|AIR93902.1| glucanase [Cicer arietinum]
Length=461

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/432 (73%), Positives = 370/432 (86%), Gaps = 4/432 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGTI+ H+L PSTVV LLR+N IQKVKLF+ADP VL ALMG+GI+VMVGIPNE
Sbjct  3     ESAIGVNWGTISSHRLKPSTVVHLLRDNKIQKVKLFEADPDVLKALMGTGIQVMVGIPNE  62

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             +L+ + SSS AAD WV QN++ Y+  GG +I+Y+AVGNEPFL+SY+GQFQ+ V+PA+TN+
Sbjct  63    ILSLLGSSSLAADFWVRQNVSSYMAKGGADIRYIAVGNEPFLSSYNGQFQNLVMPAITNI  122

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             QQSL KANL G VK+VVPCNADAYESS  LPSQG FRPELTQIMTQLV  LN+N SPFVV
Sbjct  123   QQSLVKANLAGYVKIVVPCNADAYESSGGLPSQGVFRPELTQIMTQLVQFLNTNGSPFVV  182

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
             NIYPFLSLY N+DFPQ+YAFF+GT H V DG NVY+NAFDGN DTLVAAL KLGY QMPI
Sbjct  183   NIYPFLSLYDNADFPQEYAFFQGTTHSVTDGSNVYTNAFDGNYDTLVAALGKLGYGQMPI  242

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             VIGE+GWP+DGA  AN+TAAR FNQGL+YH++ NKGTPLRP  PP+DVYLF L DE  KS
Sbjct  243   VIGEIGWPSDGAVGANITAARVFNQGLVYHIVSNKGTPLRPNAPPMDVYLFGLLDEGAKS  302

Query  761   ILPGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNH  588
              LPG+FERHWG+FSFDGQ KYPL+  LGN +L+NA++V YLP RWC+ NP+ DL+ V NH
Sbjct  303   TLPGNFERHWGIFSFDGQAKYPLNLGLGNKELRNAKNVQYLPSRWCVANPSGDLTNVVNH  362

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
             +++ACS ADCTTL YGGSCNGIGEKGNISYAFNSYYQL  Q+ +SC+FDGLG+VTFLDPS
Sbjct  363   MKIACSAADCTTLNYGGSCNGIGEKGNISYAFNSYYQLRMQDSRSCEFDGLGMVTFLDPS  422

Query  407   VDECRFLVGVTD  372
             + +C FLVGV D
Sbjct  423   IGDCHFLVGVFD  434



>gb|KHN14405.1| Glucan endo-1,3-beta-glucosidase 5 [Glycine soja]
Length=487

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/439 (74%), Positives = 372/439 (85%), Gaps = 3/439 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGTI+ H+L P+TVVDLLR+N I KVKLF+AD  VL ALMGSGI+VMVGIPNE
Sbjct  26    ESAIGVNWGTISSHRLKPTTVVDLLRQNKISKVKLFEADSDVLRALMGSGIQVMVGIPNE  85

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML  +SSS +A+DLWV QN++ Y+  GG +I+YVAVGNEPFL+SY+GQ+Q+ ++PA+ N+
Sbjct  86    MLPFLSSSPAASDLWVRQNVSAYVGRGGADIRYVAVGNEPFLSSYNGQYQNLIMPAILNI  145

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESS-LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             QQSL KANL G +KLVVPCNADAY+SS LPSQGAFRPELTQIM QLV  LNSN SPFVVN
Sbjct  146   QQSLVKANLAGYIKLVVPCNADAYQSSALPSQGAFRPELTQIMNQLVQFLNSNGSPFVVN  205

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY N DFPQ+YAFFEGT H V DG NVY+NAFDGN DTLVAAL+KLGY QMPIV
Sbjct  206   IYPFLSLYNNGDFPQEYAFFEGTTHAVQDGSNVYTNAFDGNYDTLVAALTKLGYGQMPIV  265

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWP+DGA  AN+TAA+ FNQGLI H+  NKGTPLRP  PP+DVYLFSL DE  KS 
Sbjct  266   IGEIGWPSDGAIDANITAAKVFNQGLINHIASNKGTPLRPNAPPMDVYLFSLLDEGAKST  325

Query  758   LPGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHI  585
             LPG+FERHWG+FSFDGQ KYPL+  LGN +LKNAR+V YLP RWC+ NP+ DL+ V NH+
Sbjct  326   LPGNFERHWGIFSFDGQAKYPLNLLLGNKELKNARNVEYLPSRWCVANPSGDLNNVVNHM  385

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
             RLACS+ADCTTL YGGSCN IGEKGNISYAFNSYYQL  Q+ +SC+FDGLG+VTFLDPSV
Sbjct  386   RLACSVADCTTLNYGGSCNEIGEKGNISYAFNSYYQLQMQDSRSCNFDGLGMVTFLDPSV  445

Query  404   DECRFLVGVTDTNNSSGFS  348
              +C FLVGVTD  + S  S
Sbjct  446   GDCHFLVGVTDKGSDSSTS  464



>ref|XP_011005767.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like isoform X2 
[Populus euphratica]
Length=448

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/443 (76%), Positives = 374/443 (84%), Gaps = 4/443 (1%)
 Frame = -3

Query  1610  LPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLaavsssssaADLW  1431
             L PSTVVDLL++N I+KVKLFDAD   L+AL+GSGIEVMVGIPNEMLAA+SSS+ AADLW
Sbjct  4     LKPSTVVDLLKDNKIKKVKLFDADSDALTALVGSGIEVMVGIPNEMLAALSSSTEAADLW  63

Query  1430  VAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQSLAKANLGGAVKL  1251
             V QN++RY+V GG +I+YVAVGNEPFL SYSGQFQS+VVPA+ N+QQSL KANL G VKL
Sbjct  64    VRQNVSRYVVKGGADIRYVAVGNEPFLTSYSGQFQSFVVPALLNLQQSLVKANLAGYVKL  123

Query  1250  VVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIYPFLSLYGNSDFPQD  1071
             VVPCNADAYESSLPSQGAFR ELTQIMTQLVS LNSN SPFVVNIYPFLSLYGNSDFPQD
Sbjct  124   VVPCNADAYESSLPSQGAFRSELTQIMTQLVSFLNSNGSPFVVNIYPFLSLYGNSDFPQD  183

Query  1070  YAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIGEVGWPTDGATSANL  891
             YAFFEG+ HPV DG NVY NAFDGN DTLV+AL+KLGY QMPIVIGEVGWPTDGA  ANL
Sbjct  184   YAFFEGSTHPVTDGSNVYYNAFDGNFDTLVSALNKLGYGQMPIVIGEVGWPTDGAFGANL  243

Query  890   TAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILPGDFERHWGVFSFDG  711
             +AAR FNQGLI HVL NKGTPLRP VPP+D+YLFSL DE  KS+LPG+FERHWG+FSFDG
Sbjct  244   SAARFFNQGLINHVLSNKGTPLRPRVPPMDIYLFSLLDEGAKSVLPGNFERHWGIFSFDG  303

Query  710   QLKYP--LDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLACSLADCTTLKYGG  537
             Q KY   L LGN  LKNA++V YLP RWC+ +P+KDL+ V+NH+R+ACS+ADCTTL YGG
Sbjct  304   QAKYALNLGLGNRLLKNAKNVEYLPSRWCVADPSKDLTNVANHMRIACSVADCTTLDYGG  363

Query  536   SCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDECRFLVGVTDTNNSS  357
             SCNGIG KGNISYAFNSYYQL  QN QSCDFDGLG+VTFLDPSV +CRFLVGVT    S 
Sbjct  364   SCNGIGAKGNISYAFNSYYQLQMQNAQSCDFDGLGMVTFLDPSVGDCRFLVGVTGHKKSI  423

Query  356   GFSlplltliiiIS--WGVWLFL  294
              F        I  S  W VW FL
Sbjct  424   AFRPTPRRTTIWTSILWWVWSFL  446



>ref|XP_002459936.1| hypothetical protein SORBIDRAFT_02g017290 [Sorghum bicolor]
 gb|EER96457.1| hypothetical protein SORBIDRAFT_02g017290 [Sorghum bicolor]
Length=492

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/436 (72%), Positives = 373/436 (86%), Gaps = 3/436 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             E+AIGVNWGT++ H+ PP  VVDL+R N I KVKLFDADP VL AL GSGI+VMVG+ N 
Sbjct  25    EAAIGVNWGTVSDHRAPPGVVVDLMRANRISKVKLFDADPGVLRALAGSGIQVMVGVTNG  84

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
              LA+++ S +AAD WVAQN++RY+  GGV+I+Y+AVGNEPFL SY GQFQSY++PA+TN+
Sbjct  85    ELASIAGSQAAADDWVAQNVSRYVGRGGVDIRYIAVGNEPFLTSYQGQFQSYIIPAMTNI  144

Query  1295  QQSLAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             QQSL KANL   +KLVVPCNADAY+S S+PSQG FR ELTQIMTQL + L+S+ +PFVVN
Sbjct  145   QQSLVKANLASYIKLVVPCNADAYQSASVPSQGVFRTELTQIMTQLAAFLSSSGAPFVVN  204

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY +SDFPQDYAFFEG+ HPVVDGPNVY NAFDGN DTLV+ALSK+GY  +PI 
Sbjct  205   IYPFLSLYQSSDFPQDYAFFEGSTHPVVDGPNVYYNAFDGNFDTLVSALSKIGYGNLPIA  264

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWPT+GA SANLTAARAFNQGLI  V  NKGTPLRPGVPP DVYLFSL DE GKSI
Sbjct  265   IGEIGWPTEGAPSANLTAARAFNQGLINRVTSNKGTPLRPGVPPADVYLFSLLDEEGKSI  324

Query  758   LPGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHI  585
             LPG+FERHWG+FSFDGQ KYPL+  LGN  LKNA++VPYLP RWC+ NP ++L  VS+H+
Sbjct  325   LPGNFERHWGIFSFDGQAKYPLNLGLGNSVLKNAKEVPYLPSRWCVANPARNLDGVSDHM  384

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
             +LACS+ADCTTL YGGSC GIGEKGN+SYAFNSYYQ  KQ+P+SCDF GLG++T+LDPS+
Sbjct  385   KLACSMADCTTLYYGGSCYGIGEKGNVSYAFNSYYQQQKQDPKSCDFGGLGMITYLDPSM  444

Query  404   DECRFLVGVTDTNNSS  357
              ECRFLVGV D+ +S+
Sbjct  445   GECRFLVGVDDSKSSA  460



>ref|XP_009395841.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Musa acuminata 
subsp. malaccensis]
Length=484

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/437 (73%), Positives = 375/437 (86%), Gaps = 3/437 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             +SAIG+NWGT + HKLPP  VVDLL+EN + KVKLF+ADP +L ALMGSGIEVMVGIPNE
Sbjct  24    DSAIGINWGTRSSHKLPPPVVVDLLKENRVGKVKLFEADPDILRALMGSGIEVMVGIPNE  83

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             +L  + SS +A D WV++N++R++  GG +I+Y+AVGNEPFL +Y GQ+QS V+PA+ N+
Sbjct  84    LLGVLGSSPAACDQWVSRNVSRFMDKGGADIRYIAVGNEPFLTTYQGQYQSLVLPAMLNL  143

Query  1295  QQSLAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             QQSL KANL   +KLVVPCNADAY+S S+PSQGAFRPELTQI+TQLVS LN+N SPFVVN
Sbjct  144   QQSLVKANLASYIKLVVPCNADAYQSVSVPSQGAFRPELTQIITQLVSFLNTNGSPFVVN  203

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY +SDFPQDYAFF G++HPVVDG NVY NAFDGN DTLVAALSK+GY QMPI 
Sbjct  204   IYPFLSLYQSSDFPQDYAFFGGSSHPVVDGQNVYYNAFDGNFDTLVAALSKIGYGQMPIA  263

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGEVGWP+DG  SANL+AARAF QGL+ HVL NKGTPLRPGVPP D+YLFSL DE  KSI
Sbjct  264   IGEVGWPSDGTPSANLSAARAFVQGLVNHVLSNKGTPLRPGVPPADIYLFSLLDEDQKSI  323

Query  758   LPGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHI  585
             LPG FERHWG+FSFDGQ KYPL+  LGN  LKNA+DVPYLP RWCI NP+ D SAV+NHI
Sbjct  324   LPGSFERHWGIFSFDGQAKYPLNLGLGNAALKNAKDVPYLPPRWCIANPSLDPSAVANHI  383

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
             ++AC++ADCTTL YGGSCN IGEKGNISYAFNSYYQL KQ+ +SC+FDGLG+VTFLDPS+
Sbjct  384   KVACNVADCTTLFYGGSCNAIGEKGNISYAFNSYYQLQKQDARSCNFDGLGMVTFLDPSI  443

Query  404   DECRFLVGVTDTNNSSG  354
              +CRFLVG++D+ +  G
Sbjct  444   GDCRFLVGISDSGSPVG  460



>ref|NP_001141759.1| uncharacterized protein LOC100273895 precursor [Zea mays]
 gb|ACF87003.1| unknown [Zea mays]
Length=492

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/436 (72%), Positives = 374/436 (86%), Gaps = 3/436 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             E+AIGVNWGT++ H+ PP  VVDL+R N I KVKLF+ADP VL AL GSGI+VMVG+ N+
Sbjct  25    EAAIGVNWGTVSNHRAPPGVVVDLMRANRISKVKLFNADPGVLRALAGSGIQVMVGVTND  84

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
              LA+++ S +AAD WVAQN++RY+   GV+I+Y+AVGNEPFL SY GQFQSY++PA+TN+
Sbjct  85    ELASIAGSQAAADDWVAQNVSRYVGRSGVDIRYIAVGNEPFLTSYQGQFQSYIIPAMTNI  144

Query  1295  QQSLAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             QQSL KANL   VKLVVPCNADAY+S S+PSQG FR ELTQ+MTQL + L+S+ +PFVVN
Sbjct  145   QQSLVKANLASYVKLVVPCNADAYQSASVPSQGVFRTELTQLMTQLAAFLSSSGAPFVVN  204

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY NSDFPQDYAFFEG+ HPVVDGPNVY +AFDGN DTLV+ALSK+GY  +PI 
Sbjct  205   IYPFLSLYQNSDFPQDYAFFEGSTHPVVDGPNVYYDAFDGNFDTLVSALSKIGYGNLPIA  264

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWPT+GA SANLTAARAFNQGLI  +  NKGTPLRPGVPP DVYLFSL DE GKSI
Sbjct  265   IGEIGWPTEGAPSANLTAARAFNQGLINRITSNKGTPLRPGVPPADVYLFSLLDEEGKSI  324

Query  758   LPGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHI  585
             LPG+FERHWG+FSFDGQ KYPL+  LGN  LKNA++VPYLP RWC+ NP +DL +VS+H+
Sbjct  325   LPGNFERHWGIFSFDGQAKYPLNLGLGNSVLKNAKEVPYLPSRWCVANPARDLDSVSDHM  384

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
             +LACS+ADCTTL YGGSC GIGEKGN+SYAFNSYYQ  KQ+P+SCDF GLG++T+LDPS+
Sbjct  385   KLACSMADCTTLYYGGSCYGIGEKGNVSYAFNSYYQQQKQDPKSCDFGGLGMITYLDPSM  444

Query  404   DECRFLVGVTDTNNSS  357
              ECRFLVGV D+ +S+
Sbjct  445   GECRFLVGVDDSKSSA  460



>tpg|DAA60836.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=492

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/436 (72%), Positives = 373/436 (86%), Gaps = 3/436 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             E+AIGVNWGT++ H+ PP  VVDL+R N I KVKLF+ADP VL AL GSGI+VMVG+ N+
Sbjct  25    EAAIGVNWGTVSNHRAPPGVVVDLMRANRISKVKLFNADPGVLRALAGSGIQVMVGVTND  84

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
              LA+++ S +AAD WVAQN++RY+   GV I+Y+AVGNEPFL SY GQFQSY++PA+TN+
Sbjct  85    ELASIAGSQAAADDWVAQNVSRYVGRSGVGIRYIAVGNEPFLTSYQGQFQSYIIPAMTNI  144

Query  1295  QQSLAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             QQSL KANL   VKLVVPCNADAY+S S+PSQG FR ELTQ+MTQL + L+S+ +PFVVN
Sbjct  145   QQSLVKANLASYVKLVVPCNADAYQSASVPSQGVFRTELTQLMTQLAAFLSSSGAPFVVN  204

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY NSDFPQDYAFFEG+ HPVVDGPNVY +AFDGN DTLV+ALSK+GY  +PI 
Sbjct  205   IYPFLSLYQNSDFPQDYAFFEGSTHPVVDGPNVYYDAFDGNFDTLVSALSKIGYGNLPIA  264

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWPT+GA SANLTAARAFNQGLI  +  NKGTPLRPGVPP DVYLFSL DE GKSI
Sbjct  265   IGEIGWPTEGAPSANLTAARAFNQGLINRITSNKGTPLRPGVPPADVYLFSLLDEEGKSI  324

Query  758   LPGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHI  585
             LPG+FERHWG+FSFDGQ KYPL+  LGN  LKNA++VPYLP RWC+ NP +DL +VS+H+
Sbjct  325   LPGNFERHWGIFSFDGQAKYPLNLGLGNSVLKNAKEVPYLPSRWCVANPARDLDSVSDHM  384

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
             +LACS+ADCTTL YGGSC GIGEKGN+SYAFNSYYQ  KQ+P+SCDF GLG++T+LDPS+
Sbjct  385   KLACSMADCTTLYYGGSCYGIGEKGNVSYAFNSYYQQQKQDPKSCDFGGLGMITYLDPSM  444

Query  404   DECRFLVGVTDTNNSS  357
              ECRFLVGV D+ +S+
Sbjct  445   GECRFLVGVDDSKSSA  460



>ref|XP_003534750.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Glycine max]
Length=487

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/439 (73%), Positives = 370/439 (84%), Gaps = 3/439 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGTI+ H+L P+TVV LLR+N I KVKLF+AD  V+ ALMGS I+VMVGIPNE
Sbjct  23    ESAIGVNWGTISSHRLKPTTVVALLRQNKISKVKLFEADSDVMKALMGSAIQVMVGIPNE  82

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML  +SSS +AADLWV QN++ Y+  GG +I+YVAVGNEPFL+SY+GQ+Q+ ++PA+ N+
Sbjct  83    MLPLLSSSPAAADLWVRQNVSVYVGRGGADIRYVAVGNEPFLSSYNGQYQNLIMPAILNI  142

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESS-LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             QQSL KANL G +KLVVPCNADAY+SS LPSQGAFRPELTQIM+QLV  LNSN SPFVVN
Sbjct  143   QQSLVKANLAGYIKLVVPCNADAYQSSALPSQGAFRPELTQIMSQLVQFLNSNGSPFVVN  202

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY N DFPQ+YAFFEGT H V DG NVY+NAF+GN DTLVAAL+KLGY QMPIV
Sbjct  203   IYPFLSLYNNGDFPQEYAFFEGTTHAVQDGSNVYTNAFEGNYDTLVAALTKLGYGQMPIV  262

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWP+DGA  AN+TAA+ FNQGLI H+  NKGTPLRP  PP DVYLFSL DE  KS 
Sbjct  263   IGEIGWPSDGAIGANITAAKVFNQGLINHIASNKGTPLRPNAPPTDVYLFSLLDEGAKST  322

Query  758   LPGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHI  585
             LPG+FERHWG+FSFDGQ KYPL+  LGN +LKNAR+V YLP RWC+ NP+ DL+ V NHI
Sbjct  323   LPGNFERHWGIFSFDGQAKYPLNLLLGNKELKNARNVEYLPSRWCVANPSGDLNDVVNHI  382

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
             RLACS+ADCTTL YGGSCN IGEKGNISYAFNSYYQL  Q+ +SC+FDGLG+VTFLDPSV
Sbjct  383   RLACSVADCTTLNYGGSCNEIGEKGNISYAFNSYYQLQMQDSRSCNFDGLGMVTFLDPSV  442

Query  404   DECRFLVGVTDTNNSSGFS  348
              +C FLVGVTD  + S  S
Sbjct  443   GDCHFLVGVTDKGSDSSTS  461



>gb|KHN40768.1| Glucan endo-1,3-beta-glucosidase 5 [Glycine soja]
Length=487

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/439 (73%), Positives = 369/439 (84%), Gaps = 3/439 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGTI+ H+L P+TVV LLR+N I KVKLF+AD  V+ ALMGS I+VMVGIPNE
Sbjct  23    ESAIGVNWGTISSHRLKPTTVVALLRQNKISKVKLFEADSDVMKALMGSAIQVMVGIPNE  82

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML  +SSS +AADLWV QN++ Y+  GG +I+YVAVGNEPFL+SY+GQ+Q+ ++PA+ N+
Sbjct  83    MLPLLSSSPAAADLWVRQNVSVYVGRGGADIRYVAVGNEPFLSSYNGQYQNLIMPAILNI  142

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESS-LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             QQSL KANL G +KLVVPCNADAY+SS LPSQG FRPELTQIM+QLV  LNSN SPFVVN
Sbjct  143   QQSLVKANLAGYIKLVVPCNADAYQSSALPSQGTFRPELTQIMSQLVQFLNSNGSPFVVN  202

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY N DFPQ+YAFFEGT H V DG NVY+NAF+GN DTLVAAL+KLGY QMPIV
Sbjct  203   IYPFLSLYNNGDFPQEYAFFEGTTHAVQDGSNVYTNAFEGNYDTLVAALTKLGYGQMPIV  262

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWP+DGA  AN+TAA+ FNQGLI H+  NKGTPLRP  PP DVYLFSL DE  KS 
Sbjct  263   IGEIGWPSDGAIGANITAAKVFNQGLINHIASNKGTPLRPNAPPTDVYLFSLLDEGAKST  322

Query  758   LPGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHI  585
             LPG+FERHWG+FSFDGQ KYPL+  LGN +LKNAR+V YLP RWC+ NP+ DL+ V NHI
Sbjct  323   LPGNFERHWGIFSFDGQAKYPLNLLLGNKELKNARNVEYLPSRWCVANPSGDLNDVVNHI  382

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
             RLACS+ADCTTL YGGSCN IGEKGNISYAFNSYYQL  Q+ +SC+FDGLG+VTFLDPSV
Sbjct  383   RLACSVADCTTLNYGGSCNEIGEKGNISYAFNSYYQLQMQDSRSCNFDGLGMVTFLDPSV  442

Query  404   DECRFLVGVTDTNNSSGFS  348
              +C FLVGVTD  + S  S
Sbjct  443   GDCHFLVGVTDKGSDSSTS  461



>ref|XP_006857659.1| hypothetical protein AMTR_s00061p00152190 [Amborella trichopoda]
 gb|ERN19126.1| hypothetical protein AMTR_s00061p00152190 [Amborella trichopoda]
Length=460

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/430 (74%), Positives = 367/430 (85%), Gaps = 2/430 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ES IG NWGT++ H+LPP  VV+LL+ N IQKVKLFDAD  VL  LMGSGIEVMVGIPNE
Sbjct  3     ESGIGFNWGTLSTHRLPPYVVVNLLKVNRIQKVKLFDADSYVLQGLMGSGIEVMVGIPNE  62

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             +L  ++SS +AAD WV  ++ RY V GGV+I+YVAVGNEPFL SY GQFQSYV+PAV N+
Sbjct  63    LLQVLASSPTAADSWVHDSVVRYAVRGGVDIRYVAVGNEPFLTSYQGQFQSYVLPAVVNI  122

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL G VK VVPCNADAYE+SLPSQG FRPELT IMTQLVS+LN   SPFVVNI
Sbjct  123   QQSLTKANLAGIVKPVVPCNADAYEASLPSQGTFRPELTDIMTQLVSVLNKAGSPFVVNI  182

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLY +SDFPQDYAFF G++HP+VDGPNVY NAFDGN DTL AALSK+G+ QMPIVI
Sbjct  183   YPFLSLYQSSDFPQDYAFFGGSSHPLVDGPNVYYNAFDGNHDTLAAALSKIGFGQMPIVI  242

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDGA SAN++AARAFNQGLI HVL NKGTPLRPGVPP+D+YLFSL DE  K+I+
Sbjct  243   GEVGWPTDGALSANISAARAFNQGLIDHVLSNKGTPLRPGVPPMDIYLFSLLDEGQKNIM  302

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNG--QLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWGVFSFDGQ KYPL+LG G   L+NA DV YLP RWC+ +P +DL+ VS+HI+
Sbjct  303   PGNFERHWGVFSFDGQAKYPLNLGLGYKTLRNADDVQYLPSRWCVADPTRDLALVSDHIK  362

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS+ADCTTL YGGSCN IG  GN+SYAFNSYYQ+ KQ+ ++C+FDGLG++TFLDPS+ 
Sbjct  363   LACSVADCTTLLYGGSCNSIGVAGNVSYAFNSYYQVKKQDARTCEFDGLGMITFLDPSIG  422

Query  401   ECRFLVGVTD  372
             +CRFLVG+ D
Sbjct  423   DCRFLVGIND  432



>ref|XP_010440044.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like isoform X1 
[Camelina sativa]
 ref|XP_010440045.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like isoform X2 
[Camelina sativa]
Length=478

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/435 (73%), Positives = 364/435 (84%), Gaps = 7/435 (2%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             +SAIGVNWGT++ HK+ PSTVVDLL+ N I KVKLFD +P  L ALMG+GI+VMVGIPNE
Sbjct  25    DSAIGVNWGTLSFHKMRPSTVVDLLKANKITKVKLFDTNPDALRALMGTGIQVMVGIPNE  84

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML++ +S     DL+V QNL+R++   G +I+YVAVGNEPFL  Y GQFQ+YVVPA+ N+
Sbjct  85    MLSSFNS-----DLFVQQNLSRFIGKNGADIRYVAVGNEPFLTGYGGQFQNYVVPAMVNL  139

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL   VKLVVPCNADAYE+++PSQG FRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  140   QQSLVKANLANYVKLVVPCNADAYEANVPSQGTFRPELTQIMTQLVSFLNSNGSPFVVNI  199

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEG++HPV DGPN Y NAFDGN DTLVAAL+KLGY QMPIVI
Sbjct  200   YPFLSLYGNSDFPQDYAFFEGSSHPVPDGPNTYYNAFDGNFDTLVAALTKLGYGQMPIVI  259

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDGA  ANLTAAR FNQGLI HVL NKGTPLRPG PP DVYLF L DE  KS L
Sbjct  260   GEIGWPTDGAVGANLTAARVFNQGLISHVLSNKGTPLRPGSPPADVYLFGLLDEGAKSTL  319

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY L+LG G   LKNA+DV YLP RWC+ +P++D++ V +H+R
Sbjct  320   PGNFERHWGIFSFDGQAKYRLNLGLGNRGLKNAKDVAYLPSRWCVAHPSRDMTLVGDHLR  379

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS ADCTTL  GGSC+ +GEK NISYAFNSYYQ+  QN +SCDFDGLG+VTFLDPSV 
Sbjct  380   LACSEADCTTLNDGGSCSQLGEKDNISYAFNSYYQMQMQNEKSCDFDGLGMVTFLDPSVG  439

Query  401   ECRFLVGVTDTNNSS  357
             +CRFLVGVTD   SS
Sbjct  440   DCRFLVGVTDKGLSS  454



>ref|XP_007154071.1| hypothetical protein PHAVU_003G088600g [Phaseolus vulgaris]
 gb|ESW26065.1| hypothetical protein PHAVU_003G088600g [Phaseolus vulgaris]
Length=487

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/438 (71%), Positives = 374/438 (85%), Gaps = 2/438 (0%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGT++  KL PSTVVDLL++N I KVK+F+A+P VL ALMGSGI+VMVGIPN+
Sbjct  26    ESAIGVNWGTVSFLKLQPSTVVDLLKDNKIPKVKVFEAEPEVLKALMGSGIQVMVGIPNQ  85

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA + +S +AADLW+ QN++ Y+   G +I+Y+AVGNEPFL SY+G++Q+ V+PA+ ++
Sbjct  86    MLALLGTSPTAADLWLRQNVSAYIGKDGADIRYIAVGNEPFLTSYNGEYQNLVMPAILSL  145

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL   +KLVVPCNADAYESSLPSQGAFRPELTQI+TQLV  LNSN +PFVVNI
Sbjct  146   QQSLVKANLASYIKLVVPCNADAYESSLPSQGAFRPELTQIITQLVQFLNSNGAPFVVNI  205

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLY N DFPQDYAFFEGT+HPV DG NVY+NAFDGN DTLVAAL+K+GY +MPIVI
Sbjct  206   YPFLSLYDNKDFPQDYAFFEGTSHPVTDGNNVYTNAFDGNYDTLVAALTKVGYGEMPIVI  265

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWP+DGA  AN+TA++ FNQGLI HVL NKGTPLRPG PP+D+YLFSL DE  KSIL
Sbjct  266   GEIGWPSDGAIGANMTASKVFNQGLISHVLNNKGTPLRPGAPPMDIYLFSLLDEGAKSIL  325

Query  755   PGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG FERHWG+FSFDGQ KYPL+  LGN +LKNA++V YLP RWC+ +P+ D   V+NH+R
Sbjct  326   PGGFERHWGIFSFDGQAKYPLNLGLGNKELKNAKNVQYLPSRWCVASPSIDAQNVANHMR  385

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             +ACS+ADCTTL YGGSCNGIGEKGNISYAFNSYYQL  Q+ +SC+FDGLG++TF DPSV 
Sbjct  386   IACSVADCTTLDYGGSCNGIGEKGNISYAFNSYYQLQMQDSRSCNFDGLGMITFRDPSVG  445

Query  401   ECRFLVGVTDTNNSSGFS  348
             +CRFLVGVTD  + S  S
Sbjct  446   DCRFLVGVTDKGSHSSVS  463



>emb|CAB10499.1| glucanase like protein [Arabidopsis thaliana]
 emb|CAB80989.1| glucanase like protein [Arabidopsis thaliana]
Length=502

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/435 (73%), Positives = 363/435 (83%), Gaps = 7/435 (2%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGT++ HK+ PSTVVDLL+ N I KVKLFDA+P  L ALMG+GI+VM+GIPNE
Sbjct  49    ESAIGVNWGTLSFHKMRPSTVVDLLKANKITKVKLFDANPDALRALMGTGIQVMIGIPNE  108

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML+  +S     DL+V QNL+R++   G +I+YVAVGNEPFL  Y GQFQ+YVVP + N+
Sbjct  109   MLSTFNS-----DLFVQQNLSRFIGKNGADIRYVAVGNEPFLTGYGGQFQNYVVPTMVNL  163

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL +ANL   VKLVVPCNADAY+S++PSQG FRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  164   QQSLVRANLASYVKLVVPCNADAYQSNVPSQGMFRPELTQIMTQLVSFLNSNGSPFVVNI  223

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEG++HPV DGPN Y NAFDGN DTLVAAL+KLGY QMPIVI
Sbjct  224   YPFLSLYGNSDFPQDYAFFEGSSHPVPDGPNTYYNAFDGNFDTLVAALTKLGYGQMPIVI  283

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDGA  ANLTAAR FNQGLI HVL NKGTPLRPG PP DVYLF L DE  KS L
Sbjct  284   GEIGWPTDGAVGANLTAARVFNQGLISHVLSNKGTPLRPGSPPADVYLFGLLDEGAKSTL  343

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY L+LG G   LKNA++V YLP RWC+ +P++D++ V +H+R
Sbjct  344   PGNFERHWGIFSFDGQAKYRLNLGLGNRGLKNAKNVQYLPSRWCVAHPSRDMTQVGDHLR  403

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS ADCTTL  GGSC+ +GEK NISYAFNSYYQ+  Q+ +SCDFDGLG+VTFLDPSV 
Sbjct  404   LACSEADCTTLNDGGSCSQLGEKDNISYAFNSYYQMQMQHEKSCDFDGLGMVTFLDPSVG  463

Query  401   ECRFLVGVTDTNNSS  357
             +CRFLVGVTD   SS
Sbjct  464   DCRFLVGVTDIGLSS  478



>ref|NP_193451.2| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAC42089.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83858.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=475

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/435 (73%), Positives = 363/435 (83%), Gaps = 7/435 (2%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGT++ HK+ PSTVVDLL+ N I KVKLFDA+P  L ALMG+GI+VM+GIPNE
Sbjct  22    ESAIGVNWGTLSFHKMRPSTVVDLLKANKITKVKLFDANPDALRALMGTGIQVMIGIPNE  81

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML+  +S     DL+V QNL+R++   G +I+YVAVGNEPFL  Y GQFQ+YVVP + N+
Sbjct  82    MLSTFNS-----DLFVQQNLSRFIGKNGADIRYVAVGNEPFLTGYGGQFQNYVVPTMVNL  136

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL +ANL   VKLVVPCNADAY+S++PSQG FRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  137   QQSLVRANLASYVKLVVPCNADAYQSNVPSQGMFRPELTQIMTQLVSFLNSNGSPFVVNI  196

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEG++HPV DGPN Y NAFDGN DTLVAAL+KLGY QMPIVI
Sbjct  197   YPFLSLYGNSDFPQDYAFFEGSSHPVPDGPNTYYNAFDGNFDTLVAALTKLGYGQMPIVI  256

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDGA  ANLTAAR FNQGLI HVL NKGTPLRPG PP DVYLF L DE  KS L
Sbjct  257   GEIGWPTDGAVGANLTAARVFNQGLISHVLSNKGTPLRPGSPPADVYLFGLLDEGAKSTL  316

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY L+LG G   LKNA++V YLP RWC+ +P++D++ V +H+R
Sbjct  317   PGNFERHWGIFSFDGQAKYRLNLGLGNRGLKNAKNVQYLPSRWCVAHPSRDMTQVGDHLR  376

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS ADCTTL  GGSC+ +GEK NISYAFNSYYQ+  Q+ +SCDFDGLG+VTFLDPSV 
Sbjct  377   LACSEADCTTLNDGGSCSQLGEKDNISYAFNSYYQMQMQHEKSCDFDGLGMVTFLDPSVG  436

Query  401   ECRFLVGVTDTNNSS  357
             +CRFLVGVTD   SS
Sbjct  437   DCRFLVGVTDIGLSS  451



>ref|XP_010434711.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Camelina 
sativa]
Length=478

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/435 (73%), Positives = 363/435 (83%), Gaps = 7/435 (2%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             +SAIGVNWGT++ HK+ PSTVVDLL+ N I KVKLFD +P  L ALMG+G +VMVGIPNE
Sbjct  25    DSAIGVNWGTLSFHKMRPSTVVDLLKANKITKVKLFDTNPDALRALMGTGTQVMVGIPNE  84

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML++ +S     DL+V QNL+R++   G +I+YVAVGNEPFL SY GQFQ+YVVPA+ N+
Sbjct  85    MLSSFNS-----DLFVQQNLSRFIGKNGADIRYVAVGNEPFLTSYGGQFQNYVVPAMVNL  139

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL   VKLVVPCNADAYE+++PSQG FRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  140   QQSLVKANLANYVKLVVPCNADAYEANVPSQGTFRPELTQIMTQLVSFLNSNGSPFVVNI  199

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEG++HPV DGPN Y NAFDGN DTLVAAL+KLGY QMPIVI
Sbjct  200   YPFLSLYGNSDFPQDYAFFEGSSHPVPDGPNTYYNAFDGNFDTLVAALTKLGYGQMPIVI  259

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDGA  ANLTAAR FNQGLI HVL NKGTPLRPG P  DVYLF L DE  KS L
Sbjct  260   GEIGWPTDGAVGANLTAARVFNQGLISHVLSNKGTPLRPGSPLADVYLFGLLDEGAKSTL  319

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY L+LG G   LKNA+DV YLP RWC+ +P++D++ V +H+R
Sbjct  320   PGNFERHWGIFSFDGQAKYRLNLGLGNRGLKNAKDVAYLPSRWCVAHPSRDMTLVGDHLR  379

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS ADCTTL  GGSC+ +GEK NISYAFNSYYQ+  QN +SCDFDGLG+VTFLDPSV 
Sbjct  380   LACSEADCTTLNDGGSCSQLGEKDNISYAFNSYYQMQMQNEKSCDFDGLGMVTFLDPSVG  439

Query  401   ECRFLVGVTDTNNSS  357
             +CRFLVGVTD   SS
Sbjct  440   DCRFLVGVTDKGLSS  454



>gb|EAZ06546.1| hypothetical protein OsI_28792 [Oryza sativa Indica Group]
Length=499

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/436 (72%), Positives = 374/436 (86%), Gaps = 3/436 (1%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT++ H++P   VV+L+R N I +VKLFDAD A L ALMGSG++VMVGI NEML 
Sbjct  36    VGVNWGTVSAHRMPAPVVVELMRANRIGRVKLFDADQAALRALMGSGLQVMVGITNEMLQ  95

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              +++S +AAD WVA+N++RY+  GG +I+Y+AVGNEPFL SY GQFQSYV+PA+TN+QQS
Sbjct  96    GIAASPAAADAWVARNVSRYVGPGGADIRYIAVGNEPFLTSYQGQFQSYVLPAMTNIQQS  155

Query  1286  LAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIYP  1110
             L KANL   +KLVVPCNADAY+S S+PSQG FRP+L QI+TQL + L+S+ +PFVVNIYP
Sbjct  156   LVKANLARYIKLVVPCNADAYQSASVPSQGVFRPDLIQIITQLAAFLSSSGAPFVVNIYP  215

Query  1109  FLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIGE  930
             FLSLY +SDFPQDYAFF+G++HPVVDGPNVY NAFDGN DTLV+ALSK+GY Q+PI IGE
Sbjct  216   FLSLYQSSDFPQDYAFFDGSSHPVVDGPNVYYNAFDGNFDTLVSALSKIGYGQLPIAIGE  275

Query  929   VGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILPG  750
             VGWPT+GA SANLTAARAF QGLI HVL NKGTPLRPGVPP+DVYLFSL DE  KS LPG
Sbjct  276   VGWPTEGAPSANLTAARAFTQGLISHVLSNKGTPLRPGVPPMDVYLFSLLDEEQKSTLPG  335

Query  749   DFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLA  576
             +FERHWGVFSFDGQ KYPL+LG G   LKNA+DVPYLP RWC+ NP +DL+ V NH++LA
Sbjct  336   NFERHWGVFSFDGQAKYPLNLGLGSPVLKNAKDVPYLPPRWCVANPGRDLNNVENHLKLA  395

Query  575   CSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDEC  396
             C++ADCTTL YGGSCN IGEKGNISYAFNSYYQL KQ+ QSCDFDGLG++T+LDPS+ +C
Sbjct  396   CTMADCTTLYYGGSCNAIGEKGNISYAFNSYYQLRKQDAQSCDFDGLGMITYLDPSIGDC  455

Query  395   RFLVGVTDTNNSSGFS  348
             RFLVG+ D+  S+ +S
Sbjct  456   RFLVGIDDSRTSTIYS  471



>dbj|BAD01673.1| putative glycosyl hydrolase [Oryza sativa Japonica Group]
 dbj|BAD03265.1| putative glycosyl hydrolase [Oryza sativa Japonica Group]
Length=499

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/436 (72%), Positives = 374/436 (86%), Gaps = 3/436 (1%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT++ H++P   VV+L+R N I +VKLFDAD A L ALMGSG++VMVGI NEML 
Sbjct  36    VGVNWGTVSAHRMPAPVVVELMRANRIGRVKLFDADQAALRALMGSGLQVMVGITNEMLQ  95

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              +++S +AAD WVA+N++RY+  GG +I+Y+AVGNEPFL SY GQFQSYV+PA+TN+QQS
Sbjct  96    GIAASPAAADAWVARNVSRYVGPGGADIRYIAVGNEPFLTSYQGQFQSYVLPAMTNIQQS  155

Query  1286  LAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIYP  1110
             L KANL   +KLVVPCNADAY+S S+PSQG FRP+L QI+TQL + L+S+ +PFVVNIYP
Sbjct  156   LVKANLARYIKLVVPCNADAYQSASVPSQGVFRPDLIQIITQLAAFLSSSGAPFVVNIYP  215

Query  1109  FLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIGE  930
             FLSLY +SDFPQDYAFF+G++HPVVDGPNVY NAFDGN DTLV+ALSK+GY Q+PI IGE
Sbjct  216   FLSLYQSSDFPQDYAFFDGSSHPVVDGPNVYYNAFDGNFDTLVSALSKIGYGQLPIAIGE  275

Query  929   VGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILPG  750
             VGWPT+GA SANLTAARAF QGLI HVL NKGTPLRPGVPP+DVYLFSL DE  KS LPG
Sbjct  276   VGWPTEGAPSANLTAARAFTQGLISHVLSNKGTPLRPGVPPMDVYLFSLLDEEQKSTLPG  335

Query  749   DFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLA  576
             +FERHWGVFSFDGQ KYPL+LG G   LKNA+DVPYLP RWC+ NP +DL+ V NH++LA
Sbjct  336   NFERHWGVFSFDGQAKYPLNLGLGSPVLKNAKDVPYLPPRWCVANPGRDLNNVENHLKLA  395

Query  575   CSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDEC  396
             C++ADCTTL YGGSCN IGEKGNISYAFNSYYQL KQ+ QSCDFDGLG++T+LDPS+ +C
Sbjct  396   CTMADCTTLYYGGSCNAIGEKGNISYAFNSYYQLRKQDAQSCDFDGLGMITYLDPSIGDC  455

Query  395   RFLVGVTDTNNSSGFS  348
             RFLVG+ D+  S+ +S
Sbjct  456   RFLVGIDDSRTSTIYS  471



>ref|XP_010449654.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Camelina 
sativa]
Length=477

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/435 (73%), Positives = 362/435 (83%), Gaps = 7/435 (2%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             +SAIGVNWGT++ HK+ PSTVVDLL+ N I KVKLFD +P  L ALMG+GI+VMVGIPNE
Sbjct  24    DSAIGVNWGTLSFHKMRPSTVVDLLKANKITKVKLFDTNPDALRALMGTGIQVMVGIPNE  83

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML++ +S     DL+V QNL+R++   G +I+YVAVGNEPFL  Y GQFQ+ VVPA+ N+
Sbjct  84    MLSSFNS-----DLFVQQNLSRFIGKNGADIRYVAVGNEPFLTGYGGQFQNLVVPAMVNL  138

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL   VKLVVPCNADAYE+++PSQG FRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  139   QQSLVKANLANYVKLVVPCNADAYEANVPSQGTFRPELTQIMTQLVSFLNSNGSPFVVNI  198

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEG++HPV DGPN Y NAFDGN DTLV+AL+KLGY QMPIVI
Sbjct  199   YPFLSLYGNSDFPQDYAFFEGSSHPVPDGPNTYYNAFDGNFDTLVSALTKLGYGQMPIVI  258

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDGA  ANLTAAR FNQGLI HVL NKGTPLRPG PP DVYLF L DE  KS L
Sbjct  259   GEIGWPTDGAVGANLTAARVFNQGLISHVLSNKGTPLRPGSPPADVYLFGLLDEGAKSTL  318

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY L+LG G   LKNA+DV YLP RWC+ +P +D++ V +H+R
Sbjct  319   PGNFERHWGIFSFDGQAKYRLNLGLGNRGLKNAKDVAYLPSRWCVAHPARDMTLVGDHLR  378

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS ADCTTL  GGSC+ +GEK NISYAFNSYYQ+  QN +SCDFDGLG+VTFLDPSV 
Sbjct  379   LACSEADCTTLNDGGSCSQLGEKDNISYAFNSYYQMQMQNEKSCDFDGLGMVTFLDPSVG  438

Query  401   ECRFLVGVTDTNNSS  357
             +CRFLVGVTD   SS
Sbjct  439   DCRFLVGVTDKGLSS  453



>gb|ABN08871.1| Glycoside hydrolase, family 17; X8 [Medicago truncatula]
Length=468

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/432 (72%), Positives = 363/432 (84%), Gaps = 4/432 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGT++ H+L PSTVV+LLR+N I KVKLF+ADPA+L ALMGS I+VMVGIPNE
Sbjct  4     ESAIGVNWGTLSSHRLKPSTVVNLLRDNKISKVKLFEADPAILKALMGSAIQVMVGIPNE  63

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML+ +  SS AAD WV +N++ ++  GG +I+Y+AVGNEPFL SY+GQF + V+PA+TN+
Sbjct  64    MLSLLGGSSVAADYWVQRNVSAFMTKGGADIRYIAVGNEPFLTSYNGQFINLVIPAITNI  123

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             QQSL KANL G VK+VVPCNADAYESS  LPSQG FR ELTQI+TQLV  LNSN SPFVV
Sbjct  124   QQSLVKANLAGYVKIVVPCNADAYESSGGLPSQGVFRSELTQIITQLVQFLNSNGSPFVV  183

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
             NIYPFLSLY N DFP DYAFF+GT H V DG NVY+NAFDGN DTLV+AL KLGY QMPI
Sbjct  184   NIYPFLSLYDNGDFPGDYAFFQGTTHAVTDGSNVYTNAFDGNYDTLVSALGKLGYGQMPI  243

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             VIGE+GWP+DGA  AN+TAAR FNQGL+YH+  NKGTPLRP VPP+DVYLF LFDE  KS
Sbjct  244   VIGEIGWPSDGAIGANITAARVFNQGLVYHIASNKGTPLRPNVPPMDVYLFGLFDEGAKS  303

Query  761   ILPGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNH  588
              LPG+FERHWG+FSFDGQ KY L+  LGN +L+NAR+V YLP RWC+ NP  DL+ V NH
Sbjct  304   TLPGNFERHWGIFSFDGQAKYSLNLGLGNKELRNARNVEYLPSRWCVANPLSDLTNVVNH  363

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
             +++ACS+ADCTTL YGGSCN IGEKGNISYAFNS+YQL  Q+ QSC+FDGLG+VTFLDPS
Sbjct  364   MKIACSVADCTTLNYGGSCNEIGEKGNISYAFNSFYQLRMQDSQSCEFDGLGMVTFLDPS  423

Query  407   VDECRFLVGVTD  372
             V +C FLVGV D
Sbjct  424   VGDCHFLVGVID  435



>ref|XP_002870120.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46379.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/435 (73%), Positives = 364/435 (84%), Gaps = 7/435 (2%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGT++ HK+ PSTVVDLL+ N I KVKLFD++P  L ALMG+GI+VMVGIPNE
Sbjct  23    ESAIGVNWGTLSFHKMRPSTVVDLLKANKITKVKLFDSNPDALRALMGTGIQVMVGIPNE  82

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML+ ++S     DL+V QNL+R++   G +I+YVAVGNEPFL  Y GQFQ+YVVPA+ N+
Sbjct  83    MLSTLNS-----DLFVQQNLSRFIDKNGADIRYVAVGNEPFLTGYGGQFQNYVVPAMVNL  137

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL   VKLVVPCNADAYES++PSQG FRPELTQIMTQLVS LN+N SPFVVNI
Sbjct  138   QQSLVKANLASYVKLVVPCNADAYESNVPSQGMFRPELTQIMTQLVSFLNTNGSPFVVNI  197

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEG++HPV DGPN Y NAFDGN DTLVAAL+KLGY QMPIVI
Sbjct  198   YPFLSLYGNSDFPQDYAFFEGSSHPVPDGPNTYYNAFDGNFDTLVAALTKLGYGQMPIVI  257

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDGA  ANLTAAR FNQGLI HVL NKGTPLRPG PP DVYLF L DE  KS L
Sbjct  258   GEIGWPTDGAVGANLTAARVFNQGLISHVLSNKGTPLRPGSPPADVYLFGLLDEGAKSTL  317

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY L+LG G   LKNA++V YL  RWC+ +P+KD++ V +H+R
Sbjct  318   PGNFERHWGIFSFDGQAKYRLNLGLGNRGLKNAKNVQYLASRWCVAHPSKDMTQVGDHLR  377

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS ADCTTL  GGSC+ +GEK NISYAFNSYYQ+  Q+ +SCDFDGLG+VTFLDPSV 
Sbjct  378   LACSEADCTTLNDGGSCSQLGEKDNISYAFNSYYQMQMQHEKSCDFDGLGMVTFLDPSVG  437

Query  401   ECRFLVGVTDTNNSS  357
             +CRFLVGVTD   SS
Sbjct  438   DCRFLVGVTDKGLSS  452



>ref|NP_001062739.1| Os09g0272300 [Oryza sativa Japonica Group]
 dbj|BAD26208.1| putative elicitor inducible beta-1,3-glucanase [Oryza sativa 
Japonica Group]
 dbj|BAF24653.1| Os09g0272300 [Oryza sativa Japonica Group]
 gb|EAZ44000.1| hypothetical protein OsJ_28623 [Oryza sativa Japonica Group]
 dbj|BAG95601.1| unnamed protein product [Oryza sativa Japonica Group]
Length=488

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/461 (70%), Positives = 380/461 (82%), Gaps = 5/461 (1%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT++ H++PP  VVDLLR N I KVKLFDADPAVL AL GSG++VMVG+ N  LA
Sbjct  25    VGVNWGTLSSHRVPPPVVVDLLRANRIGKVKLFDADPAVLRALAGSGLQVMVGVTNAELA  84

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             AV+ S +AAD WVAQN++RY+  GGV+I+Y+AVGNEPFL SY GQFQSYV+PA+TN+QQS
Sbjct  85    AVAGSPAAADAWVAQNVSRYVGRGGVDIRYIAVGNEPFLTSYQGQFQSYVIPAMTNIQQS  144

Query  1286  LAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIYP  1110
             L KANL   VKLVVPCNADAY+S SLPSQG FR ELTQIMTQL + L+S+ +PFVVNIYP
Sbjct  145   LVKANLASYVKLVVPCNADAYQSASLPSQGVFRTELTQIMTQLAAFLSSSGAPFVVNIYP  204

Query  1109  FLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIGE  930
             FLSLY +SDFPQDYAFFEG+ HPVVDGPN Y NAFDGN DTLVAAL K+GY Q+PI IGE
Sbjct  205   FLSLYQSSDFPQDYAFFEGSTHPVVDGPNTYYNAFDGNFDTLVAALGKIGYGQLPIAIGE  264

Query  929   VGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILPG  750
             VGWPT+GA SANLTAARAFNQGL+  V+ NKGTPLRPGVPP DVYLFSLFDE  KSILPG
Sbjct  265   VGWPTEGAPSANLTAARAFNQGLMNRVMNNKGTPLRPGVPPADVYLFSLFDEEQKSILPG  324

Query  749   DFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLA  576
             +FERHWG+FSFDGQ KYPL+LG G   LKNAR+VPYLP RWCI NP ++L  V+NH++LA
Sbjct  325   NFERHWGIFSFDGQAKYPLNLGLGNPVLKNAREVPYLPSRWCIANPAQNLDNVANHLKLA  384

Query  575   CSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDEC  396
             CS+ADCTTL YGGSC GIGEK N+SYAFNSYYQ  KQ+ +SCDFDG G++T+LDPS+ EC
Sbjct  385   CSMADCTTLDYGGSCYGIGEKANVSYAFNSYYQQQKQDAKSCDFDGNGMITYLDPSMGEC  444

Query  395   RFLVGVTDTNNSSGFSlplltliiiISWGV--WLFLN*HMI  279
             RFLVG+ D+ +S+  S      +    W +  W+F+   M+
Sbjct  445   RFLVGIDDSKSSAVSSCGCGCGVCCGVWVLFFWVFMYLRMM  485



>ref|XP_006284895.1| hypothetical protein CARUB_v10006187mg [Capsella rubella]
 gb|EOA17793.1| hypothetical protein CARUB_v10006187mg [Capsella rubella]
Length=476

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/430 (73%), Positives = 361/430 (84%), Gaps = 7/430 (2%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             +SAIGVNWGT++ HKL PSTVVDLL+ N I KVKLFD +P  L ALMG+GI+VMVGIPNE
Sbjct  23    DSAIGVNWGTVSFHKLRPSTVVDLLKANKITKVKLFDTNPDALRALMGTGIQVMVGIPNE  82

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA  +      DL+V QNL+R++   G +I+YVAVGNEPFL SY GQFQ+YVVPA+ N+
Sbjct  83    MLATFNP-----DLFVQQNLSRFIGKNGADIRYVAVGNEPFLTSYGGQFQNYVVPAMVNL  137

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL +ANL   VKLVVPCNADAYE+++PSQG FRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  138   QQSLVRANLANYVKLVVPCNADAYEANVPSQGTFRPELTQIMTQLVSFLNSNGSPFVVNI  197

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGNSDFPQDYAFFEG++HPV DGP+ Y NAFDGN DTLVAAL+KLGY QMPIVI
Sbjct  198   YPFLSLYGNSDFPQDYAFFEGSSHPVPDGPSTYYNAFDGNFDTLVAALTKLGYGQMPIVI  257

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDGA  ANLTAA+ FNQGLI HVL NKGTPLRPG PP DVYLF L DE  KS L
Sbjct  258   GEIGWPTDGAVGANLTAAQVFNQGLISHVLSNKGTPLRPGSPPADVYLFGLLDEGAKSTL  317

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY L+LG G   LKNA++V YLP RWC+ +P++D++ V +H+R
Sbjct  318   PGNFERHWGIFSFDGQAKYRLNLGLGNRGLKNAKNVQYLPSRWCVAHPSRDMTLVGDHLR  377

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS ADCTTL  GGSC+ +GEK NISYAFNSYYQ+  QN +SCDFDGLG+VTFLDPSV 
Sbjct  378   LACSAADCTTLNNGGSCSQLGEKDNISYAFNSYYQMQMQNEKSCDFDGLGMVTFLDPSVG  437

Query  401   ECRFLVGVTD  372
             +CRFLVGVTD
Sbjct  438   DCRFLVGVTD  447



>gb|EEC84224.1| hypothetical protein OsI_30642 [Oryza sativa Indica Group]
Length=488

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/461 (70%), Positives = 380/461 (82%), Gaps = 5/461 (1%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT++ H++PP  VVDLLR N I KVKLFDADPAVL AL GSG++VMVG+ N  LA
Sbjct  25    VGVNWGTLSSHRVPPPVVVDLLRANRIGKVKLFDADPAVLRALAGSGLQVMVGVTNAELA  84

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             AV+ S +AAD WVAQN++RY+  GGV+I+Y+AVGNEPFL SY GQFQSYV+PA+TN+QQS
Sbjct  85    AVAGSPAAADAWVAQNVSRYVGRGGVDIRYIAVGNEPFLTSYQGQFQSYVIPAMTNIQQS  144

Query  1286  LAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIYP  1110
             L KANL   VKLVVPCNADAY+S SLPSQG FR ELTQIMTQL + L+S+ +PFVVNIYP
Sbjct  145   LVKANLASYVKLVVPCNADAYQSASLPSQGVFRTELTQIMTQLAAFLSSSGAPFVVNIYP  204

Query  1109  FLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIGE  930
             FLSLY +SDFPQDYAFFEG+ HPVVDGPN Y NAFDGN DTLVAAL K+GY Q+PI IGE
Sbjct  205   FLSLYQSSDFPQDYAFFEGSTHPVVDGPNTYYNAFDGNFDTLVAALGKIGYGQLPIAIGE  264

Query  929   VGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILPG  750
             VGWPT+GA SANLTAARAFNQGL+  V+ NKGTPLRPGVPP DVYLFSLFDE  KSILPG
Sbjct  265   VGWPTEGAPSANLTAARAFNQGLMNRVMNNKGTPLRPGVPPADVYLFSLFDEEQKSILPG  324

Query  749   DFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLA  576
             +FERHWG+FSFDGQ KYPL+LG G   LKNA++VPYLP RWCI NP ++L  V+NH++LA
Sbjct  325   NFERHWGIFSFDGQAKYPLNLGLGNPVLKNAKEVPYLPSRWCIANPAQNLDNVANHLKLA  384

Query  575   CSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDEC  396
             CS+ADCTTL YGGSC GIGEK N+SYAFNSYYQ  KQ+ +SCDFDG G++T+LDPS+ EC
Sbjct  385   CSMADCTTLDYGGSCYGIGEKANVSYAFNSYYQQQKQDAKSCDFDGNGMITYLDPSMGEC  444

Query  395   RFLVGVTDTNNSSGFSlplltliiiISWGV--WLFLN*HMI  279
             RFLVG+ D+ +S+  S      +    W +  W+F+   M+
Sbjct  445   RFLVGIDDSKSSAVSSCGCGCGVCCGVWVLFFWVFMYLRMM  485



>ref|XP_009144687.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Brassica rapa]
 emb|CDY42963.1| BnaA01g17910D [Brassica napus]
Length=476

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/435 (72%), Positives = 365/435 (84%), Gaps = 7/435 (2%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
              SAIGVNWGT++ HKL PSTVVDLL+ N I KVKLFD++P  L ALMG+GI+VM+ IPNE
Sbjct  20    HSAIGVNWGTLSFHKLRPSTVVDLLKANKITKVKLFDSNPDALRALMGTGIQVMISIPNE  79

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             +L+  SS     DL+V QNL+R++  GG +I+YVAVGNEPFL SY G +Q+YVVPA+ N+
Sbjct  80    LLSTFSS-----DLFVQQNLSRFMGKGGADIRYVAVGNEPFLTSYGGAYQNYVVPAMVNL  134

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL   VKLVVPCNADAYES++PSQG FRPELTQIMTQLVS LNSN SPFVVNI
Sbjct  135   QQSLVKANLASYVKLVVPCNADAYESNVPSQGTFRPELTQIMTQLVSFLNSNGSPFVVNI  194

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLY NSDFPQD+AFFEG++HPV+DGPNVY NAFDGN DTLV+AL+K+GY QM IVI
Sbjct  195   YPFLSLYQNSDFPQDFAFFEGSSHPVLDGPNVYYNAFDGNFDTLVSALAKIGYGQMSIVI  254

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDGA  ANLTAAR FNQGLI H+L NKGTPLRPG PP+DVYLF L DE  KS L
Sbjct  255   GEIGWPTDGAVGANLTAARVFNQGLINHLLSNKGTPLRPGSPPMDVYLFGLLDEGAKSTL  314

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY L+LG G   LKNA +V YLP RWC+ +P KD++ V++H+R
Sbjct  315   PGNFERHWGIFSFDGQAKYRLNLGLGNRGLKNAENVQYLPSRWCVAHPEKDMTQVTDHLR  374

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS ADCTTL  GGSC+ +GEK NISYAFNSYYQL  QN +SCDFDGLG+VTFLDPSV 
Sbjct  375   LACSQADCTTLNDGGSCSQLGEKDNISYAFNSYYQLQMQNEKSCDFDGLGMVTFLDPSVG  434

Query  401   ECRFLVGVTDTNNSS  357
             +CRFLVGVTD ++S+
Sbjct  435   DCRFLVGVTDKSSSA  449



>ref|XP_003594346.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES64597.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=489

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/432 (72%), Positives = 363/432 (84%), Gaps = 4/432 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGT++ H+L PSTVV+LLR+N I KVKLF+ADPA+L ALMGS I+VMVGIPNE
Sbjct  25    ESAIGVNWGTLSSHRLKPSTVVNLLRDNKISKVKLFEADPAILKALMGSAIQVMVGIPNE  84

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML+ +  SS AAD WV +N++ ++  GG +I+Y+AVGNEPFL SY+GQF + V+PA+TN+
Sbjct  85    MLSLLGGSSVAADYWVQRNVSAFMTKGGADIRYIAVGNEPFLTSYNGQFINLVIPAITNI  144

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             QQSL KANL G VK+VVPCNADAYESS  LPSQG FR ELTQI+TQLV  LNSN SPFVV
Sbjct  145   QQSLVKANLAGYVKIVVPCNADAYESSGGLPSQGVFRSELTQIITQLVQFLNSNGSPFVV  204

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
             NIYPFLSLY N DFP DYAFF+GT H V DG NVY+NAFDGN DTLV+AL KLGY QMPI
Sbjct  205   NIYPFLSLYDNGDFPGDYAFFQGTTHAVTDGSNVYTNAFDGNYDTLVSALGKLGYGQMPI  264

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             VIGE+GWP+DGA  AN+TAAR FNQGL+YH+  NKGTPLRP VPP+DVYLF LFDE  KS
Sbjct  265   VIGEIGWPSDGAIGANITAARVFNQGLVYHIASNKGTPLRPNVPPMDVYLFGLFDEGAKS  324

Query  761   ILPGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNH  588
              LPG+FERHWG+FSFDGQ KY L+  LGN +L+NAR+V YLP RWC+ NP  DL+ V NH
Sbjct  325   TLPGNFERHWGIFSFDGQAKYSLNLGLGNKELRNARNVEYLPSRWCVANPLSDLTNVVNH  384

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
             +++ACS+ADCTTL YGGSCN IGEKGNISYAFNS+YQL  Q+ QSC+FDGLG+VTFLDPS
Sbjct  385   MKIACSVADCTTLNYGGSCNEIGEKGNISYAFNSFYQLRMQDSQSCEFDGLGMVTFLDPS  444

Query  407   VDECRFLVGVTD  372
             V +C FLVGV D
Sbjct  445   VGDCHFLVGVID  456



>ref|XP_004956438.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Setaria italica]
Length=491

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/436 (71%), Positives = 371/436 (85%), Gaps = 3/436 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ++AIGVNWGT++ H+ PP  VVDL+R N I KVKLFDADP VL AL GSGI+VMVG+ N 
Sbjct  24    DAAIGVNWGTLSSHRAPPGVVVDLMRANRISKVKLFDADPGVLRALAGSGIQVMVGVTNG  83

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
              LA+++ S +AAD WVAQN++RY+  G V+I+Y+AVGNEPFL SY GQFQSY++PA+TN+
Sbjct  84    ELASIAGSQAAADAWVAQNVSRYVGRGVVDIRYIAVGNEPFLTSYQGQFQSYIIPAMTNI  143

Query  1295  QQSLAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             QQSL KANL   VK VVPCNADAYES S+PSQG FR ELTQIMTQL + L+S+ +PFVVN
Sbjct  144   QQSLVKANLASYVKQVVPCNADAYESASVPSQGVFRTELTQIMTQLAAFLSSSGAPFVVN  203

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY NSDFPQDYAFFEG+ HP+VDGPNVY NAFDGN DTLV+AL K+GY  +PI 
Sbjct  204   IYPFLSLYQNSDFPQDYAFFEGSTHPLVDGPNVYYNAFDGNFDTLVSALGKIGYGNLPIA  263

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWPT+GA SANLTAARAFNQGLI  +  +KGTPLRPGVPP DVYLFSL DE  KSI
Sbjct  264   IGEIGWPTEGAPSANLTAARAFNQGLINRITSSKGTPLRPGVPPADVYLFSLLDEEQKSI  323

Query  758   LPGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHI  585
             LPG+FERHWG+FSFDGQ KYPL+  LGN  LKNA++VPYLP RWC+ NP ++L +VS+H+
Sbjct  324   LPGNFERHWGIFSFDGQAKYPLNLGLGNSVLKNAKEVPYLPSRWCVANPARNLDSVSDHM  383

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
             +LACS+ADCTTL YGGSC GIG+KGN+SYAFNSYYQ  KQ+P+SCDFDGLG++T+LDPS+
Sbjct  384   KLACSMADCTTLYYGGSCYGIGQKGNVSYAFNSYYQQQKQDPKSCDFDGLGMITYLDPSM  443

Query  404   DECRFLVGVTDTNNSS  357
              ECRFLVGV D+ +S+
Sbjct  444   GECRFLVGVDDSKSSA  459



>ref|NP_001061551.2| Os08g0326500 [Oryza sativa Japonica Group]
 dbj|BAF23465.2| Os08g0326500, partial [Oryza sativa Japonica Group]
Length=569

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/436 (72%), Positives = 374/436 (86%), Gaps = 3/436 (1%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT++ H++P   VV+L+R N I +VKLFDAD A L ALMGSG++VMVGI NEML 
Sbjct  106   VGVNWGTVSAHRMPAPVVVELMRANRIGRVKLFDADQAALRALMGSGLQVMVGITNEMLQ  165

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              +++S +AAD WVA+N++RY+  GG +I+Y+AVGNEPFL SY GQFQSYV+PA+TN+QQS
Sbjct  166   GIAASPAAADAWVARNVSRYVGPGGADIRYIAVGNEPFLTSYQGQFQSYVLPAMTNIQQS  225

Query  1286  LAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIYP  1110
             L KANL   +KLVVPCNADAY+S S+PSQG FRP+L QI+TQL + L+S+ +PFVVNIYP
Sbjct  226   LVKANLARYIKLVVPCNADAYQSASVPSQGVFRPDLIQIITQLAAFLSSSGAPFVVNIYP  285

Query  1109  FLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIGE  930
             FLSLY +SDFPQDYAFF+G++HPVVDGPNVY NAFDGN DTLV+ALSK+GY Q+PI IGE
Sbjct  286   FLSLYQSSDFPQDYAFFDGSSHPVVDGPNVYYNAFDGNFDTLVSALSKIGYGQLPIAIGE  345

Query  929   VGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILPG  750
             VGWPT+GA SANLTAARAF QGLI HVL NKGTPLRPGVPP+DVYLFSL DE  KS LPG
Sbjct  346   VGWPTEGAPSANLTAARAFTQGLISHVLSNKGTPLRPGVPPMDVYLFSLLDEEQKSTLPG  405

Query  749   DFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLA  576
             +FERHWGVFSFDGQ KYPL+LG G   LKNA+DVPYLP RWC+ NP +DL+ V NH++LA
Sbjct  406   NFERHWGVFSFDGQAKYPLNLGLGSPVLKNAKDVPYLPPRWCVANPGRDLNNVENHLKLA  465

Query  575   CSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDEC  396
             C++ADCTTL YGGSCN IGEKGNISYAFNSYYQL KQ+ QSCDFDGLG++T+LDPS+ +C
Sbjct  466   CTMADCTTLYYGGSCNAIGEKGNISYAFNSYYQLRKQDAQSCDFDGLGMITYLDPSIGDC  525

Query  395   RFLVGVTDTNNSSGFS  348
             RFLVG+ D+  S+ +S
Sbjct  526   RFLVGIDDSRTSTIYS  541



>ref|XP_004973213.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like isoform X1 
[Setaria italica]
Length=491

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/429 (73%), Positives = 370/429 (86%), Gaps = 4/429 (1%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT++ H++PP  VVDLLR N I KVKLFDADPAVL AL GSG++VMVGI NE LA
Sbjct  26    VGVNWGTVSAHRMPPPVVVDLLRANGIAKVKLFDADPAVLRALAGSGVQVMVGIRNEALA  85

Query  1466  avsssssaADLWVAQNLTRYLV-NGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
              +++S +AAD WVAQN++RY+   GGV+I+Y+AVGNEPFL SY GQFQSYV+PAVTN+QQ
Sbjct  86    GIAASPAAADAWVAQNVSRYVAARGGVDIRYIAVGNEPFLTSYQGQFQSYVLPAVTNIQQ  145

Query  1289  SLAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIY  1113
             SL KANL   +KLVVPCNADAY+S S+PSQG FRP+LTQIMTQL + L++  +PF+VNIY
Sbjct  146   SLVKANLASYIKLVVPCNADAYQSASVPSQGVFRPDLTQIMTQLAAFLSTTGAPFMVNIY  205

Query  1112  PFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIG  933
             PFLSLY NSDFPQDYAFF+G++HPVVDGPNVY NAFDGN DTL+++LSK+GY Q+PI IG
Sbjct  206   PFLSLYQNSDFPQDYAFFDGSSHPVVDGPNVYYNAFDGNFDTLISSLSKIGYGQLPIAIG  265

Query  932   EVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILP  753
             EVGWPT+GAT+ANL  ARAFNQGLI HVL NKGTPLRPGVPP DVYLFSL DE  KSILP
Sbjct  266   EVGWPTEGATTANLATARAFNQGLISHVLSNKGTPLRPGVPPTDVYLFSLLDEEQKSILP  325

Query  752   GDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIRL  579
             G+FERHWG+FSFDGQ KYPL+LG G   LKNARDVPYLP +WC+ NP ++L+ V NH++L
Sbjct  326   GNFERHWGIFSFDGQAKYPLNLGLGSPVLKNARDVPYLPPQWCVANPGQNLNNVGNHLKL  385

Query  578   ACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDE  399
             AC++ADCTTL YGG CN IG+KGNISYAFN YYQL KQ+ +SCDFDGLG++T+LDPS+ E
Sbjct  386   ACTMADCTTLYYGGLCNAIGDKGNISYAFNIYYQLQKQDAKSCDFDGLGMITYLDPSIGE  445

Query  398   CRFLVGVTD  372
             CRFLVG+ D
Sbjct  446   CRFLVGIDD  454



>emb|CDY35595.1| BnaC01g21170D [Brassica napus]
Length=475

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/435 (72%), Positives = 365/435 (84%), Gaps = 7/435 (2%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             +SAIGVNWGT++ HKL PSTVVDLL+ N I KVKLFD++P  L ALMG+GI+VM+ IPNE
Sbjct  20    QSAIGVNWGTMSFHKLKPSTVVDLLKANKITKVKLFDSNPDALRALMGTGIQVMISIPNE  79

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             +L+  SS     DL+V QNL+R++  GG +I+YVAVGNEPFL SY G +Q+YV PA+ N+
Sbjct  80    LLSTFSS-----DLFVQQNLSRFMGKGGADIRYVAVGNEPFLTSYGGAYQNYVFPAMVNL  134

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL   VKLVVPCNADAYES++PSQG FRPELTQIMTQLVSLL+S  SPFVVNI
Sbjct  135   QQSLVKANLASYVKLVVPCNADAYESNVPSQGTFRPELTQIMTQLVSLLSSIGSPFVVNI  194

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLY NSDFPQD+AFFEG++HPV+DGPNVY NAFDGN DTLV+AL+K+GY QMPIVI
Sbjct  195   YPFLSLYQNSDFPQDFAFFEGSSHPVLDGPNVYYNAFDGNFDTLVSALAKIGYGQMPIVI  254

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDGA  ANLTAAR FNQGLI H+L NKGTPLRPG PP DVYLF L DE  KS L
Sbjct  255   GEIGWPTDGAVGANLTAARVFNQGLINHLLSNKGTPLRPGSPPEDVYLFGLLDEGAKSTL  314

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY L+LG G   LKNA +V YLP RWC+ +P KD++ V++H+R
Sbjct  315   PGNFERHWGIFSFDGQAKYRLNLGLGNRGLKNAENVQYLPSRWCVAHPAKDMTLVTDHLR  374

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS ADCTTL  GGSC+ +GEK NISYAFNSYYQL  QN +SCDFDGLG+VTFLDPSV 
Sbjct  375   LACSQADCTTLNDGGSCSQLGEKDNISYAFNSYYQLQMQNEKSCDFDGLGMVTFLDPSVG  434

Query  401   ECRFLVGVTDTNNSS  357
             ECRFLVGVTD ++S+
Sbjct  435   ECRFLVGVTDKSSSA  449



>gb|ABD65105.1| glycosyl hydrolase family protein [Brassica oleracea]
Length=475

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/435 (72%), Positives = 363/435 (83%), Gaps = 7/435 (2%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
              SAIGVNWGT++ HKL PSTVVDLL+ N I KVKLFD++P  L ALMG+GI+VM+ IPNE
Sbjct  20    HSAIGVNWGTMSFHKLKPSTVVDLLKANKITKVKLFDSNPDALRALMGTGIQVMISIPNE  79

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             +L+  SS     DL+V QNL+R++  GG +I+YVAVGNEPFL SY G +Q+YV PA+ N+
Sbjct  80    LLSTFSS-----DLFVQQNLSRFMGKGGADIRYVAVGNEPFLTSYGGAYQNYVFPAMVNL  134

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KANL   VKLVVPCNADAYES++PSQG FRPELTQIMTQLVS L+S  SPFVVNI
Sbjct  135   QQSLVKANLASYVKLVVPCNADAYESNVPSQGTFRPELTQIMTQLVSFLSSIGSPFVVNI  194

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLY NSDFPQD+AFFEG++HPV+DGPNVY NAFDGN DTLV+AL+K+GY QMPIVI
Sbjct  195   YPFLSLYQNSDFPQDFAFFEGSSHPVLDGPNVYYNAFDGNFDTLVSALAKIGYGQMPIVI  254

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDGA  ANLTAAR FNQGLI H+L NKGTPLRPG PP DVYLF L DE  KS L
Sbjct  255   GEIGWPTDGAVGANLTAARVFNQGLINHLLSNKGTPLRPGSPPEDVYLFGLLDEGAKSTL  314

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KY L+LG G   LKNA +V YLP RWC+ +P KD++ V++H+R
Sbjct  315   PGNFERHWGIFSFDGQAKYRLNLGLGNRGLKNAENVQYLPSRWCVAHPAKDMTLVTDHLR  374

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LACS ADCTTL  GGSC+ +GEK NISYAFNSYYQL  QN +SCDFDGLG+VTFLDPSV 
Sbjct  375   LACSQADCTTLNDGGSCSQLGEKDNISYAFNSYYQLQMQNEKSCDFDGLGMVTFLDPSVG  434

Query  401   ECRFLVGVTDTNNSS  357
             ECRFLVGVTD ++S+
Sbjct  435   ECRFLVGVTDKSSSA  449



>gb|AFK40769.1| unknown [Medicago truncatula]
Length=489

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/432 (72%), Positives = 361/432 (84%), Gaps = 4/432 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGT++ H+L PSTVV+LLR+N I KVKLF+ADPA+L ALMGS I+VMVGIPNE
Sbjct  25    ESAIGVNWGTLSSHRLKPSTVVNLLRDNKISKVKLFEADPAILKALMGSAIQVMVGIPNE  84

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML+ +  SS AAD WV +N++ ++  GG +I+Y+AVGNEPFL SY+GQF + V+PA+TN+
Sbjct  85    MLSLLGGSSVAADYWVQRNVSAFMTKGGADIRYIAVGNEPFLTSYNGQFINLVIPAITNI  144

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             QQSL KANL G VK+VVPCNADAYESS  LPSQG FR +LTQI+TQLV  LNSN SPFVV
Sbjct  145   QQSLVKANLAGYVKIVVPCNADAYESSGGLPSQGVFRCKLTQIITQLVQFLNSNGSPFVV  204

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
             NIYPF SLY N DFP DYAFF GT H V DG NVY+NAFDGN DTLV+AL KLGY QMPI
Sbjct  205   NIYPFPSLYDNGDFPGDYAFFRGTTHAVTDGSNVYTNAFDGNYDTLVSALGKLGYGQMPI  264

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             VIGE+GWP+DGA  AN+TAAR FNQGL+YH+  NKGTPLRP VPP+DVYLF LFDE  KS
Sbjct  265   VIGEIGWPSDGAIGANITAARVFNQGLVYHIASNKGTPLRPNVPPMDVYLFGLFDEGAKS  324

Query  761   ILPGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNH  588
              LPG+FERHWG+FSFDGQ KY L+  LGN +L+NAR+V YLP RWC+ NP  DL+ V NH
Sbjct  325   TLPGNFERHWGIFSFDGQAKYSLNLGLGNKELRNARNVEYLPSRWCVANPLSDLTNVVNH  384

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
             +++ACS+ADCTTL YGGSCN IGEKGNISYAFNS+YQL  Q+ QSC+FDGLG+VTFLDPS
Sbjct  385   MKIACSVADCTTLNYGGSCNEIGEKGNISYAFNSFYQLRMQDSQSCEFDGLGMVTFLDPS  444

Query  407   VDECRFLVGVTD  372
             V +C FLVGV D
Sbjct  445   VGDCHFLVGVID  456



>ref|XP_003568004.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Brachypodium distachyon]
Length=487

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/430 (72%), Positives = 364/430 (85%), Gaps = 3/430 (1%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             +A+GVNWGT++ H+ PP  VVDLLR N I KVKLFDADP VLSAL  SGI+VMVG+ N  
Sbjct  27    AAVGVNWGTLSSHRAPPPVVVDLLRANRIGKVKLFDADPGVLSALARSGIQVMVGVTNGE  86

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA ++ S +AAD WVAQN++RY+   GV+I+Y+AVGNEPFL SY GQF SYV+PA+TN+Q
Sbjct  87    LAGIAGSPAAADAWVAQNVSRYVGRAGVDIRYIAVGNEPFLTSYQGQFLSYVIPAMTNIQ  146

Query  1292  QSLAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QSL KANL   VKLVVPCNADAY+S S+PSQG FR ELTQIMTQL + L+SN +PFVVNI
Sbjct  147   QSLVKANLANYVKLVVPCNADAYQSASVPSQGVFRTELTQIMTQLATYLSSNGAPFVVNI  206

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLY NSDFP+DYAFFEG+ HP+VDGPNVY NAFDGN DTL++ALSK+G+ Q+PI I
Sbjct  207   YPFLSLYQNSDFPEDYAFFEGSTHPLVDGPNVYYNAFDGNFDTLISALSKIGFGQLPIAI  266

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPT+GA+SANLTAARAFNQGLI  V+ NKGTPLRPGV P DVYLFSL DE  KS+L
Sbjct  267   GEVGWPTEGASSANLTAARAFNQGLISRVMSNKGTPLRPGVSPADVYLFSLLDEEQKSVL  326

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWG+FSFDGQ KYPL+LG G   LKNA++VPYLP RWC+ NP +DL   SNH++
Sbjct  327   PGNFERHWGIFSFDGQAKYPLNLGLGNPVLKNAKEVPYLPSRWCVANPAQDLDKASNHLK  386

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
             LAC +ADCTTL +GG CNGIGEKGNIS+AFNSYYQ+ KQ+ +SCDFDG G++T+LDPS+ 
Sbjct  387   LACDMADCTTLYHGGLCNGIGEKGNISFAFNSYYQMQKQDAKSCDFDGHGMITYLDPSMG  446

Query  401   ECRFLVGVTD  372
             ECRFLVG+ D
Sbjct  447   ECRFLVGIED  456



>gb|EAZ42319.1| hypothetical protein OsJ_26891 [Oryza sativa Japonica Group]
Length=516

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/453 (69%), Positives = 374/453 (83%), Gaps = 20/453 (4%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT++ H++P   VV+L+R N I +VKLFDAD A L ALMGSG++VMVGI NEML 
Sbjct  36    VGVNWGTVSAHRMPAPVVVELMRANRIGRVKLFDADQAALRALMGSGLQVMVGITNEMLQ  95

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIK-----------------YVAVGNEPFLASYS  1338
              +++S +AAD WVA+N++RY+  GG +I+                 Y+AVGNEPFL SY 
Sbjct  96    GIAASPAAADAWVARNVSRYVGPGGADIRHYEASTCQSRTQGMQRWYIAVGNEPFLTSYQ  155

Query  1337  GQFQSYVVPAVTNVQQSLAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQL  1161
             GQFQSYV+PA+TN+QQSL KANL   +KLVVPCNADAY+S S+PSQG FRP+L QI+TQL
Sbjct  156   GQFQSYVLPAMTNIQQSLVKANLARYIKLVVPCNADAYQSASVPSQGVFRPDLIQIITQL  215

Query  1160  VSLLNSNASPFVVNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLV  981
              + L+S+ +PFVVNIYPFLSLY +SDFPQDYAFF+G++HPVVDGPNVY NAFDGN DTLV
Sbjct  216   AAFLSSSGAPFVVNIYPFLSLYQSSDFPQDYAFFDGSSHPVVDGPNVYYNAFDGNFDTLV  275

Query  980   AALSKLGYSQMPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPID  801
             +ALSK+GY Q+PI IGEVGWPT+GA SANLTAARAF QGLI HVL NKGTPLRPGVPP+D
Sbjct  276   SALSKIGYGQLPIAIGEVGWPTEGAPSANLTAARAFTQGLISHVLSNKGTPLRPGVPPMD  335

Query  800   VYLFSLFDEAGKSILPGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCI  627
             VYLFSL DE  KS LPG+FERHWGVFSFDGQ KYPL+LG G   LKNA+DVPYLP RWC+
Sbjct  336   VYLFSLLDEEQKSTLPGNFERHWGVFSFDGQAKYPLNLGLGSPVLKNAKDVPYLPPRWCV  395

Query  626   VNPNKDLSAVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCD  447
              NP +DL+ V NH++LAC++ADCTTL YGGSCN IGEKGNISYAFNSYYQL KQ+ QSCD
Sbjct  396   ANPGRDLNNVENHLKLACTMADCTTLYYGGSCNAIGEKGNISYAFNSYYQLRKQDAQSCD  455

Query  446   FDGLGLVTFLDPSVDECRFLVGVTDTNNSSGFS  348
             FDGLG++T+LDPS+ +CRFLVG+ D+  S+ +S
Sbjct  456   FDGLGMITYLDPSIGDCRFLVGIDDSRTSTIYS  488



>ref|XP_010686601.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/429 (76%), Positives = 361/429 (84%), Gaps = 3/429 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             E+AIGVNWGT++ H+    TVVDLL+ N I KVKLFDAD  VL+AL GS I+VMVGIPN+
Sbjct  21    EAAIGVNWGTLSHHRASAKTVVDLLQNNKISKVKLFDADSQVLNALRGSQIQVMVGIPNQ  80

Query  1475  MLaavsssssaADLWVAQNLTRYL-VNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTN  1299
              L+  SSS   AD WV  NL+ Y+     V+I+YVAVGNEPFL SYSGQFQSYVVPA+ N
Sbjct  81    FLSLFSSSPPDADSWVRHNLSAYISAKPPVDIRYVAVGNEPFLTSYSGQFQSYVVPALLN  140

Query  1298  VQQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             +QQSL +ANL G+VKL+VPCNADAYESSLPSQG FRPELTQIMTQLVS LNSN SPFVVN
Sbjct  141   LQQSLVRANLAGSVKLLVPCNADAYESSLPSQGTFRPELTQIMTQLVSFLNSNGSPFVVN  200

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLYGNSDFPQ+YAFF GT HPV+DGPNVY NAFDGN DTLVAAL+K+GY Q+PIV
Sbjct  201   IYPFLSLYGNSDFPQEYAFFAGTNHPVIDGPNVYYNAFDGNYDTLVAALNKIGYGQIPIV  260

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGEVGWPTDGA  ANLTAAR FNQGLI HVL NKGTPLRPG PP D+YLFSLFDE  KS 
Sbjct  261   IGEVGWPTDGAFGANLTAARVFNQGLINHVLSNKGTPLRPGAPPSDIYLFSLFDEDSKST  320

Query  758   LPGDFERHWGVFSFDGQLKYP--LDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHI  585
             LPG+FERHWG+FSFDGQ KY   L LG G LKNA++V YLP RWCI NP+KDLS VSNHI
Sbjct  321   LPGNFERHWGIFSFDGQAKYELNLGLGGGSLKNAKEVTYLPARWCIANPSKDLSGVSNHI  380

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
             +LAC++ADCT L YGGSCNGIG K NISYAFNSYYQ  KQ+ QSCDFDGLG+VTFLDPSV
Sbjct  381   KLACTVADCTRLNYGGSCNGIGVKENISYAFNSYYQQQKQDVQSCDFDGLGVVTFLDPSV  440

Query  404   DECRFLVGV  378
              ECRFLVG+
Sbjct  441   GECRFLVGI  449



>gb|KFK32198.1| hypothetical protein AALP_AA6G210100 [Arabis alpina]
Length=482

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/435 (72%), Positives = 361/435 (83%), Gaps = 7/435 (2%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             +SAIG NWGT++ HK+ PSTVVDLL+ N I KVKLFDA+P  L ALMGSGI+VM+GIPNE
Sbjct  23    QSAIGFNWGTLSFHKMRPSTVVDLLKANKITKVKLFDANPDALRALMGSGIQVMIGIPNE  82

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML+  +S     DL+V QN++R++  GG +I+YVAVGNEPFL  Y GQF +YVVPA+ N+
Sbjct  83    MLSTFNS-----DLFVRQNISRFIGKGGADIRYVAVGNEPFLTGYGGQFLNYVVPALLNL  137

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL +ANL   VKLVVPCNADAY+S++PSQG FRPELTQIMTQLVS L+SNASPFVVNI
Sbjct  138   QQSLLRANLASYVKLVVPCNADAYQSNVPSQGMFRPELTQIMTQLVSFLDSNASPFVVNI  197

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLYGN+DFPQDYAFFEG++HPV DGPN Y NAFDGN DTLVAALSKLG+ QMPIVI
Sbjct  198   YPFLSLYGNADFPQDYAFFEGSSHPVPDGPNTYYNAFDGNFDTLVAALSKLGFPQMPIVI  257

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDGA  ANLTAAR FNQGL+ H+L NKGTPLRPG PP DVYLF L DE  KS L
Sbjct  258   GEIGWPTDGAVGANLTAARVFNQGLVNHLLSNKGTPLRPGSPPTDVYLFGLLDEGAKSTL  317

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
             PG+FERHWGVFSFDGQ KY L+LG G   LKNA +V YLP RWC+ +P +D++ V++H  
Sbjct  318   PGNFERHWGVFSFDGQAKYRLNLGLGNRGLKNANNVQYLPSRWCVAHPTRDMTQVADHFT  377

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
              ACS ADCTTL  GGSC+ +GEK NISYAFNSYYQL  QN +SC+FDGLG+VTFLDPSV 
Sbjct  378   RACSEADCTTLNDGGSCSQLGEKDNISYAFNSYYQLQMQNEKSCNFDGLGMVTFLDPSVG  437

Query  401   ECRFLVGVTDTNNSS  357
             +CRFLVGVTD + SS
Sbjct  438   DCRFLVGVTDKDLSS  452



>emb|CDP04554.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/379 (80%), Positives = 340/379 (90%), Gaps = 0/379 (0%)
 Frame = -3

Query  1496  MVGIPNEMLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYV  1317
             MVGIPN+ML+ +SSS +A+D WV+QN++RY+V  GVNIKYVAVGNEPFL SYSGQ+QSYV
Sbjct  1     MVGIPNDMLSLLSSSPTASDSWVSQNVSRYMVKNGVNIKYVAVGNEPFLTSYSGQYQSYV  60

Query  1316  VPAVTNVQQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNA  1137
             VPA+TN+QQSLAKANL G +KLVVPCNADAYESSLPSQGAFRPEL QIMTQLVS LNSN 
Sbjct  61    VPALTNLQQSLAKANLAGIIKLVVPCNADAYESSLPSQGAFRPELNQIMTQLVSFLNSNG  120

Query  1136  SPFVVNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGY  957
             SPF+VNIYPFLSLYG+SDFPQDYAFF+GT H V+DGPNVY+NAFDGN DTLVAALSK+GY
Sbjct  121   SPFIVNIYPFLSLYGSSDFPQDYAFFDGTTHSVIDGPNVYNNAFDGNFDTLVAALSKIGY  180

Query  956   SQMPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFD  777
              QMPI+IGEVGWPTDG  SANL+AARAFNQGLI HVL NKGTPLRPGVPP+D+YLFSL D
Sbjct  181   GQMPIIIGEVGWPTDGVVSANLSAARAFNQGLINHVLSNKGTPLRPGVPPMDIYLFSLLD  240

Query  776   EAGKSILPGDFERHWGVFSFDGQLKYPLDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAV  597
             E  KS LPG+FERHWG+FSFDGQ KY L+LGNG LKNA+DV YLP+RWC+ +P+KDLS V
Sbjct  241   EGAKSTLPGNFERHWGIFSFDGQAKYKLNLGNGLLKNAKDVEYLPFRWCVADPSKDLSTV  300

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
             +NH +LACS ADCTTL YGGSCN IG KGNISYAFNSYYQL KQN QSCDFDGLG+VTFL
Sbjct  301   ANHFKLACSYADCTTLNYGGSCNDIGAKGNISYAFNSYYQLLKQNVQSCDFDGLGVVTFL  360

Query  416   DPSVDECRFLVGVTDTNNS  360
             DPSV +CRFLVG+TD  +S
Sbjct  361   DPSVGDCRFLVGITDGKSS  379



>ref|XP_003637610.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=494

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/438 (70%), Positives = 366/438 (84%), Gaps = 5/438 (1%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             ESAIGVNWGT++  KL PSTVVDLL++N I KVKLF+A+  VL ALMGSGI+VMVGIPNE
Sbjct  30    ESAIGVNWGTVSFRKLNPSTVVDLLKDNKITKVKLFEAEADVLKALMGSGIQVMVGIPNE  89

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML+ +SSS SA+DLW+ QN++ Y   GG NI+YVAVGNEPFL SY+GQFQ+ V+PAV N+
Sbjct  90    MLSLLSSSPSASDLWIHQNISAYTGKGGANIRYVAVGNEPFLKSYNGQFQNLVMPAVLNL  149

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             QQSL KA L  ++KLVVPCNAD YESS+PSQG FRP+LTQIMTQLV  LN+N SPF+VNI
Sbjct  150   QQSLVKAKLASSIKLVVPCNADVYESSIPSQGIFRPDLTQIMTQLVQFLNTNGSPFIVNI  209

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPFLSLY ++DFPQDYAFFEGT HPV DG N+YSNAFDGN DTLVAAL K+GY Q+PIVI
Sbjct  210   YPFLSLYDDTDFPQDYAFFEGTTHPVTDGSNIYSNAFDGNYDTLVAALGKIGYGQIPIVI  269

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWP+DGA  AN+TAA+ FNQGLI HVLGNKGTPLRP  PP+D+YLFSL DE  KSIL
Sbjct  270   GEIGWPSDGAIGANITAAKVFNQGLINHVLGNKGTPLRPNAPPMDIYLFSLLDEGAKSIL  329

Query  755   PGDFERHWGVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNK---DLSAVSN  591
             PG FERHWG+F FDG+ KYPL+  LGN +LKNA++V YLP +WC+V+       ++ V+N
Sbjct  330   PGSFERHWGIFYFDGKAKYPLNLGLGNKELKNAKNVQYLPSKWCVVSSKSSGLSINNVAN  389

Query  590   HIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDP  411
             ++R ACS+ADCTTL YGGSCNGIG+KGNISYAFNSYYQL  Q+ +SC+FDGLG+VT  DP
Sbjct  390   YMRTACSVADCTTLDYGGSCNGIGDKGNISYAFNSYYQLQMQDSRSCNFDGLGMVTSRDP  449

Query  410   SVDECRFLVGVTDTNNSS  357
             SV +CRF++G+TD    S
Sbjct  450   SVGDCRFIIGLTDKATRS  467



>emb|CBI41064.3| unnamed protein product [Vitis vinifera]
Length=410

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/381 (80%), Positives = 336/381 (88%), Gaps = 2/381 (1%)
 Frame = -3

Query  1496  MVGIPNEMLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYV  1317
             MVGIPNEML+  SSS+ A DLWV+QNL+RY+  GGV+I+YVAVGNEPFL SYSGQFQSYV
Sbjct  1     MVGIPNEMLSVFSSSTDACDLWVSQNLSRYMGKGGVDIRYVAVGNEPFLTSYSGQFQSYV  60

Query  1316  VPAVTNVQQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNA  1137
             VPA+ N+QQSLAKAN+   VKLVVPCNADAYESSLPSQGAFR ELTQIMTQ+VS LN+N 
Sbjct  61    VPALLNLQQSLAKANVANFVKLVVPCNADAYESSLPSQGAFRSELTQIMTQIVSFLNTNG  120

Query  1136  SPFVVNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGY  957
             SPFVVNIYPFLSLYGNSDFPQDYAFF GT H V DG NVY NAFDGN DTLVAAL+KLGY
Sbjct  121   SPFVVNIYPFLSLYGNSDFPQDYAFFGGTNHAVTDGANVYYNAFDGNFDTLVAALNKLGY  180

Query  956   SQMPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFD  777
              QMPIVIGEVGWPTDGA SANLTAA+AFNQGLI HVL NKGTPLRPGVPP+D+YLFSL D
Sbjct  181   GQMPIVIGEVGWPTDGAISANLTAAKAFNQGLINHVLSNKGTPLRPGVPPMDIYLFSLLD  240

Query  776   EAGKSILPGDFERHWGVFSFDGQLKYP--LDLGNGQLKNARDVPYLPYRWCIVNPNKDLS  603
             E  KSILPG FERHWG+FSFDGQ KYP  L LGNG LKNARDV YLP RWC+ NP++DLS
Sbjct  241   EEAKSILPGTFERHWGIFSFDGQAKYPLNLGLGNGLLKNARDVEYLPSRWCVANPSRDLS  300

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              V+NH+++ACS ADCTTL YGGSCN IG KGNISYAFNSYYQ+ KQN QSCDFDGLG+VT
Sbjct  301   GVANHMKIACSNADCTTLNYGGSCNEIGAKGNISYAFNSYYQVKKQNSQSCDFDGLGIVT  360

Query  422   FLDPSVDECRFLVGVTDTNNS  360
             FLDPSV +CRFLVG+TD+++S
Sbjct  361   FLDPSVGDCRFLVGITDSSSS  381



>ref|XP_009794225.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 isoform X2 [Nicotiana 
sylvestris]
Length=384

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/384 (76%), Positives = 329/384 (86%), Gaps = 6/384 (2%)
 Frame = -3

Query  1439  DLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQSLAKANLGGA  1260
             D+W    L   L++     +YVAVGNEPFL SYSGQ+QSYVVPA+TN+Q+SLAKANL   
Sbjct  4     DIW----LKAVLISAIHQHRYVAVGNEPFLTSYSGQYQSYVVPAMTNLQESLAKANLARN  59

Query  1259  VKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIYPFLSLYGNSDF  1080
             VKLVVPCNADAYESSLPSQG FRPELTQI+TQLVS LNSN SPFVVNIYPFLSLYGNSDF
Sbjct  60    VKLVVPCNADAYESSLPSQGTFRPELTQIITQLVSFLNSNGSPFVVNIYPFLSLYGNSDF  119

Query  1079  PQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIGEVGWPTDGATS  900
             PQDYAFFEGT H V DGPNVYSNAFDGNLDTL+AAL+K+GY QMPIVIGEVGWPTDGA  
Sbjct  120   PQDYAFFEGTTHAVTDGPNVYSNAFDGNLDTLIAALAKIGYGQMPIVIGEVGWPTDGAIG  179

Query  899   ANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILPGDFERHWGVFS  720
             ANLTAAR FNQGL+ HVL NKGTPLRPGVPP+DVYLFSLFDE  KS+LPG+FERHWG+FS
Sbjct  180   ANLTAARVFNQGLVKHVLSNKGTPLRPGVPPMDVYLFSLFDEGAKSVLPGNFERHWGIFS  239

Query  719   FDGQLKYPLDLGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLACSLADCTTLKYG  540
             FDGQ KYPL+LGNG LKNA+DV YLPYRWC+ NP K+L+  ++H ++ACS ADCTTL YG
Sbjct  240   FDGQSKYPLNLGNGPLKNAKDVQYLPYRWCVANPYKNLAEAADHFKIACSYADCTTLNYG  299

Query  539   GSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDECRFLVGVTDTNNS  360
             GSC GIG KGNISYAFNSYYQL KQNP+SCDFDGLG+VTFL+PS+ ECRFLVGV+D   S
Sbjct  300   GSCYGIGAKGNISYAFNSYYQLQKQNPRSCDFDGLGMVTFLNPSIGECRFLVGVSDHTTS  359

Query  359   SGFSlpl--ltliiiISWGVWLFL  294
             SGF L    +++++I+ W  WLFL
Sbjct  360   SGFRLHNNWISVLLIVLWDAWLFL  383



>ref|XP_008464288.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 isoform X3 [Cucumis 
melo]
Length=388

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/339 (80%), Positives = 301/339 (89%), Gaps = 2/339 (1%)
 Frame = -3

Query  1382  KYVAVGNEPFLASYSGQFQSYVVPAVTNVQQSLAKANLGGAVKLVVPCNADAYESSLPSQ  1203
             +YVAVGNEPFL+SY+G++QSY++PA+ N+QQSLA+ANL   VKLVVPCNADAYESSLPSQ
Sbjct  22    RYVAVGNEPFLSSYNGEYQSYIMPALLNLQQSLARANLASYVKLVVPCNADAYESSLPSQ  81

Query  1202  GAFRPELTQIMTQLVSLLNSNASPFVVNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPN  1023
             GAFRPELTQIMTQLVS LNSN SPFVVNIYPFLSLYGNSDFPQDYAFFEGT H V DG N
Sbjct  82    GAFRPELTQIMTQLVSFLNSNGSPFVVNIYPFLSLYGNSDFPQDYAFFEGTTHAVTDGSN  141

Query  1022  VYSNAFDGNLDTLVAALSKLGYSQMPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLG  843
             VY NAFDGN DTLV+AL+K+GY QMPIVIGEVGWPTDGA  ANLTAAR FNQGLI HVLG
Sbjct  142   VYYNAFDGNYDTLVSALTKIGYGQMPIVIGEVGWPTDGAMGANLTAARVFNQGLINHVLG  201

Query  842   NKGTPLRPGVPPIDVYLFSLFDEAGKSILPGDFERHWGVFSFDGQLKYPLD--LGNGQLK  669
             NKGTPLRPG PP+DVYLFSL DE  KS+LPG+FERHWG+FSFDGQ KYPL+  LGN  LK
Sbjct  202   NKGTPLRPGTPPVDVYLFSLLDEGAKSVLPGNFERHWGIFSFDGQAKYPLNLGLGNKVLK  261

Query  668   NARDVPYLPYRWCIVNPNKDLSAVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFN  489
             NA+ V YLP RWCI NP +DL+ V+NHI+LACS+ADC+TL YGGSCNGIG KGNISYAFN
Sbjct  262   NAKHVEYLPSRWCIANPFRDLTDVANHIKLACSVADCSTLNYGGSCNGIGAKGNISYAFN  321

Query  488   SYYQLHKQNPQSCDFDGLGLVTFLDPSVDECRFLVGVTD  372
             SYYQL  QN +SC+FDGLG++TFLDPS+ ECRFLVGVTD
Sbjct  322   SYYQLQMQNEKSCEFDGLGMITFLDPSIGECRFLVGVTD  360



>ref|XP_008464287.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 isoform X2 [Cucumis 
melo]
Length=406

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/340 (80%), Positives = 301/340 (89%), Gaps = 2/340 (1%)
 Frame = -3

Query  1385  IKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQSLAKANLGGAVKLVVPCNADAYESSLPS  1206
             + YVAVGNEPFL+SY+G++QSY++PA+ N+QQSLA+ANL   VKLVVPCNADAYESSLPS
Sbjct  39    LGYVAVGNEPFLSSYNGEYQSYIMPALLNLQQSLARANLASYVKLVVPCNADAYESSLPS  98

Query  1205  QGAFRPELTQIMTQLVSLLNSNASPFVVNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGP  1026
             QGAFRPELTQIMTQLVS LNSN SPFVVNIYPFLSLYGNSDFPQDYAFFEGT H V DG 
Sbjct  99    QGAFRPELTQIMTQLVSFLNSNGSPFVVNIYPFLSLYGNSDFPQDYAFFEGTTHAVTDGS  158

Query  1025  NVYSNAFDGNLDTLVAALSKLGYSQMPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVL  846
             NVY NAFDGN DTLV+AL+K+GY QMPIVIGEVGWPTDGA  ANLTAAR FNQGLI HVL
Sbjct  159   NVYYNAFDGNYDTLVSALTKIGYGQMPIVIGEVGWPTDGAMGANLTAARVFNQGLINHVL  218

Query  845   GNKGTPLRPGVPPIDVYLFSLFDEAGKSILPGDFERHWGVFSFDGQLKYPLD--LGNGQL  672
             GNKGTPLRPG PP+DVYLFSL DE  KS+LPG+FERHWG+FSFDGQ KYPL+  LGN  L
Sbjct  219   GNKGTPLRPGTPPVDVYLFSLLDEGAKSVLPGNFERHWGIFSFDGQAKYPLNLGLGNKVL  278

Query  671   KNARDVPYLPYRWCIVNPNKDLSAVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAF  492
             KNA+ V YLP RWCI NP +DL+ V+NHI+LACS+ADC+TL YGGSCNGIG KGNISYAF
Sbjct  279   KNAKHVEYLPSRWCIANPFRDLTDVANHIKLACSVADCSTLNYGGSCNGIGAKGNISYAF  338

Query  491   NSYYQLHKQNPQSCDFDGLGLVTFLDPSVDECRFLVGVTD  372
             NSYYQL  QN +SC+FDGLG++TFLDPS+ ECRFLVGVTD
Sbjct  339   NSYYQLQMQNEKSCEFDGLGMITFLDPSIGECRFLVGVTD  378



>ref|XP_006661066.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like, partial [Oryza 
brachyantha]
Length=382

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/350 (75%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = -3

Query  1397  GGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQSLAKANLGGAVKLVVPCNADAYES  1218
             GGV+I+Y+AVGNEPFL SY GQFQSYV+PA TN+QQSL KANL   VKLVVPCNADAY+S
Sbjct  2     GGVDIRYIAVGNEPFLTSYQGQFQSYVIPATTNIQQSLVKANLASYVKLVVPCNADAYQS  61

Query  1217  -SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIYPFLSLYGNSDFPQDYAFFEGTAHP  1041
              S+PSQG FR ELTQIMTQL + L+S+ +PFVVNIYPFLSLY +SDFPQDYAFFEG+ HP
Sbjct  62    ASVPSQGVFRTELTQIMTQLAAFLSSSGAPFVVNIYPFLSLYQSSDFPQDYAFFEGSTHP  121

Query  1040  VVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIGEVGWPTDGATSANLTAARAFNQGL  861
             VVDGPN Y NAFDGN DTLVAAL K+GY Q+PI IGEVGWPT+GA SANLTAARAFNQGL
Sbjct  122   VVDGPNTYYNAFDGNFDTLVAALGKIGYGQLPIAIGEVGWPTEGAPSANLTAARAFNQGL  181

Query  860   IYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILPGDFERHWGVFSFDGQLKYPLD--L  687
             +  V+ NKGTPLRPGVPP DVYLFSLFDE  KSILPG+FERHWG+FSFDGQ KYPL+  L
Sbjct  182   MNRVMNNKGTPLRPGVPPADVYLFSLFDEEQKSILPGNFERHWGIFSFDGQAKYPLNLGL  241

Query  686   GNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLACSLADCTTLKYGGSCNGIGEKGN  507
             GN  LKNA++VPYLP RWCI NP ++L  V+NHI+LACS+ADCT L YGGSC GIGEK N
Sbjct  242   GNAVLKNAKEVPYLPSRWCIANPVQNLDNVANHIKLACSMADCTRLDYGGSCYGIGEKAN  301

Query  506   ISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDECRFLVGVTDTNNSS  357
             +SYAFNSYYQ  KQ+ +SCDFDGLG++T+LDPS+ ECRFLVG+ D+ +S+
Sbjct  302   VSYAFNSYYQQQKQDAKSCDFDGLGMITYLDPSMGECRFLVGIDDSKSSA  351



>ref|XP_006584113.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like isoform X2 
[Glycine max]
Length=393

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/370 (71%), Positives = 311/370 (84%), Gaps = 7/370 (2%)
 Frame = -3

Query  1436  LWVAQNLTRYLVNGGVNI-----KYVAVGNEPFLASYSGQFQSYVVPAVTNVQQSLAKAN  1272
             +++  ++   L++G +N+     +Y+AVGNEPFL SY+GQ+Q+ V+PA+ N+QQSL KAN
Sbjct  1     MFLLTSVKAVLISGLLNLWYFCYRYIAVGNEPFLTSYNGQYQNLVMPAILNLQQSLVKAN  60

Query  1271  LGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIYPFLSLYG  1092
             L G +KLVVPCNADAYESSLPSQGAFRPELTQIMTQLV  LNSN +PF+VNIYPFLSLY 
Sbjct  61    LAGYIKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVQFLNSNGTPFIVNIYPFLSLYD  120

Query  1091  NSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIGEVGWPTD  912
             N+DFPQDYAFFEGT HPV DG NVY+NAFDGN DTLVAALSKLGY QMPIVIGE+GWP+D
Sbjct  121   NNDFPQDYAFFEGTTHPVTDGNNVYTNAFDGNYDTLVAALSKLGYDQMPIVIGEIGWPSD  180

Query  911   GATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILPGDFERHW  732
             GA  AN+TAA+ FNQGLI HVL NKGTPLRP  PP+D+YLFSL DE  KSILPG FERHW
Sbjct  181   GAIGANITAAKVFNQGLISHVLSNKGTPLRPDAPPMDIYLFSLLDEGAKSILPGGFERHW  240

Query  731   GVFSFDGQLKYPLD--LGNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNHIRLACSLADC  558
             G+FSFDGQ KYPL+  LGN +LKNA++V YLP RWC+ +P+ D   V+NH+R+ACS+ADC
Sbjct  241   GIFSFDGQAKYPLNLGLGNKELKNAKNVQYLPSRWCVASPSTDAQNVANHMRIACSVADC  300

Query  557   TTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDECRFLVGV  378
             TTL YGGSCNGIGEKGNISYAFNSYYQL  Q+ +SC+FDGLG++TF DPSV +CRFLVGV
Sbjct  301   TTLDYGGSCNGIGEKGNISYAFNSYYQLQMQDSRSCNFDGLGVITFRDPSVGDCRFLVGV  360

Query  377   TDTNNSSGFS  348
             TD  + S  S
Sbjct  361   TDKGSDSSAS  370



>gb|EMS53962.1| Glucan endo-1,3-beta-glucosidase 5 [Triticum urartu]
Length=707

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/373 (69%), Positives = 300/373 (80%), Gaps = 4/373 (1%)
 Frame = -3

Query  1385  IKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQSLAKANLGGAVKLVVPCNADAYESSLPS  1206
             + Y+AVGNEPFL SY GQF SYV+PA+ N+QQSL KANL   VKLVVPCNADAYE ++PS
Sbjct  332   LGYIAVGNEPFLTSYQGQFLSYVIPAMANIQQSLVKANLASYVKLVVPCNADAYEGAVPS  391

Query  1205  QGAFRPELTQIMTQLVSLLNSNASPFVVNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGP  1026
             QG FR ELTQIMTQL + L+SN +PFVVNIYPFLSLY NSDFP+DYAFFEG+ HP+VDG 
Sbjct  392   QGVFRTELTQIMTQLAAYLSSNGAPFVVNIYPFLSLYQNSDFPEDYAFFEGSTHPLVDGS  451

Query  1025  NVYSNAFDGNLDTLVAALSKLGYSQMPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVL  846
             NVY NAFDGN DTL++AL KLGY Q+PI IGEVGWPT GA SANLTAARAFNQGLI  ++
Sbjct  452   NVYYNAFDGNFDTLISALGKLGYGQLPIAIGEVGWPTQGAPSANLTAARAFNQGLINRIM  511

Query  845   GNKGTPLRPGVPPIDVYLFSLFDEAGKSILPGDFERHWGVFSFDGQLKYPLDLGNGQ--L  672
              NKGTPLRPGVPP DVYLF L DE  KS LPG+FERHWG+FSFDGQ KYPL+LG G   L
Sbjct  512   SNKGTPLRPGVPPADVYLFGLLDEEQKSTLPGNFERHWGIFSFDGQAKYPLNLGLGNPVL  571

Query  671   KNARDVPYLPYRWCIVNPNKDLSAVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAF  492
             KNA++VPYLP RWC+ NP + L   S H++LAC +ADCTTL YGGSCNGIGEKGN+S+AF
Sbjct  572   KNAKEVPYLPSRWCVANPAQSLDNASTHLKLACDMADCTTLYYGGSCNGIGEKGNVSFAF  631

Query  491   NSYYQLHKQNPQSCDFDGLGLVTFLDPSVDECRFLVGVTDTNNSSGFSl--plltliiiI  318
             NSYYQ+ KQ+ +SCDFDG GL+TFLDPS+ ECRFLVG+ D+ +S+  S          + 
Sbjct  632   NSYYQMQKQDAKSCDFDGHGLITFLDPSMGECRFLVGIDDSKSSAAASCGNCCGVFCGVS  691

Query  317   SWGVWLFLN*HMI  279
              + +WLF+   M+
Sbjct  692   IFALWLFMYLRMM  704



>gb|KEH32712.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=374

 Score =   525 bits (1352),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 245/346 (71%), Positives = 289/346 (84%), Gaps = 5/346 (1%)
 Frame = -3

Query  1379  YVAVGNEPFLASYSGQFQSYVVPAVTNVQQSLAKANLGGAVKLVVPCNADAYESSLPSQG  1200
             YVAVGNEPFL SY+GQFQ+ V+PAV N+QQSL KA L  ++KLVVPCNAD YESS+PSQG
Sbjct  2     YVAVGNEPFLKSYNGQFQNLVMPAVLNLQQSLVKAKLASSIKLVVPCNADVYESSIPSQG  61

Query  1199  AFRPELTQIMTQLVSLLNSNASPFVVNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNV  1020
              FRP+LTQIMTQLV  LN+N SPF+VNIYPFLSLY ++DFPQDYAFFEGT HPV DG N+
Sbjct  62    IFRPDLTQIMTQLVQFLNTNGSPFIVNIYPFLSLYDDTDFPQDYAFFEGTTHPVTDGSNI  121

Query  1019  YSNAFDGNLDTLVAALSKLGYSQMPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGN  840
             YSNAFDGN DTLVAAL K+GY Q+PIVIGE+GWP+DGA  AN+TAA+ FNQGLI HVLGN
Sbjct  122   YSNAFDGNYDTLVAALGKIGYGQIPIVIGEIGWPSDGAIGANITAAKVFNQGLINHVLGN  181

Query  839   KGTPLRPGVPPIDVYLFSLFDEAGKSILPGDFERHWGVFSFDGQLKYPLD--LGNGQLKN  666
             KGTPLRP  PP+D+YLFSL DE  KSILPG FERHWG+F FDG+ KYPL+  LGN +LKN
Sbjct  182   KGTPLRPNAPPMDIYLFSLLDEGAKSILPGSFERHWGIFYFDGKAKYPLNLGLGNKELKN  241

Query  665   ARDVPYLPYRWCIVNPNK---DLSAVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYA  495
             A++V YLP +WC+V+       ++ V+N++R ACS+ADCTTL YGGSCNGIG+KGNISYA
Sbjct  242   AKNVQYLPSKWCVVSSKSSGLSINNVANYMRTACSVADCTTLDYGGSCNGIGDKGNISYA  301

Query  494   FNSYYQLHKQNPQSCDFDGLGLVTFLDPSVDECRFLVGVTDTNNSS  357
             FNSYYQL  Q+ +SC FDGLG+VT  DPSV +CRF++G+TD    S
Sbjct  302   FNSYYQLQMQDSRSCIFDGLGMVTSRDPSVGDCRFIIGLTDKATRS  347



>gb|AFK35356.1| unknown [Lotus japonicus]
Length=340

 Score =   519 bits (1337),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 255/340 (75%), Positives = 290/340 (85%), Gaps = 4/340 (1%)
 Frame = -3

Query  1517  MGSGIEVMVGIPNEMLaavsssssaADLWVAQNLTRYLV-NGGVNIKYVAVGNEPFLASY  1341
             MGSGI+VMVGIPNEML+A+SSS  AAD WV +NL+ Y+    G +I+YVAVGNEPFL SY
Sbjct  1     MGSGIQVMVGIPNEMLSALSSSPVAADFWVRRNLSAYIGGRRGADIRYVAVGNEPFLTSY  60

Query  1340  SGQFQSYVVPAVTNVQQSLAKANLGGAVKLVVPCNADAYES-SLPSQGAFRPELTQIMTQ  1164
             +GQFQ++V+PA++N+QQSL KANL G VKLVVPCNADAYES   PSQGAFRPELTQI+TQ
Sbjct  61    NGQFQNFVIPAISNLQQSLVKANLAGYVKLVVPCNADAYESPGPPSQGAFRPELTQIITQ  120

Query  1163  LVSLLNSNASPFVVNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTL  984
             LV  LNSN SPFVVNIYPFLSLY N DFPQDYAFFEGT HPV D  NVY+NAFDGN DTL
Sbjct  121   LVQFLNSNGSPFVVNIYPFLSLYDNGDFPQDYAFFEGTTHPVTDASNVYTNAFDGNYDTL  180

Query  983   VAALSKLGYSQMPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPI  804
             VAALSKLGY QMPIVIGE+GWP+DGA  AN+TAA+ FNQGLIYH+  NKGTPLRPG+PP+
Sbjct  181   VAALSKLGYGQMPIVIGEIGWPSDGALGANVTAAKVFNQGLIYHIASNKGTPLRPGIPPM  240

Query  803   DVYLFSLFDEAGKSILPGDFERHWGVFSFDGQLKYPLDLGNG--QLKNARDVPYLPYRWC  630
             DVYLFSL DE  KS LPG+FE HWG+FSFDGQ KYPLDLG G  +L+NAR+V YLP RWC
Sbjct  241   DVYLFSLLDEGAKSTLPGNFEGHWGIFSFDGQAKYPLDLGLGKKELRNARNVQYLPSRWC  300

Query  629   IVNPNKDLSAVSNHIRLACSLADCTTLKYGGSCNGIGEKG  510
             + NP+ DL+ V NH+R+ACS+ADCTTL YGGSCN IGEKG
Sbjct  301   VANPSSDLTNVVNHMRIACSVADCTTLNYGGSCNEIGEKG  340



>gb|EMT28220.1| Glucan endo-1,3-beta-glucosidase 5 [Aegilops tauschii]
Length=350

 Score =   501 bits (1291),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 232/322 (72%), Positives = 269/322 (84%), Gaps = 2/322 (1%)
 Frame = -3

Query  1307  VTNVQQSLAKANLGGAVKLVVPCNADAYESSLPSQGAFRPELTQIMTQLVSLLNSNASPF  1128
             +TN+QQSL KANL   VKLVVPCNADAYE ++PSQG FR ELTQIMTQL + L+SN +PF
Sbjct  1     MTNIQQSLVKANLASYVKLVVPCNADAYEGAVPSQGVFRTELTQIMTQLAAYLSSNGAPF  60

Query  1127  VVNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQM  948
             VVNIYPFLSLY NSDFP+DYAFFEG+ HP+VDG NVY NAFDGN DTL++AL KLGY Q+
Sbjct  61    VVNIYPFLSLYQNSDFPEDYAFFEGSTHPLVDGSNVYYNAFDGNFDTLISALGKLGYGQL  120

Query  947   PIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAG  768
             PI IGEVGWPT GA SANLTAAR FNQGLI  ++ NKGTPLRPGVPP DVYLF L DE  
Sbjct  121   PIAIGEVGWPTQGAPSANLTAARTFNQGLINRIMSNKGTPLRPGVPPADVYLFGLLDEEQ  180

Query  767   KSILPGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVS  594
             KS+LPG+FERHWG+FSFDGQ KYPL+LG G   LKNA++VPYLP RWC+ NP + L   S
Sbjct  181   KSVLPGNFERHWGIFSFDGQAKYPLNLGLGNPVLKNAKEVPYLPSRWCVANPAQSLDKAS  240

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
              H++LAC +ADCTTL YGGSCNGIGEKGN+S+AFNSYYQ+ KQ+ +SCDFDG G++TFLD
Sbjct  241   THLKLACDMADCTTLYYGGSCNGIGEKGNVSFAFNSYYQMQKQDAKSCDFDGHGMITFLD  300

Query  413   PSVDECRFLVGVTDTNNSSGFS  348
             PS+ ECRFLVG+ D+ +S   S
Sbjct  301   PSMGECRFLVGIDDSKSSGAAS  322



>ref|XP_010257050.1| PREDICTED: glucan endo-1,3-beta-glucosidase 9 [Nelumbo nucifera]
Length=485

 Score =   486 bits (1252),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 250/436 (57%), Positives = 311/436 (71%), Gaps = 6/436 (1%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             IGVNWGT A H LPP  VV+LL+ NN+ KVKLFDADP VL +L GSGI V+ GIPN ML 
Sbjct  24    IGVNWGTSASHPLPPPKVVELLKSNNVSKVKLFDADPLVLESLSGSGINVIAGIPNSMLK  83

Query  1466  avsssssaADLWVAQNLTRYLVNGG--VNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             ++SSS  AA+ WV  NLTRY  NGG  V I+Y+AVG+EPFL SY GQFQ +V+ A+TN+Q
Sbjct  84    SLSSSKKAAESWVHDNLTRYFSNGGAGVQIEYIAVGDEPFLQSYGGQFQPFVIGAMTNIQ  143

Query  1292  QSLAKANLGGAVKLVVPCNADAY--ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L  A L   VK+VVPCN+DAY  ES LPS+G FRP+L + MTQL++ L+ N SPF VN
Sbjct  144   IALIGAKLENKVKVVVPCNSDAYLSESGLPSKGHFRPDLNKTMTQLLTFLSKNRSPFFVN  203

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             I PF+SL+ N +   D+A FE  AH   D    Y N+FD + DTL  ALS+ G+S M IV
Sbjct  204   ISPFVSLHQNKNISLDFALFEEGAHARKDNHKEYKNSFDVSFDTLATALSQAGFSNMDIV  263

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +G++GWPTDGA +A+ + A  F +GL+ H+ G  GTPLRP  PP++ Y+FSL DE  +SI
Sbjct  264   VGQIGWPTDGAINASSSIAETFMKGLLDHLHGKVGTPLRPQKPPMETYIFSLLDEDQRSI  323

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNHI  585
               G+FERHWGVF+FDGQ KY +DLG G   L NA+ V YLP RWC+VN NKD+S V+   
Sbjct  324   TAGNFERHWGVFTFDGQAKYHIDLGQGSRNLVNAQGVEYLPSRWCVVNNNKDMSNVTASS  383

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
               AC++ADCT L  GGSC  I   GNISYAFNSYYQ H Q+  SCDF GLGL+T +DPSV
Sbjct  384   LQACAVADCTALSPGGSCFNISWPGNISYAFNSYYQQHDQSADSCDFGGLGLITTVDPSV  443

Query  404   DECRFLVGVTDTNNSS  357
               CRF V +  + ++S
Sbjct  444   GSCRFAVEILTSISTS  459



>ref|XP_004288532.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=474

 Score =   474 bits (1220),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 241/444 (54%), Positives = 312/444 (70%), Gaps = 17/444 (4%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A HKLPP TVV LL++N IQKVKLFDA+ + +SAL G+ IEVMV IPN+ L 
Sbjct  29    LGVNWGTMATHKLPPDTVVQLLKDNGIQKVKLFDAEQSTMSALAGTSIEVMVAIPNDQLQ  88

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             A++S   A + WV +N+TRY  NGGVNIKYVAVGNEPFL SY+G F +   PA+ N+Q +
Sbjct  89    AMTSYPRAKE-WVRRNVTRYNFNGGVNIKYVAVGNEPFLTSYNGSFLNITFPALQNIQNA  147

Query  1286  LAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A +G  +K  VP NAD Y S     +PS G FR +++Q+MT++V  L+ N +PF +N
Sbjct  148   LNEAGVGDTIKATVPLNADVYNSPETNPVPSAGTFRSDISQLMTEIVQFLDKNKAPFTIN  207

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPN--VYSNAFDGNLDTLVAALSKLGYSQMP  945
             IYPFLSLYGN DFP +YAFF+G A P+VD      Y+N FD N DTLV++L  +GY  M 
Sbjct  208   IYPFLSLYGNDDFPFNYAFFDGDATPIVDATTGIQYTNVFDANFDTLVSSLKAVGYGDMA  267

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             IV+GEVGWPTDG  +AN+  A  F  GL+  +  NKGTPLRPG   I++YLF L DE  K
Sbjct  268   IVVGEVGWPTDGDKNANVGNAYRFYNGLLARLAANKGTPLRPGF--IEIYLFGLIDEDAK  325

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG FERHWG+FS+DGQ K+P+D+ G GQ   L  A++V YL  +WC+ NPN KDLS 
Sbjct  326   SIAPGSFERHWGIFSYDGQPKFPIDVSGQGQNKLLMGAKNVQYLEKKWCMFNPNAKDLSK  385

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++++I  AC+ ADCT L+YG SCN +   GN SYAFN YYQ+  Q+  SC+F+GL  VT 
Sbjct  386   LADNINYACTFADCTALEYGSSCNILDANGNASYAFNMYYQVQNQDDLSCNFEGLATVTT  445

Query  419   LDPSVDECRFLVGVTDTNNSSGFS  348
              + S   C F++ +    +SS FS
Sbjct  446   QNISQGTCNFIIQIA---SSSTFS  466



>ref|XP_004288531.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform 1 
[Fragaria vesca subsp. vesca]
Length=486

 Score =   474 bits (1219),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 241/444 (54%), Positives = 312/444 (70%), Gaps = 17/444 (4%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A HKLPP TVV LL++N IQKVKLFDA+ + +SAL G+ IEVMV IPN+ L 
Sbjct  29    LGVNWGTMATHKLPPDTVVQLLKDNGIQKVKLFDAEQSTMSALAGTSIEVMVAIPNDQLQ  88

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             A++S   A + WV +N+TRY  NGGVNIKYVAVGNEPFL SY+G F +   PA+ N+Q +
Sbjct  89    AMTSYPRAKE-WVRRNVTRYNFNGGVNIKYVAVGNEPFLTSYNGSFLNITFPALQNIQNA  147

Query  1286  LAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A +G  +K  VP NAD Y S     +PS G FR +++Q+MT++V  L+ N +PF +N
Sbjct  148   LNEAGVGDTIKATVPLNADVYNSPETNPVPSAGTFRSDISQLMTEIVQFLDKNKAPFTIN  207

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPN--VYSNAFDGNLDTLVAALSKLGYSQMP  945
             IYPFLSLYGN DFP +YAFF+G A P+VD      Y+N FD N DTLV++L  +GY  M 
Sbjct  208   IYPFLSLYGNDDFPFNYAFFDGDATPIVDATTGIQYTNVFDANFDTLVSSLKAVGYGDMA  267

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             IV+GEVGWPTDG  +AN+  A  F  GL+  +  NKGTPLRPG   I++YLF L DE  K
Sbjct  268   IVVGEVGWPTDGDKNANVGNAYRFYNGLLARLAANKGTPLRPGF--IEIYLFGLIDEDAK  325

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG FERHWG+FS+DGQ K+P+D+ G GQ   L  A++V YL  +WC+ NPN KDLS 
Sbjct  326   SIAPGSFERHWGIFSYDGQPKFPIDVSGQGQNKLLMGAKNVQYLEKKWCMFNPNAKDLSK  385

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++++I  AC+ ADCT L+YG SCN +   GN SYAFN YYQ+  Q+  SC+F+GL  VT 
Sbjct  386   LADNINYACTFADCTALEYGSSCNILDANGNASYAFNMYYQVQNQDDLSCNFEGLATVTT  445

Query  419   LDPSVDECRFLVGVTDTNNSSGFS  348
              + S   C F++ +    +SS FS
Sbjct  446   QNISQGTCNFIIQIA---SSSTFS  466



>ref|XP_010257709.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nelumbo nucifera]
Length=475

 Score =   473 bits (1216),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 235/433 (54%), Positives = 306/433 (71%), Gaps = 12/433 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A HKLPP+TVV ++++N I+KVKLFDAD   +SAL G+ IEVMV IPN+ LA
Sbjct  23    LGVNWGTMATHKLPPNTVVQMMKDNGIKKVKLFDADQNTMSALAGTEIEVMVAIPNDQLA  82

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              ++    A D WV +N+TRYL NGGVNIKYVAVGNEPFLASY+  F +   PA+ N+Q +
Sbjct  83    VMNDYGRAKD-WVKRNITRYLFNGGVNIKYVAVGNEPFLASYNNSFLNVTFPALQNIQDA  141

Query  1286  LAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A  G ++K  VP NAD Y S    S+PS G FR +++ +MTQ+V  LN N +PF VN
Sbjct  142   LNEAGHGDSIKATVPLNADVYNSPSDNSVPSAGRFRSDISDLMTQIVQFLNKNNAPFTVN  201

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY N +FP D+AFF+GT +P++D    Y+N FD N DTLV+AL  +G+ +MPI+
Sbjct  202   IYPFLSLYANENFPLDFAFFDGTPNPLLDNGIQYNNVFDANFDTLVSALKAVGFGEMPIL  261

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +AN+  A+ F  GL+  +  NKGTPLRPG   ++VYLF L DE  KSI
Sbjct  262   VGEVGWPTDGDKNANVGLAQRFYNGLLPRLAANKGTPLRPGY--LEVYLFGLIDEDAKSI  319

Query  758   LPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG+FERHWG+F +DGQ KY +DL G GQ   L  A++V YLP RWC++NPN +DLS + 
Sbjct  320   APGNFERHWGIFRYDGQPKYQMDLSGQGQNTFLVAAKNVKYLPQRWCVLNPNAEDLSKLG  379

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
              +I  AC+ +DCT L YG SC  +  +GN SYAFN YYQ   Q   SC+F GL +VT  +
Sbjct  380   ENINFACTHSDCTALGYGSSCGNLDTQGNASYAFNMYYQAQNQQDLSCNFQGLAMVTTQN  439

Query  413   PSVDECRFLVGVT  375
              S   C F + ++
Sbjct  440   ASQGNCNFTIQIS  452



>ref|XP_011034355.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Populus euphratica]
Length=479

 Score =   472 bits (1214),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 239/435 (55%), Positives = 304/435 (70%), Gaps = 14/435 (3%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
              +GVNWGT+A+ KLPP TVV++L++N IQKVKLFDAD   +++L G+GIEVMV IPN+ L
Sbjct  22    GLGVNWGTMAIRKLPPETVVEMLKDNGIQKVKLFDADQNTMNSLAGTGIEVMVAIPNDQL  81

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
             A +   + A D WV +N+TRY  NGGV IKYVAVGNEPFL+SY+G F +   PA+ N+Q 
Sbjct  82    AVMGDYNRAKD-WVKRNVTRYNFNGGVTIKYVAVGNEPFLSSYNGSFLNTTFPALRNIQN  140

Query  1289  SLAKANLGGAVKLVVPCNADAY----ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             +L  A +G ++K  VP NAD Y    + + PS G FR ++  IMTQ+V  L+ N +PF V
Sbjct  141   ALNDAGVGDSIKATVPLNADVYGSPDDQAYPSSGRFRSDINDIMTQIVQFLSQNGAPFTV  200

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVD-GPNV-YSNAFDGNLDTLVAALSKLGYSQM  948
             NIYPFLSLYGN DFP DYAFF+G   PVVD G  + Y+N FD N DTLV+AL   G+  M
Sbjct  201   NIYPFLSLYGNDDFPFDYAFFDGAPQPVVDRGTGIQYTNVFDANFDTLVSALKAAGHGDM  260

Query  947   PIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAG  768
             PIV+GEVGWPTDG  +AN   A  F  GLI  ++GN+GTPLRPG   I+VYLF L DE  
Sbjct  261   PIVVGEVGWPTDGDKNANTGYAIRFYNGLIPRLVGNRGTPLRPGY--IEVYLFGLLDEDA  318

Query  767   KSILPGDFERHWGVFSFDGQLKYPLDLG----NGQLKNARDVPYLPYRWCIVNPN-KDLS  603
             KSI PG+FERHWG+F +DGQ K+PLDL     N  L  AR+V YLP +WC+ NPN KDLS
Sbjct  319   KSIAPGNFERHWGIFRYDGQPKFPLDLSGQNQNKFLAGARNVQYLPAKWCMFNPNAKDLS  378

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              ++ +I  ACS +DCT L YG SCN +   GN SYAFN YYQ+  Q+  +C+F+GL  +T
Sbjct  379   KLAENIDYACSRSDCTALGYGSSCNSLDSNGNASYAFNMYYQVQNQDEFACNFEGLATIT  438

Query  422   FLDPSVDECRFLVGV  378
               + S   C F++ +
Sbjct  439   SQNISQGNCNFIIQI  453



>ref|XP_010657459.1| PREDICTED: glucan endo-1,3-beta-glucosidase 9 [Vitis vinifera]
Length=527

 Score =   473 bits (1217),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 236/440 (54%), Positives = 307/440 (70%), Gaps = 8/440 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             +AIG+NWGT A H LPP  VV+LL+ NNI +VKLFDADP VL AL GS I V VGIPN M
Sbjct  64    TAIGLNWGTAASHPLPPPRVVELLKNNNIARVKLFDADPLVLQALSGSKIAVTVGIPNSM  123

Query  1472  LaavsssssaADLWVAQNLTRYLVNGG----VNIKYVAVGNEPFLASYSGQFQSYVVPAV  1305
             L +++SS  AA+ WV  N+TRY+ + G    V I+YVAVG+EPFL SY  QF  +V+ A 
Sbjct  124   LRSLNSSKKAAESWVHDNVTRYVSSSGRGSGVRIEYVAVGDEPFLQSYGDQFHPFVIGAA  183

Query  1304  TNVQQSLAKANLGGAVKLVVPCNADAY--ESSLPSQGAFRPELTQIMTQLVSLLNSNASP  1131
             TN+Q +L +ANL   VK+VVP ++D    ES+LPS+G FR +L + M+ L++ LN + SP
Sbjct  184   TNIQTALIRANLASEVKVVVPFSSDTIQSESNLPSKGHFRSDLNKTMSHLLTFLNKHHSP  243

Query  1130  FVVNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQ  951
             F VNI PFLSL+ N +   D++ F+ TAHP  D    Y N+FD   DT+V ALS +GY +
Sbjct  244   FFVNISPFLSLHQNKNISLDFSIFKETAHPHSDSHRTYKNSFDLIYDTVVTALSTVGYPE  303

Query  950   MPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEA  771
             M IV+G++GWPTDGA +A  + A  F +GLI H+    GTPLRP VPP + Y+FSL DE 
Sbjct  304   MDIVVGQIGWPTDGAANATSSVAETFMKGLIRHLQSKSGTPLRPRVPPTETYIFSLLDED  363

Query  770   GKSILPGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAV  597
              +SI  G+FERHWG+F+FDGQ KY +DLG G   L NA++V YLP RWC+VN N+DLS  
Sbjct  364   QRSIAAGNFERHWGLFTFDGQAKYHVDLGQGSRNLVNAQNVNYLPSRWCVVNNNRDLSNA  423

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
             +     ACS+ADCT L  G SC  I    +ISY+FNSYYQ H Q   SCDF GLGL+T +
Sbjct  424   TASASEACSVADCTALSPGSSCFNISWPASISYSFNSYYQQHNQQAASCDFGGLGLITTV  483

Query  416   DPSVDECRFLVGVTDTNNSS  357
             DPS+++CRF + +  +++SS
Sbjct  484   DPSMEKCRFSIQLHTSHSSS  503



>gb|EPS71987.1| hypothetical protein M569_02770, partial [Genlisea aurea]
Length=461

 Score =   470 bits (1210),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 237/432 (55%), Positives = 304/432 (70%), Gaps = 9/432 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             + IG NWG+ A H LPP TVV +L +N +QKVKLFD D   L AL  +GIEVMVGIPN+M
Sbjct  2     AGIGANWGSQASHLLPPETVVRMLLDNGVQKVKLFDTDYDTLRALGRTGIEVMVGIPNDM  61

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L++++++S AAD WV+QN++ +L N  V I+YVAVGNEPFLA+Y+G F     PA+ NVQ
Sbjct  62    LSSLATNSRAADKWVSQNVSHHLQNSNVTIRYVAVGNEPFLATYNGSFLRTTFPALRNVQ  121

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             Q+L KA L   +K+ VP NAD Y SS  LPS G FR ++   M Q+V  LN N +PF +N
Sbjct  122   QALTKAGLQNQIKVTVPLNADVYSSSNSLPSGGDFRADIHDYMIQIVQFLNDNRAPFTIN  181

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY + +FP +YAFF+G A PV DG   Y N FD N DTLV AL K G+  +PI+
Sbjct  182   IYPFISLYTDPNFPVEYAFFDGNASPVNDGGTSYYNMFDANHDTLVWALQKNGFGSLPII  241

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +AN+  A+ FNQG + H+ G +GTP+RPG  PID YLFSL DE  KSI
Sbjct  242   VGEIGWPTDGDRNANIQYAQRFNQGFMTHISGGRGTPMRPG--PIDAYLFSLIDEDEKSI  299

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG+FERHWG+ ++DGQ KYPL+LG    G L   R+V YL  +WCI+ PN  L    V+
Sbjct  300   QPGNFERHWGILTYDGQPKYPLNLGISNGGSLIPVRNVTYLDRKWCIMKPNARLDDPQVA  359

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  ACSLADCT+L Y  SC+G+  +GNISYAF+SYYQ + Q  ++C F+GLG VT  D
Sbjct  360   PSVSYACSLADCTSLGYLTSCSGLDARGNISYAFDSYYQKNNQLDEACKFNGLGTVTRAD  419

Query  413   PSVDECRFLVGV  378
             PS+  CRF V +
Sbjct  420   PSIGNCRFNVMI  431



>ref|XP_011010121.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Populus euphratica]
Length=480

 Score =   469 bits (1208),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 239/435 (55%), Positives = 306/435 (70%), Gaps = 16/435 (4%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A+ KLPP TVV++L++N IQKVKLFDAD   +++L G+GIEVMV IPN+ LA
Sbjct  23    LGVNWGTMAIRKLPPETVVEMLKDNGIQKVKLFDADQNTMNSLAGTGIEVMVAIPNDQLA  82

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              +   + A D WV +N+TRY  NGGV IKYVAVGNEPFL SY+G F +   PA+ N+Q +
Sbjct  83    VMGDYNRAKD-WVKRNVTRYNFNGGVTIKYVAVGNEPFLKSYNGSFLNTTFPALRNIQNA  141

Query  1286  LAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L  A +G ++K  VP NAD Y S    + PS G FR ++  +MT++V  L  N +PF VN
Sbjct  142   LNDAGVGDSIKATVPLNADVYNSPDDQAYPSSGRFRSDINDLMTEIVQFLAQNNAPFTVN  201

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVD-GPNV-YSNAFDGNLDTLVAALSKLGYSQMP  945
             IYPFLSLYGN DFP DYAFF+G   PVVD G  + Y+N FD N DTLV+AL   G+  MP
Sbjct  202   IYPFLSLYGNDDFPFDYAFFDGAPQPVVDRGTGIQYTNVFDANFDTLVSALKAAGHGDMP  261

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             IV+GEVGWPTDG  +AN+  A  F  GL+  + GN+GTPLRPG   I+VYLF L DE  K
Sbjct  262   IVVGEVGWPTDGDKNANIGNAIRFYNGLLPRLAGNRGTPLRPGY--IEVYLFGLLDEDAK  319

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPN-KDLS  603
             SI PG+FERHWG+F +DGQ K+P+DL +GQ+ N     A++V YLP RWC+ NPN KDLS
Sbjct  320   SIAPGNFERHWGIFRYDGQPKFPMDL-SGQVANKWLVGAQNVQYLPSRWCMFNPNAKDLS  378

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              ++++I  ACS +DCT L YG SCNG+   GN SYAFN YYQ+  Q+  +C+F+GL  VT
Sbjct  379   KLADNINYACSRSDCTALGYGSSCNGLDTNGNASYAFNMYYQVQNQDEFACNFEGLATVT  438

Query  422   FLDPSVDECRFLVGV  378
               + S   C F + +
Sbjct  439   EQNISQGNCNFTIQI  453



>ref|XP_010276412.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nelumbo nucifera]
Length=477

 Score =   469 bits (1207),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 234/434 (54%), Positives = 305/434 (70%), Gaps = 14/434 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A HKLPP TVV +L++N I+KVKLFDAD + +SAL G+ IEVMV IPN+ LA
Sbjct  23    LGVNWGTMATHKLPPDTVVQMLKDNGIKKVKLFDADQSTMSALAGTEIEVMVAIPNDQLA  82

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              ++    A D WV +N+TRY+ NGGVNIKYVAVGNEPFL SY+  F +  +PA+ N+Q +
Sbjct  83    VMNDYDRAKD-WVKRNVTRYIFNGGVNIKYVAVGNEPFLQSYNNSFLNITLPALQNIQNA  141

Query  1286  LAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A  G ++K  VP NAD Y S     +PS G FR +++ +MTQ+V  LN N +PF VN
Sbjct  142   LNEAGHGDSIKATVPLNADVYNSPVSNPVPSAGRFRTDISDLMTQIVQFLNKNNAPFTVN  201

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPN--VYSNAFDGNLDTLVAALSKLGYSQMP  945
             IYPFLSLY + +FP D+AFF+GTA+P  D  N   YSN FD N DTLV+AL  +G+  MP
Sbjct  202   IYPFLSLYADQNFPVDFAFFDGTANPTTDTGNGIQYSNVFDANFDTLVSALKSVGFGDMP  261

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN+  A+ F  GL+  +  NKGTPLRPG   ++VYLF L DE  K
Sbjct  262   ILVGEVGWPTDGDKNANVALAQRFYNGLLPRLAANKGTPLRPGY--LEVYLFGLIDEDAK  319

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG+FERHWG+F +DGQ K+ LD+ G GQ   L  A++V YLP RWC+ NPN KDLS 
Sbjct  320   SIAPGNFERHWGIFRYDGQPKFLLDISGQGQNTLLVAAKNVQYLPQRWCVFNPNAKDLSK  379

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++++I  AC+ +DCTTL Y  SC  +  +GN SYAFN Y+Q   Q   SC+F+GL +VT 
Sbjct  380   LADNINYACTFSDCTTLGYQSSCGNLDTQGNASYAFNMYFQAQNQQDMSCNFEGLAMVTT  439

Query  419   LDPSVDECRFLVGV  378
              + S   C F + +
Sbjct  440   QNASQGNCNFTIQI  453



>emb|CDP03371.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   469 bits (1206),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 238/436 (55%), Positives = 297/436 (68%), Gaps = 11/436 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S++GVNWGT+A H+LPP  VV ++ +N   KVKLF+AD  +L AL+G+ +EVM+GIPN M
Sbjct  6     SSLGVNWGTMASHQLPPENVVQMMLDNGFDKVKLFEADEKILGALIGTDLEVMLGIPNNM  65

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  +S    AA  WV  N+T Y   GGVNI+YVAVGNEPFL SY+  F  Y + A+ N+Q
Sbjct  66    LREISQDPEAAASWVDANVTAYCFKGGVNIRYVAVGNEPFLKSYNNSFLPYTLSALKNIQ  125

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             +++  A LG  VK  +P NAD Y S     +PS G FRPE+  +  Q++  L+SN +PFV
Sbjct  126   EAINHAGLGTVVKATIPFNADVYNSPESNPVPSAGDFRPEIRDLTVQIIQYLHSNDAPFV  185

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN  FP DYAFF+G+  P+ DG  +Y+N FD N DTLV++LS+ GY +M 
Sbjct  186   VNIYPFLSLYGNIYFPLDYAFFDGSNKPIKDGDYLYTNVFDANFDTLVSSLSRAGYPEMK  245

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I+IGEVGWPTDG  +AN+  A+ FNQGLI HV G  GTP R G   IDVYLFSL DE  K
Sbjct  246   IIIGEVGWPTDGDKNANIQNAKRFNQGLIQHVSGGVGTPARNG--SIDVYLFSLIDENAK  303

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNGQ----LKNARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG FERHWG+F FDG+ KY LDL   +    L     V Y+  RWCI++P  K+L  
Sbjct  304   SIEPGSFERHWGLFEFDGKPKYELDLSGSREEKGLVAVEGVRYMLRRWCILDPRAKELEE  363

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             +  +I  ACSL+DCT+L YG SCN +  KGN SYAFN YYQ   QN   CDF GL +VT 
Sbjct  364   LPKNIDYACSLSDCTSLGYGSSCNHLSAKGNASYAFNMYYQFKNQNGWDCDFSGLAVVTD  423

Query  419   LDPSVDECRFLVGVTD  372
              DPS DEC+F V + D
Sbjct  424   EDPSDDECQFPVMIAD  439



>ref|XP_002319699.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE95622.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=478

 Score =   469 bits (1206),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 238/435 (55%), Positives = 301/435 (69%), Gaps = 14/435 (3%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
              +GVNWGT+A+ KL P TVV +L++N I KVKLFDAD   ++AL GSGIEVMV IPN+ L
Sbjct  22    GLGVNWGTMAIRKLSPETVVQMLKDNGILKVKLFDADQTTMTALAGSGIEVMVAIPNDQL  81

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
             A +   + A D WV +N+TRY  NGG+ IKYVAVGNEPFL SY+G F +   PA+ N+Q 
Sbjct  82    AVMGDYNRAKD-WVKRNVTRYNFNGGITIKYVAVGNEPFLTSYNGSFLNTTFPALRNIQN  140

Query  1289  SLAKANLGGAVKLVVPCNADAY----ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             +L  A +G ++K  VP NAD Y    + + PS G FR ++  IMTQ+V  L+ N +PF V
Sbjct  141   ALNDAGVGDSIKATVPLNADVYGSPDDQAYPSSGRFRSDINDIMTQIVQFLSQNGAPFTV  200

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVD-GPNV-YSNAFDGNLDTLVAALSKLGYSQM  948
             NIYPFLSLYGN DFP DYAFF+G   PVVD G  + Y+N FD N DTLV+AL   G+  M
Sbjct  201   NIYPFLSLYGNDDFPFDYAFFDGAPQPVVDKGTGIQYTNVFDANFDTLVSALKAAGHGDM  260

Query  947   PIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAG  768
             PIV+GEVGWPTDG  +AN+  A  F  GLI  ++GN+GTPLRPG   I+VYLF L DE  
Sbjct  261   PIVVGEVGWPTDGDKNANIGYATRFYNGLIPRLVGNRGTPLRPGY--IEVYLFGLLDEDA  318

Query  767   KSILPGDFERHWGVFSFDGQLKYPLDLG----NGQLKNARDVPYLPYRWCIVNPN-KDLS  603
             KSI PG+FERHWG+F +DGQ K+PLDL     N  L  AR+V YLP +WC+ NPN KDLS
Sbjct  319   KSIAPGNFERHWGIFRYDGQPKFPLDLSGQNQNKFLAGARNVQYLPAKWCMFNPNAKDLS  378

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              ++ +I  ACS +DCT L YG SCN +   GN SYAFN YYQ+  Q+  +C+F+GL  +T
Sbjct  379   KLAENIDYACSRSDCTALGYGSSCNSLDSNGNASYAFNMYYQVQNQDEFACNFEGLATLT  438

Query  422   FLDPSVDECRFLVGV  378
               + S   C F++ +
Sbjct  439   NQNISQGNCNFIIQI  453



>ref|XP_009353157.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Pyrus x bretschneideri]
Length=478

 Score =   469 bits (1206),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 239/446 (54%), Positives = 313/446 (70%), Gaps = 17/446 (4%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
               +GVNWGT+A HKLPP TVV +L++N IQKVKLFDA+ + +SAL GSG+EVMV IPN+ 
Sbjct  21    EGLGVNWGTMATHKLPPETVVQMLKDNGIQKVKLFDAEESTMSALAGSGLEVMVAIPNDQ  80

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA ++S   A + WV +N+TRY  NGGVNIKYVAVGNEPFL SY+G F +  +PA+ N+Q
Sbjct  81    LAVMTSYKRAKE-WVRRNVTRYNFNGGVNIKYVAVGNEPFLTSYNGSFLNVTLPALQNIQ  139

Query  1292  QSLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L +A +G +VK  VP NAD Y S     +PS G FR ++ Q+MT++V  L+ N +PF 
Sbjct  140   NALNEAGVGDSVKATVPLNADVYNSPENNPVPSAGRFRTDILQLMTEIVQFLDKNQAPFT  199

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVD-GPNV-YSNAFDGNLDTLVAALSKLGYSQ  951
             +NIYPFLSLYGN DFP +YAFF+G  +P+VD G  + Y+N FD N DTLV++L  +G+  
Sbjct  200   INIYPFLSLYGNDDFPFNYAFFDGDTNPIVDTGTGIQYTNVFDANFDTLVSSLKAVGFGN  259

Query  950   MPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEA  771
             MPIV+GEVGWPTDG  +AN   A  F  GL+  +  N+GTPLRPG   I+VYLF L DE 
Sbjct  260   MPIVVGEVGWPTDGDKNANAGNALRFYNGLLTRLGTNRGTPLRPGY--IEVYLFGLIDED  317

Query  770   GKSILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDL  606
              KSI PG FERHWG+F +DGQ K+P+DL G GQ   L  A++V YL  +WC+ NPN KD+
Sbjct  318   AKSIAPGSFERHWGIFGYDGQPKFPVDLSGQGQNKLLVPAKNVQYLSKKWCMFNPNAKDV  377

Query  605   SAVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLV  426
             S ++++I  AC+ +DCT L+YG SCN +   GN SYAFN YYQ+  Q+  SC+F GL  +
Sbjct  378   SKLADNINYACTFSDCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDLSCNFQGLATL  437

Query  425   TFLDPSVDECRFLVGVTDTNNSSGFS  348
             T  + S   C F++ +     SS FS
Sbjct  438   TTQNISQGNCNFIIQIA---TSSAFS  460



>ref|XP_004972550.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like isoform X1 
[Setaria italica]
 ref|XP_004972551.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like isoform X2 
[Setaria italica]
Length=488

 Score =   469 bits (1207),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 236/433 (55%), Positives = 301/433 (70%), Gaps = 11/433 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
              AIGVNWGT   H LP STVV LL++N   KVKLFDA+ A+L AL GSGI+VMVGIPN+M
Sbjct  27    EAIGVNWGTQLSHPLPASTVVRLLQDNGFDKVKLFDAEDAILGALKGSGIQVMVGIPNDM  86

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA +++   AA+ WVA+N++ + V  GV+I+YVAVGNEPFL +++G + +   PA+ N+Q
Sbjct  87    LADLAAGGKAAEDWVARNVSGH-VRDGVDIRYVAVGNEPFLETFNGTYLNTTFPAMQNIQ  145

Query  1292  QSLAKANLGGAVKLVVPCNADAYESSL--PSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA L   VK+ VP NAD Y+SS   PS G FR ++  +M  +V  L S  +PFV N
Sbjct  146   SALMKAGLADKVKVTVPLNADVYQSSTGKPSDGDFRADIHGLMLTIVQFLASTGAPFVAN  205

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             +YPF+SLY + +FP DYAFF+G++ PV DG   Y N FD N DTLVAAL + GY  + IV
Sbjct  206   VYPFISLYSDPNFPLDYAFFQGSSSPVADGGVTYQNTFDANHDTLVAALRRNGYGNVSIV  265

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG+ +ANL  AR FNQG + H+ G +GTPLRPG  P+D YLFSL DE  KSI
Sbjct  266   VGEVGWPTDGSANANLDYARRFNQGFLDHIAGGRGTPLRPG--PVDAYLFSLVDEDRKSI  323

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGNGQ----LKNARDVPYLPYRWCIVNPNKDLS--AV  597
              PG+FERHWG+F++DG  KYPL L  G     LK AR V YL  RWC++ P  DL+   V
Sbjct  324   QPGNFERHWGIFNYDGTPKYPLSLAGGNSGSTLKPARGVRYLEKRWCVLKPAADLADQKV  383

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
              + +  AC LADCT L Y  SC G+  +GN+SYAFNSYYQ   Q+ ++CDF GL   T +
Sbjct  384   GDSVSYACGLADCTALGYKTSCGGLDARGNVSYAFNSYYQTMDQDDRACDFRGLATTTSV  443

Query  416   DPSVDECRFLVGV  378
             DPS   CRF+V +
Sbjct  444   DPSTGTCRFIVEI  456



>ref|XP_004139090.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Cucumis sativus]
 gb|KGN66628.1| hypothetical protein Csa_1G651130 [Cucumis sativus]
Length=491

 Score =   468 bits (1203),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 236/426 (55%), Positives = 297/426 (70%), Gaps = 8/426 (2%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             AIG NWGT + H LPP TVV +LR+N IQKVKLFDAD   L AL  +GIEVMVGIPN+ML
Sbjct  31    AIGANWGTQSSHPLPPETVVGMLRDNQIQKVKLFDADYGTLRALGKTGIEVMVGIPNDML  90

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
             +  +S+  AA+ WV++N++ ++    VNI+YVAVGNEPFLA+Y+G F S   PA+ NVQ+
Sbjct  91    STFASNEKAAEKWVSKNVSVHISENNVNIRYVAVGNEPFLATYNGSFLSTTFPALRNVQK  150

Query  1289  SLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             +L KANLG  VK+  P NAD Y S+   PS G FR ++  +M  +V  L+ + SPF VNI
Sbjct  151   ALIKANLGNQVKVTCPLNADVYASTTTFPSGGDFRSDIHDLMLDIVKFLSDSGSPFTVNI  210

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPF+SLY + +FP +YAFF+G A P+VDG   Y N FD N DTLV AL K G+  +PI++
Sbjct  211   YPFISLYSDPNFPVEYAFFDGNASPIVDGQTTYFNMFDANYDTLVWALQKNGFGNLPIIV  270

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDG  +AN   A+ FNQG + H+LG KGTP+RPG  PID YLFSL DE  KSI 
Sbjct  271   GEIGWPTDGDRNANPIYAQRFNQGFMSHILGGKGTPMRPG--PIDTYLFSLIDEDAKSID  328

Query  755   PGDFERHWGVFSFDGQLKYPLDLG--NGQLKNARDVPYLPYRWCIVNPNKDL--SAVSNH  588
             PG+FERHWG+F +DG+ KY L LG  NG L  AR V YL  +WC++ P+  L  S V+  
Sbjct  329   PGNFERHWGIFYYDGRPKYQLSLGNSNGTLVGARGVHYLERKWCVMKPSAHLEDSQVAPS  388

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
             +  AC  ADCT+L YG SC+G+  + NISYAFNSYYQ + Q   +C F GL  VT  DPS
Sbjct  389   VSYACYHADCTSLGYGTSCSGLDARSNISYAFNSYYQRNNQAEDACKFSGLSTVTNNDPS  448

Query  407   VDECRF  390
                CRF
Sbjct  449   FGSCRF  454



>emb|CCH47219.1| similar to glucan endo-1,3-beta-glucosidase [Lupinus angustifolius]
Length=485

 Score =   467 bits (1202),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 234/436 (54%), Positives = 313/436 (72%), Gaps = 11/436 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S IGVNWGT + H LPPSTVV +L++N IQKVKLFDAD ++L AL  SGI+VMVGIPN+M
Sbjct  27    SGIGVNWGTQSTHLLPPSTVVKMLKDNGIQKVKLFDADSSILDALKKSGIQVMVGIPNDM  86

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  +++S  AA+ WV++N++ ++ +GGV+I+YVAVGNEPFL++Y+G F+S  +PA+ N+Q
Sbjct  87    LYMLANSVQAAEKWVSKNISAHVSSGGVDIRYVAVGNEPFLSTYNGTFESTTLPALQNIQ  146

Query  1292  QSLAKANLGGAVKLVVPCNADAY--ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L K+ LG  VK+ VP NAD Y   S  PS G FRP++  +M Q+V  L+ N +PF VN
Sbjct  147   SALVKSGLGNQVKVTVPMNADVYLSASDKPSDGNFRPDIHDLMLQIVKFLSQNNAPFTVN  206

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY +++FP D+AFF G   P+ D   +Y N  D N DTLV AL K G+  +PIV
Sbjct  207   IYPFISLYSDANFPVDFAFFNGFQSPINDNGRIYDNVLDANHDTLVWALQKNGFGNLPIV  266

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +ANL  A+ FNQG +   +  KGTP+RPG  PID YLFSL DE  KSI
Sbjct  267   VGEIGWPTDGDHNANLQYAQRFNQGFMSRFVAGKGTPMRPG--PIDAYLFSLIDEDDKSI  324

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLSA--VS  594
              PG+FERHWG+F +DG+ KYPL+LG   NG L  A  V YLP +WCI+ P+ +L++  V+
Sbjct  325   QPGNFERHWGLFYYDGKPKYPLNLGTRTNG-LVGASGVAYLPKKWCILQPSANLNSDQVA  383

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC  ADCT+L YG SC G+  +GN+SYAFNSYYQ++ Q   +C F GL +VT  D
Sbjct  384   PSVSYACQNADCTSLGYGTSCGGLDVRGNLSYAFNSYYQVNDQMDSACKFPGLSVVTDKD  443

Query  413   PSVDECRFLVGV-TDT  369
             PS   C+F++ + TD+
Sbjct  444   PSTPSCKFIIMIQTDS  459



>ref|XP_002277003.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Vitis vinifera]
 ref|XP_010653839.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Vitis vinifera]
 emb|CAN83571.1| hypothetical protein VITISV_041708 [Vitis vinifera]
 emb|CBI29926.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   467 bits (1201),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 238/432 (55%), Positives = 301/432 (70%), Gaps = 12/432 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A HKLPP  VV +L++N IQKVKLFDAD   +SAL GSGIEVMV IPN+ LA
Sbjct  25    LGVNWGTMASHKLPPKVVVQMLKDNGIQKVKLFDADSVTMSALAGSGIEVMVAIPNDQLA  84

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              ++    A   WV +N+TRY  NGGV IKYV VGNEPFL+SY+G F +  +PA+ N+Q +
Sbjct  85    VMNDYDRA-KAWVRRNVTRYNFNGGVTIKYVGVGNEPFLSSYNGSFLNITLPALQNIQNA  143

Query  1286  LAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A +G ++K  VP NAD Y S     +PS G FR +++++MTQ+V  LN N +PF VN
Sbjct  144   LNEAGVGDSIKATVPLNADVYNSPESNPVPSAGRFRTDISELMTQIVQFLNKNNAPFTVN  203

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLYGN +FP DYAFF+G ++P+VD    Y+N FD N DTLV+AL  +G   M I+
Sbjct  204   IYPFLSLYGNDNFPFDYAFFDGVSNPIVDNGISYTNVFDANFDTLVSALKAVGLGDMTIL  263

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +AN   A  F  GL+  + GN GTPLRPG   I+VYLF L DE  KSI
Sbjct  264   VGEVGWPTDGDKNANSNNAYRFYNGLLPRLAGNIGTPLRPGY--IEVYLFGLIDEDAKSI  321

Query  758   LPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPNK-DLSAVS  594
              PG+FERHWG+F +DGQ KY LDL G GQ   L  A+DV YLP +WC+ NPN  DLS + 
Sbjct  322   APGNFERHWGIFKYDGQPKYALDLSGQGQNKLLVAAKDVTYLPQKWCMFNPNAGDLSKLG  381

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
             ++I  AC+ +DCT L YG SCNG+  +GN SYAFN Y+Q+  Q+  SC F GL  VT  +
Sbjct  382   DNINYACTFSDCTALGYGSSCNGLDAQGNASYAFNMYFQVKNQDDLSCYFQGLAKVTTQN  441

Query  413   PSVDECRFLVGV  378
              S   C F+V +
Sbjct  442   ISQGSCNFIVQI  453



>gb|KHN00669.1| Glucan endo-1,3-beta-glucosidase 8 [Glycine soja]
Length=468

 Score =   466 bits (1200),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 238/441 (54%), Positives = 309/441 (70%), Gaps = 12/441 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             + +GVNWGT A H+L   TVV++L++N IQKVKLFDAD + +SAL GSGIEVMV IPN  
Sbjct  11    AGLGVNWGTQATHQLRADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIEVMVAIPNNQ  70

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA ++    A   WV +N+TRY   GGVNIKYVAVGNEPFL SY+G F +  +PA+ N+Q
Sbjct  71    LAEMNDYDRALQ-WVKKNVTRYNFRGGVNIKYVAVGNEPFLKSYNGSFLNITLPALQNIQ  129

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L  A LG ++K  VP NAD YES     +PS G FRP+++ +MTQ+V  L  N +PF 
Sbjct  130   NALNDAGLGDSIKATVPLNADVYESPPNSPVPSAGIFRPDISDLMTQIVQFLAKNKAPFT  189

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN +FP DYAFF+G A+P++D    Y+N FD N DTLV+AL K+GY  MP
Sbjct  190   VNIYPFLSLYGNDNFPFDYAFFDGVANPIIDNGVSYTNVFDANFDTLVSALKKVGYGNMP  249

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             +++GEVGWPTDG  +AN+  A  F  GL+  +  NKGTPLRPG   I+VYLF L DE  K
Sbjct  250   VLVGEVGWPTDGDKNANVGNAFRFYNGLLPRLAMNKGTPLRPGF--IEVYLFGLIDEDAK  307

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQLK---NARDVPYLPYRWCIVNPN-KDLSA  600
             +I PG+FERHWG+F +DG+ K+P+DL G GQ K    A++V YL   WC+ NP+ +DLS 
Sbjct  308   NIAPGNFERHWGIFGYDGKPKFPMDLSGKGQKKVLVGAQNVHYLEPNWCMFNPDAQDLSK  367

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++++I  AC+LADCT L YG SCN +   GN SYAFN YYQ   QN  +C+F+GL  +T 
Sbjct  368   LADNINYACTLADCTALGYGSSCNNLDANGNASYAFNMYYQTQDQNYMACNFEGLARLTT  427

Query  419   LDPSVDECRFLVGVTDTNNSS  357
              + S   C F+V +  + +SS
Sbjct  428   SNISTPTCNFIVQINPSLSSS  448



>ref|XP_008443646.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Cucumis melo]
Length=492

 Score =   467 bits (1202),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 237/427 (56%), Positives = 296/427 (69%), Gaps = 9/427 (2%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             AIG NWGT + H LPP TVV +LR+N IQKVKLFDAD   L AL  +GIEVMVGIPN+ML
Sbjct  31    AIGANWGTQSSHPLPPETVVGMLRDNQIQKVKLFDADYGTLRALGKTGIEVMVGIPNDML  90

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
             +  ++S  AA+ WV++N++ ++    VNI+YVAVGNEPFLA+Y+G F S   PA+ NVQ+
Sbjct  91    STFANSEKAAEKWVSKNVSVHISENNVNIRYVAVGNEPFLATYNGSFLSTTFPALRNVQR  150

Query  1289  SLAKANLGGAVKLVVPCNADAYES--SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             +L KANLG  VK+  P NAD Y S  SLPS G FR ++  +M  +V  L+ + SPF VNI
Sbjct  151   ALIKANLGNQVKVTCPLNADVYASTTSLPSGGDFRSDIHDLMLAIVKFLSDSGSPFTVNI  210

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPF+SLY + +FP +YAFF+G A P+VDG   Y N FD N DTLV AL K G+  +PI++
Sbjct  211   YPFISLYSDPNFPVEYAFFDGNASPIVDGQTTYFNMFDANYDTLVWALQKNGFGNLPIIV  270

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDG  +AN   A+ FNQG + H+LG KGTP+RPG  PID YLFSL DE  KSI 
Sbjct  271   GEIGWPTDGDRNANPIYAQRFNQGFMSHILGGKGTPMRPG--PIDAYLFSLIDEDAKSID  328

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQ---LKNARDVPYLPYRWCIVNPNKDL--SAVSN  591
             PG+FERHWG+F +DG+ KY L LGN     L  A+ V YL  RWC++ P+  L  S V+ 
Sbjct  329   PGNFERHWGIFYYDGRPKYQLSLGNSNNVTLVGAKGVRYLERRWCVMKPSAHLEDSQVAP  388

Query  590   HIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDP  411
              +  AC  ADCT+L YG SC+G+  + NISYAFNSYYQ   Q   +C F GL  VT  DP
Sbjct  389   SVSYACYHADCTSLGYGTSCSGLDARSNISYAFNSYYQRSNQAEDACKFSGLSTVTNNDP  448

Query  410   SVDECRF  390
             S   CRF
Sbjct  449   SFGSCRF  455



>emb|CDP14258.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   466 bits (1200),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 240/427 (56%), Positives = 295/427 (69%), Gaps = 8/427 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             + IG NWGT A H+LPP  VV +LREN IQKVKLFDAD   L AL  SGIEVMVG+PN+M
Sbjct  16    NGIGANWGTQATHRLPPDIVVRMLRENGIQKVKLFDADYDTLKALGKSGIEVMVGMPNDM  75

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA ++ S  AA+ WV++N++ +L    VNI+YVAVGNEPFLA+Y+G F     PA+ N+Q
Sbjct  76    LAPIAGSMKAAEKWVSENVSSHLSTNNVNIRYVAVGNEPFLATYNGTFLRTTYPALQNIQ  135

Query  1292  QSLAKANLGGAVKLVVPCNADAYES--SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA +   VK  VP NAD YES   LPS G FR ++   + Q+V LL+ N +PF VN
Sbjct  136   AALIKAGISNQVKATVPLNADVYESPNGLPSAGDFRADIHDFVLQIVKLLSDNGAPFTVN  195

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY + +FP DYAFF+G A PV DG   Y+N FD N DTLV AL K G+  +P++
Sbjct  196   IYPFISLYIDPNFPVDYAFFDGNASPVNDGGTNYNNMFDANHDTLVWALQKNGFGNLPVI  255

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWPTDG  +ANL  AR FNQG + HV G KGTP+RPG  PID YLFSL DE  KSI
Sbjct  256   IGEIGWPTDGDRNANLDYARRFNQGFMSHVSGGKGTPMRPG--PIDAYLFSLIDEDAKSI  313

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG--NGQLKNARDVPYLPYRWCIVNPNKDLS--AVSN  591
              PG+FERHWGVF FDGQ KY L+LG  N  L  AR V  L  +WCI+ P+  L+   V+ 
Sbjct  314   QPGNFERHWGVFYFDGQPKYSLNLGTTNSGLVPARGVQELERKWCILKPDAKLTDPQVAP  373

Query  590   HIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDP  411
              +  ACSL DCT+L Y  SC  +  +GNISYA+NSYYQ+H Q   +C F GL  +T  DP
Sbjct  374   TVSYACSLGDCTSLGYQTSCGSLDSQGNISYAYNSYYQIHNQLDSACKFQGLATITRSDP  433

Query  410   SVDECRF  390
             SV  C+F
Sbjct  434   SVGSCKF  440



>ref|XP_004154666.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
6-like [Cucumis sativus]
Length=491

 Score =   467 bits (1201),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 235/426 (55%), Positives = 296/426 (69%), Gaps = 8/426 (2%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             AIG NWGT + H LPP TVV +LR+N IQKVKLFDAD   L AL  +GIEVMVGIPN+ML
Sbjct  31    AIGANWGTQSSHPLPPETVVRMLRDNQIQKVKLFDADYGTLRALGKTGIEVMVGIPNDML  90

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
             +  +S+  AA+ WV++N++ ++    VNI+YVAVGNEPFLA+Y+G F S   PA+ NVQ+
Sbjct  91    STFASNEKAAEKWVSKNVSVHISENNVNIRYVAVGNEPFLATYNGSFLSTTFPALRNVQK  150

Query  1289  SLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             +L KANLG   K+  P NAD Y S+   PS G FR ++  +M  +V  L+ + SPF VNI
Sbjct  151   ALIKANLGNQXKVTCPLNADVYASTTXFPSGGDFRSDIHDLMLDIVKFLSDSGSPFTVNI  210

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPF+SLY + +FP +YAFF+G A P+VDG   Y N FD N DTLV AL K G+  +PI++
Sbjct  211   YPFISLYSDPNFPVEYAFFDGNASPIVDGQTTYXNMFDANYDTLVWALQKNGFGNLPIIV  270

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDG  +AN   A+ FNQG + H+LG KGTP+RPG  PID YLFSL DE  KSI 
Sbjct  271   GEIGWPTDGDRNANPIYAQRFNQGFMSHILGGKGTPMRPG--PIDTYLFSLIDEDAKSID  328

Query  755   PGDFERHWGVFSFDGQLKYPLDLG--NGQLKNARDVPYLPYRWCIVNPNKDL--SAVSNH  588
             PG+FERHWG+F +DG+ KY L LG  NG L  AR V YL  +WC++ P+  L  S V+  
Sbjct  329   PGNFERHWGIFYYDGRPKYQLSLGNSNGTLVGARGVHYLERKWCVMKPSAHLEDSQVAPS  388

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
             +  AC  ADCT+L YG SC+G+  + NISYAFNSYYQ + Q   +C F GL  VT  DPS
Sbjct  389   VSYACYHADCTSLGYGTSCSGLDARSNISYAFNSYYQRNNQAEDACKFSGLSTVTNNDPS  448

Query  407   VDECRF  390
                CRF
Sbjct  449   FGSCRF  454



>ref|XP_008391677.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Malus domestica]
Length=484

 Score =   466 bits (1200),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 239/446 (54%), Positives = 312/446 (70%), Gaps = 17/446 (4%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
               +GVNWGT+A HKLPP TVV +L++N IQKVKLFDA+ + +SAL GSG+EVMV IPN+ 
Sbjct  21    EGLGVNWGTMATHKLPPETVVQMLKDNGIQKVKLFDAEESTMSALAGSGLEVMVAIPNDQ  80

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA ++S   A + WV +N+TRY  NGGVNIKYVAVGNEPFL SY+G F +   PA+ N+Q
Sbjct  81    LAVMTSYKRAKE-WVRRNVTRYNFNGGVNIKYVAVGNEPFLTSYNGSFLNVTFPALQNIQ  139

Query  1292  QSLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L +A +G +VK  VP NAD Y S     +PS G FR ++ Q+MT++V  L+ N +PF 
Sbjct  140   NALNEAGVGDSVKATVPLNADVYNSPENNPVPSAGRFRTDILQLMTEIVQFLDKNQAPFS  199

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVD-GPNV-YSNAFDGNLDTLVAALSKLGYSQ  951
             +NIYPFLSLYGN DFP +YAFF+G  +P+VD G  + Y+N FD N DTLV++L  +G+  
Sbjct  200   INIYPFLSLYGNDDFPFNYAFFDGDTNPIVDAGTGIQYTNVFDANFDTLVSSLKAVGFGN  259

Query  950   MPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEA  771
             MPIV+GEVGWPTDG  +AN   A  F  GL+  +  N+GTPLRPG   I+VYLF L DE 
Sbjct  260   MPIVVGEVGWPTDGDKNANAGNALRFYNGLLPRLGTNRGTPLRPGY--IEVYLFGLIDED  317

Query  770   GKSILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDL  606
              KSI PG FERHWG+F +DGQ K+P+DL G GQ   L  A++V YL  +WC+ NPN KD+
Sbjct  318   AKSIAPGSFERHWGIFRYDGQPKFPVDLSGQGQNKLLVPAKNVQYLSKKWCMFNPNAKDV  377

Query  605   SAVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLV  426
             S ++++I  AC+ +DCT L+YG SCN +   GN SYAFN YYQ+  Q+  SC+F GL  +
Sbjct  378   SKLADNINYACTFSDCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDLSCNFQGLATL  437

Query  425   TFLDPSVDECRFLVGVTDTNNSSGFS  348
             T  + S   C F++ +     SS FS
Sbjct  438   TTQNISQGNCNFIIQIA---TSSAFS  460



>ref|XP_002968123.1| hypothetical protein SELMODRAFT_231117 [Selaginella moellendorffii]
 gb|EFJ30377.1| hypothetical protein SELMODRAFT_231117 [Selaginella moellendorffii]
Length=469

 Score =   465 bits (1197),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 226/440 (51%), Positives = 311/440 (71%), Gaps = 16/440 (4%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             ++GVNWGT+  H+LP   +V LL+E+ I KVKLFDADP+V+ A  G+ +E+MV +PN++L
Sbjct  6     SVGVNWGTVTSHRLPDKMIVKLLQESRISKVKLFDADPSVIRAFAGTDLELMVAVPNDLL  65

Query  1469  aavsssssaADLWVAQNLTRYLVN-GGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
               ++ S  AA  +V +N+T++L +  GVNI+Y+AVGNEPFL +Y+G ++   +PA+ N+Q
Sbjct  66    EDMAFSEKAARRFVRRNITKFLSHQDGVNIRYIAVGNEPFLKAYNGSYEDVTIPAIRNMQ  125

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             Q++ +A +   V LVVP NAD   SS     PSQGA RP++ ++M  ++  L+ + +PFV
Sbjct  126   QAIEQAGIQHKVTLVVPLNADILTSSGNSGKPSQGAIRPDIRRLMRTILEFLDKHKAPFV  185

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             +N+YPFLSL  +S FP D+AFF+GTAH + DG N+YSN FD + D LV+AL++ G+  M 
Sbjct  186   INMYPFLSLQQDSHFPSDFAFFDGTAHVLSDGRNIYSNVFDASYDLLVSALAREGFPDME  245

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             IV+GEVGWPTDG   AN+  A+ FNQ LI HV  N+GTPLRPG+ PI++Y+F L DE  K
Sbjct  246   IVVGEVGWPTDGDIYANIPNAQRFNQQLIRHVTSNRGTPLRPGI-PIEIYIFGLVDEDRK  304

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL----GNG-----QLKNARDVPYLPYRWCIVNPN-  615
             S+LPG+FERHWG++ +DG+ KY LD+    GNG      L +   V YLP RWC++NP  
Sbjct  305   SVLPGNFERHWGLYRYDGKPKYSLDVSGRGGNGLSSPINLMSVSGVTYLPSRWCVLNPEV  364

Query  614   KDLSAVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGL  435
              DLS +   I  ACS ADC+TL YGGSCN IG  GN SYAFNS+YQ++ Q  +SC F GL
Sbjct  365   DDLSKLPATISYACSYADCSTLAYGGSCNHIGRTGNASYAFNSFYQMNNQRTESCHFGGL  424

Query  434   GLVTFLDPSVDECRFLVGVT  375
             G++T  DPS   C+F V +T
Sbjct  425   GMITETDPSSGNCQFRVEIT  444



>ref|XP_006574750.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=484

 Score =   466 bits (1198),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 238/441 (54%), Positives = 309/441 (70%), Gaps = 12/441 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             + +GVNWGT A H+L   TVV++L++N IQKVKLFDAD + +SAL GSGIEVMV IPN  
Sbjct  27    AGLGVNWGTQATHQLRADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIEVMVAIPNNQ  86

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA ++    A   WV +N+TRY   GGVNIKYVAVGNEPFL SY+G F +  +PA+ N+Q
Sbjct  87    LAEMNDYDRALQ-WVKKNVTRYNFRGGVNIKYVAVGNEPFLKSYNGSFLNITLPALQNIQ  145

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L  A LG ++K  VP NAD YES     +PS G FRP+++ +MTQ+V  L  N +PF 
Sbjct  146   NALNDAGLGDSIKATVPLNADVYESPPNSPVPSAGIFRPDISDLMTQIVQFLAKNKAPFT  205

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN +FP DYAFF+G A+P++D    Y+N FD N DTLV+AL K+GY  MP
Sbjct  206   VNIYPFLSLYGNDNFPFDYAFFDGVANPIIDNGVSYTNVFDANFDTLVSALKKVGYGNMP  265

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             +++GEVGWPTDG  +AN+  A  F  GL+  +  NKGTPLRPG   I+VYLF L DE  K
Sbjct  266   VLVGEVGWPTDGDKNANVGNAFRFYNGLLPRLAMNKGTPLRPGF--IEVYLFGLIDEDAK  323

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQLK---NARDVPYLPYRWCIVNPN-KDLSA  600
             +I PG+FERHWG+F +DG+ K+P+DL G GQ K    A++V YL   WC+ NP+ +DLS 
Sbjct  324   NIAPGNFERHWGIFGYDGKPKFPMDLSGKGQKKVLVGAQNVHYLEPNWCMFNPDAQDLSK  383

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++++I  AC+LADCT L YG SCN +   GN SYAFN YYQ   QN  +C+F+GL  +T 
Sbjct  384   LADNINYACTLADCTALGYGSSCNNLDANGNASYAFNMYYQTQDQNYMACNFEGLARLTT  443

Query  419   LDPSVDECRFLVGVTDTNNSS  357
              + S   C F+V +  + +SS
Sbjct  444   SNISTPTCNFIVQINPSLSSS  464



>ref|XP_002525445.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF36935.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=480

 Score =   465 bits (1197),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 240/441 (54%), Positives = 307/441 (70%), Gaps = 14/441 (3%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
              +GVNWGT A HKLPP TVV +L++N IQKVKLFD+D   ++AL GSG+EVMV IPN+ L
Sbjct  22    GLGVNWGTQATHKLPPKTVVQMLKDNGIQKVKLFDSDRNTMTALAGSGLEVMVAIPNDQL  81

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
             AA++    A D WV +N++ Y  NGGVNIKYVAVGNEPFL SY+G F +   PA+ N+Q 
Sbjct  82    AAMNDYDRAKD-WVKRNVSIYNFNGGVNIKYVAVGNEPFLTSYNGSFINITFPALQNIQN  140

Query  1289  SLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             +L +A +G +VK  VP NAD Y S      PS G FR ++  IMT +V  L+ N +PF V
Sbjct  141   ALNEAGVGDSVKATVPLNADVYNSPTDQPYPSAGRFRIDINDIMTNIVQFLHKNNAPFTV  200

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVD-GPNV-YSNAFDGNLDTLVAALSKLGYSQM  948
             NIYPFLSLYGN DFP DYAFF+G   PVVD G  + Y+N FD N DTLV+AL  +G+  M
Sbjct  201   NIYPFLSLYGNDDFPFDYAFFDGAPQPVVDRGTGIQYTNVFDANFDTLVSALKAVGFGDM  260

Query  947   PIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAG  768
             PI++GEVGWPTDG  +A +  A  F  GL+  + GN+GTPLRPG   I+VYLF L DE  
Sbjct  261   PIIVGEVGWPTDGDKNAKVDYAYRFYNGLLPRLAGNRGTPLRPGF--IEVYLFGLLDEDA  318

Query  767   KSILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLS  603
             KSI PG+FERHWG+F +DGQ K+ LDL G GQ   L  A++V Y P +WC+ NPN KDLS
Sbjct  319   KSIAPGNFERHWGIFRYDGQPKFALDLSGQGQNKLLVGAQNVQYQPSKWCMFNPNAKDLS  378

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              ++++I  AC+ +DCT L YG SCNG+   GN SYAFN YYQ+ KQ+  +C+F GL +VT
Sbjct  379   KLADNIDYACTFSDCTALGYGSSCNGLDSNGNASYAFNMYYQVQKQDDMACNFQGLAMVT  438

Query  422   FLDPSVDECRFLVGVTDTNNS  360
               + S   C F++ +  + +S
Sbjct  439   TQNLSQGTCNFIIQIASSPSS  459



>ref|XP_008806060.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Phoenix dactylifera]
Length=460

 Score =   464 bits (1194),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 230/441 (52%), Positives = 310/441 (70%), Gaps = 11/441 (2%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A H LPP+ VV LL++N I KVKLFDAD  ++SAL GSGIEVMV IPN  LA
Sbjct  5     LGVNWGTLATHPLPPNIVVQLLKDNGINKVKLFDADAKMMSALAGSGIEVMVAIPNNQLA  64

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             A++  ++A + WV +N+TRY  +GGVNI YVAVGNEPFL SY+  F +   PA+ N+Q +
Sbjct  65    AMNDYTTAKE-WVRKNVTRYHFDGGVNITYVAVGNEPFLKSYNDSFSNVTFPALQNIQNA  123

Query  1286  LAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A +G +VK  VP NAD YES    ++PS G FR ++  +MTQ+V   N N +PF VN
Sbjct  124   LNEAGVGDSVKATVPLNADVYESPAGNAVPSAGRFRSDINDVMTQIVQFFNQNGAPFTVN  183

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLYGN +FP D+AFF+GT+ PVVD    Y+N FD N DTLV+AL+ +G   +PI+
Sbjct  184   IYPFLSLYGNDNFPLDFAFFDGTSPPVVDNGIEYTNVFDANFDTLVSALNAVGLGNLPII  243

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  SA  + A+ F  GL+  +   +GTPLRP    ++VYLF L DE  KS+
Sbjct  244   VGEVGWPTDGDKSAEASYAQRFYNGLLKRLAAGQGTPLRPN-QYLEVYLFGLLDEDAKSV  302

Query  758   LPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG+FERHWG+F +DGQ K+P+DL G GQ   L  A++V YLP +WC+ NP+ KDLS ++
Sbjct  303   APGNFERHWGIFRYDGQPKFPVDLSGQGQNKMLAAAKNVEYLPQKWCVFNPDAKDLSKLA  362

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
             +++  AC+ +DCT+L  G +C+ +   G+ SYAFN YYQ+  Q+  SC F GL + T  D
Sbjct  363   DNVNFACTFSDCTSLGSGSTCSDLDANGSASYAFNMYYQVQNQDDTSCFFQGLAMETAQD  422

Query  413   PSVDECRFLVGVTDTNNSSGF  351
             PS  +C+F V +  + ++S F
Sbjct  423   PSTADCKFTVQIKTSASASSF  443



>ref|XP_011078775.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Sesamum indicum]
Length=478

 Score =   465 bits (1196),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 230/440 (52%), Positives = 306/440 (70%), Gaps = 12/440 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
              ++GVNWGT+A HKLPP  VV +L +N I+KVKLFDAD + +SAL G+G+EVMV IPN+ 
Sbjct  24    ESLGVNWGTMATHKLPPKVVVQMLTDNGIKKVKLFDADQSTMSALAGTGVEVMVAIPNDQ  83

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L+A+ S   A + WV +N+TRY  NGGV IKYVAVGNEPFL SY+  F +   PA+ N+Q
Sbjct  84    LSAMGSYDRAKE-WVKRNITRYNFNGGVTIKYVAVGNEPFLTSYNNSFVNTTFPALQNIQ  142

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L +A +G ++K  VP NAD Y S     +PS G FR +++  M+Q+V  LN N +PF 
Sbjct  143   NALNEAGVGDSIKATVPLNADVYGSPENNPVPSAGRFRTDISDQMSQIVKFLNQNKAPFT  202

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLY N +FP DYAFF+G ++P+VD    YSN FD N DTLV+AL  LGY  M 
Sbjct  203   VNIYPFLSLYANENFPVDYAFFDGVSNPIVDNGISYSNVFDANFDTLVSALKALGYGDMT  262

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN+  A  F +GL+  + GNKGTPLRPG   I+VYLF L DE  K
Sbjct  263   IIVGEVGWPTDGDKNANINYALRFYRGLLPRLAGNKGTPLRPGY--IEVYLFGLIDEDAK  320

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNGQ----LKNARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG+FERHWG+F +DGQ K+P+DL   Q    L  A++V YLP +WC++ P+  DLS 
Sbjct  321   SIAPGNFERHWGIFRYDGQPKFPMDLSGQQSDKYLVGAQNVNYLPTKWCMLRPDANDLSK  380

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++++I  AC+ +DCT L +G SCNG+   GN SYAFN Y+Q+  Q   +C+F GL +VT 
Sbjct  381   LADNINYACTFSDCTALGFGSSCNGLDANGNASYAFNMYFQVQNQRDLTCNFQGLAMVTD  440

Query  419   LDPSVDECRFLVGVTDTNNS  360
              + S   C F + +  +++S
Sbjct  441   KNISQGNCNFTIQIATSSSS  460



>ref|XP_003548760.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=478

 Score =   464 bits (1195),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 234/442 (53%), Positives = 306/442 (69%), Gaps = 14/442 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
               IGVNWGT A HKLPP TVV +L++N I+KVKLFD+D + +SAL G+GIEVMV IPN  
Sbjct  21    EGIGVNWGTQATHKLPPDTVVQMLKDNGIKKVKLFDSDDSTMSALAGTGIEVMVAIPNNQ  80

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA ++    A   WV +N+TRY  NGGVN+KYVAVGNEPFL SY+  F +  +PA+ N+Q
Sbjct  81    LAEMNDYGRAKQ-WVKKNVTRYNFNGGVNVKYVAVGNEPFLKSYNNSFLNITLPALQNIQ  139

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L +A LG  +K  VP NAD Y+S     +PS G FRP+++ +MTQ+V  L+ N +PF 
Sbjct  140   NALNEAGLGDKIKATVPLNADVYQSPESNPVPSAGIFRPDISGLMTQIVQFLSKNGAPFT  199

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN DFP +YAFF+G  +PV D    Y+N FD N DTLVAAL  +G+  +P
Sbjct  200   VNIYPFLSLYGNDDFPFNYAFFDGVDNPVNDNGTPYTNVFDANFDTLVAALKSVGFGDLP  259

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPT+G  +AN   A  F  GL+  +  N+GTP RPG   I+VYLF L DE  K
Sbjct  260   ILVGEVGWPTEGDKNANAGNALRFYNGLLPRLAANRGTPRRPGY--IEVYLFGLIDEDAK  317

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPN-KDLS  603
             SI PG+FERHWG+F +DGQ K+P+DL +GQ +N     A++V YL  RWC+ NP+ KDLS
Sbjct  318   SIAPGNFERHWGIFRYDGQPKFPMDL-SGQNQNKFLIGAQNVKYLAPRWCMFNPDAKDLS  376

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              + ++I  AC+  DCT L YG SCN +   GN SYAFN Y+Q+  QNP +C+F GL  +T
Sbjct  377   KLPDNINYACTFGDCTALGYGSSCNNLDANGNASYAFNMYFQVQNQNPMACNFQGLAKLT  436

Query  422   FLDPSVDECRFLVGVTDTNNSS  357
               + S   C F+V + +++ SS
Sbjct  437   TDNISTPTCNFIVQIVNSSASS  458



>ref|XP_002985205.1| hypothetical protein SELMODRAFT_121927 [Selaginella moellendorffii]
 gb|EFJ13699.1| hypothetical protein SELMODRAFT_121927 [Selaginella moellendorffii]
Length=496

 Score =   465 bits (1196),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 236/441 (54%), Positives = 302/441 (68%), Gaps = 13/441 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMG-SGIEVMVGIPNEML  1470
             +GVNWGT   H LP  TVV +LR NN+ +VKLFDADP  L AL   S  EVMVGIPNEML
Sbjct  35    VGVNWGTQLSHPLPGDTVVQMLRSNNVTRVKLFDADPNALRALTKDSSFEVMVGIPNEML  94

Query  1469  aavsssssaADLWVAQNLTRYLV-NGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
               ++ SS AADLWV+QN++RY+      NI+YVAVGNEPFL +Y+  F+   +PA+ N+Q
Sbjct  95    QRLAQSSQAADLWVSQNVSRYVSGRRRANIRYVAVGNEPFLTAYNRSFEGVTLPALRNIQ  154

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS---LPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
              +LA+A L   +K  VP NAD   +S    PS G FRPE   ++  +V  L+   +PFV+
Sbjct  155   GALARAGLDSQIKATVPLNADVLANSRPPFPSGGIFRPESQALVVSIVQFLSQTGAPFVI  214

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
             NIYPF+SL+G+ +FP ++AFFEG A+ +VDG N Y+N FD + D LVAAL+  GY+ M I
Sbjct  215   NIYPFISLHGDPNFPINFAFFEGAANSIVDGSNTYTNVFDASYDLLVAALNAAGYTNMAI  274

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             ++GEVGWPTDG  +AN+  AR FNQGL+ HVL N+GTPLRPG  PI  YLF L DE  KS
Sbjct  275   IVGEVGWPTDGDPNANVENARRFNQGLLQHVLSNRGTPLRPG-SPIHFYLFGLIDEDQKS  333

Query  761   ILPGDFERHWGVFSFDGQLKYPLDL-----GNGQLKNARDVPYLPYRWCIVNPNKDLSAV  597
             I PG+FERHWGVF++DGQ KY LD+      N +L NA+ V YLP RWC++ P   +SA 
Sbjct  334   IAPGNFERHWGVFTYDGQAKYFLDMSGRGVANARLVNAQGVQYLPRRWCVLRPGVAVSA-  392

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
              N I  AC+ ADCT L YGGSCN +  + N SYA+N+YYQ   Q P SCDF G  +VT  
Sbjct  393   -NSISFACANADCTALSYGGSCNFLTAQENASYAYNNYYQKTNQLPTSCDFQGQAVVTTT  451

Query  416   DPSVDECRFLVGVTDTNNSSG  354
             DPS+  CRF+  +   ++S+ 
Sbjct  452   DPSIQPCRFIRQIIPPDDSAA  472



>ref|XP_004250551.2| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Solanum lycopersicum]
Length=493

 Score =   465 bits (1196),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 237/435 (54%), Positives = 296/435 (68%), Gaps = 16/435 (4%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             ++GVNWGT+A H+LPP++VV +L EN   KVKLF+AD  +L+AL+G+ IEVM+ IPN ML
Sbjct  29    SVGVNWGTMATHQLPPNSVVKMLIENGFDKVKLFEADEVILNALIGTEIEVMLAIPNYML  88

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
               +SS+   AD WV  N++ Y    GV I+YVAVGNEPFL +Y+G +  Y++PA+ NVQ+
Sbjct  89    EDLSSNPIIADSWVEANVSVYAYPHGVKIRYVAVGNEPFLRTYNGTYLQYILPALKNVQE  148

Query  1289  SLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             ++ KA LG  VK  +P NAD Y S     +PS G FRPE+  +  Q+V  L SN +PFVV
Sbjct  149   AINKAGLGAKVKATIPFNADIYFSPESNQVPSAGDFRPEVRDLTLQIVQYLYSNDAPFVV  208

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
             NIYPFLSLYGN  FP D+AFF+G+  PV DG NVY+N FD N DTLV +L K G++ M I
Sbjct  209   NIYPFLSLYGNIYFPLDFAFFDGSNKPVRDGDNVYTNVFDANFDTLVWSLKKAGFTDMKI  268

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             V+GEVGWPTDG  +AN+  A  FNQGLI H L  +GTP R G   I+VYLFSL DE  KS
Sbjct  269   VVGEVGWPTDGDKNANIENAMRFNQGLIKHCLSEQGTPARKG-KKIEVYLFSLIDENAKS  327

Query  761   ILPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPNKDLSAV  597
             I PG+FERHWG+F FDG+ KY LDL     K+        V Y+  RWCI+ P   ++  
Sbjct  328   IAPGNFERHWGMFEFDGKPKYELDLSGRMQKDKGLVAVEGVNYMHKRWCILKPENAVTDA  387

Query  596   SN------HIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGL  435
              N      +I  ACSL+DCT L YG SCN +  +GN SYAFN YYQL  QN   CDFDGL
Sbjct  388   DNAEDLPKNIDYACSLSDCTALGYGSSCNHLSTEGNASYAFNMYYQLKNQNSWDCDFDGL  447

Query  434   GLVTFLDPSVDECRF  390
              +VT  DPS D+CRF
Sbjct  448   AVVTDEDPSDDKCRF  462



>ref|XP_009421440.1| PREDICTED: glucan endo-1,3-beta-glucosidase 9-like [Musa acuminata 
subsp. malaccensis]
Length=505

 Score =   465 bits (1197),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 233/442 (53%), Positives = 316/442 (71%), Gaps = 10/442 (2%)
 Frame = -3

Query  1652  SAIGVNWGTI--AVHKLPPSTVV-DLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIP  1482
             +A+GVNWGT   A H LPPS VV  LL+ N + +VKL DADP+VL++L GSGI V +G+P
Sbjct  36    TAVGVNWGTSSSASHPLPPSVVVPGLLQANRVSRVKLPDADPSVLASLAGSGIAVAIGVP  95

Query  1481  NEMLaavsssssaADLWVAQNLTRYLVN---GGVNIKYVAVGNEPFLASYSGQFQSYVVP  1311
             NEML ++SSS SAA  WV  N+TRY+ +   G V I+++AVG+E FL SY   FQ +VV 
Sbjct  96    NEMLRSLSSSKSAAVSWVHDNVTRYVSSTGGGSVRIEFIAVGDEAFLLSYGQTFQPHVVG  155

Query  1310  AVTNVQQSLAKANLGGAVKLVVPCNADAY--ESSLPSQGAFRPELTQIMTQLVSLLNSNA  1137
             A TN+Q++L  ANL   VK++VPC++D Y  ES+LPS+G FRP+L + M +L+S L+ + 
Sbjct  156   AATNIQRALTAANLANTVKVIVPCSSDVYQSESNLPSKGHFRPDLNKTMIELLSFLDKHG  215

Query  1136  SPFVVNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGY  957
             SPFVV+I PFL+     +   D+  F+  +H + DGPN Y N FD ++DTLV+ALSK+GY
Sbjct  216   SPFVVDINPFLTFQQKKNLSLDFVLFQTNSHALSDGPNKYRNHFDMSIDTLVSALSKVGY  275

Query  956   SQMPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFD  777
             ++M I++G++GWPTDGA +A    A+ F QGL+ H+    GTPLRP  PP + Y+FSL D
Sbjct  276   AEMDIIVGKIGWPTDGAMNATPAVAQIFMQGLVDHLQSKAGTPLRPKRPPRETYIFSLLD  335

Query  776   EAGKSILPGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLS  603
             E  +SI  G++ERHWG+F+FDGQ KY +DLG G   L +A DV YL  +WC+VN NKD+S
Sbjct  336   EDQRSIKTGNYERHWGIFTFDGQAKYNVDLGQGSKALASAHDVDYLAQKWCVVNNNKDIS  395

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              VS     ACS ADC+ L  GGSC+GIG  GN+SYAFN+Y+QLH Q+  SCDF GLGL+T
Sbjct  396   NVSGSASEACSAADCSALSPGGSCSGIGWPGNVSYAFNNYFQLHDQSADSCDFGGLGLIT  455

Query  422   FLDPSVDECRFLVGVTDTNNSS  357
              +DPSV +CR+ + +  + ++S
Sbjct  456   TVDPSVGDCRYTIALRTSFSTS  477



>ref|XP_002966594.1| hypothetical protein SELMODRAFT_86140 [Selaginella moellendorffii]
 gb|EFJ32621.1| hypothetical protein SELMODRAFT_86140 [Selaginella moellendorffii]
Length=482

 Score =   464 bits (1195),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 231/433 (53%), Positives = 310/433 (72%), Gaps = 11/433 (3%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             E+A+GVN+GT++ H LPP  V  LLR NNI +VKLFDAD A++ A  G+ IEVMV IPN+
Sbjct  26    EAALGVNYGTMSSHLLPPKVVARLLRANNITRVKLFDADFAMVRAFAGTDIEVMVAIPND  85

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML  +++S+ AA+ WV +N+TR+L++GGV IKYVAVGNEPFL +Y+G F S  +PA  N+
Sbjct  86    MLEMMATSTDAAERWVKRNVTRFLIDGGVKIKYVAVGNEPFLTAYNGSFISSTLPAAVNI  145

Query  1295  QQSLAKANLGGAVKLVVPCNADAYES---SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              Q+L K  +   +K+ VP NAD   +   ++PS G FRP++  IM+QLV+ L+ N  PF 
Sbjct  146   HQALVKHKVADEIKVTVPLNADVLSNGGVNVPSAGIFRPDIQDIMSQLVAFLDQNQCPFT  205

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             +N+YPFLSL  +++FP+++AFF+G   P VDG   Y+N FD + D LV+AL K G+  + 
Sbjct  206   INLYPFLSLQQDANFPREFAFFDGALPPTVDGALSYTNVFDASYDLLVSALRKNGFGNVS  265

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN+ +A+ F +GL  HV   +GTPL P   P+DVYLFSL DE  K
Sbjct  266   ILVGEVGWPTDGDPNANMASAQRFYRGLATHV--GRGTPLSP--RPLDVYLFSLTDEDQK  321

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNG---QLKNARDVPYLPYRWCIVNPNKDLSAV  597
             SI PG+FERHWG+++FDGQ KY LDL G+G    L NA  V YLP +WC+++P  D + +
Sbjct  322   SIAPGNFERHWGIYTFDGQAKYQLDLSGSGSIASLVNAPGVDYLPRKWCVLDPAADRTRL  381

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
              +++  AC  ADCT+L YGGSCNGIG  GN SYAFNSYYQL  Q   SC FDGLG VT +
Sbjct  382   GDNVAYACMYADCTSLMYGGSCNGIGGDGNASYAFNSYYQLKGQMGNSCYFDGLGKVTDV  441

Query  416   DPSVDECRFLVGV  378
             DPS  +C+F +G+
Sbjct  442   DPSQGDCKFRIGI  454



>ref|XP_007161926.1| hypothetical protein PHAVU_001G109400g [Phaseolus vulgaris]
 gb|ESW33920.1| hypothetical protein PHAVU_001G109400g [Phaseolus vulgaris]
Length=477

 Score =   464 bits (1194),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 235/431 (55%), Positives = 298/431 (69%), Gaps = 14/431 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
               IGVNWGT A HKLPP TVV LL++N IQKVKLFDAD + +SAL G+GIEVMV IPN  
Sbjct  21    EGIGVNWGTQATHKLPPDTVVQLLKDNGIQKVKLFDADDSTMSALAGTGIEVMVAIPNIQ  80

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  ++    A   WV +N+TRY  NGGVNIKYVAVGNEPFL SY+  F +   PA+ N+Q
Sbjct  81    LLEMNDFGRAKQ-WVKKNVTRYTFNGGVNIKYVAVGNEPFLKSYNNSFLNITFPALQNIQ  139

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L  A +G  +K  VP NAD Y+S     +PS G FRP++T +MTQ+V  L+ N +PF 
Sbjct  140   NALNDAGVGDTIKATVPLNADVYQSPENNPVPSAGIFRPDITGLMTQIVQFLSKNGAPFT  199

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN DFP +YAFF+G  +PV D    Y+N FD N DTLVAAL  +G+  +P
Sbjct  200   VNIYPFLSLYGNDDFPFNYAFFDGVDNPVNDNGTPYTNVFDANFDTLVAALKSVGFGDLP  259

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPT+G  +AN+  A  F  GL+  + GN+GTP RPG   I+VYLF L DE  K
Sbjct  260   ILVGEVGWPTEGDKNANVGNALRFYNGLLPRLAGNRGTPCRPG--HIEVYLFGLIDEDAK  317

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPN-KDLS  603
             SI PG+FERHWG+F +DGQ K+P+DL +GQ +N     A++V YL  RWC+ NPN KDL+
Sbjct  318   SIAPGNFERHWGIFRYDGQPKFPMDL-SGQNQNKFLIGAQNVKYLAPRWCMFNPNAKDLT  376

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
             ++ ++I  AC+  DCT L YG SCN +   GN SYAFN Y+Q+  QNP +C+F GL  +T
Sbjct  377   SLPDNINYACTFGDCTALGYGSSCNNLDANGNASYAFNMYFQVQNQNPMACNFQGLAKIT  436

Query  422   FLDPSVDECRF  390
               + S   C F
Sbjct  437   TDNISTPTCNF  447



>ref|XP_010257791.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Nelumbo nucifera]
Length=481

 Score =   464 bits (1193),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 232/428 (54%), Positives = 294/428 (69%), Gaps = 12/428 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A H LPP  VV++LR N   KVKLF+A   +L AL+G+ IEVM+ IPN ML 
Sbjct  23    VGVNWGTMATHHLPPEMVVEMLRVNGFDKVKLFEAHEGILRALIGTDIEVMLAIPNNMLQ  82

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              +     AA+ W+ +N+T YL NGGVNIKYVAVGNEPFL SY+G F    +PA+ N+Q++
Sbjct  83    DMVDPDLAAN-WIEENVTSYLNNGGVNIKYVAVGNEPFLRSYNGTFLKVTLPALRNIQRA  141

Query  1286  LAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L  A LG  +K  VP NAD Y S     +PS G FR E+  I+ ++V  L +N +PF VN
Sbjct  142   LDDAGLGSRIKATVPFNADIYNSPASNPVPSAGDFRREIRDIVLEVVEFLYNNNAPFTVN  201

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLYG+  FP DYAFF+GT  P+ DG   Y+N FD NLDTL+ +L + GY  M I+
Sbjct  202   IYPFLSLYGDPYFPVDYAFFDGTKKPIKDGDVAYTNVFDANLDTLLWSLKRAGYPSMQIM  261

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG   AN+  A+ FNQGL+ HVL  KGTP++ G   I+VYLFSL DE  KSI
Sbjct  262   VGEVGWPTDGDKHANIKNAKRFNQGLLRHVLSGKGTPMKRG--RINVYLFSLLDENAKSI  319

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG----NGQLKNARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG+FERHWG+F FDG+ KY  DL     N  L  A +V Y P RWC++NPN  DL+ +S
Sbjct  320   APGNFERHWGIFEFDGKPKYEFDLSGHEENKGLIGAENVEYFPMRWCVMNPNADDLTELS  379

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
             ++ + ACS +DCT L YG SCN +  +GN SY+FN +YQ + Q    CDF GL +VT +D
Sbjct  380   SNFQYACSFSDCTALGYGSSCNHLDVRGNASYSFNMFYQWNNQRNWDCDFSGLAVVTDVD  439

Query  413   PSVDECRF  390
             PSV ECRF
Sbjct  440   PSVGECRF  447



>ref|XP_004498612.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Cicer arietinum]
Length=481

 Score =   464 bits (1193),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 228/429 (53%), Positives = 311/429 (72%), Gaps = 8/429 (2%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             IGVNWGT + H LPPSTVV +L++N IQKVKLFDADP +L+AL  SGI+VMVGIPN++L 
Sbjct  31    IGVNWGTQSTHPLPPSTVVKMLKDNGIQKVKLFDADPDILNALKKSGIQVMVGIPNDLLY  90

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              +++S  AA+ WV++N++ ++ +GGV+I+YVAVGNEPFL++Y+G F++  +PA+ N+Q +
Sbjct  91    TMANSLQAAEKWVSKNVSAHVSSGGVDIRYVAVGNEPFLSTYNGTFEATTLPALKNIQSA  150

Query  1286  LAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIY  1113
             L KA LG +V++ VP NAD Y+SS   PS G FR ++  +M Q+V  L+ N +PF VNIY
Sbjct  151   LVKAGLGNSVRVTVPLNADVYQSSSDKPSDGDFRTDIHDLMLQIVKFLSQNNAPFAVNIY  210

Query  1112  PFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIG  933
             PF+SLY + +FP DYAFF G   P+ D  N+Y N FD N DTLV AL K G+  +PI++G
Sbjct  211   PFISLYADPNFPVDYAFFNGFGSPLTDNGNIYDNVFDANYDTLVWALQKNGFGNLPIIVG  270

Query  932   EVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILP  753
             E+GWPTDG  +AN+  A+ FNQG +   +  KGTP+RPG  PID YLFSL DE  KSI P
Sbjct  271   EIGWPTDGDRNANVLLAQRFNQGFMSRFVAGKGTPMRPG--PIDAYLFSLVDEDDKSIQP  328

Query  752   GDFERHWGVFSFDGQLKYPLDLG--NGQLKNARDVPYLPYRWCIVNPNKDLSA--VSNHI  585
             G+FERHWG+F FDG+ KY L+LG  +  L  A  V +LP +WCI+ P+ +L++  ++  +
Sbjct  329   GNFERHWGLFYFDGRPKYQLNLGLRSSGLVGATGVAHLPKKWCILKPSANLNSDQLAESV  388

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
               AC  ADCT+L YG SC+G+  +GNISYAFNSYYQ++ Q   +C F GL +VT  DPS 
Sbjct  389   SYACQNADCTSLGYGTSCSGLDVRGNISYAFNSYYQVNDQIDSACKFPGLSVVTDKDPST  448

Query  404   DECRFLVGV  378
              +C F + +
Sbjct  449   PDCIFKIMI  457



>ref|XP_002969872.1| hypothetical protein SELMODRAFT_171231 [Selaginella moellendorffii]
 gb|EFJ28996.1| hypothetical protein SELMODRAFT_171231 [Selaginella moellendorffii]
Length=496

 Score =   464 bits (1194),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 236/441 (54%), Positives = 302/441 (68%), Gaps = 13/441 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMG-SGIEVMVGIPNEML  1470
             +GVNWGT   H LP  TVV +LR NN+ +VKLFDADP  L AL   S  EVMVGIPNEML
Sbjct  35    VGVNWGTQLSHPLPGDTVVQMLRSNNVTRVKLFDADPNALRALTKDSSFEVMVGIPNEML  94

Query  1469  aavsssssaADLWVAQNLTRYLV-NGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
               ++ SS AADLWV+QN++RY+      NI+YVAVGNEPFL +Y+  F+   +PA+ N+Q
Sbjct  95    QRLAQSSQAADLWVSQNVSRYVSGRRRANIRYVAVGNEPFLTAYNRSFEGVTLPALQNIQ  154

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS---LPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
              +LA+A L   +K  VP NAD   +S    PS G FRPE   ++  +V  L+   +PFV+
Sbjct  155   GALARAGLDSQIKATVPLNADVLANSRPPFPSGGIFRPESQALVVSIVQFLSQTGAPFVI  214

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
             NIYPF+SL+G+ +FP ++AFFEG A+ +VDG N Y+N FD + D LVAAL+  GY+ M I
Sbjct  215   NIYPFISLHGDPNFPINFAFFEGAANSIVDGSNTYTNVFDASYDLLVAALNAAGYANMAI  274

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             ++GEVGWPTDG  +AN+  AR FNQGL+ HVL N+GTPLRPG  PI  YLF L DE  KS
Sbjct  275   IVGEVGWPTDGDPNANVENARRFNQGLLQHVLSNRGTPLRPG-SPIHFYLFGLIDEDQKS  333

Query  761   ILPGDFERHWGVFSFDGQLKYPLDL-----GNGQLKNARDVPYLPYRWCIVNPNKDLSAV  597
             I PG+FERHWGVF++DGQ KY LD+      N +L NA+ V YLP RWC++ P   +SA 
Sbjct  334   IAPGNFERHWGVFTYDGQAKYFLDMSGRGVANARLVNAQGVQYLPRRWCVLRPGVAVSA-  392

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
              N I  AC+ ADCT L YGGSCN +  + N SYA+N+YYQ   Q P SCDF G  +VT  
Sbjct  393   -NSISFACANADCTALSYGGSCNFLTAQENASYAYNNYYQKTNQLPTSCDFQGQAVVTTT  451

Query  416   DPSVDECRFLVGVTDTNNSSG  354
             DPS+  CRF+  +   ++S+ 
Sbjct  452   DPSIQPCRFIRQIIPPDDSAA  472



>gb|AAO37977.1| putative beta-1,3 glucanase [Oryza sativa Japonica Group]
 gb|ABF99303.1| Glucan endo-1,3-beta-glucosidase 5 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY92146.1| hypothetical protein OsI_13858 [Oryza sativa Indica Group]
 gb|EAZ28873.1| hypothetical protein OsJ_12912 [Oryza sativa Japonica Group]
 dbj|BAH01366.1| unnamed protein product [Oryza sativa Japonica Group]
Length=491

 Score =   464 bits (1194),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 234/438 (53%), Positives = 298/438 (68%), Gaps = 11/438 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
              A+G+NWGT A H LPP  V  LL++N I+KVKLFDAD   LSAL G+GIEVMV IPN M
Sbjct  32    EALGMNWGTQASHPLPPKIVAQLLQDNGIKKVKLFDADQDTLSALAGTGIEVMVAIPNVM  91

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L +++   +A + WV +N++RY  +GGV IKYVAVGNEPFLA+Y+G F    +PA+ N+Q
Sbjct  92    LDSITDYDTAKE-WVRRNVSRYNFDGGVTIKYVAVGNEPFLAAYNGTFDKVTLPALMNIQ  150

Query  1292  QSLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L  A LG ++K  VP NAD Y+S     +PS G FR ++  +MTQ+V  L +N++PF 
Sbjct  151   NALNDAGLGDSIKATVPLNADVYDSPQDQQVPSAGRFRADIADLMTQMVQFLANNSAPFT  210

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPF+SLY N DFP D+AFF+G A PVVD    Y+N FD N DTLVAAL  +G+  MP
Sbjct  211   VNIYPFISLYLNDDFPVDFAFFDGGATPVVDNGISYTNVFDANFDTLVAALKGVGHGDMP  270

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             IV+GEVGWPTDG   A  T A+ F  GL+  +  N GTP RPG   I+VYLF L DE  K
Sbjct  271   IVVGEVGWPTDGDKHATATYAQRFYNGLLKRLAANAGTPARPG-QYIEVYLFGLLDEDAK  329

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSA  600
             S+ PGDFERHWG+  FDGQ KYP+DL G GQ   L  A+ V YLP  WC++N N KD S 
Sbjct  330   SVAPGDFERHWGILRFDGQPKYPVDLTGQGQNTMLVPAKGVTYLPRTWCVINTNAKDTSK  389

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++++I  AC+ ADCT L YG +C G+   GN SYAFN+Y+Q+  Q   +CDF GL + T 
Sbjct  390   LADNINFACTFADCTALGYGSTCAGMDANGNASYAFNAYFQVQNQKDDACDFQGLAMPTQ  449

Query  419   LDPSVDECRFLVGVTDTN  366
              DPS   C F + +  T+
Sbjct  450   TDPSTPACNFTIQIAATS  467



>ref|XP_004493147.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cicer arietinum]
Length=477

 Score =   463 bits (1192),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 235/439 (54%), Positives = 303/439 (69%), Gaps = 12/439 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT A H+LPP TVV +L++N IQKVKLFDAD   +SAL GSGIEVMV IPN  LA
Sbjct  23    LGVNWGTQATHQLPPETVVQMLKDNGIQKVKLFDADDNTMSALAGSGIEVMVAIPNNQLA  82

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              ++    A   WV +N+TRY  +GGVNIKYVAVGNEPFL SY+  F +  +PA+ N+Q +
Sbjct  83    VMNDYKRAQQ-WVKKNVTRYNFHGGVNIKYVAVGNEPFLKSYNNSFLNITLPALQNIQNA  141

Query  1286  LAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             + +A LG  VK  VP NAD Y+S     LPS G FRP+++ +MT++V  LN N++PF VN
Sbjct  142   INEAGLGDTVKATVPLNADVYQSPEDNPLPSAGTFRPDISGLMTEMVQFLNKNSAPFTVN  201

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLYGN DFP +YAFF+G   P++D    Y+N FD N DTLV+AL  +G+   PI+
Sbjct  202   IYPFLSLYGNDDFPFNYAFFDGVDAPIMDNGIQYTNVFDANFDTLVSALKSVGFGDTPIL  261

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPT+G  +AN   A  F  GL+  +  NKGTP RPG   I+VYLF L DE  KSI
Sbjct  262   VGEVGWPTEGDKNANAGNALRFYNGLLSRLAANKGTPRRPGF--IEVYLFGLIDEDAKSI  319

Query  758   LPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG+FERHWG+F +DGQ K+P+DL G GQ   L  A++V YL   WC+VNP+ KDLS ++
Sbjct  320   APGNFERHWGIFRYDGQPKFPMDLTGQGQNKFLIGAQNVKYLSPTWCMVNPDAKDLSKLA  379

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
             +++  AC+  DCT L YG SCN +   GN SYAFN YYQ+  QN Q+C+F GL  +T  +
Sbjct  380   DNLNFACAYGDCTALGYGSSCNNLDAIGNASYAFNMYYQVQNQNRQACNFQGLAKLTTDN  439

Query  413   PSVDECRFLVGVTDTNNSS  357
              S   C F + +  ++ SS
Sbjct  440   ISTPTCNFTIQIAPSSASS  458



>gb|KEH32093.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=521

 Score =   464 bits (1193),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 230/433 (53%), Positives = 297/433 (69%), Gaps = 11/433 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A H+LPP  VV +L+EN   K+KLFDAD  V++AL+G+ IEVM+ IPN ML 
Sbjct  31    VGVNWGTMATHQLPPKNVVKMLQENGFDKLKLFDADEWVMAALLGTDIEVMLAIPNNMLE  90

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              +S     AD WV +N+T YL  GG+NIKY+AVGNEPFL  Y+G +  Y +PA+ N+Q S
Sbjct  91    EISKDPKVADSWVYENVTSYLYPGGLNIKYIAVGNEPFLKEYNGTYLMYTLPALKNIQTS  150

Query  1286  LAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L  A LG ++K  VP NADAY S     +PS G FRPE+  +  ++++ L +N +PF VN
Sbjct  151   LNNAGLGSSIKATVPFNADAYYSPDSNLVPSAGDFRPEVRDLTIEIINYLYTNNAPFTVN  210

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLYGN  FP D+AFF+G   P+VDG  +Y+N FD NLDTL+ AL K GY  M ++
Sbjct  211   IYPFLSLYGNDHFPFDFAFFDGNNKPLVDGNLLYTNVFDANLDTLLYALEKAGYPDMHVI  270

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGEVGWPTDG  +AN+  A+ FN GL+ H L   GTP R G+  ID+YLFSL DE  KSI
Sbjct  271   IGEVGWPTDGDKNANIQNAKRFNNGLLKHCLSGNGTPKRKGI--IDIYLFSLIDENAKSI  328

Query  758   LPGDFERHWGVFSFDGQLKYPLDL----GNGQLKNARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG+FERHWG+F FDG+ KY LDL    G+  L     V Y+  +WCI++P+  DL  ++
Sbjct  329   APGNFERHWGIFEFDGKPKYELDLKGFQGDEGLVAVEGVKYMEKQWCILDPDISDLHYLA  388

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               I  ACSL+DCT L YG SCNG+  +GN SYAFN YYQ+H Q    CDF GL +++  D
Sbjct  389   GSIDYACSLSDCTALGYGSSCNGLSLEGNASYAFNMYYQVHNQKDWDCDFSGLAILSDQD  448

Query  413   PSVDECRFLVGVT  375
             PS   C+F V ++
Sbjct  449   PSEKGCQFPVMIS  461



>ref|XP_002970359.1| hypothetical protein SELMODRAFT_231628 [Selaginella moellendorffii]
 gb|EFJ28489.1| hypothetical protein SELMODRAFT_231628 [Selaginella moellendorffii]
Length=469

 Score =   462 bits (1188),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 224/440 (51%), Positives = 311/440 (71%), Gaps = 16/440 (4%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             ++GVNWGT+  H+LP   +V LL+E+ I KVKLFDADP+V+ A  G+ +E+MV +PN++L
Sbjct  6     SVGVNWGTVTSHRLPDKMIVKLLQESRISKVKLFDADPSVIRAFAGTDLELMVAVPNDLL  65

Query  1469  aavsssssaADLWVAQNLTRYLVN-GGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
               ++ S  AA  +V +N+T++L +  GVNI+Y+AVGNEPFL +Y+G ++   +PA+ N+Q
Sbjct  66    EDMAFSEKAARRFVRRNITKFLSHQDGVNIRYIAVGNEPFLKAYNGSYEDVTIPAIRNMQ  125

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             Q++ +A +   V LVVP NAD   +S     PSQGA RP++ ++M  ++  L+ + +PFV
Sbjct  126   QAIEQAGIQHKVTLVVPLNADILTNSGNSGKPSQGAIRPDIRRLMRTILEFLDKHKAPFV  185

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             +N+YPFLSL  +S FP D+AFF+G+AH + DG N YSN FD + D LV+AL++ G+  M 
Sbjct  186   INMYPFLSLQQDSHFPSDFAFFDGSAHVLSDGRNFYSNVFDASYDLLVSALAREGFPDME  245

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             IV+GEVGWPTDG   AN+  A+ FNQ LI HV  N+GTPLRPG+ PI++Y+F L DE  K
Sbjct  246   IVVGEVGWPTDGDIYANIPNAQRFNQQLIRHVTSNRGTPLRPGI-PIEIYIFGLVDEDRK  304

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL----GNG-----QLKNARDVPYLPYRWCIVNPN-  615
             S+LPG+FERHWG++ +DG+ KY LD+    GNG      L +   V YLP RWC++NP  
Sbjct  305   SVLPGNFERHWGLYRYDGKPKYSLDVSGRGGNGLSSPINLMSVSGVTYLPSRWCVLNPEV  364

Query  614   KDLSAVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGL  435
              DLS +   I  ACS ADC+TL YGGSCN IG+ GN SYAFNS+YQ++ Q  +SC F GL
Sbjct  365   DDLSKLPATISYACSYADCSTLAYGGSCNHIGQTGNASYAFNSFYQMNNQRTESCHFGGL  424

Query  434   GLVTFLDPSVDECRFLVGVT  375
             G++T  DPS   C+F V +T
Sbjct  425   GMITETDPSSGNCQFRVEIT  444



>gb|KEH39797.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=476

 Score =   462 bits (1188),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 232/440 (53%), Positives = 312/440 (71%), Gaps = 11/440 (3%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
              IGVNWGT + H LPPSTVV +L++N IQKVKLFDADP +L AL  SGI+VMVGIPN++L
Sbjct  25    GIGVNWGTQSTHPLPPSTVVKMLKDNGIQKVKLFDADPNILDALKKSGIQVMVGIPNDLL  84

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
               +++S  AA+ WVA+N++ ++ +GGV+I+Y+AVGNEPFL++Y+G F++  +PA+ N+Q 
Sbjct  85    YTMANSRQAAEKWVAKNVSAHVSSGGVDIRYIAVGNEPFLSTYNGTFEATTLPALVNIQN  144

Query  1289  SLAKANLGGAVKLVVPCNADAYESSL--PSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             +L KA LG ++K+ VP NAD Y+SS   PS G FR ++  +M Q+V  L+ N +PF VNI
Sbjct  145   ALIKAGLGSSIKVTVPSNADVYQSSSGNPSDGDFRTDIHDLMVQIVKFLSQNNAPFTVNI  204

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPF+SLY + +FP DYAFF G + P+ D   +Y N FD N DTLV AL+K G+  MPI++
Sbjct  205   YPFISLYEDPNFPVDYAFFNGFSDPLNDNGKIYDNVFDANYDTLVWALNKNGFGNMPIIV  264

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDG  + NL  A+ FNQG +   +  KGTPLRPG  P+D YLFSL DE  KSI 
Sbjct  265   GEIGWPTDGDRNGNLQLAQRFNQGFMTRFIAGKGTPLRPG--PMDAYLFSLVDEDNKSIQ  322

Query  755   PGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLSA--VSN  591
             PG+FERHWG+F +DG+ KY L +G   NG L  A  V +LP +WCI+ P+ +L++  V+ 
Sbjct  323   PGNFERHWGLFYYDGRPKYQLTIGSRTNG-LVGATGVAHLPKKWCILKPSANLNSDQVAP  381

Query  590   HIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDP  411
              +  AC  ADCT+L YG SC G+  +GNISYAFNSYYQ++ Q   +C F GL  VT  DP
Sbjct  382   SVSYACQNADCTSLGYGTSCGGLDIRGNISYAFNSYYQVNDQVDGACKFPGLSTVTDRDP  441

Query  410   SVDECRFLVGV-TDTNNSSG  354
             S  +C F + + TD+    G
Sbjct  442   STQDCTFQIMIQTDSARKIG  461



>ref|XP_011097609.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Sesamum indicum]
Length=548

 Score =   464 bits (1195),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 240/426 (56%), Positives = 299/426 (70%), Gaps = 10/426 (2%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             IG NWG+ + H+LPP  VV +LREN IQKVKLFDAD   L AL GSGIEVMVGIPN+MLA
Sbjct  90    IGANWGSQSSHRLPPDKVVRMLRENGIQKVKLFDADYDTLKALGGSGIEVMVGIPNDMLA  149

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
               +SSS AA+ WV+QN++ +L +  V I+YVAVGNEPFL +Y+G F     PA+ NVQ +
Sbjct  150   NFASSSKAAEKWVSQNVSHHLTSN-VLIRYVAVGNEPFLETYNGSFLRTTFPALKNVQDA  208

Query  1286  LAKANLGGAVKLVVPCNADAYE--SSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIY  1113
             L KA L   VK+ VP NAD Y   S LPS G FR ++   M  +V LL+ NA+PF VNIY
Sbjct  209   LTKAGLRNQVKVTVPLNADVYTTASGLPSGGDFRADIHDFMIPIVKLLSDNAAPFTVNIY  268

Query  1112  PFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIG  933
             PF+SLY +S+FP +YAFF+G A PV DG   Y N FD N DTLV AL K G+  +PI++G
Sbjct  269   PFISLYTDSNFPVEYAFFDGNATPVNDGGTSYYNMFDANHDTLVWALQKNGFGNLPIIVG  328

Query  932   EVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILP  753
             E+GWPTDG  +AN+  A+ FNQG + H+ G KGTP+RPG  PI+ YLFSL DE  KSI P
Sbjct  329   EIGWPTDGDKNANVEYAQRFNQGFMTHISGGKGTPMRPG--PINAYLFSLIDEDQKSIQP  386

Query  752   GDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDL--SAVSNH  588
             G+FERHWG+F +DGQ KY L+LG   +G L  AR+V YL  +WCI+ PN  L  S V+  
Sbjct  387   GNFERHWGIFRYDGQPKYGLNLGTTSSGTLVPARNVSYLDSKWCIMKPNARLDDSQVAPS  446

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
             +  AC LADCT L Y  SC+ +  +GNISYAFNSYYQ + Q  ++C F+GLG +T  DP+
Sbjct  447   VSYACGLADCTALGYQTSCSNLDARGNISYAFNSYYQQNNQLDEACKFNGLGTITRADPT  506

Query  407   VDECRF  390
                CRF
Sbjct  507   TGTCRF  512



>gb|EYU24023.1| hypothetical protein MIMGU_mgv1a004416mg [Erythranthe guttata]
Length=528

 Score =   464 bits (1193),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 234/429 (55%), Positives = 300/429 (70%), Gaps = 8/429 (2%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             IG NWG+ + H+LPP  VV +LREN IQKVKLFDAD   L AL  SGI+VMVGIPN+ML+
Sbjct  72    IGANWGSQSTHRLPPEIVVRMLRENGIQKVKLFDADYDTLKALGKSGIQVMVGIPNDMLS  131

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
               +SSS AA+ WV+QN++ +L    V I+YVAVGNEPFLA+Y+G F     PA+ N+Q++
Sbjct  132   TFASSSKAAEKWVSQNVSHHLTTNNVLIRYVAVGNEPFLATYNGTFLRTTYPALENIQKA  191

Query  1286  LAKANLGGAVKLVVPCNADAYE--SSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIY  1113
             L KA L   VK+ VP NAD YE  S+LPS G FR ++   M ++V LL+ N +PF +NIY
Sbjct  192   LTKAGLQNQVKVTVPLNADVYESASTLPSGGDFRADIHDNMIRIVKLLSDNEAPFTINIY  251

Query  1112  PFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIG  933
             PF+SLY + +FP +YAFF+G A P+ DG   Y N FD N DTLV AL K G++ +PIVIG
Sbjct  252   PFISLYIDPNFPVEYAFFDGGATPLNDGGTSYYNMFDANHDTLVWALQKNGFANLPIVIG  311

Query  932   EVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILP  753
             E+GWPTDG  +AN+  A+ FNQG++  +   +GTP+RPG  PID YLFSL DE  KSI P
Sbjct  312   EIGWPTDGDRNANIDYAQRFNQGVMARITAGRGTPMRPG--PIDAYLFSLIDEDDKSIQP  369

Query  752   GDFERHWGVFSFDGQLKYPLDLG--NGQLKNARDVPYLPYRWCIVNPNK--DLSAVSNHI  585
             G+FERHWGVF FDGQ KY L+LG   G L  A++V YL  +WCI+ PN   D + ++  +
Sbjct  370   GNFERHWGVFRFDGQPKYSLNLGGPTGALVPAKNVSYLEKKWCIMKPNARVDDAQLAASV  429

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
               AC   DCT L YG SC G+  +GNISYAFNSYYQ + Q  ++C FDGLG +T  DP+V
Sbjct  430   SYACGRGDCTCLGYGTSCGGLDARGNISYAFNSYYQKNNQMDEACKFDGLGTITRADPTV  489

Query  404   DECRFLVGV  378
               C F + +
Sbjct  490   GSCVFEIAI  498



>emb|CDP18694.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   462 bits (1188),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 237/436 (54%), Positives = 299/436 (69%), Gaps = 14/436 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT A HKLPP  VV +L++N I KVKLFDAD + +SAL GS IEVMV IPN+ L 
Sbjct  28    LGVNWGTQATHKLPPKVVVQMLKDNGITKVKLFDADASTMSALAGSNIEVMVAIPNDQLL  87

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              ++    A + WV +N+T YL NGGVNIKYVAVGNEPFLASY+  F +   PA+ N+Q +
Sbjct  88    VMNDYDRAKN-WVKRNVTVYLFNGGVNIKYVAVGNEPFLASYNNSFVNTTFPALQNIQNA  146

Query  1286  LAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L  A  G  +K  VP NAD Y S     +PS G FR +++  MTQ+V  LN N +PF VN
Sbjct  147   LNDAGHGDTIKATVPLNADVYFSPEGNPVPSAGRFRADISSQMTQIVQFLNQNNAPFTVN  206

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY NS FP DYAFF+G A+P+VD    Y+N FD N DTLV+AL  LGY  M I+
Sbjct  207   IYPFLSLYLNSHFPVDYAFFDGAANPIVDDGVQYTNVFDANFDTLVSALKGLGYGSMNIL  266

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +AN+  A  F +GL+  +  NKGTPLRPG   I+VYLF L DE  KS+
Sbjct  267   VGEVGWPTDGDRNANVNYAIRFYRGLLPRLAANKGTPLRPGY--IEVYLFGLLDEDLKSV  324

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPN-KDLSAV  597
              PG+FERHWG+F +DGQ K+P+DL +GQL++     A++V YLP +WC  NPN KDLS +
Sbjct  325   APGNFERHWGIFRYDGQPKFPMDL-SGQLQDKYLVGAQNVQYLPAKWCQFNPNAKDLSKL  383

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
             + +I  AC+ ADCT L YG SCNG+   GN SYAFN Y+Q+  Q   SC+F GL +VT  
Sbjct  384   AENINYACTFADCTALGYGSSCNGLDSNGNASYAFNMYFQVQNQGDLSCNFQGLAMVTEQ  443

Query  416   DPSVDECRFLVGVTDT  369
             + S   C F + +  +
Sbjct  444   NISQANCNFTIQIATS  459



>gb|EYU24024.1| hypothetical protein MIMGU_mgv1a004416mg [Erythranthe guttata]
Length=527

 Score =   463 bits (1192),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 234/429 (55%), Positives = 300/429 (70%), Gaps = 8/429 (2%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             IG NWG+ + H+LPP  VV +LREN IQKVKLFDAD   L AL  SGI+VMVGIPN+ML+
Sbjct  71    IGANWGSQSTHRLPPEIVVRMLRENGIQKVKLFDADYDTLKALGKSGIQVMVGIPNDMLS  130

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
               +SSS AA+ WV+QN++ +L    V I+YVAVGNEPFLA+Y+G F     PA+ N+Q++
Sbjct  131   TFASSSKAAEKWVSQNVSHHLTTNNVLIRYVAVGNEPFLATYNGTFLRTTYPALENIQKA  190

Query  1286  LAKANLGGAVKLVVPCNADAYE--SSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIY  1113
             L KA L   VK+ VP NAD YE  S+LPS G FR ++   M ++V LL+ N +PF +NIY
Sbjct  191   LTKAGLQNQVKVTVPLNADVYESASTLPSGGDFRADIHDNMIRIVKLLSDNEAPFTINIY  250

Query  1112  PFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIG  933
             PF+SLY + +FP +YAFF+G A P+ DG   Y N FD N DTLV AL K G++ +PIVIG
Sbjct  251   PFISLYIDPNFPVEYAFFDGGATPLNDGGTSYYNMFDANHDTLVWALQKNGFANLPIVIG  310

Query  932   EVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILP  753
             E+GWPTDG  +AN+  A+ FNQG++  +   +GTP+RPG  PID YLFSL DE  KSI P
Sbjct  311   EIGWPTDGDRNANIDYAQRFNQGVMARITAGRGTPMRPG--PIDAYLFSLIDEDDKSIQP  368

Query  752   GDFERHWGVFSFDGQLKYPLDLG--NGQLKNARDVPYLPYRWCIVNPNK--DLSAVSNHI  585
             G+FERHWGVF FDGQ KY L+LG   G L  A++V YL  +WCI+ PN   D + ++  +
Sbjct  369   GNFERHWGVFRFDGQPKYSLNLGGPTGALVPAKNVSYLEKKWCIMKPNARVDDAQLAASV  428

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
               AC   DCT L YG SC G+  +GNISYAFNSYYQ + Q  ++C FDGLG +T  DP+V
Sbjct  429   SYACGRGDCTCLGYGTSCGGLDARGNISYAFNSYYQKNNQMDEACKFDGLGTITRADPTV  488

Query  404   DECRFLVGV  378
               C F + +
Sbjct  489   GSCVFEIAI  497



>gb|KHN32753.1| Glucan endo-1,3-beta-glucosidase 8 [Glycine soja]
Length=466

 Score =   461 bits (1185),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 237/441 (54%), Positives = 306/441 (69%), Gaps = 12/441 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
               +GVNWGT A H+L   TVV++L++N IQKVKLFDAD + +SAL GSGIEVMV IPN  
Sbjct  9     EGLGVNWGTQATHQLKADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIEVMVAIPNNQ  68

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA ++    A   WV +N+TRY   GG+NIKYVAVGNEPFL SY+G F +  +PA+ N+Q
Sbjct  69    LAEMNDYDRALQ-WVKKNVTRYNFRGGINIKYVAVGNEPFLKSYNGSFLNITLPALQNIQ  127

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L  A LG ++K  VP NAD YES     +PS G FRP+++ +MTQ+V  L  N +PF 
Sbjct  128   NALNDAGLGDSIKATVPLNADVYESPPNNPVPSAGIFRPDISDLMTQIVQFLAKNNAPFT  187

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN +FP DYAFF+G A+P+ D    Y+N FD N DTLV+AL K+GY  MP
Sbjct  188   VNIYPFLSLYGNDNFPFDYAFFDGVANPINDNGVSYTNVFDANFDTLVSALEKVGYGNMP  247

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN+  A  F  GL+  +  NKGTPLRPG   I+VYLF L DE  K
Sbjct  248   ILVGEVGWPTDGDKNANVGNAFRFYNGLLPRLAINKGTPLRPGF--IEVYLFGLIDEDAK  305

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSA  600
             +I PG+FERHWG+F +DG+ K+P+DL G GQ   L  A++V YL   WC+ NP+ +DLS 
Sbjct  306   TIAPGNFERHWGIFGYDGKPKFPMDLSGKGQNKLLVGAQNVHYLEPNWCMFNPDAQDLSK  365

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++++I  AC+ ADCT L YG SCN +   GN SYAFN YYQ   QN  +C+F+GL  +T 
Sbjct  366   LADNINYACTFADCTALGYGSSCNNLDANGNASYAFNMYYQTQDQNYMACNFEGLARLTT  425

Query  419   LDPSVDECRFLVGVTDTNNSS  357
              + S   C F+V +  + +SS
Sbjct  426   SNISTPTCNFIVQINPSLSSS  446



>ref|XP_006843517.1| hypothetical protein AMTR_s00007p00020870 [Amborella trichopoda]
 gb|ERN05192.1| hypothetical protein AMTR_s00007p00020870 [Amborella trichopoda]
Length=479

 Score =   461 bits (1186),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 233/433 (54%), Positives = 303/433 (70%), Gaps = 7/433 (2%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWG+++ + LPP+ VV++L  NN+ KVKL DADP  L AL G+GI VMVGIPN ML 
Sbjct  20    VGVNWGSLSSNPLPPAIVVNVLLANNVSKVKLDDADPLALEALSGTGIRVMVGIPNSMLK  79

Query  1466  avsssssaADLWVAQNLTRYLVN-GGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
             A++SS  AA  WV  N+TRY    GGV I+ +A+G+EPFL  Y GQFQ YVV A  N+Q 
Sbjct  80    ALNSSKLAASAWVHDNITRYQSKTGGVIIESIAIGDEPFLHIYKGQFQPYVVGAAINIQL  139

Query  1289  SLAKANLGGAVKLVVPCNADAY---ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             +L KA L   VK+VVPCNADAY    S LPS+G FRP+L   M QL+S L+ N SPFV+N
Sbjct  140   ALVKARLETRVKVVVPCNADAYLSNPSGLPSEGHFRPDLNSTMLQLLSFLSKNRSPFVIN  199

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             +YPFL++Y N  FP DYA F  ++H + DG + Y N  D ++DTL+ ALS LG+ +M ++
Sbjct  200   LYPFLNVYQNKSFPIDYAIFRPSSHHLKDGKSTYGNYLDQSIDTLITALSNLGFGKMEVL  259

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPI-DVYLFSLFDEAGKS  762
             IG++GWPTDG+ +A    ARAF QGL  H+    GTPLRP    + + Y+ SL DE  + 
Sbjct  260   IGKIGWPTDGSRNATSANARAFLQGLKDHLKSKSGTPLRPNRTIVEEFYILSLLDENERK  319

Query  761   ILPGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNH  588
             ++ G FERHWGVF+FDGQ KY +DLG G   L N++ V Y+  +WC+VN NKD+S VS  
Sbjct  320   LINGGFERHWGVFTFDGQAKYQVDLGQGSRDLVNSKGVEYMSLKWCVVNNNKDISNVSAK  379

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
             ++ AC+ ADCT L  GGSC G+G  GN SYAFNSYYQ   Q  + C+FDGLGL+T +DPS
Sbjct  380   VQEACAEADCTALLDGGSCFGLGWPGNASYAFNSYYQAWNQTSEGCNFDGLGLITTVDPS  439

Query  407   VDECRFLVGVTDT  369
             V +CRF VG+ ++
Sbjct  440   VGQCRFPVGLNES  452



>ref|XP_008386810.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=488

 Score =   461 bits (1186),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 238/441 (54%), Positives = 309/441 (70%), Gaps = 16/441 (4%)
 Frame = -3

Query  1637  NWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLaavs  1458
             NWGT+A H+LPP TV+ +L++N I KVKLFDAD + +SAL GSG+EVMV IPN+ LA ++
Sbjct  29    NWGTMATHELPPDTVIQILKDNGIPKVKLFDADESTMSALTGSGLEVMVAIPNDQLAVMT  88

Query  1457  ssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQSLAK  1278
             S   A + WV +N+TRY  NGGVNIKYVAVGNEPFL+SY+G F +   PA+ N+Q +L +
Sbjct  89    SYKRAKE-WVRRNVTRYNFNGGVNIKYVAVGNEPFLSSYNGSFLNVTFPALQNIQNALNE  147

Query  1277  ANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIYP  1110
             A +G +VK  VP NAD Y+S     +PS G FR ++ Q+MT++V  L+ N +PF +NIYP
Sbjct  148   AGVGDSVKATVPLNADVYDSPVDNPVPSAGRFRTDILQLMTEIVQFLDKNKAPFTINIYP  207

Query  1109  FLSLYGNSDFPQDYAFFEGTAHPVVD-GPNV-YSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             FLSLYGN  FP +YAFF+G   P+VD G  + Y+N FD N DTLV++L  +G+  MPIV+
Sbjct  208   FLSLYGNDGFPFNYAFFDGDTTPIVDTGTGIQYTNVFDANFDTLVSSLKAVGFGNMPIVV  267

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDG  +AN+  A  F  GL+  +  NKGTPLR G   I+VYLF L DE  KSI 
Sbjct  268   GEVGWPTDGDKNANVGNAFRFYNGLLTRLGTNKGTPLRTGY--IEVYLFGLIDEDAKSIA  325

Query  755   PGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSAVSN  591
             PG FERHWG+FS+DGQ K+P+DL G GQ   L  A++V YL  +WC+ NPN KD+S +++
Sbjct  326   PGSFERHWGIFSYDGQPKFPVDLSGQGQNKLLVPAKNVLYLSKKWCMXNPNAKDVSNLAD  385

Query  590   HIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDP  411
              I  AC+ ADCT L+YG SCN +   GN SYAFN YYQ+  Q+ QSC F GL  +T  + 
Sbjct  386   KINYACTYADCTALEYGSSCNNLDANGNASYAFNMYYQVQDQDDQSCSFQGLATLTTQNI  445

Query  410   SVDECRFLVGVTDTNNSSGFS  348
             S   C F++ +  T  SS FS
Sbjct  446   SQGNCNFIIQMATT--SSAFS  464



>ref|XP_011078347.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Sesamum indicum]
Length=494

 Score =   461 bits (1187),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 235/440 (53%), Positives = 296/440 (67%), Gaps = 12/440 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S++GVNWGT+A H+LP   VVD+L++N   KVKLF+AD  +L AL G+ IEVM+ +PN M
Sbjct  30    SSVGVNWGTMASHQLPARNVVDMLKDNGFDKVKLFEADEGILEALCGTDIEVMLAVPNYM  89

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  +S    AA  WV  NLT Y   GGVNI+YVAVGNEPFL +Y+G +  + +PA+ N+Q
Sbjct  90    LEEMSLDPGAAASWVEANLTAYAYPGGVNIRYVAVGNEPFLKTYNGTYLQHTLPALRNIQ  149

Query  1292  QSLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             +++ +A LG  +K +VP NAD Y S     +PS G FRPE+  +  Q+V  L SNA+PFV
Sbjct  150   EAINRAGLGSEIKAIVPFNADIYYSPESNQVPSAGDFRPEIRDLTVQIVQYLYSNAAPFV  209

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLY N+ FP D+AFF+G+  P  DG  VY+N FD N DTLV AL+K GY  + 
Sbjct  210   VNIYPFLSLYQNTYFPLDFAFFDGSNRPFRDGNYVYTNVFDANFDTLVWALTKAGYPDIK  269

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG   AN+  A+ FNQGL+ H L  +GTP R G   IDVYLFSL DE  K
Sbjct  270   IIVGEVGWPTDGDKHANIENAKRFNQGLVRHALSGEGTPARKG--EIDVYLFSLVDENAK  327

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL----GNGQLKNARDVPYLPYRWCIVNPN-KDL-S  603
             SI PG FERHWG+F FDG+ KY LDL     N  L   + V Y+  RWCI+NP+ KD   
Sbjct  328   SIDPGSFERHWGIFEFDGKPKYELDLSGVQANKGLVAVQGVRYMVRRWCILNPHVKDTDQ  387

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              +  +I  ACSL+DCT+L YG SCN +  +GN SYAFN YYQ   QN   CDF GL ++T
Sbjct  388   ELRGNIDYACSLSDCTSLGYGSSCNHLSVRGNASYAFNMYYQFRNQNEWDCDFSGLAMIT  447

Query  422   FLDPSVDECRFLVGVTDTNN  363
               DPS D C F V +   N+
Sbjct  448   EKDPSDDRCHFPVMIAYGNS  467



>ref|XP_009786014.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
sylvestris]
Length=474

 Score =   461 bits (1185),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 233/432 (54%), Positives = 298/432 (69%), Gaps = 12/432 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A+HKLPP TVV LL++N I KVKLFDAD + +SAL G+ IEVMV IPN+ L+
Sbjct  20    LGVNWGTMAMHKLPPKTVVQLLKDNGIGKVKLFDADQSTMSALAGTDIEVMVAIPNDQLS  79

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             A++    A D WV +N+TRY   GGVNIKYVAVGNEPFL SY+  F +   PA+ N+Q +
Sbjct  80    AMNDYDRAKD-WVRRNVTRYNFKGGVNIKYVAVGNEPFLTSYNNSFINTTFPALQNIQNA  138

Query  1286  LAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A LG ++K  VP NAD Y S     +PS G FR ++  +MTQ+V  +N N +PF VN
Sbjct  139   LNEAGLGNSIKATVPLNADVYFSPESNPVPSAGRFRQDINDLMTQMVQFMNQNNAPFTVN  198

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY N  FP D+AFF+G + P++D    Y+N FD N DTLV+AL   G   M I+
Sbjct  199   IYPFLSLYANEHFPVDFAFFDGASSPILDKGVTYTNVFDANFDTLVSALRAAGVGNMTIL  258

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +AN+  A  F +GL+  +  N GTPLRPG   I+VYLF L DE GKSI
Sbjct  259   VGEVGWPTDGDKNANVNLAYRFYKGLLSRLAANTGTPLRPGY--IEVYLFGLIDEDGKSI  316

Query  758   LPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG+FERHWG+F +DGQ K+ +DL G GQ   L  A++V YLP +WC++NPN KDLS ++
Sbjct  317   APGNFERHWGIFRYDGQPKFAMDLTGQGQDKFLVGAQNVEYLPKKWCMLNPNAKDLSKLA  376

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
             ++I  AC+ +DCT L YG SCNG+   GN SYAFN YYQ   Q   SC F GL +VT  +
Sbjct  377   DNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYYQAQNQGDFSCGFQGLAMVTDQN  436

Query  413   PSVDECRFLVGV  378
              S   C F + +
Sbjct  437   ISQANCNFTIQI  448



>ref|XP_002982430.1| hypothetical protein SELMODRAFT_155115 [Selaginella moellendorffii]
 gb|EFJ16675.1| hypothetical protein SELMODRAFT_155115 [Selaginella moellendorffii]
Length=469

 Score =   460 bits (1184),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 229/433 (53%), Positives = 308/433 (71%), Gaps = 11/433 (3%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             E+A+GVN+GT++ H LPP  V  LL+ NNI +VKLFDAD A++ A  G+ IEVMV IPN+
Sbjct  12    EAALGVNYGTMSSHLLPPKVVARLLKANNITRVKLFDADFAMVRAFAGTDIEVMVAIPND  71

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML  +++S+ AA+ WV +N+TR+L++GGV IKYVAVGNEPFL +Y+G F S  +PA  N+
Sbjct  72    MLEMMATSTDAAERWVKRNVTRFLIDGGVKIKYVAVGNEPFLTAYNGSFISSTLPAAVNI  131

Query  1295  QQSLAKANLGGAVKLVVPCNADAYES---SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              Q+L K  +   +K+ VP NAD   +   ++PS G FRP++   M+QLV+ L+ N  PF 
Sbjct  132   HQALVKHKVADEIKVTVPLNADVLSNGGVNVPSAGIFRPDIQDTMSQLVAFLDQNQCPFT  191

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             +N+YPFLSL  +++FP+++AFF+G   P VDG   Y+N FD + D LV+AL K G+  + 
Sbjct  192   INLYPFLSLQQDANFPREFAFFDGAVPPTVDGALSYTNVFDASYDLLVSALRKNGFGNVG  251

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN+ +A+ F +GL  HV   +GTPL P   P+DVYLFSL DE  K
Sbjct  252   ILVGEVGWPTDGDPNANMASAQRFYRGLATHV--GRGTPLSP--RPLDVYLFSLTDEDQK  307

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNG---QLKNARDVPYLPYRWCIVNPNKDLSAV  597
             SI PG+FERHWG+++FDGQ KY LDL G+G    L NA  V YLP +WC+++P  D + +
Sbjct  308   SIAPGNFERHWGIYTFDGQAKYQLDLSGSGSIASLVNAPGVDYLPRKWCVLDPAADRTRL  367

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
              +++  AC  ADCT L YGGSCNGIG  GN SYAFNSYYQL  Q   SC FDGLG VT +
Sbjct  368   GDNVAYACMYADCTALMYGGSCNGIGGDGNASYAFNSYYQLKGQMGNSCYFDGLGKVTDV  427

Query  416   DPSVDECRFLVGV  378
             DPS  +C+F +G+
Sbjct  428   DPSQGDCKFKIGI  440



>ref|XP_010054473.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Eucalyptus grandis]
 gb|KCW89851.1| hypothetical protein EUGRSUZ_A02084 [Eucalyptus grandis]
Length=478

 Score =   460 bits (1184),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 235/433 (54%), Positives = 303/433 (70%), Gaps = 15/433 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A H+LPP TVV +L++N I+KVKLFDAD   LSAL GS IEVMV IPN+ LA
Sbjct  25    LGVNWGTMATHELPPGTVVQMLKDNGIKKVKLFDADQYTLSALAGSNIEVMVAIPNDQLA  84

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             +++S   A   WV +N+TRY  NGGV+IKYVAVGNEPFL++Y+G F +   PA+ N+Q +
Sbjct  85    SMTSYERAKQ-WVQRNVTRYNFNGGVSIKYVAVGNEPFLSAYNGSFLNVTFPALQNIQNA  143

Query  1286  LAKANLGGAVKLVVPCNADAYESSL----PSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +  +G  VK  VP NAD Y S +    PS G FR +++ +MTQ+V  L  N++P  VN
Sbjct  144   LNEVGVGDTVKATVPVNADVYNSPVSNPVPSAGRFRTDISDLMTQIVEFLAKNSAPLTVN  203

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLYGN +FP DYAFF+G A PVVD    Y+N FD N DTLV+AL  +G+  M ++
Sbjct  204   IYPFLSLYGNDNFPIDYAFFDG-ATPVVDNGIQYTNVFDANFDTLVSALKAVGHGDMTLM  262

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +AN+ +A  F  GL+  +  N GTPLRPG   I+VYLF L DE  KSI
Sbjct  263   VGEVGWPTDGDKNANIASAVRFYNGLMPRLAANTGTPLRPGY--IEVYLFGLIDEDAKSI  320

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPN-KDLSAV  597
              PG FERHWG+F +DGQ K+PLDL +GQ +N     A++V YLP +WC++NP   DLS +
Sbjct  321   APGSFERHWGIFRYDGQPKFPLDL-SGQNQNKFLVAAKNVNYLPQQWCVLNPKANDLSKL  379

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
               +I  AC+ ADCT+L YG SCN +   GN SYAFN YYQ+  QNP SC+F+GL  VT  
Sbjct  380   GTNINYACTFADCTSLGYGSSCNSLDANGNASYAFNMYYQVQNQNPLSCNFEGLATVTTQ  439

Query  416   DPSVDECRFLVGV  378
             + S   C F++ +
Sbjct  440   NISQGTCNFIIQI  452



>ref|XP_009610199.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   460 bits (1184),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 233/434 (54%), Positives = 298/434 (69%), Gaps = 12/434 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
               +GVNWGT+A HKLPP TVV LL++N I KVKLFDAD + +SAL GS IEVMV IPN+ 
Sbjct  18    EGLGVNWGTMATHKLPPKTVVQLLKDNGIGKVKLFDADQSTMSALAGSDIEVMVAIPNDQ  77

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L+A++    A D WV +N+TRY   GGVNIKYVAVGNEPFL SY+  F +   PA+ N+Q
Sbjct  78    LSAMNDYHRAKD-WVRRNVTRYNFKGGVNIKYVAVGNEPFLTSYNNSFINTTFPALENIQ  136

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L +A LG ++K  VP NAD Y S     +PS G FR ++  +MTQ+V  +N N +PF 
Sbjct  137   NALNEAGLGNSIKATVPLNADVYFSPESNPVPSAGRFRQDINDLMTQMVQFMNQNNAPFT  196

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLY N  FP D+AFF+G ++P++D    Y+N FD N DTLV+AL   G   M 
Sbjct  197   VNIYPFLSLYANEHFPVDFAFFDGASNPILDKGVTYTNVFDANFDTLVSALRAAGVGNMT  256

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN+  A  F +GL+  +  N GTPLRPG   I+VYLF L DE GK
Sbjct  257   ILVGEVGWPTDGDKNANVNLAYRFYKGLLSRLAANTGTPLRPGY--IEVYLFGLIDEDGK  314

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG+FERHWG+F +DGQ K+ +DL G GQ   L  A++V YLP +WC++NPN KDLS 
Sbjct  315   SIAPGNFERHWGIFRYDGQPKFSMDLTGQGQDKFLVGAQNVEYLPKKWCMLNPNAKDLSK  374

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++++I  AC+ +DCT L YG SCNG+   GN SYAFN Y+Q   Q   SC F GL +VT 
Sbjct  375   LADNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQAQNQGDFSCGFQGLAMVTD  434

Query  419   LDPSVDECRFLVGV  378
              + S   C F + +
Sbjct  435   QNISQANCNFTIQI  448



>ref|XP_010672074.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   461 bits (1185),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 232/435 (53%), Positives = 297/435 (68%), Gaps = 14/435 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
               +GVNWGT A+HKLPPSTVV +L++N IQKVKLFDAD + LSA  G+ IEVMV IPN  
Sbjct  32    EGLGVNWGTQAIHKLPPSTVVQMLKDNGIQKVKLFDADESTLSAFSGTNIEVMVAIPNGD  91

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L A+     A   WV +N+TRY   GGVNIKYVAVGNEPFL +Y+G F++   PA+ N+Q
Sbjct  92    LVAMLDYDRARK-WVEKNVTRYNFKGGVNIKYVAVGNEPFLKAYNGTFENATFPALKNIQ  150

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L +A +G  VK  VP NAD YES     +PS G FRP++  +MTQ+V  L+ N +PF 
Sbjct  151   NALNEAGVGNTVKATVPLNADVYESPEGTPVPSAGRFRPDVADLMTQMVQFLSQNNAPFS  210

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN  FP DYAFF+G A P+ D    Y+N FD N DTLV+AL   GY  +P
Sbjct  211   VNIYPFLSLYGNPGFPVDYAFFDGGAAPIADNGIEYTNVFDANFDTLVSALKAAGYGDLP  270

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPT+G  +AN+  A  F +GL+  +  N GTPLRPG   I++YLF L DE  K
Sbjct  271   IIVGEVGWPTNGDVNANINNAIRFYRGLLPRIAANTGTPLRPG--NIEMYLFGLLDEDAK  328

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNGQ-----LKNARDVPYLPYRWCIVNPN-KDLS  603
             ++ PG+FERHWG+F +DGQ K+P+DL  GQ     L  A+DV YL  +WC  NPN KD+S
Sbjct  329   TVAPGNFERHWGIFRYDGQPKFPMDL-TGQNRDVYLVGAKDVTYLQNQWCEFNPNAKDVS  387

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              ++ +I  AC+ ADCT L YG SC+G+   GNISYAFN Y+Q   QN ++C+F GL  +T
Sbjct  388   KLAENIDFACTFADCTPLGYGSSCHGMDANGNISYAFNVYFQTQNQNLEACNFQGLARLT  447

Query  422   FLDPSVDECRFLVGV  378
               + S   C F + +
Sbjct  448   LQNISAPTCNFTIQI  462



>ref|XP_007030700.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY11202.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=479

 Score =   460 bits (1183),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 232/435 (53%), Positives = 305/435 (70%), Gaps = 15/435 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             + +GVNWGT+A HKLPP TVV ++++N I+KVKLFDAD   +SAL GS +EVMV IPN+ 
Sbjct  25    NGLGVNWGTMATHKLPPKTVVQMIKDNGIKKVKLFDADSNTMSALAGSDLEVMVAIPNDQ  84

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L A++S   A + WV +N+TRY  NGGVNIKYVAVGNEPFL +Y+G F +   PA+ N+Q
Sbjct  85    LLAMNSYDRAKE-WVRRNVTRYNFNGGVNIKYVAVGNEPFLTTYNGSFVNITFPALQNIQ  143

Query  1292  QSLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L  A +G ++K  VP NAD Y S     +PS G FR +++ IMTQ+V  L+ N++PF 
Sbjct  144   NALNDAGVGDSIKATVPLNADVYNSPDSNPVPSAGRFRSDISGIMTQIVDFLSKNSAPFT  203

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN DFP +YAFF+G   P+ D    Y+N FD N DTLV+AL  +G+  M 
Sbjct  204   VNIYPFLSLYGNDDFPFNYAFFDG-GTPITDNGIQYTNVFDANFDTLVSALKAVGHGDMT  262

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN+  A+ F  GL+  +  N GTPLRPG   I+VYLF L DE  K
Sbjct  263   IIVGEVGWPTDGDKNANVANAQRFYNGLMPRLAANTGTPLRPGY--IEVYLFGLIDEDAK  320

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPN-KDLS  603
             SI PG+FERHWG++ +DGQ K+PLDL +GQ +N     A++V YLP +WC  NPN KDLS
Sbjct  321   SIAPGNFERHWGIYRYDGQPKFPLDL-SGQNQNRFLIGAQNVEYLPQKWCTFNPNAKDLS  379

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              ++++I  AC+ +DCT L YG SCN +   GN S+AFN YYQ+  QN  +C+F GLG VT
Sbjct  380   KLADNINYACTFSDCTALGYGSSCNNLDANGNASFAFNMYYQVQNQNDMACNFQGLGTVT  439

Query  422   FLDPSVDECRFLVGV  378
               + S   C F++ +
Sbjct  440   TQNLSQGTCNFIIQI  454



>ref|XP_004296615.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Fragaria 
vesca subsp. vesca]
Length=490

 Score =   460 bits (1184),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 232/432 (54%), Positives = 302/432 (70%), Gaps = 9/432 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S IG NWGT A H LPP +VV LLR+N IQKVKLFDAD   L+ L  SGIEVMVGIPN+M
Sbjct  27    SGIGANWGTQASHPLPPDSVVSLLRQNGIQKVKLFDADYDTLTNLGKSGIEVMVGIPNDM  86

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA+++SS  AA+ WV++N++ ++ +  V I+YVAVGNEPFL +Y+G F   + PA+ NVQ
Sbjct  87    LASLASSVKAAEKWVSKNVSAHISSNNVKIRYVAVGNEPFLETYNGSFLRTIFPALKNVQ  146

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA +   VK+ VP NAD YESS  LPS G FR E+  +M Q++  L+ N +PF VN
Sbjct  147   SALIKAGISNQVKVTVPQNADVYESSNGLPSGGDFRTEIHDLMLQIIKFLSDNGAPFTVN  206

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY +++FP DYAFF+G A P+ DG   Y N FD N DTL  AL K G+  +PI+
Sbjct  207   IYPFISLYIDANFPVDYAFFDGNASPITDGSLTYYNMFDANYDTLAWALQKNGFGNLPII  266

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +ANL  A+ FNQG + H+L  +GTP+RPG  PID YLFSL DE  KSI
Sbjct  267   VGEIGWPTDGDQNANLVYAQKFNQGFMSHILSGRGTPMRPG--PIDAYLFSLIDEDSKSI  324

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG+FERHWG+F+FDG  KY L+LG   +G +  A+ V YL  +WC++ P+  L    V+
Sbjct  325   DPGNFERHWGIFTFDGIPKYQLNLGTTNSGSVVAAKGVHYLERKWCVMRPSASLDDPQVA  384

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC LADCT+L YG SC  +  +GNISYAFNSYYQ++ Q   +C F  L ++T  +
Sbjct  385   LSMSYACGLADCTSLGYGTSCGNLDARGNISYAFNSYYQMNNQLDVACKFPNLSMITKTN  444

Query  413   PSVDECRFLVGV  378
             PSV  CRF + +
Sbjct  445   PSVGSCRFEIMI  456



>ref|XP_007016969.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY34588.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=494

 Score =   460 bits (1184),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 232/437 (53%), Positives = 297/437 (68%), Gaps = 6/437 (1%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             AIGVNWG ++ H LP   VV+LL+ NN+ KVKLFDADP VL AL G+ I V  GIPN ML
Sbjct  26    AIGVNWGAMSSHPLPAPKVVELLKSNNVSKVKLFDADPLVLQALSGTNIAVTAGIPNSML  85

Query  1469  aavsssssaADLWVAQNLTRYLVNG--GVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
              A++SS  AA+ WV  N+TRY  +G  GV I+YVAVG+EPFL SY  QF  +V+ A  N+
Sbjct  86    KALNSSRKAAESWVHDNVTRYFSHGRAGVRIEYVAVGDEPFLQSYGEQFHPFVIGAAMNI  145

Query  1295  QQSLAKANLGGAVKLVVPCNADAY--ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             Q +L KANLG  VK+VVPC+ D +  ESSLPS+G FR +L + M +L++ L+   SPF V
Sbjct  146   QAALTKANLGSEVKVVVPCSFDTFVAESSLPSKGHFRTDLNKTMIELLTFLSKRHSPFFV  205

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
              I PF+S   N +   D++ F+       D    Y N+FD + DTLV ALSK+G+ +M I
Sbjct  206   TISPFISFQQNKNISLDFSLFKENVRTHNDSHRTYKNSFDLSYDTLVTALSKIGFPEMDI  265

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             V+  +GWPTDGA +AN + A  F +GL+ H+    GTPLRP  PPI+ ++FSL DE  +S
Sbjct  266   VVARIGWPTDGAANANTSVAETFMKGLVDHLHSKTGTPLRPRNPPIETFIFSLLDEDQRS  325

Query  761   ILPGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNH  588
             I  G+FERHWGVF+FDGQ KY ++ G G   L NA+ V YLP +WC+VN NKDLS  +  
Sbjct  326   ITSGNFERHWGVFTFDGQAKYHVNFGQGSKNLVNAQFVEYLPSKWCVVNNNKDLSNATAS  385

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
                ACS++DCT L  GGSC+ I   GNISYAFNSYYQ H Q   SCDF GLGLVT +DPS
Sbjct  386   ALEACSVSDCTVLSPGGSCSNISWPGNISYAFNSYYQQHDQRADSCDFGGLGLVTTVDPS  445

Query  407   VDECRFLVGVTDTNNSS  357
             V  CRF V +  ++++S
Sbjct  446   VGNCRFFVELQTSHSTS  462



>ref|XP_006352469.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum tuberosum]
Length=489

 Score =   460 bits (1183),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 237/435 (54%), Positives = 295/435 (68%), Gaps = 16/435 (4%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             ++GVNWGT+A H+LPP++VV +L EN   KVKLF+AD  +L+AL+G+ IEVM+ IPN ML
Sbjct  24    SVGVNWGTMATHQLPPNSVVKMLIENGFDKVKLFEADEVILNALIGTEIEVMLAIPNYML  83

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
               +SS+S  AD WV  N++ Y    GV I+YVAVGNEPFL +Y+G +  Y++PA+ NVQ+
Sbjct  84    EDLSSNSIIADSWVEANVSAYAYPHGVKIRYVAVGNEPFLRTYNGTYLQYILPALKNVQE  143

Query  1289  SLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             ++ KA LG  VK  +P NAD Y S     +PS G FRPE+  +  Q+V  L  N +PFVV
Sbjct  144   AINKAGLGAKVKATIPFNADIYFSPESNQVPSAGDFRPEVRDLTLQIVQYLYLNDAPFVV  203

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
             NIYPFLSLYGN  FP D+AFF+G+  PV DG  VY+N FD N DTLV +L K G++ M I
Sbjct  204   NIYPFLSLYGNIYFPLDFAFFDGSNKPVRDGDYVYTNVFDANFDTLVWSLKKAGFTDMKI  263

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             V+GEVGWPTDG  +AN   A  FNQGLI H L  +GTP R G   I+VYLFSL DE  KS
Sbjct  264   VVGEVGWPTDGDKNANNENAMRFNQGLIKHCLSEQGTPARKG-KKIEVYLFSLIDENAKS  322

Query  761   ILPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPNKDLSAV  597
             I PG+FERHWG+F FDG+ KY LDL     K+        V Y+  RWCI+ P   ++ V
Sbjct  323   IAPGNFERHWGMFEFDGKPKYELDLSGRMQKDKGLVAVEGVNYMHKRWCILKPENAVTDV  382

Query  596   SN------HIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGL  435
              N      +I  ACSL+DCT L YG SCN +  +GN SYAFN YYQL  QN   CDFDGL
Sbjct  383   DNAEDLPKNIDYACSLSDCTALGYGSSCNHLSTEGNASYAFNMYYQLKNQNSWDCDFDGL  442

Query  434   GLVTFLDPSVDECRF  390
              +VT  DPS D+CRF
Sbjct  443   AVVTDEDPSDDKCRF  457



>gb|KDP39719.1| hypothetical protein JCGZ_02739 [Jatropha curcas]
Length=478

 Score =   459 bits (1181),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 232/437 (53%), Positives = 303/437 (69%), Gaps = 14/437 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT A HKLPP TVV +L++N I+KVKLFD + + + AL G+GIEVMV IPN+ L 
Sbjct  23    LGVNWGTQATHKLPPKTVVQMLKDNGIKKVKLFDTEASTMRALAGTGIEVMVAIPNDQLL  82

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             A++    A D +V  N++ Y  NGGVNIKYVAVGNEPFL SY+G F +   PA+ N+Q +
Sbjct  83    AMNDYKRAKD-FVKSNISIYNFNGGVNIKYVAVGNEPFLTSYNGSFINTTFPALQNIQNA  141

Query  1286  LAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A +G ++K  VP NAD Y S    S PS G FR ++  +MTQ+V  LN N +PF VN
Sbjct  142   LNEAGVGDSIKATVPLNADVYNSPTGQSYPSAGRFRSDINDLMTQIVQFLNKNNAPFTVN  201

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVD-GPNV-YSNAFDGNLDTLVAALSKLGYSQMP  945
             IYPFLSLYGN +FP DYAFF+G +  VVD G  + Y+N FD N DTLV+AL  +G+  M 
Sbjct  202   IYPFLSLYGNDNFPIDYAFFDGVSQTVVDVGSGIQYTNVFDANFDTLVSALKAVGFGDMT  261

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             +++GEVGWPTDG  SA +  A  F  GL+  +  N+GTPLRPG   I+VYLF L DE  K
Sbjct  262   VIVGEVGWPTDGDKSATVDYAYRFYNGLLPRLASNRGTPLRPGF--IEVYLFGLLDEDAK  319

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG+FERHWG+F +DGQ K+ LDL G GQ   L  A++V YLP +WC  NPN +DLS 
Sbjct  320   SIAPGNFERHWGIFKYDGQPKFALDLSGQGQNKLLIGAQNVQYLPSKWCTFNPNAQDLSK  379

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++++I  AC+ +DCT L YG SCNG+   GN SYAFN Y+Q+  Q+P +CDF GL  VT 
Sbjct  380   LADNIDYACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQVQNQDPMACDFQGLATVTN  439

Query  419   LDPSVDECRFLVGVTDT  369
             ++ S  +C F++ +  +
Sbjct  440   VNISQGKCNFIIQIASS  456



>ref|XP_007161283.1| hypothetical protein PHAVU_001G057100g [Phaseolus vulgaris]
 gb|ESW33277.1| hypothetical protein PHAVU_001G057100g [Phaseolus vulgaris]
Length=483

 Score =   459 bits (1181),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 232/435 (53%), Positives = 310/435 (71%), Gaps = 10/435 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S IGVNWGT   H LP ST+V +L++N IQKVKLFDADP +L+AL  SGI+VMVGIPNEM
Sbjct  27    SGIGVNWGTQLTHPLPSSTMVKMLKDNGIQKVKLFDADPDILNALKKSGIQVMVGIPNEM  86

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  +++S  AA+ WV++N++ Y+ +GGV+I+YVAVGNEPFL++Y+G F++  +PA+ N+Q
Sbjct  87    LYTLANSMQAAERWVSKNVSAYVSSGGVDIRYVAVGNEPFLSTYNGSFEATTLPALQNIQ  146

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS-LPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
              +L KA+LG  VK+ VP NAD Y+S+ +PS G FR ++  +M Q+V  L+ N +PF VNI
Sbjct  147   AALVKASLGNQVKVTVPLNADVYQSAQVPSDGDFRQDIHDLMVQIVKFLSQNNAPFTVNI  206

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPF+SLY + +FP DYAFF G   P+ D   +Y N FD N DTLV AL K G+  MPIV+
Sbjct  207   YPFISLYADPNFPVDYAFFNGFQSPINDNGRIYDNVFDANHDTLVWALQKNGFGNMPIVV  266

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDG  +ANL  A+ FNQG +   +  KGTP+RPG  P+D YLFSL DE  KSI 
Sbjct  267   GEVGWPTDGDRNANLQYAQRFNQGFMSRYMAGKGTPMRPG--PMDAYLFSLLDEDFKSIQ  324

Query  755   PGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVSN  591
             PG+FERHWG+F +DGQ KY L++G   NG L  A  + YL  +WCI+ P+ +L+   V+ 
Sbjct  325   PGNFERHWGLFYYDGQPKYQLNIGSRTNG-LVGANGIAYLGKKWCILKPSANLNDDQVAP  383

Query  590   HIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDP  411
              +  AC  ADCT+L Y  SC  +  +GNIS+AFNSYYQ++ Q   +C F GL +VT  DP
Sbjct  384   SVSFACQNADCTSLGYQTSCGNLDVRGNISFAFNSYYQVNDQIDSACKFPGLSVVTDKDP  443

Query  410   SVDECRFLVGV-TDT  369
             S  +C+F + + TD+
Sbjct  444   STGDCKFKIMIQTDS  458



>ref|XP_006474357.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like isoform X1 
[Citrus sinensis]
Length=480

 Score =   459 bits (1181),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 232/430 (54%), Positives = 296/430 (69%), Gaps = 9/430 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S +G NWGT A H LPP TVV+LLR+N  QK KLFDAD   L AL  SGIEVMVGIPN+M
Sbjct  23    SGLGANWGTQASHPLPPETVVNLLRDNGFQKAKLFDADYGTLRALGKSGIEVMVGIPNDM  82

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA+++SS   A+ WV+QN+++++    VNI+YVAVGNEPFL +Y+G F     PA+ NVQ
Sbjct  83    LASLASSMKTAEKWVSQNVSQHIRKNNVNIRYVAVGNEPFLETYNGSFLRTTFPALRNVQ  142

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA L   VK+ VP NAD YES+  +PS G FR ++  +M  +V  L+ N  PF VN
Sbjct  143   AALIKAGLSNQVKVTVPLNADVYESASGVPSGGDFRADIHDLMLAIVKFLSDNGGPFTVN  202

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY +S+FP +YAFF+G + P+ DG   Y N FD N DTLV AL K GY  +PI+
Sbjct  203   IYPFISLYSDSNFPVEYAFFDGNSSPINDGGATYYNMFDANHDTLVRALQKNGYGNLPII  262

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWPTDG  +AN   AR FNQG + H+ G KGTP+RPG  PID YLFSL DE  KS+
Sbjct  263   IGEIGWPTDGDRNANNEYARRFNQGFMSHISGGKGTPMRPG--PIDAYLFSLIDEDAKSV  320

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG+FERHWG+F++DG+ KY ++LG   +G L  AR V YL  +WC++ P+  L    V+
Sbjct  321   DPGNFERHWGIFTYDGRPKYQINLGTTNSGSLVPARSVHYLQKKWCVMKPSARLDDPQVA  380

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC LADCT+L YG SC  +  +GNISYAFNSYYQ + Q   +C F  L ++T  D
Sbjct  381   PSVSYACGLADCTSLGYGTSCGNLDARGNISYAFNSYYQKNNQLDTACKFPNLSMITKAD  440

Query  413   PSVDECRFLV  384
             PSV  C F +
Sbjct  441   PSVGSCIFQI  450



>ref|XP_008465328.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis melo]
Length=479

 Score =   459 bits (1180),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 232/434 (53%), Positives = 305/434 (70%), Gaps = 14/434 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
               +GVNWGT+A H+LPP TVV +L++N IQKVKLFDAD + + AL G+GIEVMV IPN+ 
Sbjct  21    EGLGVNWGTMANHRLPPKTVVQMLKDNGIQKVKLFDADQSSMGALAGTGIEVMVAIPNDQ  80

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L+A+   + A   WV +N+TRY+ +GGV IKYVAVGNEPFL+SY+G F +   PA+ N+Q
Sbjct  81    LSAMGDYNRAKQ-WVQRNVTRYIFDGGVTIKYVAVGNEPFLSSYNGSFLNVTFPALQNIQ  139

Query  1292  QSLAKANLGGAVKLVVPCNADAYESSL----PSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L +A  G ++K  VP NAD Y S +    PS G FR ++ Q+M  +V  LN N +PF 
Sbjct  140   NALNEAGHGDSIKATVPLNADVYNSPVNSPYPSAGRFRSDINQLMNDIVQFLNKNKAPFT  199

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVD-GPNV-YSNAFDGNLDTLVAALSKLGYSQ  951
             VNIYPFLSLYGN +FP DYAFF+G ++PVVD G  + Y+N FD N DTLV++L  +G   
Sbjct  200   VNIYPFLSLYGNDNFPFDYAFFDGASNPVVDIGTGIQYTNVFDANFDTLVSSLKAVGLGD  259

Query  950   MPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEA  771
             MPI++GEVGWPTDG  +AN   A  F  GL+  +  NKGTPLRPG   I+VYLFS  DE 
Sbjct  260   MPILVGEVGWPTDGDKNANDGNAYRFYNGLLPRLAANKGTPLRPGF--IEVYLFSFLDEN  317

Query  770   GKSILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDL  606
             GKSI PG+FERHWG+F +DGQ K+ +DL G GQ   L  A++V YLP +WC+ NPN KDL
Sbjct  318   GKSIAPGNFERHWGIFGYDGQPKFGMDLSGQGQNKLLVGAQNVEYLPQKWCMFNPNAKDL  377

Query  605   SAVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLV  426
             S ++++I  AC+ +DCT+L YG SCN +   GN SYAFN Y+Q+  Q+  +C+F GL  +
Sbjct  378   SKLADNIDYACTFSDCTSLGYGSSCNNLDANGNASYAFNMYFQVQNQDELACNFQGLATI  437

Query  425   TFLDPSVDECRFLV  384
             T  + S   C F++
Sbjct  438   TSRNLSQGTCNFII  451



>ref|XP_006299509.1| hypothetical protein CARUB_v10015679mg [Capsella rubella]
 gb|EOA32407.1| hypothetical protein CARUB_v10015679mg [Capsella rubella]
Length=498

 Score =   459 bits (1182),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 235/440 (53%), Positives = 305/440 (69%), Gaps = 12/440 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S++GVNWGT+A H+LPP  VV +L++N   K+KLF+AD  +L AL+GS IEVM+GIPN  
Sbjct  35    SSVGVNWGTMASHQLPPEKVVKMLQDNGFTKLKLFEADQNILDALVGSDIEVMIGIPNRF  94

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  V+  +S A  WV +N+T Y  +GGVNIKY+AVGNEPFL +Y+G +  + +PA+ N+Q
Sbjct  95    LKEVAQDTSVAASWVEENVTAYSYHGGVNIKYIAVGNEPFLQTYNGTYVEFTLPALVNIQ  154

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             ++L +A+L   VK+ VP NAD Y S     +PS G FRPEL     ++++ L S+ SPF 
Sbjct  155   RALEEADLKN-VKVTVPFNADIYFSPEANPVPSAGDFRPELRDATIEIINFLYSHDSPFT  213

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN+ FP D+AFF+GT  P+ DG  VY+N FD NLDTL+ A+ +  +  M 
Sbjct  214   VNIYPFLSLYGNAYFPLDFAFFDGTNKPLRDGSLVYTNVFDANLDTLICAMERYSFLGMK  273

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN+ +A+ FNQG++ H +   GTP R GV  +DVYLFSL DE  K
Sbjct  274   IIVGEVGWPTDGDKNANVKSAKRFNQGMVKHAMSGNGTPARKGV-VMDVYLFSLVDEDAK  332

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG FERHWG+F FDG+ KY LDL G G    L    DV YLP  WC+++PN  +L  
Sbjct  333   SIAPGTFERHWGIFGFDGRPKYELDLSGKGNDNPLVPVEDVKYLPKTWCVLDPNASNLDD  392

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             + ++I  ACSL+DCT L YG SCN +   GN SYAFN YYQ+H Q    CDF GLGL+T 
Sbjct  393   LPDNIDYACSLSDCTALGYGSSCNHLTAIGNASYAFNMYYQMHDQETWDCDFLGLGLITD  452

Query  419   LDPSVDECRFLVGVTDTNNS  360
              DPS + C F V + DT NS
Sbjct  453   EDPSDELCEFPVMI-DTGNS  471



>gb|KDP39750.1| hypothetical protein JCGZ_02770 [Jatropha curcas]
Length=463

 Score =   458 bits (1178),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 233/441 (53%), Positives = 301/441 (68%), Gaps = 9/441 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S IG NWGT A H LPP TVV LL +N IQKVKLFDAD   L AL  SGIEVMVGIPN++
Sbjct  6     SCIGANWGTQATHPLPPDTVVRLLLDNRIQKVKLFDADYDTLRALGKSGIEVMVGIPNDL  65

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA+++SS  AA+ WV++N++ ++    VNI+YVAVGNEPFL +Y+G F     PA+ NVQ
Sbjct  66    LASMASSVKAAEKWVSKNVSTHISTNNVNIRYVAVGNEPFLETYNGSFIQSTFPALQNVQ  125

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA L   VK+ VP NAD YESS  LPS G FR ++  +M  +V  L+ + SPF VN
Sbjct  126   SALIKAGLSNQVKVTVPLNADVYESSTGLPSGGDFRADIHDLMINIVKFLSDSGSPFTVN  185

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY + +FP +YAFF+G A PV DG   Y N FD N DTL +AL K G+  +PI+
Sbjct  186   IYPFISLYIDPNFPVEYAFFDGNATPVNDGGTSYYNMFDANYDTLASALQKNGFGNLPII  245

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +ANL  A+ FNQG + H+   KGTPLRPG  PID YLFSL DE  KSI
Sbjct  246   VGEIGWPTDGDKNANLVYAQRFNQGFMSHISDGKGTPLRPG--PIDAYLFSLIDEDAKSI  303

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLSA--VS  594
              PG+FERHWG+F++DG+ KY L+LG   +G L  A++V YL  +WC++ P+  L    V+
Sbjct  304   DPGNFERHWGIFTYDGKAKYALNLGTANSGLLVEAKNVHYLERKWCVMKPSAKLDDPNVA  363

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC LADCT+L YG SC  +  +GNISYA NSYYQ+  Q   +C F+ + ++T  D
Sbjct  364   PSVSFACGLADCTSLGYGTSCGNLDARGNISYALNSYYQIQNQVDTACKFENVSMITKND  423

Query  413   PSVDECRFLVGVTDTNNSSGF  351
             P+   CRF + +      +GF
Sbjct  424   PTTGTCRFGIMIEQYYGGAGF  444



>gb|KDO73371.1| hypothetical protein CISIN_1g011636mg [Citrus sinensis]
Length=480

 Score =   458 bits (1179),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 233/430 (54%), Positives = 296/430 (69%), Gaps = 9/430 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S +G NWGT A H LPP TVV+LLR+N  QK KLFDAD   L AL  SGIEVMVGIPN+M
Sbjct  23    SGLGANWGTQASHPLPPETVVNLLRDNGFQKAKLFDADYGTLRALGKSGIEVMVGIPNDM  82

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA+++SS   A+ WV+QN+++++    VNI+YVAVGNEPFL +Y+G F     PA+ NVQ
Sbjct  83    LASLASSMKTAEKWVSQNVSQHIRKNNVNIRYVAVGNEPFLETYNGSFLRTTFPALRNVQ  142

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA L   VK+ VP NAD YES+  +PS G FR ++  +M  +V  L+ N  PF VN
Sbjct  143   AALIKAGLSNQVKVTVPLNADVYESASGVPSGGDFRADIHDLMLAIVKFLSDNGGPFTVN  202

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY +S+FP +YAFF+G + P+ DG   Y N FD N DTLV AL K GY  +PI+
Sbjct  203   IYPFISLYIDSNFPVEYAFFDGNSSPINDGGATYYNMFDANHDTLVRALQKNGYGNLPII  262

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWPTDG  +AN   AR FNQG + H+ G KGTP+RPG  PID YLFSL DE  KS+
Sbjct  263   IGEIGWPTDGDRNANNEYARRFNQGFMSHISGGKGTPMRPG--PIDAYLFSLIDEDAKSV  320

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG+FERHWG+F++DG+ KY L+LG   +G L  AR V YL  +WC++ P+  L    V+
Sbjct  321   DPGNFERHWGIFTYDGRPKYQLNLGTTNSGSLVPARSVHYLQKKWCVMKPSARLDDPQVA  380

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC LADCT+L YG SC  +  +GNISYAFNSYYQ + Q   +C F  L ++T  D
Sbjct  381   PSVSYACGLADCTSLGYGTSCGNLDARGNISYAFNSYYQKNNQLDTACKFPNLSMITKAD  440

Query  413   PSVDECRFLV  384
             PSV  C F +
Sbjct  441   PSVGSCIFQI  450



>ref|XP_009366428.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Pyrus x bretschneideri]
Length=487

 Score =   458 bits (1179),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 232/438 (53%), Positives = 308/438 (70%), Gaps = 14/438 (3%)
 Frame = -3

Query  1637  NWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLaavs  1458
             NWGT+A H+LPP+TVV +L++N I KVKLFDA+ + +SAL+ SG+EVMV IPN+ LA ++
Sbjct  29    NWGTMATHELPPATVVQMLKDNGIPKVKLFDAEESTMSALLDSGLEVMVAIPNDQLAVLT  88

Query  1457  ssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQSLAK  1278
             S   A + WV +N+TRY  NGGVNIKYVAVGNEPFL+SY+G F +   PA+ N+Q +L +
Sbjct  89    SYKRAKE-WVRRNVTRYNFNGGVNIKYVAVGNEPFLSSYNGSFLNVTFPALQNIQNALNE  147

Query  1277  ANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIYP  1110
             A +G +VK  VP NAD Y+S     +PS G FR ++ Q+MT++V  L+ N +PF +NIYP
Sbjct  148   AGVGDSVKATVPLNADVYDSPENNPVPSAGRFRTDILQLMTEIVQFLDKNKAPFTINIYP  207

Query  1109  FLSLYGNSDFPQDYAFFEGTAHPVVDGPN--VYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             FLSLYGN  FP +YAFF+G   P+VD      Y+N FD N DTLV++L  +G+  MPIV+
Sbjct  208   FLSLYGNDGFPFNYAFFDGDTTPIVDTTTGIQYTNVFDANFDTLVSSLKAVGFGNMPIVV  267

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDG  +AN+  A  F  GL+  +  N+GTPLR G   I+VYLF L DE  KSI 
Sbjct  268   GEVGWPTDGDKNANVGNAFRFYNGLLTKLGTNRGTPLRTGY--IEVYLFGLIDEDAKSIA  325

Query  755   PGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSAVSN  591
             PG FERHWG+FS+DGQ K+P+DL G GQ   L  A++V YL  +WC+ NPN KD+S +++
Sbjct  326   PGSFERHWGIFSYDGQPKFPVDLSGQGQNKLLVPAKNVQYLSKKWCMFNPNAKDVSNLAD  385

Query  590   HIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDP  411
              I  AC+ ADCT L+YG SCN +   GN SYAFN YYQ+  Q+ QSC+F GL  +T  + 
Sbjct  386   KINYACTYADCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDQSCNFQGLATLTTQNV  445

Query  410   SVDECRFLVGVTDTNNSS  357
             S   C F++ +  ++ SS
Sbjct  446   SQGNCNFIIQMATSSASS  463



>dbj|BAK03700.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=483

 Score =   458 bits (1178),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 233/437 (53%), Positives = 301/437 (69%), Gaps = 9/437 (2%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT   H LP STVV LL++N   +VKLFDA+  +L AL GSGI+VMVGIPN+ML+
Sbjct  27    MGVNWGTQLSHPLPASTVVRLLKDNGFDRVKLFDAEDGILGALKGSGIQVMVGIPNDMLS  86

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              ++ S+ AA+ WVA N++++ +N GV+I+ VAVGNEPFL +++G + +   PA+ NVQ +
Sbjct  87    DLAGSTKAAERWVAANVSKH-INDGVDIRLVAVGNEPFLQTFNGTYLNTTFPAMQNVQAA  145

Query  1286  LAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIY  1113
             L  A LGG VK+ V  NAD Y+S+   PS G FR ++  +M  +V  L S+ +PFV N+Y
Sbjct  146   LMAAGLGGQVKVTVALNADVYQSASGKPSDGDFRADIHGLMLNIVQFLASSGAPFVANVY  205

Query  1112  PFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIG  933
             PF+SLY + +FP DYAFF+G+  PVVDG   Y N FD N DTLVAAL + G+  + +V+G
Sbjct  206   PFISLYADPNFPLDYAFFQGSTSPVVDGGVTYQNTFDANHDTLVAALRRNGFPNVTVVVG  265

Query  932   EVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILP  753
             EVGWPTDG  +AN   AR FNQGLI HV   KGTPL PG  PID YLFSL DE  KSI P
Sbjct  266   EVGWPTDGDANANPDYARRFNQGLIDHVASGKGTPLAPGA-PIDAYLFSLVDEDRKSIQP  324

Query  752   GDFERHWGVFSFDGQLKYPLDL---GNGQLKNARDVPYLPYRWCIVNPNKDLS--AVSNH  588
             G+FERHWG+F +DG+ KY L L   G G L  AR V YL  RWC++ P  DL+   V + 
Sbjct  325   GNFERHWGIFFYDGKPKYQLGLRGSGGGMLVPARGVEYLQRRWCVLKPGADLADQKVGDS  384

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
             +  AC  ADCT+L Y  SC G+  KGN+SYAFNSYYQ   Q+ ++CDF GL   T +DPS
Sbjct  385   VSYACGSADCTSLGYKTSCGGLDAKGNVSYAFNSYYQTEDQDDRACDFRGLATTTTVDPS  444

Query  407   VDECRFLVGVTDTNNSS  357
                CRF+VG+  T+  +
Sbjct  445   SGTCRFIVGIAPTSTGT  461



>ref|XP_010048510.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Eucalyptus grandis]
 gb|KCW80769.1| hypothetical protein EUGRSUZ_C02156 [Eucalyptus grandis]
 gb|KCW80770.1| hypothetical protein EUGRSUZ_C02156 [Eucalyptus grandis]
 gb|KCW80771.1| hypothetical protein EUGRSUZ_C02156 [Eucalyptus grandis]
Length=483

 Score =   457 bits (1177),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 230/428 (54%), Positives = 297/428 (69%), Gaps = 9/428 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S IG NWGT A H LPP+TVV +LREN IQKVKLFDAD   L AL  +GIEVMVGIPN+M
Sbjct  22    SGIGANWGTQASHPLPPATVVRMLRENGIQKVKLFDADYGALRALGRTGIEVMVGIPNDM  81

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA+ + S  AA+ WV++N++ ++ +  VNI+YVAVGNEPFL +Y+  F +   PA+ NVQ
Sbjct  82    LASFAGSVKAAERWVSKNVSTHITSSNVNIRYVAVGNEPFLKTYNDSFITTTYPALQNVQ  141

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L +A L   VK+ VP NAD Y SS  LPS G FR ++ Q+M Q+V  L+ N   F VN
Sbjct  142   SALIRAGLSSQVKVTVPLNADVYASSTGLPSGGDFRADIQQLMIQIVKFLSDNGGSFTVN  201

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY +++FP +YAFF+G A P+VDG   Y N FD N DTLV AL K G+  + I+
Sbjct  202   IYPFISLYTDANFPVEYAFFDGNASPIVDGSATYYNMFDANYDTLVWALQKNGFGNLAII  261

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +ANL  A+ FNQG + H+ G KGTP+RPG  PID YLFSL DE  KSI
Sbjct  262   VGEIGWPTDGDRNANLVYAQRFNQGFMSHISGGKGTPMRPG--PIDAYLFSLIDEDAKSI  319

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGNGQ---LKNARDVPYLPYRWCIVNPNKDLSA--VS  594
              PG+FERHWG+F +DG+ KY  +LG      L  AR V YL  +WC++ P+ +L+   ++
Sbjct  320   EPGNFERHWGIFGYDGKPKYLFNLGTTNSNGLIPARGVNYLEPKWCLLKPSANLTGDQMA  379

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  ACS  DCT+L YG SC  +  +GNISYAFNSYYQ++ Q   +C F GL ++T  +
Sbjct  380   PSVSYACSRGDCTSLGYGTSCGNLDAEGNISYAFNSYYQINNQLDSACKFSGLSMITRTN  439

Query  413   PSVDECRF  390
             PSV  CRF
Sbjct  440   PSVGTCRF  447



>ref|XP_004982257.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Setaria italica]
Length=495

 Score =   458 bits (1178),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 234/439 (53%), Positives = 301/439 (69%), Gaps = 17/439 (4%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             A+GVNWGT+A H+LP  TVV +L++N I+KVKLFDADP  + AL GSGIEVMVGIPN ML
Sbjct  28    ALGVNWGTMATHRLPSGTVVRMLQDNGIRKVKLFDADPGPMDALAGSGIEVMVGIPNNML  87

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
               ++   +A D WV +N++RY  +GGV IKYVAVGNEPFL++++G F +  +PA+ N+Q+
Sbjct  88    DMMTDYGTARD-WVHENVSRYNFDGGVTIKYVAVGNEPFLSAFNGTFLNVTLPALQNIQR  146

Query  1289  SLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             +L  A LG ++K  VP NAD Y S     +PS G FR ++  +MT++V  LN + +PF V
Sbjct  147   ALDDAGLGESIKATVPLNADVYNSPVSNPVPSAGRFRSDIADLMTEIVQFLNQSGAPFTV  206

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPN--VYSNAFDGNLDTLVAALSKLGYSQM  948
             NIYPFLSLYG+  FP DYAFF+GT+ PVVD  +   Y+N FD N DTLV+AL+  G   +
Sbjct  207   NIYPFLSLYGSDGFPLDYAFFDGTSSPVVDAGSGITYTNVFDANFDTLVSALAAAGAGGL  266

Query  947   PIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAG  768
             P+V+GEVGWPTDG T A    A+ F  GL+  +  N GTPLRP    I+VYLFSL DE  
Sbjct  267   PVVVGEVGWPTDGDTHATAAYAQKFYAGLLRKLAANAGTPLRPS-QYIEVYLFSLIDEDA  325

Query  767   KSILPGDFERHWGVFSFDGQLKYPLDLGNGQLKN--------ARDVPYLPYRWCIVNPNK  612
             KS+ PG+FERHWG+  +DGQ KYP+DL  GQ  N        AR V YLP +WC+ NPN 
Sbjct  326   KSVAPGNFERHWGIVRYDGQPKYPMDLSGGQGGNAAPAALVAARGVQYLPRQWCVANPNA  385

Query  611   -DLSAVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGL  435
              D S +S+ +  ACSL+DCT L YG SCNG+   GN SYAFN Y+Q+  Q   SCDF GL
Sbjct  386   PDTSRISDGVAYACSLSDCTALGYGSSCNGLDAAGNASYAFNMYFQVQNQAEGSCDFQGL  445

Query  434   GLVTFLDPSVDECRFLVGV  378
              + T  +PS D C F + +
Sbjct  446   AVTTAQNPSTDACNFTIQI  464



>ref|XP_010049931.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Eucalyptus grandis]
Length=489

 Score =   458 bits (1178),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 231/431 (54%), Positives = 292/431 (68%), Gaps = 13/431 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S++GVNWGT + H+LPP  VV +L+EN I+K+KLF+ D  +L AL GS IEVM+ +PN M
Sbjct  28    SSVGVNWGTQSNHQLPPEKVVKMLKENGIKKLKLFEYDEKILGALAGSKIEVMLAVPNYM  87

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  +S   S A  WV  N+T Y   GGVNIKY+AVGNEPFL SY+ ++   V+PA+ N+ 
Sbjct  88    LEIMSVDPSFAASWVDTNVTSYRYTGGVNIKYIAVGNEPFLQSYNHKYVRQVLPALRNIH  147

Query  1292  QSLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             ++L +A L   VK+ VP NAD Y S      PS G FRPE+     +++  L  N SPF 
Sbjct  148   EALHRARLSSKVKVTVPFNADVYYSPPPNEYPSSGDFRPEVRDAAIEIIHFLYINDSPFT  207

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLY N +FP D+AFF+GT  PV DG  VY+N FD N D LV+AL+K GYS M 
Sbjct  208   VNIYPFLSLYQNQNFPVDFAFFDGTTEPVKDGDRVYTNVFDANFDILVSALTKAGYSDME  267

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GE+GWPTDG   AN+  A+ FNQGL+ H L   GTP R GV  IDVYLFSL DE  K
Sbjct  268   ILVGEIGWPTDGDKFANIKNAQRFNQGLLKHALSGDGTPARKGV--IDVYLFSLIDEDTK  325

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNGQLKNARDVP-----YLPYRWCIVNPN-KDLS  603
             +I PG+FERHWG+F +DG+ KY LDL +G  K+ R VP     Y+P RWCI+NP   DL+
Sbjct  326   NIDPGNFERHWGLFEYDGKPKYELDL-SGSEKDTRLVPVMGVSYMPRRWCILNPELNDLT  384

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              +  +I  AC  +DCT L YG SCN +  +GN SYAFN YYQ++ Q   +CDF GL  VT
Sbjct  385   DLGENIDYACKSSDCTALGYGSSCNNLSSQGNASYAFNRYYQMNDQRIMACDFQGLAEVT  444

Query  422   FLDPSVDECRF  390
               DPS +EC+F
Sbjct  445   ENDPSTEECQF  455



>ref|XP_004249143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum lycopersicum]
Length=479

 Score =   457 bits (1177),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 227/432 (53%), Positives = 297/432 (69%), Gaps = 12/432 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
                GVNWGT+A H L P  +V +LR+N I+KVKLFDAD + + AL G+ IEVMV IPN+ 
Sbjct  24    EGFGVNWGTMATHMLEPKILVQMLRDNGIKKVKLFDADKSTMDALAGTDIEVMVAIPNDQ  83

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  ++    A D WV +N+TRY    GVNIKYVAVGNEPFL SY+  F +   PA+ N+Q
Sbjct  84    LLTMTDIDRAKD-WVRRNVTRYNFKNGVNIKYVAVGNEPFLTSYNNSFVNLTFPALQNIQ  142

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L +A +G ++K  VP NAD Y S     +PS G FR ++ ++MTQ+V  ++ N +PF 
Sbjct  143   NALNEAGVGDSIKATVPLNADVYFSPESNPVPSAGRFRTDIAELMTQIVQFMSKNQAPFT  202

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLY N  FP D+AFF+GT +PV+D    Y+N FD N DTL +AL  +GY  M 
Sbjct  203   VNIYPFLSLYANEHFPMDFAFFDGTPNPVLDNGVEYTNVFDANFDTLYSALKAVGYGHMA  262

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +ANL  A  F +GL   +  N+GTPLRPG   I+VYLF L DE  K
Sbjct  263   ILVGEVGWPTDGDKNANLNNAYRFYKGLFAKLASNRGTPLRPGY--IEVYLFGLIDEDAK  320

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQLKN---ARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG+FERHWG+F +DGQ K+P+D+ G GQ K+   A++V YLP RWC++NPN KDLS 
Sbjct  321   SIAPGNFERHWGIFRYDGQPKFPMDISGQGQDKHLVAAKNVQYLPNRWCMLNPNAKDLSK  380

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++N+I  AC+ +DCT+L +G SCN +   GN SYAFN YYQ+  Q   SCDF+GL +VT 
Sbjct  381   LANNIDYACTFSDCTSLGFGSSCNNLDAIGNASYAFNMYYQVQNQLDLSCDFEGLAMVTN  440

Query  419   LDPSVDECRFLV  384
              + S   C F++
Sbjct  441   KNLSQGTCNFII  452



>ref|XP_002445228.1| hypothetical protein SORBIDRAFT_07g006340 [Sorghum bicolor]
 gb|EES14723.1| hypothetical protein SORBIDRAFT_07g006340 [Sorghum bicolor]
Length=494

 Score =   458 bits (1178),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 235/433 (54%), Positives = 301/433 (70%), Gaps = 11/433 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             SAIGVNWGT   H+LP STVV LL++N   KVKLFDA+  +L AL GSGI+VMVGIPN++
Sbjct  32    SAIGVNWGTQLSHQLPASTVVRLLQDNGFDKVKLFDAEDTILGALKGSGIQVMVGIPNDL  91

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA +++   AAD WVA+N++ + V  GV+I+YVAVGNEPFL +++G +     PA+ NVQ
Sbjct  92    LADLAAGGKAADNWVAKNVSGH-VRDGVDIRYVAVGNEPFLETFNGTYLKTTFPAMQNVQ  150

Query  1292  QSLAKANLGGAVKLVVPCNADAYES--SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA L   VK+ VP NAD Y+S    PS G FR ++  +M  +V  L S  SPFV N
Sbjct  151   AALVKAGLADKVKVTVPLNADVYQSPTGKPSDGDFRADIHGLMLTIVQFLASTGSPFVAN  210

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNV-YSNAFDGNLDTLVAALSKLGYSQMPI  942
             +YPF+SLY + +FP DYAFF+G++ PVVDG  V Y N FD N DTLVAAL + G+  + +
Sbjct  211   VYPFISLYADPNFPLDYAFFQGSSSPVVDGGGVTYQNTFDANHDTLVAALRRNGFGNVSV  270

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             V+GEVGWPTDG  +ANL  AR FNQG + H+   +GTPLRPG  P+D YLFSL DE  KS
Sbjct  271   VVGEVGWPTDGDANANLDYARRFNQGFLTHIASGQGTPLRPG--PVDAYLFSLIDEDRKS  328

Query  761   ILPGDFERHWGVFSFDGQLKYPLDL--GNGQ-LKNARDVPYLPYRWCIVNPNKDLS--AV  597
             I PG+FERHWG+F +DG  KYPL L  GNG  LK AR V YL  +WC++ P  DL+   V
Sbjct  329   IQPGNFERHWGIFYYDGTPKYPLSLAGGNGSTLKPARGVKYLEKKWCVLKPAADLADQKV  388

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
              + +  AC LADCT+L Y  SC G+  KGN+SYA+N YYQ   Q+ ++C F+GL   T +
Sbjct  389   GDSVSYACGLADCTSLGYKTSCAGLDAKGNVSYAYNIYYQTMDQDDRACGFNGLATTTSV  448

Query  416   DPSVDECRFLVGV  378
             DPS   CRF+V +
Sbjct  449   DPSAGTCRFIVEI  461



>ref|XP_008224566.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Prunus mume]
Length=482

 Score =   457 bits (1176),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 231/432 (53%), Positives = 301/432 (70%), Gaps = 9/432 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S IG NWGT A H LPP TVV LLREN I+KVKLFDAD   L +L  SG+EVMVGIPN+M
Sbjct  21    SGIGANWGTQASHPLPPDTVVRLLRENEIRKVKLFDADYDTLRSLGKSGVEVMVGIPNDM  80

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA++++S  AA+ WV++N++ ++ +  V I+YVAVGNEPFL +Y+G F     PA+ NVQ
Sbjct  81    LASLATSVKAAEKWVSKNVSAHVSSSNVKIRYVAVGNEPFLETYNGSFLRTTFPALQNVQ  140

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA L   +K+ VP NAD Y SS  LPS G FR ++  +M Q+V  L+ N +PF VN
Sbjct  141   SALIKAGLSNQIKVTVPLNADVYASSNGLPSGGDFRTDIHGLMLQIVKFLSDNGAPFTVN  200

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY +S+FP DYAFF+G A P+ DG   Y N FD N DTLV +L K G+  +PI+
Sbjct  201   IYPFISLYIDSNFPVDYAFFDGNASPIADGSLTYYNMFDANYDTLVWSLQKNGFGNLPII  260

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +AN+  A+ FNQG + H+LG +GTP+RPG  PID YLFSL DE  KSI
Sbjct  261   VGEIGWPTDGDLNANIVYAQRFNQGFMSHILGGRGTPMRPG--PIDAYLFSLIDEDAKSI  318

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG+FERHWG+F+FDG  KY L+LG   +G L  A+ V YL  +WC++ P+ +L    V+
Sbjct  319   DPGNFERHWGIFTFDGIAKYQLNLGSTNSGSLVPAKGVHYLERKWCVMKPSANLDDPQVA  378

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC LADCT+L YG SC  +  +GNISYA NSYYQ + Q   +C F  L ++T  +
Sbjct  379   LSVSYACGLADCTSLGYGTSCGSLDARGNISYAVNSYYQRNNQLDVACKFPNLSMITKTN  438

Query  413   PSVDECRFLVGV  378
             PSV  CRF + +
Sbjct  439   PSVGSCRFEIMI  450



>ref|XP_004141142.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
 ref|XP_004171752.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
 gb|KGN59764.1| hypothetical protein Csa_3G843830 [Cucumis sativus]
Length=479

 Score =   457 bits (1176),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 232/434 (53%), Positives = 304/434 (70%), Gaps = 14/434 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
               +GVNWGT+A H+LPP TVV + ++N IQKVKLFDAD + + AL G+GIEVMV IPN+ 
Sbjct  21    EGLGVNWGTMANHRLPPKTVVQMFKDNGIQKVKLFDADQSSMGALAGTGIEVMVAIPNDQ  80

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L+A+   + A   WV +N+TRY  +GGV IKYVAVGNEPFL+SY+G F +   PA+ N+Q
Sbjct  81    LSAMGDYNRAKQ-WVQRNVTRYTFDGGVTIKYVAVGNEPFLSSYNGSFLNVTFPALLNIQ  139

Query  1292  QSLAKANLGGAVKLVVPCNADAYESSL----PSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L +A  G ++K  VP NAD Y S +    PS G FR ++ Q+MT +V  LN N +PF 
Sbjct  140   NALNEAGHGDSIKATVPLNADVYNSPVNSPYPSAGRFRNDINQLMTDIVQFLNKNKAPFT  199

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVD-GPNV-YSNAFDGNLDTLVAALSKLGYSQ  951
             VNIYPFLSLYGN +FP DYAFF+G ++PVVD G  + Y+N FD N DTLV++L  +G   
Sbjct  200   VNIYPFLSLYGNDNFPFDYAFFDGASNPVVDIGTGIQYTNVFDANFDTLVSSLKAVGLGD  259

Query  950   MPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEA  771
             MPI++GEVGWPTDG  + N+  A  F  GL+  +  NKGTPLRPG   I+VYLFS  DE 
Sbjct  260   MPILVGEVGWPTDGDKNGNVGNAYRFYNGLLPRLAANKGTPLRPGF--IEVYLFSFLDEN  317

Query  770   GKSILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDL  606
             GKSI PG+FERHWG+F +DGQ K+ +DL G GQ   L  A++V YLP +WC+ NPN KDL
Sbjct  318   GKSIAPGNFERHWGIFGYDGQPKFGMDLSGQGQNKLLVGAQNVQYLPQKWCMFNPNAKDL  377

Query  605   SAVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLV  426
             S ++++I  AC+ +DCT+L YG SCN +   GN SYAFN Y+Q+  Q+  +C+F GL  V
Sbjct  378   SKLADNIDYACTFSDCTSLGYGSSCNNLDANGNASYAFNMYFQVQNQDELACNFQGLATV  437

Query  425   TFLDPSVDECRFLV  384
             T  + S   C F++
Sbjct  438   TSQNLSQGTCNFII  451



>ref|XP_006596135.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Glycine max]
 gb|KHN09382.1| Glucan endo-1,3-beta-glucosidase 5 [Glycine soja]
Length=483

 Score =   457 bits (1176),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 229/435 (53%), Positives = 311/435 (71%), Gaps = 10/435 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             + IGVNWGT   H LP ST+V +L++N IQKVKLFDADP +L+AL  SGI+VMVGIPN+M
Sbjct  27    NGIGVNWGTQLTHPLPASTIVKMLKDNGIQKVKLFDADPDILNALKKSGIQVMVGIPNDM  86

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  ++++  AA+ WV++N++ ++ +GGV+I+YVAVGNEPFL++Y+G F++  +PA+ N+Q
Sbjct  87    LYTLANNMQAAEKWVSKNVSAHVSSGGVDIRYVAVGNEPFLSTYNGTFEAITLPALQNIQ  146

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS-LPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
              +L KA LG  VK+ VP NAD Y+S+ +PS G FR  +  +M Q+V  L+ N +PF VNI
Sbjct  147   SALVKAGLGNQVKVTVPLNADVYQSTQVPSDGDFRQNIHDLMVQIVKFLSQNNAPFTVNI  206

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPF+SLY +S+FP DYAFF G   P+ D   +Y N FD N DTLV AL K G+  MPI++
Sbjct  207   YPFISLYSDSNFPVDYAFFNGFQSPINDNGRIYDNVFDANHDTLVWALQKNGFGNMPIIV  266

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GEVGWPTDG  +ANL  A+ FNQG +   +  KGTP+RPG  P+D YLFSL DE  KSI 
Sbjct  267   GEVGWPTDGDRNANLQYAQRFNQGFMSRYIAGKGTPMRPG--PMDAYLFSLIDEDFKSIQ  324

Query  755   PGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLSA--VSN  591
             PG+FERHWG+F +DGQ KY L++G   NG L  A  V YLP +WCI+  + +L++  V+ 
Sbjct  325   PGNFERHWGLFYYDGQPKYMLNIGSRANG-LVAATGVAYLPKKWCILKTSANLNSDQVAP  383

Query  590   HIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDP  411
              +  AC  ADCT+L Y  SC G+  +GN+SYAFNSY+Q++ Q   +C F GL +VT  DP
Sbjct  384   SVSYACQNADCTSLGYQTSCGGLDARGNLSYAFNSYFQVNDQIDSACKFPGLSVVTDKDP  443

Query  410   SVDECRFLVGV-TDT  369
             S  +C+F + + TD+
Sbjct  444   STGDCKFKIMIQTDS  458



>ref|XP_010513396.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=498

 Score =   457 bits (1177),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 233/440 (53%), Positives = 305/440 (69%), Gaps = 12/440 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S++GVNWGT+A H+LPP  VV +L++N   K+KLF+AD  +L AL+GS IEVM+GIPN  
Sbjct  35    SSVGVNWGTMASHQLPPENVVKMLQDNGFTKLKLFEADQNILDALIGSDIEVMIGIPNRF  94

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  ++  ++ A  WV +N+T Y  +GGV IKY+AVGNEPFL +Y+G +  + +PA+ N+Q
Sbjct  95    LKEMAQDTAVAASWVEENVTAYSYHGGVKIKYIAVGNEPFLQTYNGTYVEFTLPALINIQ  154

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             ++L +A+L   VK+ VP NAD Y S     +PS G FRPEL     ++++ L S+ SPF 
Sbjct  155   RALEEADLK-TVKVTVPFNADIYFSPEANPVPSTGDFRPELRDATIEIINFLYSHDSPFT  213

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN+ FP D+AFF+GT  P+ DG  VY+N FD NLDTL+ AL +  +  M 
Sbjct  214   VNIYPFLSLYGNAYFPLDFAFFDGTNKPLRDGNLVYTNVFDANLDTLICALERYSFLGMK  273

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN+ +A+ FNQG++ H +   GTP R GV  +DVYLFSL +E  K
Sbjct  274   IIVGEVGWPTDGDKNANVKSAKRFNQGMVKHAMSGNGTPARKGV-IMDVYLFSLINEDAK  332

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL---GNGQ-LKNARDVPYLPYRWCIVNPNK-DLSA  600
             SI PG FERHWG+F FDG+ KY LDL   GN + L    DV YLP  WC+++PN  +L  
Sbjct  333   SIAPGTFERHWGIFEFDGRPKYELDLSGKGNDKPLVPVEDVKYLPKTWCVLDPNAYNLDD  392

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             + ++I  ACSL+DCT L YG SCN +   GN SYAFN YYQ+H Q    CDF GLGLVT 
Sbjct  393   LPDNIDYACSLSDCTALGYGSSCNHLTAIGNASYAFNMYYQMHDQKTWDCDFLGLGLVTD  452

Query  419   LDPSVDECRFLVGVTDTNNS  360
              DPS + C F V + DT NS
Sbjct  453   EDPSDELCEFPVMI-DTGNS  471



>ref|XP_003523713.2| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Glycine max]
Length=489

 Score =   457 bits (1176),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 227/441 (51%), Positives = 307/441 (70%), Gaps = 10/441 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S IGVNWGT + H L PS VV +L++N IQKVKLFDAD  +L AL  SGI+VMVGIPN+M
Sbjct  29    SGIGVNWGTQSTHPLSPSKVVKMLKDNGIQKVKLFDADAGILDALKKSGIQVMVGIPNDM  88

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  +++S  AA+ WV++N+++++ +GGV+I+YVAVGNEPFL++Y+G F++  +PA+ N+Q
Sbjct  89    LYTLANSVEAAEKWVSKNISKHVSSGGVDIRYVAVGNEPFLSTYNGSFEATTLPALQNIQ  148

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L ++ L   VK+ VP NAD Y+SS   PS G FRP++  +M Q+V  LN N +PF VN
Sbjct  149   AALTRSGLSNRVKVTVPLNADVYQSSSEKPSDGGFRPDINNVMLQIVKFLNDNGAPFTVN  208

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY + +FP DYAFF G    + D    Y N FD N DTLV AL K G+  +PI+
Sbjct  209   IYPFISLYADPNFPVDYAFFNGYQPTINDNGRAYDNVFDANHDTLVWALQKNGFGNLPII  268

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +ANL  A+ FNQG +   +  KGTP+RPG  PID YLFSL DE  KSI
Sbjct  269   VGEIGWPTDGDRNANLQYAQRFNQGFMSRYMSGKGTPMRPG--PIDAYLFSLIDEDAKSI  326

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGNGQ---LKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG+FERHWG+F FDGQ KY L+LG+ +   L  A  V +L  +WC++ P+ +L+   ++
Sbjct  327   QPGNFERHWGMFYFDGQPKYQLNLGSARGNGLVGASGVDHLAKKWCVLKPSANLNDDQLA  386

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC  ADCT+L YG SC  +   GNISYAFNSYYQ++ Q   +C F GL ++T  D
Sbjct  387   PSVAYACQNADCTSLGYGTSCGNLDVHGNISYAFNSYYQINDQMDSACKFPGLSMITDKD  446

Query  413   PSVDECRFLVGV-TDTNNSSG  354
             PSV +C+F + + TD+    G
Sbjct  447   PSVGDCKFRIMIQTDSAEPHG  467



>ref|XP_006476105.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Citrus sinensis]
Length=490

 Score =   457 bits (1176),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 230/434 (53%), Positives = 292/434 (67%), Gaps = 13/434 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT++ H LP   VV +LREN   K+KLF+AD  +L AL+GS IEVM+ IPN ML 
Sbjct  30    VGVNWGTMSTHHLPADNVVQMLRENRFNKLKLFEADKKILDALIGSDIEVMLAIPNYMLL  89

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              +S    AA  WV  N++ Y  NGGVNIKYVAVGNEPFL +Y+  ++   +PA+ N+QQ+
Sbjct  90    EMSEDPGAAASWVYANVSSYFYNGGVNIKYVAVGNEPFLRTYNDTYRYITLPALKNIQQA  149

Query  1286  LAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L  A LG  +K  VP NAD Y S     +PS G FR E+  +   ++  L+ N +PF VN
Sbjct  150   LNDAGLGSKIKATVPFNADIYNSPESNPVPSAGGFRDEVKDLTIGIIQFLHLNNAPFTVN  209

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLYGN  FP D+AFFEGT  P+ DG  +Y+N FD N DTLV +L K GY  M I+
Sbjct  210   IYPFLSLYGNDYFPVDFAFFEGTNKPIRDGSLLYTNVFDANFDTLVWSLDKAGYPDMHII  269

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +AN+  A+ F+QGL+ HVL   GTP R G   IDVYLFSL DE  KSI
Sbjct  270   VGEVGWPTDGDKNANIENAKKFSQGLLKHVLSGAGTPARKGT--IDVYLFSLLDENAKSI  327

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPN-KDLSAV  597
              PG+FERHWG+F +DG+ KY LDL +G++KN        V Y+P RWC++NP+  D   +
Sbjct  328   APGNFERHWGIFEYDGKPKYELDL-SGKMKNKGLAPVEGVAYMPRRWCVLNPHADDFEEL  386

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
              + I  ACSL+DCT L YG SCN +  +GN SYAFN YYQ++ Q   +CDF GL +VT  
Sbjct  387   PDSIDYACSLSDCTALGYGSSCNHLTVEGNASYAFNMYYQMNSQESWNCDFSGLAMVTDE  446

Query  416   DPSVDECRFLVGVT  375
             DPS D C+F V + 
Sbjct  447   DPSDDHCQFPVMIA  460



>ref|XP_009605785.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
tomentosiformis]
Length=480

 Score =   457 bits (1175),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 227/430 (53%), Positives = 296/430 (69%), Gaps = 12/430 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A H L P  VV +L++N I+KVKLFDAD   ++AL G+ IEVMV IPN+ L 
Sbjct  27    LGVNWGTMASHPLEPKIVVQMLKDNGIKKVKLFDADKTTMNALAGTDIEVMVAIPNDQLL  86

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              ++    A D WV +N+TRY +  GVNIKYVAVGNEPFL +Y+  F +   PA+ N+Q +
Sbjct  87    TMTDYDRAKD-WVRRNVTRYNIKAGVNIKYVAVGNEPFLTAYNNSFVNLTFPALQNIQNA  145

Query  1286  LAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A +G ++K  VP NAD Y S     +PS G FR ++ ++MTQ+V  +N N +PF VN
Sbjct  146   LNEAGVGDSIKATVPLNADVYFSPESNPVPSAGRFRTDIAELMTQIVQFMNKNQAPFTVN  205

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY N  FP D+AFF+G ++PVVD    Y+N FD N DTL +AL  +GY  M I+
Sbjct  206   IYPFLSLYSNEHFPIDFAFFDGASNPVVDNGVEYTNVFDANFDTLYSALKAVGYGNMNIL  265

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +ANL  A  F +GL   +  NKGTPLRPG   I+VYLF L DE  KSI
Sbjct  266   VGEVGWPTDGDKNANLNYAYRFYKGLFSRLAANKGTPLRPGY--IEVYLFGLIDEDAKSI  323

Query  758   LPGDFERHWGVFSFDGQLKYPLDL-GNGQLKN---ARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG+FERHWG+F +DGQ K+P+D+ G GQ K+   A++V YLP RWC++NPN  +LS ++
Sbjct  324   APGNFERHWGIFRYDGQPKFPMDISGQGQDKHLVAAKNVQYLPKRWCMLNPNANNLSILA  383

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
             N+I  AC+ +DCT L YG SCN +   GN SYAFN YYQ+  Q   SCDF GL +VT  +
Sbjct  384   NNIDYACTFSDCTALGYGSSCNNLDANGNASYAFNMYYQVQNQLDLSCDFQGLAMVTDKN  443

Query  413   PSVDECRFLV  384
              S   C F++
Sbjct  444   ISQGTCNFII  453



>ref|XP_009112609.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
 ref|XP_009112610.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
 ref|XP_009112611.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
 ref|XP_009112612.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
 ref|XP_009112614.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
Length=478

 Score =   457 bits (1175),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 235/432 (54%), Positives = 296/432 (69%), Gaps = 13/432 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A HKLPP TVV +L++NNI KVKLFDAD   + AL GSG+EVMV IPN+ L 
Sbjct  26    LGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPNDQLK  85

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              + S   A D WV +N+TRY  NGGVNI +VAVGNEPFL SY+G F +   PA+ N+Q +
Sbjct  86    VMGSYDRAKD-WVRKNVTRYNFNGGVNITFVAVGNEPFLKSYNGTFINLTFPALQNIQNA  144

Query  1286  LAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A LG ++K  VP NAD Y+S     +PS G FRP++   MTQ+V  L  N +P  +N
Sbjct  145   LNEAGLGNSIKATVPLNADVYDSPVSDPVPSAGRFRPDILGQMTQIVDFLGKNNAPITIN  204

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLYGN DFP +YAFF+G A P+ D    Y+N FD N DTLV++L  +G+  MPI+
Sbjct  205   IYPFLSLYGNDDFPINYAFFDG-AQPIDDHGVSYTNVFDANFDTLVSSLKAVGHGDMPII  263

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPT+G   AN   A  F  GL+  +  NKGTPLRP    I+VYLF L DE  KSI
Sbjct  264   VGEVGWPTEGDKHANNGEAYRFYNGLLPRLGTNKGTPLRPTY--IEVYLFGLLDEDAKSI  321

Query  758   LPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG FERHWG+F FDGQ K+PLDL G GQ   L  AR+V YLP +WC+ NPN KDL+ ++
Sbjct  322   APGAFERHWGLFRFDGQPKFPLDLSGQGQNKLLIGARNVTYLPNKWCMFNPNAKDLTKLA  381

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
              +I  AC+ +DCT L YG SCNG+   GN SYAFN Y+Q+  Q+ ++C F GL  VT  +
Sbjct  382   QNIDFACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQVKNQDEEACIFQGLATVTTQN  441

Query  413   PSVDECRFLVGV  378
              S  +C F V +
Sbjct  442   ISQGQCDFPVQI  453



>ref|XP_010526287.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Tarenaya 
hassleriana]
Length=490

 Score =   457 bits (1176),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 229/431 (53%), Positives = 304/431 (71%), Gaps = 11/431 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             IGVNWGT A H LPP+TVV LLREN  QKVKLF+AD A+L AL  SGI+VMVGIPN+MLA
Sbjct  27    IGVNWGTQATHPLPPATVVRLLRENGFQKVKLFEADAAILKALSRSGIQVMVGIPNDMLA  86

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             +++ S  AA+ WVAQN++ ++ + GV+I+YVAVGNEPFL +++G F +  +PA+ NVQ +
Sbjct  87    SLAGSVEAAERWVAQNVSSHVSSNGVDIRYVAVGNEPFLQTFNGTFLTTTLPAIQNVQSA  146

Query  1286  LAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIY  1113
             L KA L   VK+ VP NAD Y+S+  LPS+G FRP++  +M Q+V  L+ N +P  +NIY
Sbjct  147   LIKAGLATQVKVTVPLNADVYQSTSNLPSEGDFRPDIRDLMLQIVKFLSDNQAPLTINIY  206

Query  1112  PFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIG  933
             PF+SLY + +FP ++AFF+G + P+ D    Y N  D N DTLV AL K G+  MPI++G
Sbjct  207   PFISLYNDPNFPVEFAFFDGASAPINDNGRAYDNVLDANHDTLVWALQKNGFGNMPIIVG  266

Query  932   EVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILP  753
             E+GWPTDG  +ANL  AR FNQG +      KGTP+RPG   +DVYLFSL DE  KSI P
Sbjct  267   EIGWPTDGDKNANLQYARRFNQGFLNRQKAGKGTPMRPG--SMDVYLFSLIDEDAKSIQP  324

Query  752   GDFERHWGVFSFDGQLKYPLDLG----NGQLKNARDVPYLPYRWCIVNPNKDLS--AVSN  591
             G+FERHWG+F FDGQ KY L LG    NG L  A++V YL  +WC+++P+ +L    ++ 
Sbjct  325   GNFERHWGLFYFDGQAKYGLSLGGTNANG-LVPAKEVRYLARKWCVLSPSANLDDPQMAP  383

Query  590   HIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDP  411
              +  ACS ADCT+L YG SC  +  + NISYAFNSYYQ+  Q   +C F GL +++  DP
Sbjct  384   SVSYACSHADCTSLGYGSSCGNLDARQNISYAFNSYYQISDQLDSACKFPGLSVISNTDP  443

Query  410   SVDECRFLVGV  378
             SV +C+F + +
Sbjct  444   SVGDCKFRIMI  454



>gb|KHN10282.1| Glucan endo-1,3-beta-glucosidase 5 [Glycine soja]
Length=485

 Score =   457 bits (1175),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 227/441 (51%), Positives = 307/441 (70%), Gaps = 10/441 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S IGVNWGT + H L PS VV +L++N IQKVKLFDAD  +L AL  SGI+VMVGIPN+M
Sbjct  25    SGIGVNWGTQSTHPLSPSKVVKMLKDNGIQKVKLFDADAGILDALKKSGIQVMVGIPNDM  84

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  +++S  AA+ WV++N+++++ +GGV+I+YVAVGNEPFL++Y+G F++  +PA+ N+Q
Sbjct  85    LYTLANSVEAAEKWVSKNISKHVSSGGVDIRYVAVGNEPFLSTYNGSFEATTLPALQNIQ  144

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L ++ L   VK+ VP NAD Y+SS   PS G FRP++  +M Q+V  LN N +PF VN
Sbjct  145   AALTRSGLSNRVKVTVPLNADVYQSSSEKPSDGGFRPDINNVMLQIVKFLNDNGAPFTVN  204

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY + +FP DYAFF G    + D    Y N FD N DTLV AL K G+  +PI+
Sbjct  205   IYPFISLYADPNFPVDYAFFNGYQPTINDNGRAYDNVFDANHDTLVWALQKNGFGNLPII  264

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +ANL  A+ FNQG +   +  KGTP+RPG  PID YLFSL DE  KSI
Sbjct  265   VGEIGWPTDGDRNANLQYAQRFNQGFMSRYMSGKGTPMRPG--PIDAYLFSLIDEDAKSI  322

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGNGQ---LKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG+FERHWG+F FDGQ KY L+LG+ +   L  A  V +L  +WC++ P+ +L+   ++
Sbjct  323   QPGNFERHWGMFYFDGQPKYQLNLGSARGNGLVGASGVDHLAKKWCVLKPSANLNDDQLA  382

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC  ADCT+L YG SC  +   GNISYAFNSYYQ++ Q   +C F GL ++T  D
Sbjct  383   PSVAYACQNADCTSLGYGTSCGNLDVHGNISYAFNSYYQINDQMDSACKFPGLSMITDKD  442

Query  413   PSVDECRFLVGV-TDTNNSSG  354
             PSV +C+F + + TD+    G
Sbjct  443   PSVGDCKFRIMIQTDSAEPHG  463



>gb|AAQ90287.1| beta-1,3-glucanase, acidic [Coffea arabica]
Length=480

 Score =   457 bits (1175),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 235/436 (54%), Positives = 296/436 (68%), Gaps = 14/436 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT A HKLPP  VV +L++N I KVKLFDAD + +SAL GS IEVMV IPN+ L 
Sbjct  28    LGVNWGTQATHKLPPKVVVQMLKDNGITKVKLFDADASTMSALAGSNIEVMVAIPNDQLL  87

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              ++    A + WV +N+T YL NGGVNIKYVAVGNEPFLASY+  F +   PA+ N+Q +
Sbjct  88    VMNDYDRAKN-WVKRNVTVYLFNGGVNIKYVAVGNEPFLASYNNSFVNTTFPALQNIQNA  146

Query  1286  LAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L  A  G  +K  VP NAD Y S     +PS G FR +++  MTQ+V  LN N +PF VN
Sbjct  147   LNDAGHGDTIKATVPLNADVYFSPEGNPVPSAGRFRADISSQMTQIVQFLNQNNAPFTVN  206

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY NS FP DYAFF+G A+P+VD    Y+N FD N D LV+AL  LGY  M I+
Sbjct  207   IYPFLSLYLNSHFPVDYAFFDGAANPIVDDGVQYTNVFDANFDALVSALKGLGYGSMNIL  266

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +AN+  A  F +GL+  +  NKGTPLRPG   I+VYLF L DE  KS+
Sbjct  267   VGEVGWPTDGDRNANVNYAIRFYRGLLPRLAANKGTPLRPGY--IEVYLFGLLDEDLKSV  324

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPN-KDLSAV  597
              PG+FERHWG+F +DGQ K+P+DL +GQL++     A++V Y P +WC  NPN KDLS +
Sbjct  325   APGNFERHWGIFRYDGQPKFPMDL-SGQLQDKYLVGAQNVQYFPAKWCQFNPNAKDLSKL  383

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
               +I  AC+ ADCT L YG SCNG+   GN SYAFN Y+Q+  Q   SC+F GL +VT  
Sbjct  384   VENINYACTFADCTALGYGSSCNGLDANGNASYAFNMYFQVQNQGDLSCNFQGLAMVTEQ  443

Query  416   DPSVDECRFLVGVTDT  369
             + S   C F + +  +
Sbjct  444   NISQANCNFTIQIATS  459



>ref|NP_189076.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAB02933.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
 gb|AAY78755.1| glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
 gb|AEE76890.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=500

 Score =   457 bits (1176),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 233/441 (53%), Positives = 305/441 (69%), Gaps = 12/441 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S +GVNWG +A H+LPP  VV +L +N+  K+KLF+AD  +L AL+GS IEVM+GIPN  
Sbjct  37    SNVGVNWGIMASHQLPPEKVVKMLMDNSFTKLKLFEADQNILDALIGSDIEVMIGIPNRF  96

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  ++  +S A  WV +N+T Y  NGGVNIKY+AVGNEPFL +Y+G +  + +PA+ N+Q
Sbjct  97    LKEMAQDTSVAASWVEENVTAYSYNGGVNIKYIAVGNEPFLQTYNGTYVEFTLPALINIQ  156

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             ++L +A+L   VK+ VP NAD Y S     +PS G FRPEL     ++++ L S+ SPF 
Sbjct  157   RALEEADLKN-VKVTVPFNADIYFSPEANPVPSAGDFRPELRDATIEIINFLYSHDSPFT  215

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN+ FP D+AFF+GT   + DG  VY+N FD NLDTL+ A+ +  +  M 
Sbjct  216   VNIYPFLSLYGNAYFPLDFAFFDGTNKSLRDGNLVYTNVFDANLDTLICAMERYSFLGMK  275

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN+ +A+ FNQG++ H +   GTP R GV  +DVYLFSL DE  K
Sbjct  276   IIVGEVGWPTDGDKNANVKSAKRFNQGMVKHAMSGNGTPARKGV-IMDVYLFSLVDEDAK  334

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL---GNGQ-LKNARDVPYLPYRWCIVNPNK-DLSA  600
             SI PG FERHWG+F FDG+ KY LDL   GN + L    DV YLP  WCI++PN  +L  
Sbjct  335   SIAPGTFERHWGIFEFDGRPKYELDLSGKGNDKPLVPVEDVKYLPKTWCILDPNAYNLDD  394

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             + ++I  ACSL+DCT L YG SCN +   GN+SYAFN YYQ+H Q    CDF GLGL+T 
Sbjct  395   LPDNIDYACSLSDCTALGYGSSCNHLTATGNVSYAFNMYYQMHDQKTWDCDFLGLGLITD  454

Query  419   LDPSVDECRFLVGVTDTNNSS  357
              DPS + C F V + DT +S+
Sbjct  455   EDPSDELCEFPVMI-DTGDST  474



>gb|KGN60639.1| hypothetical protein Csa_2G005360 [Cucumis sativus]
Length=478

 Score =   456 bits (1174),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 231/437 (53%), Positives = 295/437 (68%), Gaps = 12/437 (3%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             ++GVNWGT+A H+LPP  VV +L+EN   K+KLF+AD  +L AL+GS IEVM+ IPN ML
Sbjct  8     SVGVNWGTMATHQLPPEKVVKMLQENGFHKLKLFEADDRILEALIGSDIEVMLAIPNSML  67

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
               +S    AA  WV  N+T Y  +GGV IKYVAVGNEPFL SY+G +    +PA+ N+QQ
Sbjct  68    FLMSQDPHAAASWVDSNVTAYTYHGGVKIKYVAVGNEPFLKSYNGTYLPLTLPALRNIQQ  127

Query  1289  SLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             SL  A LG  VK  +P NAD Y S     +PS G FRP++  +  +++  L+ N +PF V
Sbjct  128   SLNDAGLGSKVKATIPFNADIYNSPDSNPVPSAGEFRPDVRDLTIEILHYLSINNAPFTV  187

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAH-PVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             NIYPFLSLYGN  FP D+AFF+GTA+ P+ D    Y+N FD N DTLV+AL+K GY  M 
Sbjct  188   NIYPFLSLYGNDYFPIDFAFFDGTAYRPIKDRDLTYTNVFDANFDTLVSALAKAGYPDMK  247

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG   AN+  A+ FNQGL+ H L  +GTP R G+  IDVYLFSL DE  K
Sbjct  248   IIVGEVGWPTDGDKHANVQNAKRFNQGLLRHALSGQGTPARVGI--IDVYLFSLIDENAK  305

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNGQ----LKNARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG FERHWG+F FDG+ KY LDL   +    L     V Y+  RWC++NPN  D   
Sbjct  306   SIEPGSFERHWGIFEFDGKPKYELDLAGTEEEKGLIPVEGVRYMGKRWCVLNPNVNDWEG  365

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             +++ +  ACSL+DCT L+YG SCN +  +GN SYAFN YYQ++ Q   +CDFDGL +VT 
Sbjct  366   LADSVDYACSLSDCTALEYGSSCNQLSAQGNASYAFNMYYQVNSQKSWNCDFDGLAVVTQ  425

Query  419   LDPSVDECRFLVGVTDT  369
              DPS   C+F + +  T
Sbjct  426   QDPSYGNCQFPIMIDYT  442



>emb|CBI28434.3| unnamed protein product [Vitis vinifera]
Length=873

 Score =   469 bits (1208),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 236/440 (54%), Positives = 307/440 (70%), Gaps = 8/440 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             +AIG+NWGT A H LPP  VV+LL+ NNI +VKLFDADP VL AL GS I V VGIPN M
Sbjct  21    TAIGLNWGTAASHPLPPPRVVELLKNNNIARVKLFDADPLVLQALSGSKIAVTVGIPNSM  80

Query  1472  LaavsssssaADLWVAQNLTRYLVNGG----VNIKYVAVGNEPFLASYSGQFQSYVVPAV  1305
             L +++SS  AA+ WV  N+TRY+ + G    V I+YVAVG+EPFL SY  QF  +V+ A 
Sbjct  81    LRSLNSSKKAAESWVHDNVTRYVSSSGRGSGVRIEYVAVGDEPFLQSYGDQFHPFVIGAA  140

Query  1304  TNVQQSLAKANLGGAVKLVVPCNADAY--ESSLPSQGAFRPELTQIMTQLVSLLNSNASP  1131
             TN+Q +L +ANL   VK+VVP ++D    ES+LPS+G FR +L + M+ L++ LN + SP
Sbjct  141   TNIQTALIRANLASEVKVVVPFSSDTIQSESNLPSKGHFRSDLNKTMSHLLTFLNKHHSP  200

Query  1130  FVVNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQ  951
             F VNI PFLSL+ N +   D++ F+ TAHP  D    Y N+FD   DT+V ALS +GY +
Sbjct  201   FFVNISPFLSLHQNKNISLDFSIFKETAHPHSDSHRTYKNSFDLIYDTVVTALSTVGYPE  260

Query  950   MPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEA  771
             M IV+G++GWPTDGA +A  + A  F +GLI H+    GTPLRP VPP + Y+FSL DE 
Sbjct  261   MDIVVGQIGWPTDGAANATSSVAETFMKGLIRHLQSKSGTPLRPRVPPTETYIFSLLDED  320

Query  770   GKSILPGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAV  597
              +SI  G+FERHWG+F+FDGQ KY +DLG G   L NA++V YLP RWC+VN N+DLS  
Sbjct  321   QRSIAAGNFERHWGLFTFDGQAKYHVDLGQGSRNLVNAQNVNYLPSRWCVVNNNRDLSNA  380

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
             +     ACS+ADCT L  G SC  I    +ISY+FNSYYQ H Q   SCDF GLGL+T +
Sbjct  381   TASASEACSVADCTALSPGSSCFNISWPASISYSFNSYYQQHNQQAASCDFGGLGLITTV  440

Query  416   DPSVDECRFLVGVTDTNNSS  357
             DPS+++CRF + +  +++SS
Sbjct  441   DPSMEKCRFSIQLHTSHSSS  460



>gb|AFU52646.1| beta-1,3-glucanase 11 [Solanum tuberosum]
Length=469

 Score =   456 bits (1172),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 228/432 (53%), Positives = 296/432 (69%), Gaps = 12/432 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A HKLPP TVV +L++N I KVKLFDAD + +SAL GS +EVMV IPN+ L+
Sbjct  17    LGVNWGTMATHKLPPKTVVQMLKDNGIGKVKLFDADQSTMSALAGSDLEVMVAIPNDQLS  76

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             A++    A D WV +N+TRY   GGVNIKYVAVGNEPFL SY+  F +   PA+ N+Q +
Sbjct  77    AMNDYDRAKD-WVKRNVTRYNFKGGVNIKYVAVGNEPFLTSYNNSFLNTTFPALQNIQNA  135

Query  1286  LAKANLGGAVKLVVPCNADAY----ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A LG ++K  VP NAD Y    ++ +PS G FR ++  +MTQ+V  ++ N +PF VN
Sbjct  136   LNEAGLGSSIKATVPLNADVYFSPDDNPVPSAGRFREDINDLMTQIVQFMSQNNAPFTVN  195

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY N  FP D+AFF+G ++P+ D    Y+N FD N DTLV+AL   G   +PI+
Sbjct  196   IYPFLSLYANEHFPVDFAFFDGASNPIADNGLSYTNVFDANFDTLVSALKAAGVGNLPIL  255

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +AN+  A  F +GL+  +  N GTPLRPG   I+VYLF L DE GKSI
Sbjct  256   VGEVGWPTDGDKNANVNLAYRFYKGLLPRLAANTGTPLRPGF--IEVYLFGLIDEDGKSI  313

Query  758   LPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG+FERHWG+F +DGQ K+ +DL G GQ   L  AR+V Y   +WC+ NPN KDLS ++
Sbjct  314   APGNFERHWGIFRYDGQPKFAMDLMGQGQDKFLVAARNVEYFSKKWCMFNPNAKDLSKLA  373

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
             ++I  AC+ +DCT L YG SCNG+   GN SYAFN YYQ   Q   SC+F GL  +T  +
Sbjct  374   DNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYYQAQNQEEFSCNFQGLATLTDQN  433

Query  413   PSVDECRFLVGV  378
              S   C F + +
Sbjct  434   ISQANCNFTIQI  445



>ref|XP_009418954.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Musa acuminata 
subsp. malaccensis]
Length=478

 Score =   456 bits (1173),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 230/444 (52%), Positives = 303/444 (68%), Gaps = 14/444 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A H LPP  VV LL++N I+KVK+FDAD A ++AL GSGIEVMV IPN ML 
Sbjct  23    LGVNWGTMATHPLPPKIVVQLLKDNGIRKVKIFDADAATMNALAGSGIEVMVAIPNNMLG  82

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              +    +A   WV QN+TRY   GGVNIKYVAVGNEPFL +Y+G F +  +PA+ NVQ +
Sbjct  83    YMIDYETAKK-WVNQNVTRYNFQGGVNIKYVAVGNEPFLTTYNGSFLNLTLPALQNVQTA  141

Query  1286  LAKANLGGAVKLVVPCNADAYESSL----PSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L  A +G  +K  VP NAD Y S +    PS G FR ++  +MT++V  LN + +PF VN
Sbjct  142   LNNAGIGDTIKATVPLNADVYNSPVSNPVPSAGRFRADINDLMTEIVMFLNQSGAPFTVN  201

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY N +FP DYAFF+GT+ PVVD    Y+N FD N DTLV+AL+ +G   +PI+
Sbjct  202   IYPFLSLYDNPNFPVDYAFFDGTSTPVVDNGIQYTNVFDANFDTLVSALNAVGLGNLPII  261

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +A ++ A+ F  GL+  +  N+GTPLRP    I+VY+FSL DE  KSI
Sbjct  262   VGEVGWPTDGDINAKVSYAQRFYNGLLRRLTVNQGTPLRPN-QYIEVYMFSLIDEDAKSI  320

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPN--KDLSA  600
              PG+FERHWG+F +DGQ KY LD  +GQ +N     A+ V YLP +WC+ NPN   D+S 
Sbjct  321   DPGNFERHWGIFKYDGQPKYALD-PSGQGQNMMPVAAKGVQYLPQKWCVFNPNGGGDMSK  379

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             + ++I  ACS +DCT L YG +CNG+   GN S+AFN Y+Q+  Q  QSC F GL + T 
Sbjct  380   LGDNINYACSRSDCTALGYGSTCNGLDANGNASFAFNMYFQVQNQMTQSCFFQGLAVETT  439

Query  419   LDPSVDECRFLVGVTDTNNSSGFS  348
              +PS  +C F + +  + ++  F+
Sbjct  440   QNPSTADCNFTIQIVSSASACSFA  463



>ref|XP_006348032.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum tuberosum]
Length=475

 Score =   456 bits (1172),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 228/432 (53%), Positives = 296/432 (69%), Gaps = 12/432 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A HKLPP TVV +L++N I KVKLFDAD + +SAL GS +EVMV IPN+ L+
Sbjct  23    LGVNWGTMATHKLPPKTVVQMLKDNGIGKVKLFDADQSTMSALAGSDLEVMVAIPNDQLS  82

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             A++    A D WV +N+TRY   GGVNIKYVAVGNEPFL SY+  F +   PA+ N+Q +
Sbjct  83    AMNDYDRAKD-WVKRNVTRYNFKGGVNIKYVAVGNEPFLTSYNNSFLNTTFPALQNIQNA  141

Query  1286  LAKANLGGAVKLVVPCNADAY----ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A LG ++K  VP NAD Y    ++ +PS G FR ++  +MTQ+V  ++ N +PF VN
Sbjct  142   LNEAGLGSSIKATVPLNADVYFSPDDNPVPSAGRFREDINDLMTQIVQFMSQNNAPFTVN  201

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY N  FP D+AFF+G ++P+ D    Y+N FD N DTLV+AL   G   +PI+
Sbjct  202   IYPFLSLYANEHFPVDFAFFDGASNPIADNGLSYTNVFDANFDTLVSALKAAGVGNLPIL  261

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +AN+  A  F +GL+  +  N GTPLRPG   I+VYLF L DE GKSI
Sbjct  262   VGEVGWPTDGDKNANVNLAYRFYKGLLPRLAANTGTPLRPGF--IEVYLFGLIDEDGKSI  319

Query  758   LPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG+FERHWG+F +DGQ K+ +DL G GQ   L  AR+V Y   +WC+ NPN KDLS ++
Sbjct  320   APGNFERHWGIFRYDGQPKFAMDLMGQGQDKFLVAARNVEYFSKKWCMFNPNAKDLSKLA  379

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
             ++I  AC+ +DCT L YG SCNG+   GN SYAFN YYQ   Q   SC+F GL  +T  +
Sbjct  380   DNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYYQAQNQEEFSCNFQGLATLTDQN  439

Query  413   PSVDECRFLVGV  378
              S   C F + +
Sbjct  440   ISQANCNFTIQI  451



>ref|XP_010536989.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Tarenaya hassleriana]
Length=483

 Score =   456 bits (1173),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 230/429 (54%), Positives = 295/429 (69%), Gaps = 9/429 (2%)
 Frame = -3

Query  1655  ESAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
              S IG NWGT + H LPP  VV LLR+N IQKVKLFDAD   L AL  SGIEVMVGIPN+
Sbjct  24    SSGIGANWGTQSSHPLPPDVVVRLLRDNGIQKVKLFDADYDTLRALGKSGIEVMVGIPND  83

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             ML++++SS  AA+ WV++N++ +L    VNI+YVAVGNEPFL +Y+G +     PA+ N+
Sbjct  84    MLSSLASSLKAAEKWVSKNVSTHLSTDTVNIRYVAVGNEPFLETYNGSYLKTTFPALRNI  143

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             Q +L KA L   VK+ VP NAD YESS  LPS G FR ++  +M  +V  L+ N  PF V
Sbjct  144   QIALVKAGLQNQVKVTVPLNADVYESSTGLPSGGDFRSDIRDLMITIVKFLSDNGGPFTV  203

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
             NIYPF+SLY +++FP +YAFF+G + P+ DG   Y N FD N DTLV AL K G+  MPI
Sbjct  204   NIYPFISLYIDANFPVEYAFFDGNSSPLNDGGTYYYNMFDANHDTLVHALQKNGFGNMPI  263

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             ++GE+GWPTDG  +AN+  AR FNQG + H+ G KGTP+RPG  PIDVYLFSL DE  KS
Sbjct  264   IVGEIGWPTDGDRNANIEYARRFNQGFMSHISGGKGTPMRPG--PIDVYLFSLIDEDAKS  321

Query  761   ILPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AV  597
             I PG+FERHWG+F++DG+ KY L+LG   +G L  A+ V YL  +WCI+ PN  L    V
Sbjct  322   IQPGNFERHWGIFTYDGRPKYQLNLGTTNSGALIPAKGVRYLEQKWCIMKPNAKLDDPQV  381

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
             +  +  AC L DCT+L YG SC  +  +GNISYAFNSY+Q+  Q   +C F  + ++   
Sbjct  382   APSVSYACGLGDCTSLGYGTSCGNLDARGNISYAFNSYFQIQDQQDSACKFPNISMIIKT  441

Query  416   DPSVDECRF  390
             DPS   C+F
Sbjct  442   DPSRGSCKF  450



>ref|XP_009376335.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Pyrus x bretschneideri]
Length=500

 Score =   456 bits (1174),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 229/432 (53%), Positives = 298/432 (69%), Gaps = 9/432 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S IG NWGT A H LPP TVV LL++N  Q+VKLFDAD   L++L  SGIEVMVGIPN+M
Sbjct  39    SGIGANWGTQASHPLPPDTVVRLLKDNGFQRVKLFDADYDTLNSLAKSGIEVMVGIPNDM  98

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA++++S  AA+ WV++N++ ++ +  V I+YVAVGNEPFL++Y+G F     PA+ NVQ
Sbjct  99    LASLATSVKAAEKWVSKNVSAHISSNNVKIRYVAVGNEPFLSTYNGSFLRTTFPALQNVQ  158

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA L   VK+ VP NAD Y SS   PS G FR ++   M Q+V  L+ N  PF VN
Sbjct  159   SALIKAGLSNQVKVTVPQNADVYASSNGFPSGGDFRTDIHDYMIQIVKFLSDNGCPFTVN  218

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY +S+FP DYAFF+G A P+ DG   Y N FD N DTLV  L K G+  +PI+
Sbjct  219   IYPFISLYIDSNFPVDYAFFDGNASPITDGSATYYNMFDANYDTLVWTLQKNGFGNLPII  278

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +ANL  A+ FNQG + H+LG +GTP+RPG  PID YLFSL DE  KSI
Sbjct  279   VGEIGWPTDGDRNANLVYAQRFNQGFMSHILGGRGTPMRPG--PIDAYLFSLIDEDAKSI  336

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDL--SAVS  594
              PG+FERHWG+F+FDG  KY L+LG   +G L  A+ V YL  +WC++ P+  L    V+
Sbjct  337   DPGNFERHWGIFTFDGLAKYQLNLGSTNSGALVPAKGVRYLERKWCVMKPSASLDDQQVA  396

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC LADCT+L YG SC  + ++ NISYA NSYYQ + Q  ++C F  L ++T  +
Sbjct  397   LSVSYACGLADCTSLGYGTSCGNLDDRANISYAVNSYYQRNNQLDEACKFPNLSMITKTN  456

Query  413   PSVDECRFLVGV  378
             PSV  CRF + +
Sbjct  457   PSVGSCRFEIMI  468



>ref|XP_006488579.1| PREDICTED: glucan endo-1,3-beta-glucosidase 9-like [Citrus sinensis]
Length=485

 Score =   456 bits (1173),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 229/438 (52%), Positives = 295/438 (67%), Gaps = 7/438 (2%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             AIGVNWGT A H LPP+ VV+LL+ NNI KVKLFDADP VL AL GS I V VGIPN +L
Sbjct  23    AIGVNWGTNASHPLPPAKVVELLKSNNIAKVKLFDADPLVLEALSGSNIGVTVGIPNSLL  82

Query  1469  aavsssssaADLWVAQNLTRYLVNG---GVNIKYVAVGNEPFLASYSGQFQSYVVPAVTN  1299
              +++SS  AA+ WV  N+TRY   G   GV  +YVA+G+EPFL SYS QF  +++ A  N
Sbjct  83    KSLNSSKKAAESWVHDNVTRYFSAGHGNGVRFEYVALGDEPFLQSYSEQFHPFIIGAAMN  142

Query  1298  VQQSLAKANLGGAVKLVVPCNADAY--ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             +Q +L +ANL   VK+VVPC+ D +  ES  PS G FRP+L + M +L+  L+ + SPF 
Sbjct  143   IQIALGRANLASEVKVVVPCSFDTFLSESGKPSGGHFRPDLNKTMIELLEFLSKHHSPFF  202

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             V I PF+S + N +   D+A F+ TAHP  D    Y N+FD + DTLV ALS +G+ +M 
Sbjct  203   VTISPFISFHQNKNISLDFALFKETAHPHKDSHKTYKNSFDLSYDTLVTALSTVGFPEMD  262

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             IV+ ++GWPTDG  +A  + A  F +GLI H+    GTPLRP  PPI+ Y++SL DE  +
Sbjct  263   IVVAQIGWPTDGVANATSSTAEIFMKGLINHLRSRSGTPLRPRNPPIETYIYSLLDEDQR  322

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNG--QLKNARDVPYLPYRWCIVNPNKDLSAVSN  591
                 G+FERHWGVF+FDGQ KY L+ G    +L NAR+V YLP RWC+VN NKDLS  + 
Sbjct  323   RTATGNFERHWGVFTFDGQAKYHLNFGQNAEKLVNARNVEYLPSRWCVVNNNKDLSNATA  382

Query  590   HIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDP  411
                 ACS+ADC+ +  GGSC  I    NISYAFNSYYQ H Q   +CDF GLGL+T +DP
Sbjct  383   VALEACSVADCSAISPGGSCYNISWPRNISYAFNSYYQQHNQRHDNCDFGGLGLITTVDP  442

Query  410   SVDECRFLVGVTDTNNSS  357
             S D CRF + +  + ++S
Sbjct  443   SADNCRFSIELRTSYSAS  460



>ref|XP_003624610.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|ABN09816.1| Glycoside hydrolase, family 17; X8 [Medicago truncatula]
 gb|AES80828.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=480

 Score =   456 bits (1172),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 231/442 (52%), Positives = 298/442 (67%), Gaps = 14/442 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
               +GVNWGT A HKLPP TVV +L++N IQKVKLFDAD   ++AL GSGIEVMV IPN  
Sbjct  24    EGLGVNWGTQATHKLPPETVVKMLKDNGIQKVKLFDADDTTMTALAGSGIEVMVAIPNNQ  83

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA ++    A   WV +N+TRY  +GGV IKYVAVGNEPFL +Y+  F +   PA+ N+Q
Sbjct  84    LAEMNDFKRA-QYWVRKNVTRYNFDGGVKIKYVAVGNEPFLKAYNNSFLNITFPALQNIQ  142

Query  1292  QSLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              ++ +A LG  VK  VP NAD Y S     +PS G FRP++  +MTQ+V  LN N +PF 
Sbjct  143   NAINEAGLGDTVKATVPLNADVYMSPPDNQVPSAGIFRPDINGLMTQMVQFLNKNGAPFT  202

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN DFP ++AFF+G   P+ D    Y+N FD N DTLV+AL  +G+   P
Sbjct  203   VNIYPFLSLYGNDDFPFNFAFFDGVDKPITDNGIQYTNVFDANFDTLVSALKSIGFGDTP  262

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPT+G  +AN   A  F  GL+  +  N+GTPLRPG   I+VYLF L DE  K
Sbjct  263   ILVGEVGWPTEGDKNANSGNAIRFYNGLLSRLAANRGTPLRPGF--IEVYLFGLIDEDAK  320

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPN-KDLS  603
             SI PG+FERHWG+F +DGQ K+P+DL +GQL+N     A+ V YL   WC+ NP+ KDLS
Sbjct  321   SIAPGNFERHWGIFRYDGQPKFPMDL-SGQLQNKLLVGAQGVKYLDPMWCMFNPDAKDLS  379

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              ++++I  AC+  DCT L YG SCN +   GN SYAFN YYQ   Q+ Q+C+F+GL   T
Sbjct  380   KLADNINFACTFGDCTALGYGSSCNNLDANGNASYAFNMYYQTQNQDRQACNFEGLAKPT  439

Query  422   FLDPSVDECRFLVGVTDTNNSS  357
               + S   C F++ +  ++ SS
Sbjct  440   TDNISTPTCNFIIQIVPSSASS  461



>gb|KDO67009.1| hypothetical protein CISIN_1g011468mg [Citrus sinensis]
Length=485

 Score =   456 bits (1173),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 229/438 (52%), Positives = 295/438 (67%), Gaps = 7/438 (2%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             AIGVNWGT A H LPP+ VV+LL+ NNI KVKLFDADP VL AL GS I V VGIPN +L
Sbjct  23    AIGVNWGTNASHPLPPAKVVELLKSNNIAKVKLFDADPLVLEALSGSNIGVTVGIPNSLL  82

Query  1469  aavsssssaADLWVAQNLTRYLVNG---GVNIKYVAVGNEPFLASYSGQFQSYVVPAVTN  1299
              +++SS  AA+ WV  N+TRY   G   GV  +YVA+G+EPFL SYS QF  +++ A  N
Sbjct  83    KSLNSSKKAAESWVHDNVTRYFSAGHGNGVRFEYVALGDEPFLQSYSEQFHPFIIGAAMN  142

Query  1298  VQQSLAKANLGGAVKLVVPCNADAY--ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             +Q +L +ANL   VK+VVPC+ D +  ES  PS G FRP+L + M +L+  L+ + SPF 
Sbjct  143   IQIALGRANLASEVKVVVPCSFDTFLSESGKPSGGHFRPDLNKTMIELLEFLSKHHSPFF  202

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             V I PF+S + N +   D+A F+ TAHP  D    Y N+FD + DTLV ALS +G+ +M 
Sbjct  203   VTISPFISFHQNKNISLDFALFKETAHPHKDSHKTYKNSFDLSYDTLVTALSTVGFPEMD  262

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             IV+ ++GWPTDG  +A  + A  F +GLI H+    GTPLRP  PPI+ Y++SL DE  +
Sbjct  263   IVVAQIGWPTDGVANATSSTAEIFMKGLINHLRSRSGTPLRPRNPPIETYIYSLLDEDQR  322

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNG--QLKNARDVPYLPYRWCIVNPNKDLSAVSN  591
                 G+FERHWGVF+FDGQ KY L+ G    +L NAR+V YLP RWC+VN NKDLS  + 
Sbjct  323   RTATGNFERHWGVFTFDGQAKYHLNFGQNAEKLVNARNVEYLPSRWCVVNNNKDLSNATA  382

Query  590   HIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDP  411
                 ACS+ADC+ +  GGSC  I    NISYAFNSYYQ H Q   +CDF GLGL+T +DP
Sbjct  383   IALEACSVADCSAISPGGSCYNISWPRNISYAFNSYYQQHNQRHDNCDFGGLGLITTVDP  442

Query  410   SVDECRFLVGVTDTNNSS  357
             S D CRF + +  + ++S
Sbjct  443   SADNCRFSIELRTSYSAS  460



>ref|XP_011082117.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Sesamum indicum]
Length=484

 Score =   456 bits (1172),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 230/436 (53%), Positives = 305/436 (70%), Gaps = 11/436 (3%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             +IG NWGT A H L PS VV LL++N IQKVKLFDA+  VL+AL GSGIEVMVGIPN+ML
Sbjct  26    SIGANWGTQATHPLHPSIVVKLLKDNGIQKVKLFDAEATVLNALSGSGIEVMVGIPNDML  85

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
             + +++S  AA+ WV +N++ ++ +  V+I+YVAVGNEPFL++Y+G FQ+  +PA+ N+Q 
Sbjct  86    STLANSVDAAERWVERNVSAHVSSNSVDIRYVAVGNEPFLSTYNGTFQATTLPALQNIQA  145

Query  1289  SLAKANLGGAVKLVVPCNADAYESSL--PSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             +L KA LG  VK+ VP NAD Y+SS   PS G FR  +  +M Q+VS L+ N +PF VNI
Sbjct  146   ALIKAGLGNRVKVTVPLNADVYQSSTEQPSTGDFRANIHDLMVQIVSFLSLNGAPFTVNI  205

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             YPF+SLY + +FP DYAFF+G + P+VD    Y+N FD N DTLV AL K G+  M I++
Sbjct  206   YPFISLYNDPNFPVDYAFFDGYSSPIVDNGRTYTNVFDANYDTLVWALQKNGFGNMTIIV  265

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDG  +AN+  A+ FNQG + H+  N GTP+RPG  PID YLFSL DE  KSI 
Sbjct  266   GEIGWPTDGDRNANIGYAQRFNQGFMSHM--NAGTPMRPG--PIDAYLFSLIDEDAKSIQ  321

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNG---QLKNARDVPYLPYRWCIVNPNKDLS--AVSN  591
             PG+FERHWG+F++DG  KY L LG+     L  A +V YLP RWC+++P+ +L    V+ 
Sbjct  322   PGNFERHWGIFNYDGTPKYNLSLGSSNSHSLVPASNVHYLPRRWCVLSPSANLEDPQVAL  381

Query  590   HIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDP  411
              +  AC+  DCT+L YG SC  +  + NISYAFNSYYQ++ Q   +C F  L ++T  DP
Sbjct  382   SVSYACANGDCTSLGYGTSCGNLDAQRNISYAFNSYYQINNQLESACRFPNLSVITTTDP  441

Query  410   SVDECRFLVGVTDTNN  363
             SV  CRF + +    N
Sbjct  442   SVGTCRFNIMIQTAAN  457



>ref|XP_006599436.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=483

 Score =   456 bits (1172),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 305/441 (69%), Gaps = 12/441 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
               +GVNWGT A H+L   TVV++L++N IQKVKLFDAD + +SAL GSGIEVMV IPN  
Sbjct  26    EGLGVNWGTQATHQLKADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIEVMVAIPNNQ  85

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA ++    A   WV +N+TRY   GG+NIKYVAVGNEPFL SY+G F +  +PA+ N+Q
Sbjct  86    LAEMNDYDRALQ-WVKKNVTRYNFRGGINIKYVAVGNEPFLKSYNGSFLNITLPALQNIQ  144

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L  A LG ++K  VP NAD YES     +PS G FRP+++ +MTQ+V  L  N +PF 
Sbjct  145   NALNDAGLGDSIKATVPLNADVYESPPNNPVPSAGIFRPDISDLMTQIVQFLAKNNAPFT  204

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN +FP DYAFF+G A+P+ D    Y+N FD N DTLV+AL K+GY  MP
Sbjct  205   VNIYPFLSLYGNDNFPFDYAFFDGVANPINDNGVSYTNVFDANFDTLVSALEKVGYGNMP  264

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN+  A  F  GL+  +  NKGTPLRPG   I+VYLF L DE  K
Sbjct  265   ILVGEVGWPTDGDKNANVGNAFRFYNGLLPRLAINKGTPLRPGF--IEVYLFGLIDEDAK  322

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSA  600
             +I PG+FERHWG+F +DG+ K+P+DL G GQ   L  A++V YL   WC+ NP+ +DLS 
Sbjct  323   TIAPGNFERHWGIFGYDGKPKFPMDLSGKGQNKLLVGAQNVHYLEPNWCMFNPDAQDLSK  382

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++++I  AC+ ADCT + YG S N +   GN SYAFN YYQ   QN  +C+F+GL  +T 
Sbjct  383   LADNINYACTFADCTAIGYGSSGNNLDANGNASYAFNMYYQTQDQNYMACNFEGLARLTT  442

Query  419   LDPSVDECRFLVGVTDTNNSS  357
              + S   C F+V +  + +SS
Sbjct  443   SNISTPTCNFIVQINPSLSSS  463



>ref|XP_010036190.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Eucalyptus 
grandis]
 gb|KCW47732.1| hypothetical protein EUGRSUZ_K01479 [Eucalyptus grandis]
Length=481

 Score =   456 bits (1172),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 236/438 (54%), Positives = 301/438 (69%), Gaps = 13/438 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A HKLPP TVV +L++N IQKVKLFDAD   +SAL GSGIEVMV IPN+ LA
Sbjct  28    LGVNWGTLATHKLPPKTVVQMLKDNGIQKVKLFDADRKTMSALAGSGIEVMVAIPNDQLA  87

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              + S   A + WV +N+T Y   GGVN+KYVAVGNEPFL SY+G F +  +PA+ N+Q++
Sbjct  88    VMGSYDRAQE-WVKKNVTAYNFTGGVNVKYVAVGNEPFLKSYNGSFVNTTLPALQNIQKA  146

Query  1286  LAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A LG  VK  VP NAD YES     LPS G FR +++ +MTQ+V  +  N +PF VN
Sbjct  147   LNEAGLGDTVKATVPLNADVYESPEDNPLPSAGTFRSDISDVMTQIVKFMAENNAPFTVN  206

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLYGN+DFP +YAFF+G A P+VD    Y+N FD N DTLV+AL  +G+  M I+
Sbjct  207   IYPFLSLYGNNDFPFNYAFFDG-ATPIVDKGIEYTNVFDANFDTLVSALKAVGHGNMTII  265

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGEVGWPT+G  +AN   A  F  GL   +  N+GTPLRPG   I+VYLF L DE  KS+
Sbjct  266   IGEVGWPTEGDINANNGNAYRFYNGLFTKLGANRGTPLRPGY--IEVYLFGLIDEDAKSV  323

Query  758   LPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG+FERHWG+F +DGQ K+ +DL G GQ   L  A++V Y P +WC  N   KD+S + 
Sbjct  324   APGNFERHWGLFRYDGQPKFLIDLTGRGQNKLLIPAQNVEYQPQKWCTFNAGAKDVSKLV  383

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
             ++I  AC+ ADCTTL YG SCN +   GN SYAFN+Y+Q   Q+P SC+F GL  VT  +
Sbjct  384   DNINFACTYADCTTLGYGSSCNSLDANGNASYAFNAYFQTQNQDPDSCNFQGLATVTTKN  443

Query  413   PSVDECRFLVGVTDTNNS  360
              S   C F + +  ++ S
Sbjct  444   ISQGSCNFTIQLVASSTS  461



>ref|XP_008812061.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Phoenix dactylifera]
Length=477

 Score =   455 bits (1171),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 231/432 (53%), Positives = 297/432 (69%), Gaps = 12/432 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A H LPP  VV LL++N I+KVKLFDAD A +SAL GSGIEVMV IPN  L 
Sbjct  23    LGVNWGTMATHPLPPEIVVQLLKDNGIKKVKLFDADAATMSALAGSGIEVMVAIPNNQLG  82

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             A++  ++A   WV +N+TRY  +GGVNIKYVAVGNEPFL+SY+G F +   PA+ N+Q +
Sbjct  83    AMNDYATAKK-WVNRNVTRYNFDGGVNIKYVAVGNEPFLSSYNGSFLNVTFPALQNIQNA  141

Query  1286  LAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A  GG +K  VP NAD Y S     +PS G FR ++  +MTQ+V  LN   +PF VN
Sbjct  142   LNEAGAGG-IKATVPLNADVYNSPTNNPVPSAGRFRSDINDLMTQIVQFLNQAGAPFTVN  200

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY N +FP D+AFF+GT+ PVVD    Y+N FD N DTLV+AL  +G   +P++
Sbjct  201   IYPFLSLYDNDNFPLDFAFFDGTSQPVVDNGIQYANVFDANFDTLVSALKAVGLGDLPVI  260

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +A  + A+ F  GL+  +  N GTPLRP    ++VYLFSL DE  KSI
Sbjct  261   VGEVGWPTDGDKNAKASYAQRFYNGLLKRLAANSGTPLRPN-QYLEVYLFSLIDEDAKSI  319

Query  758   LPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG+FERHWG+  +DGQ K+P+DL G GQ   L  A++V YLP  WC+ NPN KDLS + 
Sbjct  320   APGNFERHWGILKYDGQPKFPMDLSGQGQNKMLVAAKNVEYLPQTWCVFNPNAKDLSKLG  379

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
             ++I  AC+ +DCT L YG +CN +   GN SYAFN Y+Q+  Q   SC F GL + T  +
Sbjct  380   DNINYACTFSDCTPLGYGSTCNQLDANGNASYAFNMYFQVQNQKDMSCFFQGLAMQTTQN  439

Query  413   PSVDECRFLVGV  378
             PS  EC F + +
Sbjct  440   PSTAECNFTIQI  451



>gb|KCW82758.1| hypothetical protein EUGRSUZ_C04137 [Eucalyptus grandis]
Length=558

 Score =   458 bits (1178),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 231/431 (54%), Positives = 292/431 (68%), Gaps = 13/431 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S++GVNWGT + H+LPP  VV +L+EN I+K+KLF+ D  +L AL GS IEVM+ +PN M
Sbjct  97    SSVGVNWGTQSNHQLPPEKVVKMLKENGIKKLKLFEYDEKILGALAGSKIEVMLAVPNYM  156

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  +S   S A  WV  N+T Y   GGVNIKY+AVGNEPFL SY+ ++   V+PA+ N+ 
Sbjct  157   LEIMSVDPSFAASWVDTNVTSYRYTGGVNIKYIAVGNEPFLQSYNHKYVRQVLPALRNIH  216

Query  1292  QSLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             ++L +A L   VK+ VP NAD Y S      PS G FRPE+     +++  L  N SPF 
Sbjct  217   EALHRARLSSKVKVTVPFNADVYYSPPPNEYPSSGDFRPEVRDAAIEIIHFLYINDSPFT  276

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLY N +FP D+AFF+GT  PV DG  VY+N FD N D LV+AL+K GYS M 
Sbjct  277   VNIYPFLSLYQNQNFPVDFAFFDGTTEPVKDGDRVYTNVFDANFDILVSALTKAGYSDME  336

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GE+GWPTDG   AN+  A+ FNQGL+ H L   GTP R GV  IDVYLFSL DE  K
Sbjct  337   ILVGEIGWPTDGDKFANIKNAQRFNQGLLKHALSGDGTPARKGV--IDVYLFSLIDEDTK  394

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNGQLKNARDVP-----YLPYRWCIVNPN-KDLS  603
             +I PG+FERHWG+F +DG+ KY LDL +G  K+ R VP     Y+P RWCI+NP   DL+
Sbjct  395   NIDPGNFERHWGLFEYDGKPKYELDL-SGSEKDTRLVPVMGVSYMPRRWCILNPELNDLT  453

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              +  +I  AC  +DCT L YG SCN +  +GN SYAFN YYQ++ Q   +CDF GL  VT
Sbjct  454   DLGENIDYACKSSDCTALGYGSSCNNLSSQGNASYAFNRYYQMNDQRIMACDFQGLAEVT  513

Query  422   FLDPSVDECRF  390
               DPS +EC+F
Sbjct  514   ENDPSTEECQF  524



>ref|XP_004163604.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
8-like [Cucumis sativus]
Length=478

 Score =   455 bits (1170),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 231/437 (53%), Positives = 294/437 (67%), Gaps = 12/437 (3%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             ++GVNWGT+A H+LPP  VV +L+EN   K+KLF+AD  +L AL+GS IEVM+ IPN ML
Sbjct  8     SVGVNWGTMATHQLPPEKVVKMLQENGFHKLKLFEADDRILEALIGSDIEVMLAIPNSML  67

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
               +S    AA  WV  N+T Y  +GGV IKYVAVGNEPFL SY+G +    +PA+ N+QQ
Sbjct  68    FLMSQDPHAAASWVDSNVTAYTYHGGVKIKYVAVGNEPFLKSYNGTYLPLTLPALRNIQQ  127

Query  1289  SLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             SL  A LG  VK  +P NAD Y S     +PS G FRP++  +  +++  L+ N +PF V
Sbjct  128   SLNDAGLGSKVKATIPFNADIYNSPDSNPVPSAGEFRPDVRDLTIEILHYLSINNAPFTV  187

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAH-PVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             NIYPFLSLYGN  FP D+AFF+GTA+ P+ D    Y+N FD N DTLV+AL+K GY  M 
Sbjct  188   NIYPFLSLYGNDYFPIDFAFFDGTAYRPIKDRDLTYTNVFDANFDTLVSALAKAGYPDMK  247

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG   AN+  A+ FNQGL+ H L  +GTP R G+  IDVYLFSL DE  K
Sbjct  248   IIVGEVGWPTDGDKHANVQNAKRFNQGLLRHALSGQGTPARVGI--IDVYLFSLIDENAK  305

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNGQ----LKNARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG FERHWG+F FDG+ KY LDL   +    L     V Y+  RWC +NPN  D   
Sbjct  306   SIEPGSFERHWGIFEFDGKPKYELDLAGTEEEKGLIPVEGVRYMGKRWCXLNPNVNDWEG  365

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             +++ +  ACSL+DCT L+YG SCN +  +GN SYAFN YYQ++ Q   +CDFDGL +VT 
Sbjct  366   LADSVDYACSLSDCTALEYGSSCNQLSAQGNASYAFNMYYQVNSQKSWNCDFDGLAVVTQ  425

Query  419   LDPSVDECRFLVGVTDT  369
              DPS   C+F + +  T
Sbjct  426   QDPSYGNCQFPIMIDYT  442



>emb|CDY03359.1| BnaC09g09890D [Brassica napus]
Length=477

 Score =   455 bits (1170),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 235/432 (54%), Positives = 296/432 (69%), Gaps = 13/432 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A HKLPP TVV +L++NNI KVKLFDAD   + AL GSG+EVMV IPN+ L 
Sbjct  25    LGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPNDQLK  84

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              + S   A D WV +N+TRY  +GGVNI +VAVGNEPFL SY+G F +   PA+ N+Q +
Sbjct  85    VMGSYDRAKD-WVHKNVTRYNFSGGVNITFVAVGNEPFLKSYNGTFINLTFPALQNIQNA  143

Query  1286  LAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A LG +VK  VP NAD Y+S     +PS G FRP++   MTQ+V  L  N +P  +N
Sbjct  144   LNEAGLGNSVKATVPLNADVYDSPASDPVPSAGRFRPDILGQMTQIVDFLGKNNAPITIN  203

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLYGN DFP +YAFF+G A P+ D    Y+N FD N DTLV++L  +G+  MPI+
Sbjct  204   IYPFLSLYGNDDFPINYAFFDG-AQPIDDHGVSYTNVFDANFDTLVSSLKAVGHGDMPII  262

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPT+G   AN   A  F  GL+  +  NKGTPLRP    I+VYLF L DE  KSI
Sbjct  263   VGEVGWPTEGDKHANNGEAYRFYNGLLPRLGTNKGTPLRPTY--IEVYLFGLLDEDAKSI  320

Query  758   LPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG FERHWG+F FDGQ K+PLDL G GQ   L  AR+V YLP +WC+ NPN KDL+ ++
Sbjct  321   APGAFERHWGLFRFDGQPKFPLDLSGQGQNKLLIGARNVTYLPNKWCMFNPNAKDLTKLA  380

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
              +I  AC+ +DCT L YG SCNG+   GN SYAFN Y+Q+  Q+ ++C F GL  VT  +
Sbjct  381   QNIDFACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQVKNQDEEACIFQGLATVTTQN  440

Query  413   PSVDECRFLVGV  378
              S  +C F V +
Sbjct  441   ISQGQCDFPVQI  452



>ref|XP_009102513.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
Length=494

 Score =   455 bits (1171),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 230/440 (52%), Positives = 305/440 (69%), Gaps = 12/440 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             +++GVNWGT+A H+LPP  VV +L++N   K+KLF+AD  +L+AL GS IEVM+GIPN +
Sbjct  35    TSVGVNWGTMASHQLPPENVVKMLKDNGFTKLKLFEADQNILNALTGSDIEVMIGIPNRL  94

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  V+   + A  WV +N+T Y  NGGVNIKY+AVGNEPFL +Y+G +  + +PA+ N+Q
Sbjct  95    LKEVAQDPALAASWVEENVTAYSYNGGVNIKYIAVGNEPFLQTYNGTYVEFTLPALVNIQ  154

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             ++L +A L   V++ VP NAD Y S     +PS G FRPEL  +  ++++ L ++ SPF 
Sbjct  155   KALEEAGLKN-VRVTVPFNADIYFSPESNPVPSAGDFRPELRDVTIEIINFLYTHDSPFT  213

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN+ FP D+AFF+G+ + + DG  VY+N FD NLDTLV A+ +  +  M 
Sbjct  214   VNIYPFLSLYGNAYFPVDFAFFDGSNNSLRDGDLVYNNVFDANLDTLVCAMERYSFLGMK  273

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN  +A+ FNQG++ H +   GTP R GV  +DVYLFSL DE  K
Sbjct  274   IIVGEVGWPTDGDKNANAKSAKRFNQGMVKHAMSGNGTPARKGV-IMDVYLFSLVDEDAK  332

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQLKN---ARDVPYLPYRWCIVNPNK-DLSA  600
             SI PG FERHWG+F FDG+ KY LDL G G  K     +DV YLP  WC+++ N  +L  
Sbjct  333   SIAPGTFERHWGIFEFDGRPKYELDLSGKGDDKTLVPVQDVKYLPKTWCVLDTNAFNLDD  392

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             +++++  ACSL+DCT L YG SCN +   GN SYAFN YYQ+H Q    CDF GLGL+T 
Sbjct  393   LADNVDYACSLSDCTALGYGSSCNHLTNVGNASYAFNMYYQMHDQKTWDCDFLGLGLITD  452

Query  419   LDPSVDECRFLVGVTDTNNS  360
              DPS D C F V + DT NS
Sbjct  453   EDPSDDLCEFPVMI-DTGNS  471



>ref|XP_008380615.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Malus domestica]
 ref|XP_008380617.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Malus domestica]
Length=500

 Score =   456 bits (1172),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 229/432 (53%), Positives = 297/432 (69%), Gaps = 9/432 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S IG NWGT A H LPP TVV LL++N  Q+VKLFDAD   L++L  SGIEVMVGIPN+M
Sbjct  39    SGIGANWGTQASHPLPPDTVVRLLKDNGFQRVKLFDADYDTLNSLAKSGIEVMVGIPNDM  98

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA++++S  AA+ WV++N++ ++ +  V I+YVAVGNEPFL +Y+G F     PA+ NVQ
Sbjct  99    LASLATSVKAAEKWVSKNVSAHISSNNVKIRYVAVGNEPFLETYNGSFLRTTFPALQNVQ  158

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA L   VK+ VP NAD Y SS   PS G FR ++   M Q+V  L+ N  PF VN
Sbjct  159   SALIKAGLSNQVKVTVPQNADVYASSNGFPSGGDFRTDIHDYMIQIVKFLSDNGCPFTVN  218

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY +S+FP DYAFF+G A P+ DG   Y N FD N DTLV  L K G+  +PI+
Sbjct  219   IYPFISLYIDSNFPVDYAFFDGNASPITDGSATYYNMFDANYDTLVWTLQKNGFGNLPII  278

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +ANL  A+ FNQG + H+LG +GTP+RPG  PID YLFSL DE  KSI
Sbjct  279   VGEIGWPTDGDRNANLVYAQRFNQGFMSHILGGRGTPMRPG--PIDAYLFSLIDEDAKSI  336

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG+FERHWG+F+FDG  KY L+LG   +G L  A+ V YL  +WC++ P+  L    V+
Sbjct  337   DPGNFERHWGIFTFDGLAKYQLNLGSTNSGALVPAKGVHYLERKWCVMKPSASLDDPQVA  396

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC LADCT+L YG SC  + ++ NISYA NSYYQ + Q  ++C F  L ++T  +
Sbjct  397   LSVSYACGLADCTSLGYGTSCGNLDDRANISYAVNSYYQRNNQLDEACKFPNLSMITKTN  456

Query  413   PSVDECRFLVGV  378
             PSV  CRF + +
Sbjct  457   PSVGSCRFEIMI  468



>ref|XP_002313970.1| hypothetical protein POPTR_0009s08030g [Populus trichocarpa]
 gb|EEE87925.1| hypothetical protein POPTR_0009s08030g [Populus trichocarpa]
Length=480

 Score =   455 bits (1170),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 229/437 (52%), Positives = 297/437 (68%), Gaps = 6/437 (1%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             AIGVNWGT + H LPP  VV+LL+ N I KVKLFDADP VL AL GS I V VGIPN ML
Sbjct  21    AIGVNWGTTSSHPLPPDKVVELLKSNKITKVKLFDADPLVLQALSGSNIGVTVGIPNSML  80

Query  1469  aavsssssaADLWVAQNLTRYLVNG--GVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
              +++SS   A+ WV  N+TRY+ +G  GV I+YVAVG+EPF  SY  Q+  +V+ A  N+
Sbjct  81    KSLNSSKKVAESWVHDNVTRYVSSGNSGVRIEYVAVGDEPFQQSYGEQYHPFVIGAAMNI  140

Query  1295  QQSLAKANLGGAVKLVVPCNADAY--ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             Q +LA+ +L   VK+VVPC+ D +  ESSLPS+G FRP+L + MT+L++ L  + SPF  
Sbjct  141   QTALARVSLANQVKVVVPCSYDTFQSESSLPSKGHFRPDLNKTMTELLTFLTKHHSPFFA  200

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
              I PF+  + N +   D++ F+ T H   DG   Y N+FD   DTLV+ALS  G+ +M +
Sbjct  201   TISPFIISHRNKNISLDFSLFKETKHSRNDGHRTYKNSFDLGYDTLVSALSTAGFPEMDV  260

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             V+ ++GWPTDGA +A  +AA  F +GL+ H+    GTPLRP  PPI+ Y+FSL DE  +S
Sbjct  261   VVAKIGWPTDGAANATPSAAETFMKGLMDHLHSKSGTPLRPRNPPIETYIFSLLDEDQRS  320

Query  761   ILPGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLSAVSNH  588
             I+ G+FERHWGVF+FDGQ KY +DLG G   L NA+ V YL  +WC+VN NKDLS  +  
Sbjct  321   IVNGNFERHWGVFTFDGQAKYNVDLGQGSKNLVNAQYVEYLSSKWCVVNNNKDLSNATAS  380

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
                ACS ADC+ L  GGSC  I    NISYAFN+YYQ+H Q   SCDF GLGL+T +DPS
Sbjct  381   ALDACSTADCSALSPGGSCFNISWPANISYAFNNYYQVHDQRADSCDFGGLGLITTVDPS  440

Query  407   VDECRFLVGVTDTNNSS  357
             V  CRF V +  +++ S
Sbjct  441   VGNCRFPVELRTSHSES  457



>gb|KFK27342.1| hypothetical protein AALP_AA8G370600 [Arabis alpina]
Length=478

 Score =   454 bits (1169),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 233/428 (54%), Positives = 290/428 (68%), Gaps = 9/428 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S+IG NWGT A H LPP  VV +LR+N IQK+KLFDA+   L AL  SGIEVMVGIPNEM
Sbjct  20    SSIGANWGTQASHPLPPDIVVRMLRDNGIQKIKLFDAEYDTLRALGKSGIEVMVGIPNEM  79

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA +++S  AA+ WVA+N++ ++    VNI+YVAVGNEPFL++Y+G + S   PA+ N+Q
Sbjct  80    LATLATSLKAAEKWVAKNVSTHIRTDNVNIRYVAVGNEPFLSTYNGSYLSTTFPALRNIQ  139

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA L   VK+  P NAD Y+SS  LPS G FR  +  +M  +V  L+ N  PF VN
Sbjct  140   IALIKAGLRDQVKVTCPLNADVYDSSTTLPSGGDFRANIRDVMITIVKFLSENGGPFTVN  199

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY ++DFP DYAFF+G + PV DG   Y N FD N DTLV AL K G+  MPI+
Sbjct  200   IYPFISLYNDADFPVDYAFFDGNSQPVSDGGTFYYNMFDANYDTLVHALEKNGFGNMPII  259

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +AN+  AR FNQG + H+ G KGTP RPG  PID YLFSL DE  KS+
Sbjct  260   VGEIGWPTDGDRNANVDYARKFNQGFMSHISGGKGTPRRPG--PIDAYLFSLIDEDAKSV  317

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG FERHWG+F+FDG  KY L+LG    G L  A+ V YL  +WC++ PN  L    V+
Sbjct  318   QPGYFERHWGIFTFDGLPKYALNLGTTNTGALIQAKGVRYLSRKWCVMKPNVRLDDPQVA  377

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  ACSL DCT+L  G SC  +  K NISYAFNSYYQ++ Q   +C F  +  VT  D
Sbjct  378   PAVSYACSLGDCTSLGIGTSCGNLDGKENISYAFNSYYQINDQADTACKFPNISEVTKND  437

Query  413   PSVDECRF  390
             PS   CRF
Sbjct  438   PSTGTCRF  445



>ref|XP_008242583.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Prunus mume]
Length=489

 Score =   455 bits (1170),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 226/436 (52%), Positives = 301/436 (69%), Gaps = 13/436 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             ++ GVNWGT+A H+LPP  VV +L++N   K+KLF+A+  +L+ALMG+ IEVM+ +PN M
Sbjct  27    TSFGVNWGTMATHQLPPEKVVKMLKDNEFNKLKLFEAEEKILAALMGTQIEVMLAVPNVM  86

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  +S    AA  WV  N+T Y  NGGVNIKYVAVGNEPFL +Y+G +    +PA+ N+Q
Sbjct  87    LQEMSQDPVAAATWVDANVTSYCDNGGVNIKYVAVGNEPFLKTYNGTYLKTTLPALKNIQ  146

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             ++L  A LG  VK  VP NAD Y S     +PS G FRPE+   + +++  L++N +PF 
Sbjct  147   EALNNAGLGSQVKATVPFNADIYFSPDSDPVPSTGDFRPEIRDSLIEIIQYLHTNDAPFT  206

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN+ FP  +AFF+GT  P+ DG  +Y+N FD N DTLV +L+K G+ +M 
Sbjct  207   VNIYPFLSLYGNTYFPFGFAFFDGTTKPIKDGDLLYTNVFDANFDTLVWSLTKAGFPEMK  266

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN+  A+ FNQG+I H L   GTP R G   IDVYLFSL DE  K
Sbjct  267   IMVGEVGWPTDGDINANIRNAKRFNQGMIQHSLSGNGTPARKG--KIDVYLFSLIDEDAK  324

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPN-KDLS  603
             SI PG+FERHWG+F +DG+ KY LDL  G L+N       DV Y+  RWC+++ + KDL 
Sbjct  325   SIAPGNFERHWGLFEYDGKPKYNLDL-TGSLENKGLAAVEDVDYMLKRWCVLDKDAKDLE  383

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              ++  I  AC+L+DCT L YG SCN +  +GN SYAFN YYQ++ Q   +CDF GL +VT
Sbjct  384   VLAKSIDYACTLSDCTALGYGCSCNNLSLQGNASYAFNMYYQMNSQKSWTCDFSGLAVVT  443

Query  422   FLDPSVDECRFLVGVT  375
               +PSV +C+F V ++
Sbjct  444   DENPSVGDCQFPVMIS  459



>ref|XP_006650710.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Oryza brachyantha]
Length=493

 Score =   455 bits (1170),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 229/434 (53%), Positives = 293/434 (68%), Gaps = 11/434 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
              A+G+NWGT A H LPP  V  LL++N ++KVKLFDAD   LSAL G+GIEVMV IPN M
Sbjct  33    EALGMNWGTQASHPLPPKVVAQLLKDNGVKKVKLFDADQDTLSALAGTGIEVMVAIPNVM  92

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L +++   +A + WV +N++RY  +GGV IKYVAVGNEPFLA+Y+G F    +PA+ N+Q
Sbjct  93    LDSITDYDTAKE-WVRRNVSRYNFDGGVTIKYVAVGNEPFLAAYNGTFDKVTLPALMNIQ  151

Query  1292  QSLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L  A LG ++K  VP NAD Y S     +PS G FR ++  +MTQ+V  L +N++PF 
Sbjct  152   NALNDAGLGDSIKATVPLNADVYNSPADQQVPSAGRFRADIADLMTQMVQFLANNSAPFT  211

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPF+SLY N +FP D+AFF+G A P  D    Y+N FD N DTLVAAL  +G+  MP
Sbjct  212   VNIYPFISLYLNDNFPVDFAFFDGGATPGADNGISYTNVFDANFDTLVAALKAVGHGDMP  271

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG   A    A+ F  GL+  +  N GTPLRPG   I+VYLF L DE  K
Sbjct  272   IIVGEVGWPTDGDKHATAAYAQRFYNGLLRRLAANAGTPLRPG-QYIEVYLFGLLDEDAK  330

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSA  600
             S+ PG FERHWG+  FDGQ KYP+DL G GQ   L  A+DV YL   WC+VN N KD S 
Sbjct  331   SVAPGSFERHWGILRFDGQPKYPVDLTGQGQNTMLVPAKDVQYLSRTWCVVNTNAKDTSK  390

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++++I  AC+ ADCT L YG +C G+   GN SYAFN+Y+Q+  Q  ++CDF GL + T 
Sbjct  391   LADNINFACTFADCTALGYGSTCAGMDANGNASYAFNAYFQVQNQKDEACDFQGLAMPTQ  450

Query  419   LDPSVDECRFLVGV  378
              DPS   C F V +
Sbjct  451   TDPSTPACNFTVQI  464



>dbj|BAK03448.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=483

 Score =   454 bits (1169),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 232/437 (53%), Positives = 300/437 (69%), Gaps = 9/437 (2%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT   H LP STVV LL++N   +VKLFDA+  +L AL GSGI+VMVGIPN+ML+
Sbjct  27    MGVNWGTQLSHPLPASTVVRLLKDNGFDRVKLFDAEDGILGALKGSGIQVMVGIPNDMLS  86

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              ++ S+ AA+ WVA N++++ +N GV+I+ VAVGNEPFL +++G + +   PA+ NVQ +
Sbjct  87    DLAGSTKAAERWVAANVSKH-INDGVDIRLVAVGNEPFLQTFNGTYLNTTFPAMQNVQAA  145

Query  1286  LAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIY  1113
             L  A LGG VK+ V  NAD Y+S+   PS G FR ++  +M  +V  L S+ +PFV N+Y
Sbjct  146   LMAAGLGGQVKVTVALNADVYQSASGKPSDGDFRADIHGLMLNIVQFLASSGAPFVANVY  205

Query  1112  PFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIG  933
             PF+SLY + +FP DYA F+G+  PVVDG   Y N FD N DTLVAAL + G+  + +V+G
Sbjct  206   PFISLYADPNFPLDYASFQGSTSPVVDGGVTYQNTFDANHDTLVAALRRNGFPNVTVVVG  265

Query  932   EVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILP  753
             EVGWPTDG  +AN   AR FNQGLI HV   KGTPL PG  PID YLFSL DE  KSI P
Sbjct  266   EVGWPTDGDANANPDYARRFNQGLIDHVASGKGTPLAPGA-PIDAYLFSLVDEDRKSIQP  324

Query  752   GDFERHWGVFSFDGQLKYPLDL---GNGQLKNARDVPYLPYRWCIVNPNKDLS--AVSNH  588
             G+FERHWG+F +DG+ KY L L   G G L  AR V YL  RWC++ P  DL+   V + 
Sbjct  325   GNFERHWGIFFYDGKPKYQLGLRGSGGGMLVPARGVEYLQRRWCVLKPGADLADQKVGDS  384

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
             +  AC  ADCT+L Y  SC G+  KGN+SYAFNSYYQ   Q+ ++CDF GL   T +DPS
Sbjct  385   VSYACGSADCTSLGYKTSCGGLDAKGNVSYAFNSYYQTEDQDDRACDFRGLATTTTVDPS  444

Query  407   VDECRFLVGVTDTNNSS  357
                CRF+VG+  T+  +
Sbjct  445   SGTCRFIVGIAPTSTGT  461



>ref|XP_002281500.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Vitis vinifera]
Length=485

 Score =   454 bits (1169),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 232/433 (54%), Positives = 292/433 (67%), Gaps = 12/433 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A H+LPP  VV +L++N  +K+KLF+AD  +L AL G+ IEVM+ IPN ML 
Sbjct  29    VGVNWGTMATHQLPPEKVVRMLKDNGFRKLKLFEADERILEALTGTHIEVMLAIPNYMLP  88

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              +S   S A  WV  N++ Y   GGVNIKYVAVGNEPFL +Y+G F  Y +PA+ N+QQ+
Sbjct  89    EMSEDPSVATSWVQANVSSYSYAGGVNIKYVAVGNEPFLQTYNGTFLKYTLPALKNIQQA  148

Query  1286  LAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L    L  +VK  VP NAD Y S     +PS G FR E+  +  +++  L+SN +PF VN
Sbjct  149   LNNEALE-SVKATVPFNADIYYSPDSNPVPSAGDFRAEVRDLTIEIIQYLHSNDAPFTVN  207

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLYGN+ FP DYAFF+G+  P+ DG NVY+N FD N DTLV AL + GY  + I+
Sbjct  208   IYPFLSLYGNAYFPMDYAFFDGSNKPIKDGNNVYTNVFDANFDTLVWALDRAGYPDVKII  267

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +AN+  A+ FNQGLI+HVL  KGTP R G   I+ YLFSL DE  KSI
Sbjct  268   VGEVGWPTDGDKNANVKNAKRFNQGLIHHVLSGKGTPARKG--KIEAYLFSLIDENAKSI  325

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG----NGQLKNARDVPYLPYRWCIVNPNK-DLSAVS  594
              PG FERHWG+F +DG+ KY LD+     N  L  A  V Y+  RWC++NPN  DL  + 
Sbjct  326   APGCFERHWGIFEYDGKPKYELDVSGSRENKGLVAAEGVKYMVRRWCVLNPNTDDLEDLP  385

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
             + I  ACS++DCT L YG SCN +   GN SYAFN YYQ++ Q    CDF GLG+ T  D
Sbjct  386   DSINYACSMSDCTALGYGSSCNHLSVAGNASYAFNMYYQVNNQQSWDCDFSGLGIETEED  445

Query  413   PSVDECRFLVGVT  375
             PS DEC F V + 
Sbjct  446   PSDDECLFPVMIA  458



>ref|XP_010921014.1| PREDICTED: glucan endo-1,3-beta-glucosidase 9 [Elaeis guineensis]
Length=489

 Score =   455 bits (1170),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 235/442 (53%), Positives = 303/442 (69%), Gaps = 11/442 (2%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVV--DLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNE  1476
             A+GVNWGT +     P + V   LL+ NNI +VKL  ADP V+++L GSGI+V VGIPNE
Sbjct  23    ALGVNWGTSSSSHPLPPSTVVPGLLKANNITRVKLSGADPDVMASLSGSGIQVTVGIPNE  82

Query  1475  MLaavsssssaADLWVAQNLTRYL-----VNGGVNIKYVAVGNEPFLASYSGQFQSYVVP  1311
             ML A+SSS   A  WV  N+TRY      V GGV I+Y+AVG+EPFL+SY  QFQ +VV 
Sbjct  83    MLRALSSSKKDAASWVHDNVTRYFPPISGVGGGVRIEYIAVGDEPFLSSYGQQFQHFVVG  142

Query  1310  AVTNVQQSLAKANLGGAVKLVVPCNADAYES--SLPSQGAFRPELTQIMTQLVSLLNSNA  1137
             A TN+Q +L  A L   VK++VPC +DAY+S  +LPS+G FRP+LT+ M +L+S L+ + 
Sbjct  143   AATNIQLALTAAKLANNVKIIVPCTSDAYQSDMNLPSKGHFRPDLTKTMIELLSFLSKHG  202

Query  1136  SPFVVNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGY  957
             SPFVV+I PFL+L  N +    Y  F+  +H V DG N Y N FD ++DTL+++LSK+G+
Sbjct  203   SPFVVDINPFLALQQNKNVSLGYVLFQSKSHAVTDGHNKYKNYFDASIDTLISSLSKVGF  262

Query  956   SQMPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFD  777
               M IV+G +GWPTDGA +A    A+ F QGLI H+    GTPLR   PP + Y+FSL D
Sbjct  263   GDMDIVVGRIGWPTDGAVNATPAVAQTFMQGLIDHLKSKAGTPLRLKRPPRETYIFSLLD  322

Query  776   EAGKSILPGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLS  603
             E  + I  G++ERHWG+F+FDGQ KY +DLG G   L NA +V YL  +WC+VN NKDLS
Sbjct  323   EDQRGITTGNYERHWGIFTFDGQAKYNVDLGQGSKNLVNAHNVEYLASKWCVVNNNKDLS  382

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
               S     ACS ADCT L  GGSC GI   GN+SYAFNSYYQ H Q+  SCDF GLGL+T
Sbjct  383   NASAGAADACSNADCTALSPGGSCFGISWPGNVSYAFNSYYQQHDQSADSCDFGGLGLIT  442

Query  422   FLDPSVDECRFLVGVTDTNNSS  357
              +DPS+D+CRF + +  + +SS
Sbjct  443   TVDPSIDDCRFTIALHTSFSSS  464



>ref|XP_010909077.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Elaeis guineensis]
Length=478

 Score =   454 bits (1168),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 230/442 (52%), Positives = 300/442 (68%), Gaps = 13/442 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A H LPP  VV LL++N I+KVKLFDAD A +SAL GSGIEVMV IPN  L 
Sbjct  23    LGVNWGTMATHPLPPKIVVQLLKDNGIKKVKLFDADAATMSALAGSGIEVMVAIPNNQLG  82

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             A++   +A   WV +N++RY  +GGV IKYVAVGNEPFL+SY+G F +   PA+ N+Q +
Sbjct  83    AMNDYDTAKK-WVDRNVSRYHFDGGVTIKYVAVGNEPFLSSYNGSFLNVTFPALQNIQNA  141

Query  1286  LAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A  G  +K  VP NAD Y S     +PS G FR ++  +MTQ+V   N + +PF VN
Sbjct  142   LNEAGFGDTIKATVPLNADVYNSPTNNPVPSAGRFRTDINDLMTQIVQFFNLSGAPFTVN  201

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLYGN +FP D+AFF+GT+ PVVD    Y+N FD N DTL++AL  +G   +PI+
Sbjct  202   IYPFLSLYGNDNFPLDFAFFDGTSQPVVDNGIQYTNVFDANFDTLLSALKAVGLGNLPII  261

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +A  + A+ F  GL+  +  N GTPLRP    ++VYLFSL DE  KSI
Sbjct  262   VGEVGWPTDGDKNAKASYAQRFYNGLLKRLAANVGTPLRPN-QYLEVYLFSLIDEDAKSI  320

Query  758   LPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG+FERHWG+  +DGQ ++P+DL G GQ   L  A++V YLP  WC+ NPN KDLS + 
Sbjct  321   APGNFERHWGILKYDGQPQFPMDLSGQGQNKMLVAAKNVEYLPQTWCVFNPNAKDLSKLG  380

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
             ++I  AC+ +DCT+L YG +CN +   GN SYAFN Y+Q   Q   SC F GL + T  +
Sbjct  381   DNINYACTFSDCTSLGYGSTCNQLDANGNASYAFNMYFQDQNQKDMSCFFQGLAMQTTQN  440

Query  413   PSVDECRFLVGVTDTNNSSGFS  348
             PS  EC F + +  +  +S FS
Sbjct  441   PSTTECNFTIQIKTS--ASAFS  460



>emb|CDY48710.1| BnaA09g09850D [Brassica napus]
Length=477

 Score =   454 bits (1168),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 235/432 (54%), Positives = 294/432 (68%), Gaps = 13/432 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A HKLPP TVV +L++NNI KVKLFDAD   + AL  SG+EVMV IPN+ L 
Sbjct  25    LGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALASSGLEVMVAIPNDQLK  84

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              + S   A D WV +N+TRY  NGGVNI +VAVGNEPFL SY+G F +   PA+ N+Q +
Sbjct  85    VMGSYDRAKD-WVRKNVTRYNFNGGVNITFVAVGNEPFLKSYNGTFINLTFPALQNIQNA  143

Query  1286  LAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A LG  VK  VP NAD Y+S     +PS G FRP++   MTQ+V  L  N +P  +N
Sbjct  144   LNEAGLGNTVKATVPLNADVYDSPVSDPVPSAGRFRPDILGQMTQIVDFLGKNNAPITIN  203

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLYGN DFP +YAFF+G A P+ D    Y+N FD N DTLV++L  +G+  MPI+
Sbjct  204   IYPFLSLYGNDDFPINYAFFDG-AQPIDDHGVSYTNVFDANFDTLVSSLKAVGHGDMPII  262

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPT+G   AN   A  F  GL+  +  NKGTPLRP    I+VYLF L DE  KSI
Sbjct  263   VGEVGWPTEGDKHANNGEAYRFYNGLLPRLGTNKGTPLRPTY--IEVYLFGLLDEDAKSI  320

Query  758   LPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG FERHWG+F FDGQ K+PLDL G GQ   L  AR+V YLP +WC+ NPN KDL+ ++
Sbjct  321   APGAFERHWGLFRFDGQPKFPLDLSGQGQNTLLIGARNVTYLPNKWCMFNPNAKDLTKLA  380

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
              +I  AC+ +DCT L YG SCNG+   GN SYAFN Y+Q+  Q+ ++C F GL  VT  +
Sbjct  381   QNIDFACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQVKNQDEEACIFQGLATVTTQN  440

Query  413   PSVDECRFLVGV  378
              S  +C F V +
Sbjct  441   ISQGQCDFPVQI  452



>ref|XP_010669627.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Beta vulgaris 
subsp. vulgaris]
Length=488

 Score =   454 bits (1169),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 228/432 (53%), Positives = 299/432 (69%), Gaps = 9/432 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             + IG NWGT + H L P+ VV +LREN IQKVKLFDA    L AL  +GIEVMVGIPN+M
Sbjct  28    NGIGANWGTQSSHPLSPAVVVRMLRENRIQKVKLFDAAYDTLHALGSTGIEVMVGIPNDM  87

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L+ +++SS AA+ WV++N+T ++ N  VNI+YVAVGNEPFLA+Y+G F     PA+ N+Q
Sbjct  88    LSTLATSSRAAEKWVSENITEHISNNKVNIRYVAVGNEPFLATYNGSFLRTTFPALQNIQ  147

Query  1292  QSLAKANLGGAVKLVVPCNADAYES--SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L +A  G  VK+ VP NAD Y S  S+PS G FR ++   M Q+V  L+ N +PF VN
Sbjct  148   NALLRAGHGNQVKVTVPSNADVYASPSSMPSGGDFRSDINDYMIQIVKFLSDNGAPFTVN  207

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY +++FP +YAFF+G A P+ DG   Y N FD N DTL+ AL K G+  MPI+
Sbjct  208   IYPFISLYTDANFPVEYAFFDGNATPLNDGGTNYYNMFDANYDTLIWALQKNGFGNMPII  267

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +AN+  A+ FNQG + H+   KGTP+R G  PID YLFSL DE  KSI
Sbjct  268   VGEIGWPTDGDMNANVKFAQRFNQGFMSHIANGKGTPMRAG--PIDAYLFSLIDEDQKSI  325

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGN---GQLKNARDVPYLPYRWCIVNPNKDL--SAVS  594
              PG+FERHWG+F+FDG  KY L+LG    G L  A+ V Y   +WC++ P+  L  S ++
Sbjct  326   QPGNFERHWGIFTFDGLPKYQLNLGTTNLGTLVKAKGVTYEQRQWCVLKPSVKLDDSRLA  385

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC+ ADCT+L YG SC  +  +GN+SYAFNSYYQ++ Q  ++C FDGL  VT  D
Sbjct  386   PSVSYACARADCTSLGYGTSCGSLDIQGNVSYAFNSYYQINDQVDEACKFDGLAAVTKSD  445

Query  413   PSVDECRFLVGV  378
             PS D CRF + +
Sbjct  446   PSRDSCRFEIMI  457



>ref|XP_006418767.1| hypothetical protein EUTSA_v10002822mg [Eutrema salsugineum]
 gb|ESQ37203.1| hypothetical protein EUTSA_v10002822mg [Eutrema salsugineum]
Length=545

 Score =   456 bits (1174),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 231/435 (53%), Positives = 302/435 (69%), Gaps = 12/435 (3%)
 Frame = -3

Query  1637  NWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLaavs  1458
             NWGT+A H+LPP  VV +L++N   K+KLF+AD  +L AL+GS IEVM+GIPN +L  V+
Sbjct  87    NWGTMASHQLPPQNVVKMLKDNGFTKLKLFEADQNILDALIGSEIEVMIGIPNRLLKEVA  146

Query  1457  ssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQSLAK  1278
                  A  WV +N+T Y  +GGVNIKY+AVGNEPFL +Y+G +  + +PA+ N+Q++L +
Sbjct  147   QDPDVAASWVEENVTAYYYHGGVNIKYIAVGNEPFLQTYNGTYVEFTLPALVNIQRALEE  206

Query  1277  ANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIYP  1110
             A+L   VK+ VP NAD Y S     +PS G FRPEL     ++++ L ++ SPF VNIYP
Sbjct  207   ADLK-TVKVTVPFNADIYFSPESNPVPSAGDFRPELRDATIEIINFLYTHDSPFTVNIYP  265

Query  1109  FLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIGE  930
             FLSLYGN+ FP D+AFF+GT  P+ DG  VY+N FD NLDTLV A+ +  +  M I++GE
Sbjct  266   FLSLYGNAYFPLDFAFFDGTNKPLRDGDLVYTNVFDANLDTLVCAMERYSFLGMKIIVGE  325

Query  929   VGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILPG  750
             VGWPTDG  +AN  +A+ FNQG++ H +   GTP R GV  +DVYLFSL DE  KSI PG
Sbjct  326   VGWPTDGDKNANSKSAKRFNQGMVKHAMSGNGTPARKGV-IMDVYLFSLVDEDAKSIAPG  384

Query  749   DFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPNK-DLSAVSNHI  585
              FERHWG+F FDG+ KY LDL G G+   L    DV YLP  WC+++PN  +L  +++++
Sbjct  385   TFERHWGIFGFDGRPKYELDLSGQGKDYPLVPVEDVKYLPKTWCVLDPNAFNLDDLADNV  444

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
               ACSL+DCT+L YG SCN +   GN SYAFN YYQ+H QN   CDF GLGL+T  DPS 
Sbjct  445   DYACSLSDCTSLGYGSSCNHLTNIGNASYAFNMYYQMHDQNTWECDFLGLGLITDEDPSD  504

Query  404   DECRFLVGVTDTNNS  360
             + C F V + DT NS
Sbjct  505   ELCEFPVMI-DTGNS  518



>ref|XP_006280397.1| hypothetical protein CARUB_v10026324mg [Capsella rubella]
 gb|EOA13295.1| hypothetical protein CARUB_v10026324mg [Capsella rubella]
Length=477

 Score =   454 bits (1168),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 234/432 (54%), Positives = 292/432 (68%), Gaps = 9/432 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S+IG NWGT A H LPP  VV +LREN IQKVKLFDA+   L AL  SGIEVMVGIPNEM
Sbjct  20    SSIGANWGTQASHPLPPDIVVRMLRENGIQKVKLFDAEYDTLRALGKSGIEVMVGIPNEM  79

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA ++SS  AA+ WVA+N+T ++    VNI+YVAVGNEPFL++Y+G + S   PA+ N+Q
Sbjct  80    LATLASSLKAAEKWVAKNVTTHISTDKVNIRYVAVGNEPFLSTYNGSYLSTTFPALRNIQ  139

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              ++ +A L   VK+  P NAD YESS  LPS G FR  +  +M  +V  L+ N  PF VN
Sbjct  140   IAIIRAGLQNQVKVTCPLNADVYESSTSLPSGGDFRANIRDLMITIVKFLSENGGPFTVN  199

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY +++FP DYAFF+G + PV DG   Y N FD N DTLV AL K G+  MPI+
Sbjct  200   IYPFISLYNDANFPVDYAFFDGNSQPVSDGGTFYYNMFDANYDTLVHALEKNGFGNMPII  259

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWPTDG  +ANL  A+ FNQG + H+ G KGTP RPG  PID YLFSL DE  KS+
Sbjct  260   IGEIGWPTDGDKNANLDYAKKFNQGFMAHISGGKGTPRRPG--PIDAYLFSLIDEDAKSV  317

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG FERHWG+F+FDG  KY L+LG    G L  A+ V YL  +WC++ PN  L    V+
Sbjct  318   QPGYFERHWGIFTFDGLPKYALNLGTTNTGALIQAKGVRYLQRKWCVMKPNVRLDDPQVA  377

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC+  DCT+L  G SC+ +  K NISYAFNSYYQ++ Q   +C F  +  VT  D
Sbjct  378   PSVSYACARGDCTSLGVGTSCSNLDGKENISYAFNSYYQINDQLDTACKFPNISEVTKTD  437

Query  413   PSVDECRFLVGV  378
             PS   CRF + +
Sbjct  438   PSTGNCRFPIMI  449



>ref|XP_002866250.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42509.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=477

 Score =   454 bits (1168),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 235/432 (54%), Positives = 291/432 (67%), Gaps = 9/432 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S+IG NWGT A H LPP  VV +LREN IQKVKLFDA+   L AL  SGIEVMVGIPNEM
Sbjct  20    SSIGANWGTQASHPLPPDIVVRMLRENGIQKVKLFDAEYDTLRALGKSGIEVMVGIPNEM  79

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA ++SS  AA+ WVA+N++ ++    VNI+YVAVGNEPFL++Y+G + S   PA+ N+Q
Sbjct  80    LATLASSLKAAEKWVAKNVSTHISTDNVNIRYVAVGNEPFLSTYNGSYLSTTFPALRNIQ  139

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              ++ KA L   VK+  P NAD Y+SS   PS G FR  +  +M  +V  L+ N  PF VN
Sbjct  140   IAIIKAGLQNQVKVTCPLNADVYDSSTTFPSGGDFRANIRDLMITIVKFLSENGGPFTVN  199

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY N DFP DYAFF+G + P+ DG   Y N FD N DTLV AL K G+  MPI+
Sbjct  200   IYPFISLYNNPDFPVDYAFFDGNSQPLNDGGTYYYNMFDANYDTLVHALEKNGFGNMPII  259

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWPTDG ++AN+  AR FNQG + H+ G KGTP RPG  PID YLFSL DE  KS+
Sbjct  260   IGEIGWPTDGDSNANVDYARKFNQGFMSHISGGKGTPRRPG--PIDAYLFSLIDEDAKSV  317

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG FERHWG+F+FDG  KY L+LG   +G L  A+ V YL  +WC++ PN  L    V+
Sbjct  318   QPGYFERHWGIFTFDGLPKYLLNLGTTNSGSLIQAKGVRYLQRKWCVMRPNVRLDDPQVA  377

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  ACSL DCT+L  G SC  +  K NISYAFNSYYQ+  Q   +C F  +  VT  D
Sbjct  378   PSVSYACSLGDCTSLGVGTSCANLDGKQNISYAFNSYYQIQDQLDTACKFPNISEVTKTD  437

Query  413   PSVDECRFLVGV  378
             PS   CRF + +
Sbjct  438   PSTGTCRFPIMI  449



>gb|KDO80436.1| hypothetical protein CISIN_1g047337mg [Citrus sinensis]
Length=490

 Score =   454 bits (1169),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 229/433 (53%), Positives = 291/433 (67%), Gaps = 13/433 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT++ H LP   VV +LREN   K+KLF+AD  +L AL+GS IEVM+ IPN ML 
Sbjct  30    VGVNWGTMSTHHLPADNVVQMLRENRFNKLKLFEADKKILDALIGSDIEVMLAIPNYMLL  89

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              +S    AA  WV  N++ Y   GGVNIKYVAVGNEPFL +Y+  ++   +PA+ N+QQ+
Sbjct  90    EMSEDPGAAASWVYANVSSYFYTGGVNIKYVAVGNEPFLRTYNDTYRYITLPALKNIQQA  149

Query  1286  LAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L  A LG  +K  VP NAD Y S     +PS G FR E+  +   ++  L+ N +PF VN
Sbjct  150   LNDAGLGSKIKATVPFNADIYNSPESNPVPSAGGFRDEVKDLTIGIIQFLHLNNAPFTVN  209

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLYGN  FP D+AFFEGT  P+ DG  +Y+N FD N DTLV +L K GY  M I+
Sbjct  210   IYPFLSLYGNDYFPVDFAFFEGTNKPIRDGSLLYTNVFDANFDTLVWSLDKAGYPDMHII  269

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +AN+  A+ F+QGL+ HVL   GTP R G   IDVYLFSL DE  KSI
Sbjct  270   VGEVGWPTDGDKNANIENAKKFSQGLLKHVLSGAGTPARKGT--IDVYLFSLLDENAKSI  327

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPN-KDLSAV  597
              PG+FERHWG+F +DG+ KY LDL +G++KN        V Y+P RWC++NP+  D   +
Sbjct  328   APGNFERHWGIFEYDGKPKYELDL-SGKMKNKGLAPVEGVAYMPRRWCVLNPHADDFEEL  386

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
              + I  ACSL+DCT L YG SCN +  +GN SYAFN YYQ++ Q   +CDF GL +VT  
Sbjct  387   PDSIDYACSLSDCTALGYGSSCNHLTVEGNASYAFNMYYQMNSQESWNCDFSGLAMVTDG  446

Query  416   DPSVDECRFLVGV  378
             DPS D C+F V +
Sbjct  447   DPSDDHCQFPVMI  459



>ref|XP_008234046.1| PREDICTED: glucan endo-1,3-beta-glucosidase 9 [Prunus mume]
Length=483

 Score =   454 bits (1168),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 227/428 (53%), Positives = 294/428 (69%), Gaps = 6/428 (1%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             A+GVNWGT A H LPP+ VV+LL+ NN+ KVKL DADP VL AL GS + + VGIPN +L
Sbjct  22    AVGVNWGTTASHPLPPTKVVELLKSNNVTKVKLLDADPGVLEALSGSNLVITVGIPNALL  81

Query  1469  aavsssssaADLWVAQNLTRYLVNGG--VNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
               ++SS  AA+ WV  N+TRY+ NGG  V I+YVAVG+EPFL SY  QF  +V+ A  N+
Sbjct  82    RTLNSSKKAAESWVHDNVTRYVSNGGSGVKIEYVAVGDEPFLQSYGEQFHPFVIGAAMNI  141

Query  1295  QQSLAKANLGGAVKLVVPCNADAY--ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
               +LA+A L   VK+VVPC+ D++  ES  PS+G FR +L + M +L++ L+ ++SPF  
Sbjct  142   HIALARAKLESKVKVVVPCSFDSFLSESGHPSKGHFRADLNRTMIELLTFLSKHSSPFFA  201

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
              I PFLSL+ N +   D+A F+  A    D    Y N+FD + D LV ALS +G+ +M I
Sbjct  202   TISPFLSLHQNKNISLDFALFKANAKHHNDSRRTYKNSFDLSYDILVTALSTVGFPKMEI  261

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             V+ ++GWPTDGA +A  + A  F +GL+ H+    GTPLRP  PP + Y+FSL DE  +S
Sbjct  262   VVSQIGWPTDGAANATSSTAETFMKGLMEHLHSKSGTPLRPRDPPSETYIFSLLDEDQRS  321

Query  761   ILPGDFERHWGVFSFDGQLKYPLDL--GNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNH  588
             I  G+FERHWGVF+FDGQ KY  D   G+  L +A++V YLP +WC+VN NKDLS V+  
Sbjct  322   ISTGNFERHWGVFTFDGQAKYHFDFIQGSKNLVDAQNVEYLPSKWCVVNNNKDLSNVTAS  381

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
                ACSLADCT L  GGSC+ I   GNISYAFNSYYQ H Q+  SC+F GLGL+T +DPS
Sbjct  382   SLEACSLADCTALSPGGSCSNISWPGNISYAFNSYYQQHNQSADSCNFGGLGLITTVDPS  441

Query  407   VDECRFLV  384
             VD CRF V
Sbjct  442   VDNCRFSV  449



>ref|XP_008458070.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Cucumis melo]
Length=496

 Score =   454 bits (1169),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 229/438 (52%), Positives = 295/438 (67%), Gaps = 12/438 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S++GVNWGT+A H+LPP  VV +L+EN   K+KLF+AD  +L AL+G+ IEVM+ IPN M
Sbjct  25    SSVGVNWGTMATHQLPPEKVVKMLQENGFHKLKLFEADDRILEALIGTDIEVMLAIPNSM  84

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  +S    AA  WV  N+T Y  +GGV IKYVAVGNEPFL SY+G +    +PA+ N+Q
Sbjct  85    LFLMSQDPQAAASWVDSNVTAYTYHGGVKIKYVAVGNEPFLKSYNGTYLQLTLPALRNIQ  144

Query  1292  QSLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             Q+L  A LG  VK  +P NAD Y S     +PS G FRP++  +  +++  L+ N +PF 
Sbjct  145   QALNDAGLGSKVKATIPFNADIYNSPDSNPVPSAGEFRPDVRDLAIEILHYLSINNAPFT  204

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAH-PVVDGPNVYSNAFDGNLDTLVAALSKLGYSQM  948
             VNIYPFLSLYGN  FP D+AFF+GTA+ P+ D    Y+N FD N DTLV+AL+K GY  M
Sbjct  205   VNIYPFLSLYGNDYFPIDFAFFDGTAYKPIKDRDLTYTNVFDANFDTLVSALAKAGYPDM  264

Query  947   PIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAG  768
              I++GEVGWPTDG   AN+  A+ FNQGL+ H L  +GTP R G+  ID+YLFSL DE  
Sbjct  265   KIIVGEVGWPTDGDKHANIQNAKRFNQGLLRHALSGEGTPARVGI--IDIYLFSLIDENA  322

Query  767   KSILPGDFERHWGVFSFDGQLKYPLDLGNGQ----LKNARDVPYLPYRWCIVNPN-KDLS  603
             KSI PG FERHWG+F FDG+ KY LDL   +    L     V Y+  RWC++NPN  D  
Sbjct  323   KSIEPGSFERHWGIFEFDGKPKYELDLAGTEEEKGLIPVEGVRYMGKRWCVLNPNVNDWE  382

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              +++ +  ACSL+DCT L+YG SCN +  +GN SYAFN YYQ++ Q   +CDFDGL +VT
Sbjct  383   GLADSVDYACSLSDCTALEYGSSCNQLTAQGNASYAFNMYYQVNNQKSWNCDFDGLAVVT  442

Query  422   FLDPSVDECRFLVGVTDT  369
               DPS   C F + +  T
Sbjct  443   QQDPSYGNCLFPIMIDYT  460



>ref|XP_009769717.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Nicotiana sylvestris]
Length=470

 Score =   453 bits (1166),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 229/437 (52%), Positives = 297/437 (68%), Gaps = 14/437 (3%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             ++GVNWGT+A  +LPP +VV +L++N   KVKLF+AD  +L+AL+G+ I+VM+ IPN ML
Sbjct  10    SVGVNWGTMATQQLPPKSVVKMLKDNGFDKVKLFEADENILNALVGTDIQVMLAIPNFML  69

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
               +S+    A  WV +N++ Y   GGV I+YVAVGNEPFL +Y+G +  Y++PA+ N+Q+
Sbjct  70    HDMSADPLMAAAWVQENVSAYAYTGGVKIRYVAVGNEPFLRTYNGTYLPYILPALKNIQE  129

Query  1289  SLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             ++ KA LG  VK  +P NAD Y S     +PS G FRPE+  +  Q+V  L SN +PFVV
Sbjct  130   AINKAGLGSEVKATIPFNADIYFSPESNPVPSAGDFRPEVRDLTIQIVQYLYSNDAPFVV  189

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
             NIYP+LSLYGN  FP D+AFF+G+  PV DG  VY+N FD N DTLV +L K G+ ++ I
Sbjct  190   NIYPYLSLYGNIYFPLDFAFFDGSNKPVRDGDYVYTNVFDANFDTLVWSLKKAGFPEVKI  249

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             V+GEVGWPTDG  +AN+  A  FNQGLI H L  +GTP R G   I+VYLFSL DE  KS
Sbjct  250   VVGEVGWPTDGDKNANIENAMRFNQGLIQHCLTGQGTPARKG--RIEVYLFSLIDENAKS  307

Query  761   ILPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPNKDLSA-  600
             I PG+FERHWG+F FDG+ KY LDL     K+        V Y+  RWC++ P+   +A 
Sbjct  308   IAPGNFERHWGIFEFDGKPKYELDLSGKMQKDKGLVAVEGVNYMHKRWCVLKPDAVDNAE  367

Query  599   --VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLV  426
               +  +I  ACSL+DCT L YG SCN +  KGN SYAFN YYQ   QN   CDFDGL +V
Sbjct  368   EDLPKNIDYACSLSDCTALGYGSSCNHLSAKGNASYAFNMYYQFKNQNSWDCDFDGLAVV  427

Query  425   TFLDPSVDECRFLVGVT  375
             T  DPS D+C FLV ++
Sbjct  428   TNDDPSDDKCHFLVMIS  444



>ref|XP_010688142.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   454 bits (1168),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 228/429 (53%), Positives = 294/429 (69%), Gaps = 11/429 (3%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
              +GVNWGTIA H+LPP  VV +L+ N   K+KLF+AD  +LSAL+G+ IEVM+ IPN ML
Sbjct  27    CVGVNWGTIATHQLPPEMVVQMLKNNGFDKLKLFEADDRILSALIGTQIEVMLAIPNNML  86

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
               +SSS  AA  WV  N+T Y  +GGVNI YVAVGNEP L +Y+G +  Y++PA+ N+Q+
Sbjct  87    EEMSSSVDAAVSWVEANVTTYYYSGGVNINYVAVGNEPTLQTYNGTYLKYMLPALKNIQE  146

Query  1289  SLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             +L  A  G  +K  +P NAD Y S     +PS G FR E+  +  +++  L+ N +PF V
Sbjct  147   ALNHAGYGDQIKATIPFNADVYYSPDSNPVPSAGDFRAEVRDLTLEILQFLHENNAPFTV  206

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
             NIYPFLSLYGN +FP DYAFFEG+  P+ D   VY+N FD N DTLV+AL+K GY  M I
Sbjct  207   NIYPFLSLYGNKNFPIDYAFFEGSNVPIRDQGVVYTNVFDANFDTLVSALNKAGYPDMDI  266

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             ++GEVGWPTDG   AN+  A+ FNQGL+ H+L  +GTPLR G   IDVYLFSL DE  KS
Sbjct  267   IVGEVGWPTDGDIYANVENAKRFNQGLLQHILSGEGTPLRKG--KIDVYLFSLIDENAKS  324

Query  761   ILPGDFERHWGVFSFDGQLKYPLDLGNGQ----LKNARDVPYLPYRWCIVNPNKD-LSAV  597
             + PG+FERHWG+F FDG  KY LDL   Q    L     V Y+  RWC++NP+   L  +
Sbjct  325   VAPGNFERHWGIFEFDGMPKYELDLAGMQEDRVLIPVEGVQYMVKRWCVLNPDATGLGNL  384

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
             +++I  ACSL+DCT+L YG SCN +  +GN SYAFN YYQ+  Q+  +CDFDGL ++T  
Sbjct  385   ADNINYACSLSDCTSLGYGCSCNHLSVQGNASYAFNMYYQIKSQDTWNCDFDGLAMITDQ  444

Query  416   DPSVDECRF  390
             DPS   C+F
Sbjct  445   DPSDSTCQF  453



>ref|XP_007222660.1| hypothetical protein PRUPE_ppa004964mg [Prunus persica]
 gb|EMJ23859.1| hypothetical protein PRUPE_ppa004964mg [Prunus persica]
Length=483

 Score =   454 bits (1167),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 232/433 (54%), Positives = 301/433 (70%), Gaps = 10/433 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGS-GIEVMVGIPNE  1476
             S IG NWGT A H LPP TVV LLREN I+KVKLFDAD   L +L  S G+EVMVGIPN+
Sbjct  21    SGIGANWGTQASHPLPPDTVVRLLRENGIRKVKLFDADYDTLRSLGKSEGVEVMVGIPND  80

Query  1475  MLaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             MLA++++S  AA+ WV++N++ ++ +  V I+YVAVGNEPFL +Y+G F     PA+ NV
Sbjct  81    MLASLATSVKAAEKWVSKNVSAHVSSSNVKIRYVAVGNEPFLETYNGSFLRTTFPALQNV  140

Query  1295  QQSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             Q +L KA L   VK+ VP NAD Y SS  LPS G FR ++  +M Q+V  L+ N +PF V
Sbjct  141   QSALIKAGLSNQVKVTVPLNADVYASSNGLPSGGDFRTDIHGLMLQIVKFLSDNGAPFTV  200

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
             NIYPF+SLY +S+FP DYAFF+G A P+ DG   Y N FD N DTLV AL + G+  +PI
Sbjct  201   NIYPFISLYIDSNFPVDYAFFDGNASPITDGSLTYYNMFDANYDTLVWALQRNGFGNLPI  260

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             ++GE+GWPTDG  +AN+  A+ FNQG + H+LG +GTP+RPG  PID YLFSL DE  KS
Sbjct  261   IVGEIGWPTDGDQNANIVYAQRFNQGFMSHILGGRGTPMRPG--PIDAYLFSLIDEDAKS  318

Query  761   ILPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AV  597
             I PG+FERHWG+F+FDG  KY L+LG   +G L  A+ V YL  +WC++ P+ +L    V
Sbjct  319   IDPGNFERHWGIFTFDGIAKYQLNLGSTNSGSLVPAKGVHYLERKWCVMKPSANLDDPQV  378

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
             +  +  AC LADCT+L YG SC  +  +GNISYA NSYYQ + Q   +C F  L ++T  
Sbjct  379   ALSVSYACGLADCTSLGYGTSCGSLDARGNISYAVNSYYQRNNQLDVACKFPNLSMITKT  438

Query  416   DPSVDECRFLVGV  378
             +PSV  CRF + +
Sbjct  439   NPSVGSCRFEIMI  451



>ref|XP_010525845.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Tarenaya 
hassleriana]
Length=494

 Score =   454 bits (1168),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 233/439 (53%), Positives = 302/439 (69%), Gaps = 8/439 (2%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             IGVNWGT A H LPP TVV LLR+N  QKVKLF+AD A+L AL  SGI+VMVGIPN+MLA
Sbjct  27    IGVNWGTQATHPLPPETVVRLLRDNGFQKVKLFEADAAILKALSRSGIQVMVGIPNDMLA  86

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             +++ S  AA+ WVAQN++ ++ + GV+I+YVAVGNEPFL + +G + +  +PA+ N+Q +
Sbjct  87    SLAGSVEAAERWVAQNVSSHVSSNGVDIRYVAVGNEPFLQALNGTYLTTTLPALQNIQSA  146

Query  1286  LAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIY  1113
             L KA L   VK  +P NAD Y+SS  LPS G FRP++  +M Q+V  LN N SP  +NIY
Sbjct  147   LIKAGLATQVKATIPLNADVYQSSSNLPSDGDFRPDIRDLMLQIVKFLNDNQSPITINIY  206

Query  1112  PFLSLYGNSDFPQDYAFFE-GTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
             PF+SLY + +FP ++AFF+ G++ P+ D   +Y N  D N DTL  AL K G+  M IV+
Sbjct  207   PFISLYNDPNFPVEFAFFDGGSSAPINDNGRIYDNVLDANHDTLAWALQKNGFGNMSIVV  266

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             GE+GWPTDG  +ANL  AR FNQG +      KGTP+RPG   +DVYLFSL DE  KSI 
Sbjct  267   GEIGWPTDGDKNANLQNARRFNQGFLNRQRAGKGTPMRPGA--MDVYLFSLIDEDAKSIQ  324

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNGQLKNARDVPYLPYRWCIVNPNKDLS--AVSNHIR  582
             PG+FERHWG+F FDGQ KY L L    L  A+ V YL  +WC+++P+ +L    V+  + 
Sbjct  325   PGNFERHWGMFYFDGQPKYELTLNGNGLVPAKAVHYLARKWCVLSPSANLDDPQVAPSVS  384

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
              ACS ADCT+L  G SC  I  + NISYAFNSYYQ+  Q   SC F GL ++T +DPSV 
Sbjct  385   YACSHADCTSLGLGSSCGNIDSRQNISYAFNSYYQISNQTESSCKFPGLSVITNVDPSVG  444

Query  401   ECRFLVGV-TDTNNSSGFS  348
             +C+F V + T+T  S G S
Sbjct  445   DCKFRVMIQTETLESGGSS  463



>ref|XP_010314012.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum lycopersicum]
Length=475

 Score =   453 bits (1166),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 228/432 (53%), Positives = 298/432 (69%), Gaps = 12/432 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A HKLPP TVV +L++N I KVKLFDAD + +SAL GS +EVMV IPN+ L+
Sbjct  23    LGVNWGTMATHKLPPKTVVQMLKDNGIGKVKLFDADQSTMSALAGSDLEVMVAIPNDQLS  82

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             A++    A D WV +N+TRY   GGVNIKYVAVGNEPFL SY+  F +   PA+ N+Q +
Sbjct  83    AMNDYDRAKD-WVKRNVTRYNFKGGVNIKYVAVGNEPFLTSYNNSFLNTTFPALQNIQNA  141

Query  1286  LAKANLGGAVKLVVPCNADAY----ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A LG ++K  VP NAD Y    ++ +PS G FR ++  +MTQ+V  ++ N +PF VN
Sbjct  142   LNEAGLGSSIKATVPLNADVYFSPDDNPVPSAGRFREDINDLMTQIVQFMSQNNAPFTVN  201

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLY N  FP ++AFF+G ++P+VD    Y+N FD N DTLV+AL   G   +PI+
Sbjct  202   IYPFLSLYANEHFPVNFAFFDGASNPIVDNGLSYTNVFDANFDTLVSALKAAGVGNLPIL  261

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +AN+  A  F +GL+  +  N GTPLRPG   I+VYLF L DE GKSI
Sbjct  262   VGEVGWPTDGDKNANVNLAYRFYKGLLPRLAANVGTPLRPGF--IEVYLFGLIDEDGKSI  319

Query  758   LPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG+FERHWG+F +DGQ K+ +DL G GQ   L  A++V YL  +WC+ NPN KDLS ++
Sbjct  320   APGNFERHWGIFRYDGQPKFAMDLTGQGQDKFLVAAQNVEYLSKKWCMFNPNAKDLSKLA  379

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
             ++I  AC+ +DCT L YG SCNG+   GN SYAFN YYQ   Q   SC+F GL  +T  +
Sbjct  380   DNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYYQAQNQEEFSCNFQGLATLTDQN  439

Query  413   PSVDECRFLVGV  378
              S   C F + +
Sbjct  440   ISQANCNFTIQI  451



>ref|NP_200617.2| glucan endo-1,3-beta-glucosidase 6 [Arabidopsis thaliana]
 sp|Q93Z08.2|E136_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 6; AltName: Full=(1->3)-beta-glucan 
endohydrolase 6; Short=(1->3)-beta-glucanase 
6; AltName: Full=Beta-1,3-endoglucanase 6; Short=Beta-1,3-glucanase 
6; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB11001.1| glucanase; glucan endo-1,3-beta-glucosidase [Arabidopsis thaliana]
 gb|AED96996.1| glucan endo-1,3-beta-glucosidase 6 [Arabidopsis thaliana]
Length=477

 Score =   453 bits (1166),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 235/432 (54%), Positives = 290/432 (67%), Gaps = 9/432 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S+IG NWGT A H LPP  VV +LREN IQKVKLFDA+   L AL  SGIEVMVGIPNEM
Sbjct  20    SSIGANWGTQASHPLPPDIVVRMLRENGIQKVKLFDAEYDTLRALGKSGIEVMVGIPNEM  79

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA ++SS  AA+ WVA+N++ ++    VNI+YVAVGNEPFL++Y+G + S   PA+ N+Q
Sbjct  80    LATLASSLKAAEKWVAKNVSTHISTDNVNIRYVAVGNEPFLSTYNGSYLSTTFPALRNIQ  139

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              ++ KA L   VK+  P NAD Y+SS   PS G FR  +  +M  +V  L+ N  PF VN
Sbjct  140   IAIIKAGLQNQVKVTCPLNADVYDSSTTFPSGGDFRANIRDLMITIVKFLSENGGPFTVN  199

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYP++SLY N DFP DYAFF+G A P+ DG   Y N FD N DTLV AL K G+  MPI+
Sbjct  200   IYPYISLYTNPDFPVDYAFFDGNAQPLNDGGTFYYNMFDANYDTLVHALEKNGFGNMPII  259

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWPTDG ++ANL  A+ FNQG + H+ G KGTP RPG  PID YLFSL DE  KS+
Sbjct  260   IGEIGWPTDGDSNANLDYAKKFNQGFMAHISGGKGTPRRPG--PIDAYLFSLIDEDAKSV  317

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG FERHWG+F+FDG  KY L+LG    G L  A+ V YL  +WC++ PN  L    V+
Sbjct  318   QPGYFERHWGIFTFDGLPKYALNLGTTNTGALIQAKGVRYLERKWCVMKPNVRLDDPQVA  377

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  ACSL DCT+L  G SC  +  K NISYAFNSYYQ+  Q   +C F  +  VT  D
Sbjct  378   PAVSYACSLGDCTSLGVGTSCANLDGKQNISYAFNSYYQIQDQLDTACKFPNISEVTKTD  437

Query  413   PSVDECRFLVGV  378
             PS   CRF + +
Sbjct  438   PSTGTCRFPIMI  449



>ref|XP_011017570.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Populus euphratica]
Length=482

 Score =   454 bits (1167),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 231/430 (54%), Positives = 293/430 (68%), Gaps = 8/430 (2%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             IG NWGT A H LPP TVV LLREN IQKVKLFDAD   L  L  +GIEVMVGIPN++LA
Sbjct  23    IGANWGTQASHPLPPETVVRLLRENGIQKVKLFDADYDTLKVLGKTGIEVMVGIPNDLLA  82

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             +++ S  AA+ WV++N++ ++ N  VNI+YVAVGNEPFL +Y+G F     PA+ NVQ +
Sbjct  83    SLAGSMKAAERWVSKNVSAHVTNNNVNIRYVAVGNEPFLQTYNGSFLRTTFPALQNVQSA  142

Query  1286  LAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIY  1113
             L KA LG  +K+ VP NAD YESS  LPS G FR ++  +M  +V  LN   +PF VNIY
Sbjct  143   LIKAGLGNLIKVTVPLNADVYESSSGLPSGGDFRADIHDLMLTIVKFLNDAGAPFTVNIY  202

Query  1112  PFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIG  933
             PF+SLY +S+FP +YAFF+G A+PV DG   Y N FD N DTLV AL K G+  +PI++G
Sbjct  203   PFISLYIDSNFPVEYAFFDGNANPVNDGGTSYYNMFDANYDTLVNALQKNGFGNLPIIVG  262

Query  932   EVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILP  753
             E+GWPTDG  +AN+  AR FNQG + H+   KGTP+RP    I+ YLFSL DE  KSI P
Sbjct  263   EIGWPTDGDRNANIEYARRFNQGFMSHIASGKGTPMRPNA-GINAYLFSLIDEDAKSIDP  321

Query  752   GDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVSNH  588
             G+FERHWG+F+FDG  KY L+LG    G L  AR+V YL  +WC++ P+  L    V+  
Sbjct  322   GNFERHWGIFTFDGIPKYSLNLGTTNTGALIPARNVHYLERKWCVMKPSAKLDDPQVAPS  381

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
             +  AC LADCT+L YG SC  +  + NISYAFNSY+Q+  Q   +C F  L  +T  DPS
Sbjct  382   VSYACGLADCTSLGYGTSCGNLDARENISYAFNSYFQIQNQLGDACKFPNLSTITRTDPS  441

Query  407   VDECRFLVGV  378
                CRF + +
Sbjct  442   TSTCRFEIMI  451



>ref|XP_006409040.1| hypothetical protein EUTSA_v10022665mg [Eutrema salsugineum]
 gb|ESQ50493.1| hypothetical protein EUTSA_v10022665mg [Eutrema salsugineum]
Length=482

 Score =   453 bits (1166),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 233/435 (54%), Positives = 295/435 (68%), Gaps = 13/435 (3%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
              +GVNWGT+A HKLPP TVV +L++NNI KVKLFDAD + +SAL GSG++VMV IPN+ L
Sbjct  24    GLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADESTMSALAGSGLQVMVAIPNDQL  83

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
               + S   A D WV +N+TRY   GGVNI +VAVGNEPFL SY+G F +   PA+ N+Q 
Sbjct  84    KVMCSYDRAKD-WVRKNVTRYNFTGGVNITFVAVGNEPFLKSYNGSFINITFPALQNIQN  142

Query  1289  SLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             +L +A LG +VK  VP NAD Y+S     +PS G FRP++   MTQ+V  L  N +P  +
Sbjct  143   ALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNAPITI  202

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
             NIYPFLSLYGN DFP +YAFF+G A P+ D    Y+N FD N DTLV+AL  +G+  MPI
Sbjct  203   NIYPFLSLYGNDDFPLNYAFFDG-AQPINDNGVDYTNVFDANFDTLVSALKAVGHGDMPI  261

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             ++GEVGWPT+G   AN   A  F  GL+  +  NKGTPLRP    I+VYLF L DE  KS
Sbjct  262   IVGEVGWPTEGDKHANTGNAYRFYNGLLPRLGTNKGTPLRPTY--IEVYLFGLLDEDAKS  319

Query  761   ILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSAV  597
             I PGDFERHWG+F FDGQ K+P+DL G GQ   L  A+ V YLP +WC  NP  KDL+ +
Sbjct  320   IAPGDFERHWGIFKFDGQPKFPIDLSGQGQNKMLIGAQGVTYLPNKWCTFNPQAKDLTKL  379

Query  596   SNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFL  417
             + +I  AC+ +DCT L YG SCNG+   GN SYAFN Y+Q+  Q+  +C F GL  +T  
Sbjct  380   AANIDFACTYSDCTGLGYGSSCNGLDANGNASYAFNMYFQVKNQDEGACIFQGLATITTQ  439

Query  416   DPSVDECRFLVGVTD  372
             + S  +C F + + D
Sbjct  440   NISQGQCNFPIQIVD  454



>ref|XP_008240488.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Prunus mume]
Length=485

 Score =   453 bits (1166),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 232/446 (52%), Positives = 306/446 (69%), Gaps = 17/446 (4%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
               +GVNWGT+A H+LPP TVV +L++N IQKVKLFDAD + +SAL GSG+EVMV IPN+ 
Sbjct  27    EGLGVNWGTMATHELPPETVVQMLKDNGIQKVKLFDADESTMSALAGSGLEVMVAIPNDQ  86

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA +++   A + WV +N+TRY  NGGVNIKYVAVGNEPFL SY+G F +   PA+ N+Q
Sbjct  87    LAVMATYKRAKE-WVRRNVTRYNFNGGVNIKYVAVGNEPFLTSYNGSFLNVTFPALQNIQ  145

Query  1292  QSLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L +A +G ++K  VP NAD Y S     +PS G FR +++ +M  +V  L  N +PF 
Sbjct  146   NALNEAGVGDSIKATVPLNADVYNSPESNPVPSAGRFRSDISPLMIAIVQFLAKNKAPFT  205

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPN--VYSNAFDGNLDTLVAALSKLGYSQ  951
             +NIYPFLSLYGN DFP +YAFF+G  +P+VD      Y+N FD N DTLV++L  +G+  
Sbjct  206   INIYPFLSLYGNDDFPFNYAFFDGDTNPIVDATTGIQYTNVFDANFDTLVSSLKAVGFGD  265

Query  950   MPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEA  771
             M IV+GEVGWPTDG  +AN   A  F  GL+  +  N+GTPLRPG   I+VYLF L DE 
Sbjct  266   MTIVVGEVGWPTDGDKNANTGNAYRFYNGLLPKLGTNRGTPLRPGY--IEVYLFGLIDED  323

Query  770   GKSILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDL  606
              KSI PG FERHWG+F +DGQ K+ +DL G GQ   L  A++V YL  +WC+ NPN KD+
Sbjct  324   AKSIAPGSFERHWGIFRYDGQPKFLVDLSGQGQNKLLVPAKNVQYLSKKWCMFNPNAKDV  383

Query  605   SAVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLV  426
             + ++++I  AC+ ADCT L+YG SCN +   GN SYAFN YYQ+  Q+  SC+F+GL  +
Sbjct  384   TKLADNINYACTYADCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDLSCNFEGLATM  443

Query  425   TFLDPSVDECRFLVGVTDTNNSSGFS  348
             T  + S   C F++ +     SS FS
Sbjct  444   TTQNISQGNCNFIIQIA---TSSTFS  466



>ref|XP_007204529.1| hypothetical protein PRUPE_ppa017632mg [Prunus persica]
 gb|EMJ05728.1| hypothetical protein PRUPE_ppa017632mg [Prunus persica]
Length=486

 Score =   453 bits (1166),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 226/436 (52%), Positives = 300/436 (69%), Gaps = 13/436 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             ++ GVNWGT+A H+LPP  VV +L++N   K+KLF+A+  +L+ALMG+ IEVM+ +PN M
Sbjct  24    TSFGVNWGTMATHQLPPEKVVKMLKDNGFNKLKLFEAEEKILAALMGTQIEVMLAVPNVM  83

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  +S    AA  WV  N+T Y  NGGVNIKYV+VGNEPFL +Y+G +    +PA+ N+Q
Sbjct  84    LQEMSQDPVAAATWVDANVTSYCSNGGVNIKYVSVGNEPFLKTYNGTYLKTTLPALKNIQ  143

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             ++L  A LG  VK  VP NAD Y S     +PS G FRPE+   + +++  L++N +PF 
Sbjct  144   EALNNAGLGSQVKATVPFNADIYFSPDSDPVPSTGDFRPEIRDSLIEIIQYLHTNDAPFT  203

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN+ FP  +AFF+GT  P+ DG  +Y+N FD N DTLV +L+K G+ +M 
Sbjct  204   VNIYPFLSLYGNTYFPFGFAFFDGTTKPMKDGDLLYTNVFDANFDTLVWSLTKAGFPEMK  263

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN+  AR FNQG+I H L   GTP R G   IDVYLFSL DE  K
Sbjct  264   IMVGEVGWPTDGDINANIRNARRFNQGMIQHSLSGNGTPARKG--KIDVYLFSLIDEDAK  321

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPN-KDLS  603
             SI PG+FERHWG+F +DG+ KY LDL  G L+N       DV Y+  RWC+++ + KDL 
Sbjct  322   SIAPGNFERHWGLFEYDGKPKYNLDL-TGSLENKGLAAVEDVDYMLKRWCVLDKDAKDLE  380

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              +   I  AC+L+DCT L YG SCN +  +GN SYAFN YYQ++ Q   +CDF GL +VT
Sbjct  381   VLVKSIDYACTLSDCTALGYGCSCNNLSLRGNASYAFNMYYQVNSQKSWTCDFSGLAVVT  440

Query  422   FLDPSVDECRFLVGVT  375
               +PSV +C+F V ++
Sbjct  441   DENPSVGDCQFPVMIS  456



>emb|CDX77431.1| BnaA07g05690D [Brassica napus]
Length=494

 Score =   453 bits (1166),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 229/440 (52%), Positives = 304/440 (69%), Gaps = 12/440 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             +++GVNWGT+A H+LPP  VV +L++N   K+KLF+AD  +L+AL GS IEVM+GIPN +
Sbjct  35    TSVGVNWGTMASHQLPPENVVKMLKDNGFTKLKLFEADQNILNALTGSDIEVMIGIPNRL  94

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  V+   + A  WV +N+T Y  NGGVNIKY+AVGNEPFL +Y+G +  + +PA+ N+Q
Sbjct  95    LKEVAQDPALAASWVEENVTAYSYNGGVNIKYIAVGNEPFLQTYNGTYVEFTLPALVNIQ  154

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             ++L +A L   V++ VP NAD Y S     +PS G FRPEL  +  ++++ L ++ SPF 
Sbjct  155   KALEEAGLKN-VRVTVPFNADIYFSPESNPVPSAGDFRPELRDVTIEIINFLYTHDSPFT  213

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN+ FP D+AFF+G+ + + DG  VY+N FD NLDTLV A+ +  +  M 
Sbjct  214   VNIYPFLSLYGNAYFPVDFAFFDGSNNSLRDGDLVYNNVFDANLDTLVCAMERYSFLGMK  273

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN  +A+ FNQG++ H +   GTP R GV  +DVYLFSL DE  K
Sbjct  274   IIVGEVGWPTDGDKNANAKSAKRFNQGMVKHAMSGNGTPARKGV-IMDVYLFSLIDEDAK  332

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQLKN---ARDVPYLPYRWCIVNPNK-DLSA  600
             SI PG FERHWG+F FDG+ KY LDL G G  K     +DV YLP  WC+++ N  +   
Sbjct  333   SIAPGTFERHWGIFEFDGRPKYELDLSGKGDDKTLVPVQDVKYLPKTWCVLDTNAFNQDD  392

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             +++++  ACSL+DCT L YG SCN +   GN SYAFN YYQ+H Q    CDF GLGL+T 
Sbjct  393   LADNVDYACSLSDCTALGYGSSCNHLTNVGNASYAFNMYYQMHDQKTWDCDFLGLGLITD  452

Query  419   LDPSVDECRFLVGVTDTNNS  360
              DPS D C F V + DT NS
Sbjct  453   EDPSDDLCEFPVMI-DTGNS  471



>emb|CDY43882.1| BnaC09g33610D [Brassica napus]
Length=480

 Score =   453 bits (1165),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 234/428 (55%), Positives = 290/428 (68%), Gaps = 9/428 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S+IG NWGT A H LPP  VV +LREN IQKVKLFDA+   L AL  SGIEVMVGIPNEM
Sbjct  22    SSIGANWGTQASHPLPPDIVVRMLRENGIQKVKLFDAEYDTLRALGKSGIEVMVGIPNEM  81

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA+++SS  AA+ WVA+N++ ++    VNI+YVAVGNEPFL++Y+G + +   PA+ N+Q
Sbjct  82    LASLASSLKAAEKWVAKNVSTHIKTDNVNIRYVAVGNEPFLSTYNGSYLTTTFPALRNIQ  141

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA L   VK+  P NAD YESS   PS G FR  +  +M  +V  L+ N  PF VN
Sbjct  142   IALIKAGLQNQVKVTCPLNADVYESSNTFPSGGDFRANIRDLMITIVKFLSDNGGPFTVN  201

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY +++FP DYAFF+G + PV DG   Y N FD N DTLV AL K G+  MPI+
Sbjct  202   IYPFISLYNDANFPVDYAFFDGNSQPVSDGGTFYYNMFDANYDTLVHALEKNGFGNMPII  261

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +AN+  AR FNQG + H+ G KGTP RPG  PID YLFSL DE  KS+
Sbjct  262   VGEIGWPTDGDKNANVEFARKFNQGFMAHISGGKGTPRRPG--PIDAYLFSLIDEDAKSV  319

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG FERHWG+F+FDG  KY L+LG    G L  A+ V YL  +WC++ PN  L    V+
Sbjct  320   QPGYFERHWGIFTFDGLPKYVLNLGTTNTGALIQAKGVRYLQRKWCVMKPNVRLDDPQVA  379

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  ACSL DCT+L  G SC  +  K NISYAFNSYYQ++ Q   +C F  +  VT  D
Sbjct  380   PSVSYACSLGDCTSLGVGTSCGNLDGKDNISYAFNSYYQINDQLDTACKFPNISEVTKTD  439

Query  413   PSVDECRF  390
             PS   CRF
Sbjct  440   PSTGTCRF  447



>ref|XP_006372260.1| hypothetical protein POPTR_0018s14730g [Populus trichocarpa]
 gb|ERP50057.1| hypothetical protein POPTR_0018s14730g [Populus trichocarpa]
Length=482

 Score =   453 bits (1165),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 231/430 (54%), Positives = 292/430 (68%), Gaps = 8/430 (2%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             IG NWGT A H LPP TVV LLREN IQKVKLFDAD   L  L  +GIEVMVGIPN++LA
Sbjct  23    IGANWGTQASHPLPPETVVRLLRENGIQKVKLFDADYDTLKVLGKTGIEVMVGIPNDLLA  82

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             +++ S  AA+ WV++N++ ++ N  VNI+YVAVGNEPFL +Y+G F     PA+ NVQ +
Sbjct  83    SLAGSMKAAEKWVSRNVSAHVTNNNVNIRYVAVGNEPFLQTYNGSFLRTTFPALQNVQSA  142

Query  1286  LAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIY  1113
             L KA LG  +K+ VP NAD YESS  LPS G FR ++  +M  +V  LN   +PF VNIY
Sbjct  143   LIKAGLGNLIKVTVPLNADVYESSSGLPSGGDFRADIHDLMLTIVKFLNDAGAPFTVNIY  202

Query  1112  PFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIG  933
             PF+SLY +S+FP +YAFF+G A+PV DG   Y N FD N DTLV AL K G+  +PI++G
Sbjct  203   PFISLYIDSNFPVEYAFFDGNANPVNDGGTSYYNMFDANYDTLVNALQKNGFGNLPIIVG  262

Query  932   EVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILP  753
             E+GWPTDG  +AN+  AR FNQG + H+   KGTP+RP    I+ YLFSL DE  KSI P
Sbjct  263   EIGWPTDGDRNANVEYARRFNQGFMSHIASGKGTPMRPNA-GINAYLFSLIDEDAKSIDP  321

Query  752   GDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVSNH  588
             G+FERHWG+F+FDG  KY L+LG    G L  AR V YL  +WC++ P+  L    V+  
Sbjct  322   GNFERHWGIFTFDGIPKYSLNLGTTNTGALIPARSVHYLERKWCVMKPSAKLDDPQVAPS  381

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
             +  AC LADCT+L YG SC  +  + NISYAFNSY+Q+  Q   +C F  L  +T  DPS
Sbjct  382   VSYACGLADCTSLGYGTSCGNLDPRENISYAFNSYFQIQNQLGDACKFPNLSTITRTDPS  441

Query  407   VDECRFLVGV  378
                CRF + +
Sbjct  442   TSTCRFAIMI  451



>ref|XP_007207749.1| hypothetical protein PRUPE_ppb004066mg [Prunus persica]
 gb|EMJ08948.1| hypothetical protein PRUPE_ppb004066mg [Prunus persica]
Length=483

 Score =   453 bits (1165),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 226/428 (53%), Positives = 292/428 (68%), Gaps = 6/428 (1%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             A+GVNWGT A H LPP+ VV+LL+ NN+ KVKL DADP VL AL GS + V VGIPN  L
Sbjct  22    AVGVNWGTTASHPLPPTKVVELLKSNNVTKVKLLDADPGVLEALSGSNLGVTVGIPNASL  81

Query  1469  aavsssssaADLWVAQNLTRYLVNGG--VNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
               ++SS  AA+ WV  N+TRY+ NGG  V I+YVAVG+EPFL SY  QF  +V+ A  N+
Sbjct  82    RTLNSSKKAAESWVHDNVTRYVSNGGSGVKIEYVAVGDEPFLQSYGEQFHPFVIGAAMNI  141

Query  1295  QQSLAKANLGGAVKLVVPCNADAY--ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
               +LA+A L   VK+VVPC+ D++  ES  PS+G FR +L + M +L++ L+ ++SPF  
Sbjct  142   HIALARAKLESKVKVVVPCSFDSFLSESGHPSKGHFRADLNRTMIELLTFLSKHSSPFFA  201

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
              I PFLSL+ N +   D+  F+  A P  D    Y N+FD + D LV ALS +G+ +M I
Sbjct  202   TISPFLSLHQNKNISLDFTLFKANAKPHNDSRRTYKNSFDLSYDILVTALSTVGFPKMEI  261

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             V+ ++GWPTDGA +A  + A  F +GL+ H+    GTPLRP  PP + Y+FSL DE  +S
Sbjct  262   VVSQIGWPTDGAANATSSTAETFMKGLVEHLHSKSGTPLRPRDPPSETYIFSLLDEDQRS  321

Query  761   ILPGDFERHWGVFSFDGQLKYPLDL--GNGQLKNARDVPYLPYRWCIVNPNKDLSAVSNH  588
             +  G+FERHWGVF+FDGQ KY  D   G+  L +A++V YLP +WC+VN NKDLS  +  
Sbjct  322   VSTGNFERHWGVFTFDGQAKYHFDFIQGSKNLVDAQNVEYLPSKWCVVNNNKDLSNATAS  381

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
                ACSLADCT L  GGSC+ I   GNISYAFNSYYQ H Q+  SC+F GLGL+T +DPS
Sbjct  382   SLEACSLADCTALSPGGSCSNISWPGNISYAFNSYYQQHNQSADSCNFGGLGLITTVDPS  441

Query  407   VDECRFLV  384
             VD CRF V
Sbjct  442   VDNCRFSV  449



>ref|XP_009760964.1| PREDICTED: glucan endo-1,3-beta-glucosidase 9 [Nicotiana sylvestris]
Length=481

 Score =   453 bits (1165),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 229/437 (52%), Positives = 296/437 (68%), Gaps = 5/437 (1%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             AIGVNWGT A H LPPS VV+LL+ N I KVKLFD +P VL +L GS I+V VG+PN ML
Sbjct  26    AIGVNWGTAASHPLPPSKVVELLKSNGITKVKLFDTNPDVLESLSGSNIDVTVGVPNSML  85

Query  1469  aavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQ  1290
              +++SS   A  WV  NL RY  +G + I+Y+A+G+EPF   Y  QF  +VV A  N+Q 
Sbjct  86    RSLNSSFKVAQSWVHDNLARYFSDG-LRIEYIAIGDEPFNHVYGDQFFPFVVGAAENIQT  144

Query  1289  SLAKANLGGAVKLVVPCNADAY--ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVNI  1116
             +L KA L G VKLVVPC+ DA+  ES LPS+G FR ++ + M++L+  L  + SPF VNI
Sbjct  145   ALTKAKLAGRVKLVVPCSFDAFQSESGLPSKGHFRADVNRTMSELLKFLTKHQSPFFVNI  204

Query  1115  YPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVI  936
              PFLS + N +   D+A F+ TA P  D    Y N+FD + DTLV+ALS  G  +M IVI
Sbjct  205   SPFLSYHNNKNISLDFALFKETARPRKDSRRTYKNSFDLSYDTLVSALSSAGSDKMDIVI  264

Query  935   GEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSIL  756
             G++GWPTDGA SA  + A+ F +  + H+    GTPLRP  PPI+ Y+ SL DE  +SI 
Sbjct  265   GQIGWPTDGAASATSSNAQVFMKKFLEHLHSRSGTPLRPKEPPIETYILSLLDEDNRSIA  324

Query  755   PGDFERHWGVFSFDGQLKYPLDLGNG--QLKNARDVPYLPYRWCIVNPNKDLSAVSNHIR  582
              G+FER+WGVF+FDGQ KY LDLG G  +L NA++V YL  +WC+VN N++LS  +    
Sbjct  325   TGNFERYWGVFTFDGQAKYQLDLGQGSRKLVNAQNVQYLSSKWCLVNNNQNLSNATTRAL  384

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
              ACS ADC+ L  G SC  +   GNISYAFNSYYQ H Q   SCDF GLGL+T +DPSV 
Sbjct  385   EACSSADCSALSPGASCFNLSWPGNISYAFNSYYQQHDQRVDSCDFGGLGLITTVDPSVG  444

Query  401   ECRFLVGVTDTNNSSGF  351
              CRF+V ++ +N++S F
Sbjct  445   TCRFIVQLSTSNSASFF  461



>ref|XP_004239309.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Solanum lycopersicum]
Length=482

 Score =   453 bits (1165),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 227/428 (53%), Positives = 297/428 (69%), Gaps = 10/428 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S IG NWGT + H+LPP  VV +L++N IQKVKLFDAD   L AL  SG+EVMVGIPN+M
Sbjct  26    SGIGANWGTQSTHRLPPEIVVRMLKDNGIQKVKLFDADYDTLKALGKSGLEVMVGIPNDM  85

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L+++ S  +A + WV++N++ ++ +  VNI+YVAVGNEP+L +Y+G +    +PA+ N+Q
Sbjct  86    LSSMGSLKAA-EKWVSKNVSVHINDNNVNIRYVAVGNEPYLTTYNGTYLRTTLPAMQNIQ  144

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA LG  VK+  P NAD YESS   PS G FR E+   ++QLV  L+ N  PF +N
Sbjct  145   TALVKAGLGSQVKVTCPLNADVYESSNTFPSGGDFRAEIHGYVSQLVKFLSDNGCPFTIN  204

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY + +FP +YAFF+G A P+ DG  +YSN FD N DTLV AL K G+  +PI+
Sbjct  205   IYPFISLYIDPNFPVEYAFFDGNATPLNDGGTIYSNMFDANHDTLVWALQKNGFGNVPII  264

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWPTDG  +AN   A+ FNQG + H+ G KGTP+RPG  P+D YLFSL DE  KSI
Sbjct  265   IGEIGWPTDGDRNANAQLAQRFNQGFMQHISGGKGTPMRPG--PVDAYLFSLIDEDAKSI  322

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG+FERHWG+ ++DG  KY L+LG   +G L  AR+V YL  +WC++ PN  L    ++
Sbjct  323   QPGNFERHWGILTYDGLPKYSLNLGTTNSGSLVPARNVKYLERKWCVLKPNAKLDDPQIA  382

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC LADCT+L Y  SC G+  +GNISYAFNSYYQ++ Q   +C F GL  VT  D
Sbjct  383   PSMSYACGLADCTSLGYQTSCGGLDARGNISYAFNSYYQINNQLDDACKFSGLATVTKSD  442

Query  413   PSVDECRF  390
             PS   CRF
Sbjct  443   PSTGTCRF  450



>ref|XP_002888279.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64538.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   452 bits (1164),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 231/434 (53%), Positives = 296/434 (68%), Gaps = 13/434 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             + +GVNWGT+A HKLPP TVV +L++NNI KVKLFDAD   + AL GSG+EVMV IPN+ 
Sbjct  23    NGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPNDQ  82

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  ++S   A D WV +N+TRY  +GGVNI +VAVGNEPFL SY+G F +   PA+TN+Q
Sbjct  83    LKVMTSYDRAKD-WVRKNVTRYNFDGGVNITFVAVGNEPFLKSYNGSFINLTFPALTNIQ  141

Query  1292  QSLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L +A LG +VK  VP NAD Y+S     +PS G FRP++   MTQ+V  L  N +P  
Sbjct  142   NALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNAPIT  201

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             +NIYPFLSLYGN DFP +YAFF+G A P+ D    Y+N FD N DTLV++L  +G+  MP
Sbjct  202   INIYPFLSLYGNDDFPLNYAFFDG-AQPINDNGIDYTNVFDANFDTLVSSLKAVGHGDMP  260

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPT+G   AN   A  F  GL+  +  NKGTPLRP    I+VYLF L DE  K
Sbjct  261   IIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTNKGTPLRPTY--IEVYLFGLLDEDAK  318

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG FERHWG+F FDGQ K+P+DL G GQ   L  A++VPYLP +WC  NP  KDL+ 
Sbjct  319   SIAPGPFERHWGIFKFDGQPKFPIDLSGQGQNKLLIGAQNVPYLPNKWCTFNPEAKDLTK  378

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++ +I  AC+ +DCT L YG SCN +   GN SYAFN Y+Q+  Q+  +C F GL  +T 
Sbjct  379   LAANIDFACTFSDCTALGYGSSCNTLDANGNASYAFNMYFQVKNQDESACFFQGLATITT  438

Query  419   LDPSVDECRFLVGV  378
              + S  +C F + +
Sbjct  439   QNISQGQCNFPIQI  452



>ref|XP_010470322.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=481

 Score =   452 bits (1164),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 230/434 (53%), Positives = 296/434 (68%), Gaps = 13/434 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             + +GVNWGT+A HKLPP TVV +L++NNI KVKLFDAD   + AL GSG+EVMV IPN+ 
Sbjct  23    NGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPNDQ  82

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  + S   A D WV +N+TRY  +GGVNI +VAVGNEPFL SY+G F +   PA+ N+Q
Sbjct  83    LKVMGSYHRAKD-WVRKNVTRYNFDGGVNITFVAVGNEPFLKSYNGSFINLTFPALQNIQ  141

Query  1292  QSLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L +A LG +VK  VP NAD Y+S     +PS G FRP++   MTQ+V  L  N +P  
Sbjct  142   NALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNAPIT  201

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             +NIYPFLSLYGN DFP +YAFF+G A P+ D    Y+N FD N DTLV++L  +G+  MP
Sbjct  202   INIYPFLSLYGNDDFPLNYAFFDG-AQPINDNGVDYTNVFDANFDTLVSSLKAVGHGDMP  260

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPT+G   AN   A  F  GL+  +  NKGTPLRP    I+VYLF L DE  K
Sbjct  261   IIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTNKGTPLRPTY--IEVYLFGLLDEDAK  318

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG+FERHWG+F FDGQ K+P+DL G GQ   L  A++VPYLP +WC+ NP  KDL+ 
Sbjct  319   SIAPGEFERHWGIFKFDGQPKFPIDLSGQGQNKFLIGAQNVPYLPNKWCVFNPEAKDLTK  378

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++ +I  AC+ +DCT L YG SCN +   GN SYAFN Y+Q+  Q+  +C F GL  +T 
Sbjct  379   LAANIDFACTFSDCTALGYGSSCNSLDANGNASYAFNMYFQVKNQDESACFFQGLATITT  438

Query  419   LDPSVDECRFLVGV  378
              + S  +C F + +
Sbjct  439   QNISQGQCSFPIQI  452



>ref|XP_006362259.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum tuberosum]
Length=479

 Score =   452 bits (1164),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 225/432 (52%), Positives = 295/432 (68%), Gaps = 12/432 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
                GVNWGT+A H L P  VV +L++N I KVKLFDAD + ++AL G+ IEVMV IPN+ 
Sbjct  24    EGFGVNWGTMATHMLEPKIVVQMLKDNGINKVKLFDADKSTMNALAGTDIEVMVAIPNDQ  83

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  ++    A D WV +N+TRY    GVNIKYVAVGNEPFL +Y+  F +   PA+ N+Q
Sbjct  84    LLTMTDYDRAKD-WVRRNVTRYNFKNGVNIKYVAVGNEPFLTAYNNSFLNLTFPALRNIQ  142

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L +A +G ++K  VP NAD Y S     +PS G FR ++ ++MTQ+V  ++ N +PF 
Sbjct  143   NALNEAGVGDSIKATVPLNADVYFSPESNPVPSAGRFRTDIAELMTQIVEFMSKNQAPFT  202

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLY N  FP D+AFF+GT  PV+D    Y+N FD N DTL +AL  +GY  M 
Sbjct  203   VNIYPFLSLYANEHFPIDFAFFDGTPSPVLDNGVEYTNVFDANFDTLYSALKAVGYGNMA  262

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +ANL  A  F +GL   +  N+GTPLRPG   I+VYLF L DE  K
Sbjct  263   ILVGEVGWPTDGDKNANLNNAYRFYKGLFAKLASNRGTPLRPGY--IEVYLFGLIDEDAK  320

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQLKN---ARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG+FERHWG+F +DGQ K+P+D+ G GQ K+   A++V YLP RWC++NPN  DLS 
Sbjct  321   SIAPGNFERHWGIFRYDGQSKFPMDISGQGQDKHLVAAKNVQYLPNRWCMLNPNATDLSK  380

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++N+I  AC+ +DCT+L YG SCN +   GN SYAFN +YQ+  Q   SCDF+GL +VT 
Sbjct  381   LANNIDYACTFSDCTSLGYGSSCNNLDAIGNASYAFNMFYQVQNQLDLSCDFEGLAMVTN  440

Query  419   LDPSVDECRFLV  384
              + S   C F++
Sbjct  441   RNLSQGTCNFII  452



>ref|XP_006483661.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Citrus sinensis]
Length=501

 Score =   453 bits (1166),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 230/440 (52%), Positives = 305/440 (69%), Gaps = 9/440 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S IGVNWGT A H LPPSTVV +L++N I +VKLFDAD   L+AL  SGI+VMVGIPNEM
Sbjct  42    SGIGVNWGTQATHPLPPSTVVRMLKDNGIDRVKLFDADSKYLNALANSGIQVMVGIPNEM  101

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L+ ++SS  AA+ WVA+N++ ++ + GV+I+YVAVGNEPFL +++G F    +PA+ N+Q
Sbjct  102   LSTLASSVQAAENWVAKNVSSHVSSNGVDIRYVAVGNEPFLPTFNGTFIGTTLPALQNIQ  161

Query  1292  QSLAKANLGGAVKLVVPCNADAY--ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA LG  +K+ VP NAD Y  +S+LPS+G FR ++  +M Q++  L+ N  PF VN
Sbjct  162   AALIKAGLGTRIKVTVPLNADVYQSQSNLPSEGDFRTDIHDLMLQILKFLSDNGGPFTVN  221

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY +  FP D+AFF+  + P+ D   VY N FD N DTLV AL K G+  + I+
Sbjct  222   IYPFISLYNDPSFPIDFAFFDSNSSPINDNGRVYENVFDANYDTLVWALQKNGFGNLSII  281

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +ANL  A+ FNQG +  V   KGTP+R G   ID YLFSL DE  KSI
Sbjct  282   VGEIGWPTDGDKNANLKFAQRFNQGFMSQVNAGKGTPMRSGA--IDAYLFSLIDEDAKSI  339

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGNGQ--LKNARDVPYLPYRWCIVNPNKDLS--AVSN  591
              PG+FERHWG+F FDGQ KY L LGNG+  L   +DV YL  +WC+++P+  L    V+ 
Sbjct  340   QPGNFERHWGLFYFDGQPKYQLSLGNGRNGLVTPKDVHYLAQKWCVMSPSASLDDPQVAL  399

Query  590   HIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDP  411
              +  AC  ADCT+L YG SC  +  +GNISYAFNSYYQ++ Q   +C F  L +VT  +P
Sbjct  400   SVSYACGNADCTSLGYGTSCGNLDSRGNISYAFNSYYQINNQLDTACKFPNLSVVTNTNP  459

Query  410   SVDECRFLVGV-TDTNNSSG  354
             S  +C+F + + TDT  S+G
Sbjct  460   STGDCQFRIMIKTDTTASAG  479



>ref|XP_006355982.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Solanum tuberosum]
Length=492

 Score =   453 bits (1165),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 227/434 (52%), Positives = 290/434 (67%), Gaps = 9/434 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S++GVNWGT+A H+L   +VV +L+EN   KVKLF+AD  +LSAL+GS IEVM+ IPN M
Sbjct  31    SSVGVNWGTMASHQLAAESVVKMLKENGFDKVKLFEADDKILSALIGSDIEVMLAIPNYM  90

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  +S++   A  W+  N++ Y    GV I+YVAVGNEPFL +Y+G +     PA+ NVQ
Sbjct  91    LQDMSTNPEMAASWIDANVSTYAYTHGVKIRYVAVGNEPFLQTYNGTYLHSTFPALRNVQ  150

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             +++  A LG  VK VVP NAD Y S     +PS G FRPE+  +  Q+V  L+SN +PFV
Sbjct  151   EAINHAGLGPEVKAVVPLNADIYYSPDSNPVPSAGDFRPEIRDLAIQIVQYLDSNDAPFV  210

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLY N+ FP +YAFF G+  P+ DG N+Y+N FD N DTL  +L K G+  M 
Sbjct  211   VNIYPFLSLYANNYFPFEYAFFNGSNKPMKDGDNLYTNVFDANFDTLAWSLKKAGFPNMK  270

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG   AN+  A+ FNQGL+ H L  +GTP R G   IDVYLFSL DE  K
Sbjct  271   IIVGEVGWPTDGNKYANIENAKRFNQGLVQHALSGEGTPARKG--KIDVYLFSLIDENTK  328

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLGNGQLKNARDVPYLPYRWCIVNPN--KDLSA-VS  594
             SI PG+FERHWG+F FDGQ KY LDL    L     V Y+  +WC++ P+  KD    ++
Sbjct  329   SIAPGNFERHWGIFEFDGQPKYELDLSEKPLAAVEGVTYMHKKWCVLKPHLPKDAQIYLA  388

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  ACS +DCT L YG SCN + E+GN SYAFN YYQ + QN   CDF GL +VT  D
Sbjct  389   KSVDYACSRSDCTALGYGSSCNHLSERGNTSYAFNMYYQFNNQNSLDCDFQGLAMVTHND  448

Query  413   PSVDECRFLVGVTD  372
             PS D+C F + + D
Sbjct  449   PSNDKCHFPLMIAD  462



>ref|XP_010488537.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=499

 Score =   453 bits (1165),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 231/440 (53%), Positives = 305/440 (69%), Gaps = 12/440 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S++GVNWGT+A H+LPP  VV +L++N   K+KLF+AD  +L AL+GS IEVM+GIPN  
Sbjct  36    SSVGVNWGTMASHQLPPENVVKMLQDNGFTKLKLFEADQNILDALIGSDIEVMIGIPNRF  95

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  ++  ++ A  WV +N+T Y  +GGVNIKY+AVGNEPFL +Y+G +  + +PA+ N+Q
Sbjct  96    LKEMAQDTAVAASWVEENVTAYSYHGGVNIKYIAVGNEPFLQTYNGTYVEFTLPALINIQ  155

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             ++L +A+L  +V++ VP NAD Y S     +PS G FRPEL     ++++ L S+ SPF 
Sbjct  156   RALEEADLK-SVEVTVPFNADIYFSPEANPVPSAGDFRPELRDATIEIINFLYSHDSPFT  214

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLYGN+ FP D+AFF+GT  P+ DG  VY+N FD NLDTL+ AL +  +  M 
Sbjct  215   VNIYPFLSLYGNAYFPLDFAFFDGTNKPLRDGNLVYTNVFDANLDTLICALERYSFLGMK  274

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN+ +A+ FNQG++ H +   GTP R GV  +DVYLFSL +E  K
Sbjct  275   IIVGEVGWPTDGDKNANVKSAKRFNQGMVKHAMSGNGTPARKGV-IMDVYLFSLINEDAK  333

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL---GNGQ-LKNARDVPYLPYRWCIVNPNK-DLSA  600
             SI PG FERHWG+F FDG+ KY LDL   GN + L    DV YLP  WC+++PN  +L  
Sbjct  334   SIAPGTFERHWGIFEFDGRPKYELDLSGKGNDKPLVPVEDVKYLPKTWCVLDPNAYNLDD  393

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             + ++I  ACSL+DCT L YG SCN +   GN SYAFN YYQ+H Q    CDF  LGLV  
Sbjct  394   LPDNIDYACSLSDCTALGYGSSCNHLTAIGNASYAFNMYYQMHDQKTWDCDFLVLGLVID  453

Query  419   LDPSVDECRFLVGVTDTNNS  360
              DPS + C F V + DT NS
Sbjct  454   EDPSDELCEFPVMI-DTGNS  472



>ref|XP_010496623.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Camelina sativa]
Length=482

 Score =   452 bits (1164),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 230/434 (53%), Positives = 295/434 (68%), Gaps = 13/434 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             + +GVNWGT+A HKLPP TVV +L++NNI K KLFDAD   + AL GSGIEVMV IPN+ 
Sbjct  23    NGLGVNWGTMATHKLPPKTVVQMLKDNNINKFKLFDADETTMGALAGSGIEVMVAIPNDQ  82

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  + S   A D WV +N+TRY  +GGVNI +VAVGNEPFL SY+G F +   PA+ N+Q
Sbjct  83    LKVMGSYHRAKD-WVRKNVTRYNFDGGVNITFVAVGNEPFLKSYNGSFINLTFPALQNIQ  141

Query  1292  QSLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L +A LG +VK  VP NAD Y+S     +PS G FRP++   MTQ+V  L  N +P  
Sbjct  142   NALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNAPIT  201

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             +NIYPFLSLYGN DFP +YAFF+G A P+ D    Y+N FD N DTLV++L  +G+  MP
Sbjct  202   INIYPFLSLYGNDDFPLNYAFFDG-AQPINDNGVDYTNVFDANFDTLVSSLKAVGHGDMP  260

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPT+G   AN   A  F  GL+  +  NKGTPLRP    I+VYLF L DE  K
Sbjct  261   IIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTNKGTPLRPTY--IEVYLFGLLDEDAK  318

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG+FERHWG+F FDGQ K+P+DL G GQ   L  A++VPYLP +WC+ NP  KDL+ 
Sbjct  319   SIAPGEFERHWGIFKFDGQPKFPIDLSGQGQNKFLIGAQNVPYLPNKWCVFNPEAKDLTK  378

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++ +I  AC+ +DCT L YG SCN +   GN SYAFN Y+Q+  Q+  +C F GL  +T 
Sbjct  379   LAANIDFACTFSDCTALGYGSSCNSLDANGNASYAFNMYFQVKNQDESACFFQGLATITT  438

Query  419   LDPSVDECRFLVGV  378
              + S  +C F + +
Sbjct  439   QNISQGQCSFPIQI  452



>ref|NP_001130924.1| putative O-Glycosyl hydrolase superfamily protein precursor [Zea 
mays]
 gb|ACF79312.1| unknown [Zea mays]
 gb|ACG29657.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
 tpg|DAA42581.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=486

 Score =   452 bits (1164),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 229/434 (53%), Positives = 285/434 (66%), Gaps = 9/434 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             +A+GVNWGT A H LPP  VV +LR+N I+KVKLFDADPA + AL G+GIEVMV IPN M
Sbjct  20    TALGVNWGTQATHPLPPKAVVQVLRDNGIKKVKLFDADPAAMRALAGTGIEVMVAIPNAM  79

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA +++ +  A  WV  N+ RY  +GGV IKYVAVGNEPFL SY+G F +  +PA+ NVQ
Sbjct  80    LAGLAADAGQARNWVKHNVRRYDFDGGVTIKYVAVGNEPFLESYNGSFINVTLPALKNVQ  139

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L  A +G  +K  VP NAD Y S     +PS G FR ++  +M  +V  L  N +PF 
Sbjct  140   NALNDAGIGDRIKATVPLNADVYNSPRSNPVPSAGRFRADIAGLMADMVRFLARNGAPFT  199

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLY N  FP DYAFF+G A PV D   +Y+N FD N DTLVAAL  +G+  MP
Sbjct  200   VNIYPFLSLYLNEHFPLDYAFFDGGAAPVDDHGVLYTNVFDANFDTLVAALGAVGHGDMP  259

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             +V+GEVGWPTDG   A  + A+ F  GL+  +  N GTP RPG  P +VYLF L DE  K
Sbjct  260   VVVGEVGWPTDGDRHAKASYAQRFYAGLLRRLAANTGTPARPGQRPAEVYLFGLVDEDAK  319

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSA  600
             S+ PG+FERHWGV  +DGQ K+ +DL G G+   L  AR V YL   WC +NP  KDL  
Sbjct  320   SVAPGNFERHWGVLRYDGQPKFAMDLTGQGRDTTLVPARGVAYLSRTWCALNPRAKDLGR  379

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             +  ++  AC+ ADCT L YG +C G+   GN SYAFN+YYQ   Q  ++CDF GL L T 
Sbjct  380   LGANVDYACTFADCTPLGYGSTCGGMDVAGNASYAFNAYYQAQNQKDEACDFQGLALPTE  439

Query  419   LDPSVDECRFLVGV  378
              DPS   C F + +
Sbjct  440   TDPSTATCNFTIQI  453



>gb|ACG29689.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
Length=485

 Score =   452 bits (1164),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 229/434 (53%), Positives = 286/434 (66%), Gaps = 9/434 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             +A+GVNWGT A H LPP  VV +LR+N I+KVKLFDADPA + AL G+GIEVMV IPN M
Sbjct  19    TALGVNWGTQATHPLPPKAVVQVLRDNGIKKVKLFDADPAAMRALAGTGIEVMVAIPNAM  78

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA +++ +  A  WV +N+ RY  +GGV IKYVAVGNEPFL SY+G F +  +PA+ NVQ
Sbjct  79    LAGLAADAGQARDWVKRNVRRYDFDGGVTIKYVAVGNEPFLESYNGSFINVTLPALQNVQ  138

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L  A +G  +K  VP NAD Y S     +PS G FR ++  +M  +V  L  N +PF 
Sbjct  139   NALNDAGIGDRIKATVPLNADVYNSPRSNPVPSAGRFRADIAGLMADMVRFLARNGAPFT  198

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLY N  FP DYAFF+G A PV D   +Y+N FD N DTLVAAL  +G+  MP
Sbjct  199   VNIYPFLSLYLNEHFPLDYAFFDGGAAPVDDHGVLYTNVFDANFDTLVAALGAVGHGDMP  258

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             +V+GEVGWPTDG   A  + A+ F  GL+  +  N GTP RPG  P +VYLF L DE  K
Sbjct  259   VVVGEVGWPTDGDRHAKASYAQRFYAGLLRRLAANAGTPARPGQRPAEVYLFGLVDEDAK  318

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQ---LKNARDVPYLPYRWCIVNPN-KDLSA  600
             S+ PG+FERHWGV  +DGQ K+ +DL G G+   L  AR V YL   WC +NP  KDL  
Sbjct  319   SVAPGNFERHWGVLRYDGQPKFAMDLTGQGRDTTLVPARGVAYLSRTWCALNPRAKDLGR  378

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             +  ++  AC+ ADCT L YG +C G+   GN SYAFN+YYQ   Q  ++CDF GL L T 
Sbjct  379   LGANVDYACTFADCTPLGYGSTCGGMDVAGNASYAFNAYYQAQNQKDEACDFQGLALPTE  438

Query  419   LDPSVDECRFLVGV  378
              DPS   C F + +
Sbjct  439   TDPSTATCNFTIQI  452



>ref|XP_009792149.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Nicotiana 
sylvestris]
Length=487

 Score =   452 bits (1164),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 231/431 (54%), Positives = 297/431 (69%), Gaps = 10/431 (2%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             IG NWGT A H LPP+ VV LL++N IQKVKLFDAD  +  AL GSGIEVMVGIPNEML 
Sbjct  27    IGANWGTQATHPLPPNIVVKLLKDNGIQKVKLFDADADIFKALSGSGIEVMVGIPNEMLY  86

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             ++++S  AA+ WV +N++ ++ +  V+IKYVAVGNEPFL+ ++G F S   PA+ N+Q +
Sbjct  87    SLANSLGAAEKWVEKNISSFVSSNSVDIKYVAVGNEPFLSQFNGTFLSTTFPAIQNIQAA  146

Query  1286  LAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIY  1113
             L KA LG  VK+ VP NAD YESS   PS G FR ++  +M  +V  LN N   F VNIY
Sbjct  147   LIKAGLGNRVKVTVPLNADVYESSSEKPSTGDFRQDIRDLMVNIVKFLNENGGAFTVNIY  206

Query  1112  PFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIG  933
             PF+SLY + +FP DYAFF+G ++ + D   +Y+N FD N DTL+ AL K GY  M I+IG
Sbjct  207   PFISLYNDPNFPADYAFFDGYSNAIDDNGKIYNNVFDANHDTLLWALQKNGYPNMSIIIG  266

Query  932   EVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILP  753
             E+GWPTDG  +ANL AA+ FNQG + H+ G KGTP+RPG  PID YLFSL DE  KSI P
Sbjct  267   EIGWPTDGDNNANLKAAQRFNQGFMTHISGGKGTPMRPG--PIDAYLFSLIDEDAKSIQP  324

Query  752   GDFERHWGVFSFDGQLKYPLDLG--NGQLKNARDVPYLPYRWCIVNPNKDLS--AVSNHI  585
             G+FERHWG+F FDG  KY L LG  NG+L  A  V YL  +WC+++ +  L    +++ +
Sbjct  325   GNFERHWGIFYFDGTAKYNLSLGANNGELVPASGVRYLARQWCVLSLSASLDDPQLADSV  384

Query  584   RLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSV  405
               ACS ADCT+L +G SC  +  +GNISYAFNSYYQ + Q P +C F  L +VT  DPS 
Sbjct  385   GYACSHADCTSLGHGTSCADLDTRGNISYAFNSYYQENDQLPTACKFPNLSMVTNTDPSP  444

Query  404   --DECRFLVGV  378
                 C+F + +
Sbjct  445   LGGNCKFKIMI  455



>ref|XP_010088872.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
 gb|EXB37069.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
Length=490

 Score =   452 bits (1164),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 237/463 (51%), Positives = 308/463 (67%), Gaps = 20/463 (4%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S++GVNWGTIA HKLPP  VV +++EN   KVKLF+AD  +L ALMG+ IEVMVGIPN M
Sbjct  34    SSVGVNWGTIASHKLPPGKVVKMMKENGFTKVKLFEADEWILEALMGTNIEVMVGIPNIM  93

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  +S +   A  WV  N+T YL  GGV+IKYVAVGNEPFL +Y+G +     PA+ N+Q
Sbjct  94    LQEISENPKVAADWVEANVTDYLYTGGVHIKYVAVGNEPFLEAYNGSYTHTTFPALKNIQ  153

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
             Q+L    +G  VK  VP NAD Y S     +PS G FRP++  I  +++  L++N +PF 
Sbjct  154   QALNDQGVGSKVKATVPFNADVYFSPDSNPVPSAGDFRPQVRDITIEIIQYLHANDAPFT  213

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAH-PVVDGPNVYSNAFDGNLDTLVAALSKLGYSQM  948
             VNIYPFLSLY N  FP D+AFF+GT + PV DG  VY+N FD N DTLV A++K G+  M
Sbjct  214   VNIYPFLSLYSNDYFPLDFAFFDGTNYKPVRDGDRVYNNVFDANFDTLVEAINKAGFPDM  273

Query  947   PIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAG  768
              I++GEVGWPTDG   AN+  A+ FNQG++ H L   GTP + G   I+VYLFSL DE  
Sbjct  274   KIIVGEVGWPTDGDRHANVKNAKRFNQGMLQHALSGNGTPAQKG--KIEVYLFSLIDEDA  331

Query  767   KSILPGDFERHWGVFSFDGQLKYPLDLG----NGQLKNARDVPYLPYRWCIVNPNKD-LS  603
             KSI PG+FERHWG++ +DG+ KY LDL     N  L     V Y+  RWC++NP+ + L 
Sbjct  332   KSIEPGNFERHWGIYEYDGKPKYELDLSGSKRNKGLVAVDGVEYMLKRWCVLNPDAEYLD  391

Query  602   AVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVT  423
              + + I  ACSL+DCT L +G SCN +  +GN SYAFN YYQ++ QN +SCDF GL +V+
Sbjct  392   DLPDSIDYACSLSDCTALGFGSSCNNLSAQGNASYAFNMYYQVNGQNSRSCDFSGLAVVS  451

Query  422   FLDPSVDECRFLVGVTDTNNSSGFSlplltliiiISWGVWLFL  294
               DPSV +C+F V ++      GFSL          +GV++FL
Sbjct  452   DKDPSVGDCQFPVMIS-RGGQMGFSLLRF-------FGVFVFL  486



>ref|XP_002530371.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF32004.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=482

 Score =   452 bits (1163),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 228/432 (53%), Positives = 291/432 (67%), Gaps = 9/432 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S IG NWGT A H LPP TVV LLREN IQKVKLFDAD   L AL  SGIEVMVGIPN+M
Sbjct  21    SGIGANWGTQATHPLPPDTVVRLLRENGIQKVKLFDADYDALRALGKSGIEVMVGIPNDM  80

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L++++ S  AA+ WVA+N++ ++    VNI+YVAVGNEPFL +Y+G F S   PA+ NVQ
Sbjct  81    LSSMAGSMKAAEKWVAKNVSTHITTNNVNIRYVAVGNEPFLETYNGTFLSTTFPALQNVQ  140

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA L   VK+ VP NAD Y SS   PS G FR ++  +M  +V  L+ + SPF VN
Sbjct  141   SALIKAGLSNQVKVTVPLNADVYASSTGFPSGGDFRTDIHDLMINIVKFLSDSGSPFTVN  200

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY + +FP +YAFF+G A PV DG   Y N FD N DTL  AL K G+  +PI+
Sbjct  201   IYPFISLYSDPNFPVEYAFFDGNAVPVNDGGTSYYNMFDANYDTLAYALQKNGFGNLPII  260

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +AN+  A+ FNQG +  + G KGTPLRP   PID YLFSL DE  KSI
Sbjct  261   VGEIGWPTDGDKNANMIYAQRFNQGFMQRISGGKGTPLRP--EPIDAYLFSLIDEDAKSI  318

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGNGQ---LKNARDVPYLPYRWCIVNPNKDLSA--VS  594
              PG+FERHWG+F+FDG+ KY L+LG      L  A++V YL  +WC++  +  L    V+
Sbjct  319   DPGNFERHWGIFTFDGRAKYTLNLGTTNSRALVEAKNVRYLERKWCVMKSSAKLDDPNVA  378

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC L DCT+L YG SC  +  +GNISYA NSYYQ+  Q   +C F+ +  +T  D
Sbjct  379   PSVSYACGLGDCTSLGYGTSCGNLDARGNISYALNSYYQIQNQLDSACKFENISTITKSD  438

Query  413   PSVDECRFLVGV  378
             PS + C+F + +
Sbjct  439   PSTETCKFEIMI  450



>ref|XP_003526446.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Glycine max]
Length=482

 Score =   452 bits (1163),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 225/436 (52%), Positives = 305/436 (70%), Gaps = 10/436 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S IGVNWGT + H L PS VV +L++N IQKVKLFDAD  +L AL  SGI+VMVGIPN+M
Sbjct  22    SGIGVNWGTQSTHPLSPSKVVKMLKDNGIQKVKLFDADAGILDALKKSGIQVMVGIPNDM  81

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  +++S  AA+ WV++N+++++ +GGV+I+YVAVGNEPFL++Y+G F++  +PA+ N+Q
Sbjct  82    LYTLANSVEAAEKWVSKNVSKHVSSGGVDIRYVAVGNEPFLSTYNGSFEATTLPALQNIQ  141

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L K+ L   VK+ VP NAD Y+SS   PS G FRP++  +M Q+V  LN+N +PF VN
Sbjct  142   AALTKSGLSNRVKVTVPLNADVYQSSSEKPSDGGFRPDINNVMLQIVKFLNNNGAPFTVN  201

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY + +FP DYAFF G    + D    Y N FD N DTLV AL K G+  +PI+
Sbjct  202   IYPFISLYADPNFPVDYAFFNGYQPAINDNGRNYDNVFDANHDTLVWALQKNGFGNLPII  261

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +ANL  A+ FNQG +   +  KGTP+RPG  PID YLFSL DE  KSI
Sbjct  262   VGEIGWPTDGDRNANLQYAQRFNQGFMSRYMSGKGTPMRPG--PIDAYLFSLIDEDAKSI  319

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGNGQ---LKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG+FERHWG+F FD Q KY L+LG+ +   L  A  V +L  +WC++ P+ +L+   ++
Sbjct  320   QPGNFERHWGMFYFDAQPKYQLNLGSARGNGLVGASGVDHLAKKWCVLKPSANLNDDQLA  379

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC  ADCT+L YG SC  +   GNISYAFNSYYQ++ Q   +C F  L ++T  D
Sbjct  380   PSVAYACQNADCTSLGYGTSCGNLDVHGNISYAFNSYYQINDQMDSACKFPSLSMITDKD  439

Query  413   PSVDECRFLVGV-TDT  369
             PSV +C+F + + TD+
Sbjct  440   PSVGDCKFRIMIQTDS  455



>gb|KHG15443.1| hypothetical protein F383_00171 [Gossypium arboreum]
Length=484

 Score =   452 bits (1163),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 229/438 (52%), Positives = 296/438 (68%), Gaps = 6/438 (1%)
 Frame = -3

Query  1649  AIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEML  1470
             AIGVNWGT++ H LPP  VV+LL+ N + KVKLFDADP VL AL GS I V +GIPN ML
Sbjct  22    AIGVNWGTMSSHPLPPPKVVELLKSNEVSKVKLFDADPLVLQALSGSNIVVTLGIPNSML  81

Query  1469  aavsssssaADLWVAQNLTRYLVNGG--VNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
               ++SS  AA+ WV  N+TRY  +GG  V I+YVAVG+EPFL SY  QF  +V+ A  N+
Sbjct  82    KTLNSSRKAAESWVHDNVTRYFSHGGAGVRIEYVAVGDEPFLQSYGDQFHPFVIGAAMNI  141

Query  1295  QQSLAKANLGGAVKLVVPCNADAY--ESSLPSQGAFRPELTQIMTQLVSLLNSNASPFVV  1122
             Q +L KANL G VK+VVPC+ D +  ES  PS+G FR +L + M +L++ L+ + S F V
Sbjct  142   QATLTKANLAGEVKVVVPCSFDTFVSESGRPSKGHFRTDLNKTMIELLTFLSKHHSSFFV  201

Query  1121  NIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPI  942
              I PF+S   N +   D++ F+  AH   D    Y N+FD + DTLV+ALSK+G+ ++ I
Sbjct  202   TISPFISFQQNKNISLDFSLFKENAHHHNDSLRTYKNSFDLSYDTLVSALSKIGFPEIDI  261

Query  941   VIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKS  762
             V+  +GWPTDGA +A  + A  F +GLI H+    GTPLRP  PPI+ ++FSL DE  +S
Sbjct  262   VVARIGWPTDGAANATSSIAETFMKGLIDHLHSKTGTPLRPQNPPIETFIFSLLDEDHRS  321

Query  761   ILPGDFERHWGVFSFDGQLKYPLDLGNG--QLKNARDVPYLPYRWCIVNPNKDLSAVSNH  588
             I  G+FERHWGVF+FDGQ KY  + G G   L N++ V YL  +WC+VN NKDLS  S  
Sbjct  322   ITSGNFERHWGVFTFDGQAKYHFNFGQGTKNLVNSQFVEYLAPKWCVVNNNKDLSNASAS  381

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPS  408
                ACS +DCT L  GGSC+ I   GNISYAFNSYYQ + Q   SCDF GLGL+T +DPS
Sbjct  382   ALEACSTSDCTALSPGGSCSNISWPGNISYAFNSYYQQNDQRADSCDFGGLGLITTVDPS  441

Query  407   VDECRFLVGVTDTNNSSG  354
             VD CRF V +  ++++S 
Sbjct  442   VDTCRFFVELQTSHSTSA  459



>ref|XP_006283637.1| hypothetical protein CARUB_v10004695mg [Capsella rubella]
 gb|EOA16535.1| hypothetical protein CARUB_v10004695mg [Capsella rubella]
Length=484

 Score =   452 bits (1162),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 224/436 (51%), Positives = 301/436 (69%), Gaps = 7/436 (2%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             IGVNWG+ A H LPP+TVV LLREN IQKVKLF+AD ++L AL  +GI+VMVGIPN++LA
Sbjct  27    IGVNWGSQARHPLPPATVVRLLRENGIQKVKLFEADSSILKALSRTGIQVMVGIPNDLLA  86

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              ++ S +AA+ WV+QN++ ++ + GV+I+YVAVGNEPFL +++G F+S  +PA+ N+Q +
Sbjct  87    PIAGSVAAAERWVSQNVSAHVSSNGVDIRYVAVGNEPFLKAFNGTFESITLPALQNIQSA  146

Query  1286  LAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIY  1113
             + KA L   VK+ VP NAD Y+S+  LPS G FRPE+  +M  +V  L+ N +PF +NIY
Sbjct  147   IIKAGLATQVKVTVPLNADVYQSASNLPSDGDFRPEIRDLMLNIVKFLSDNQAPFTINIY  206

Query  1112  PFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIG  933
             PF+SLY + +FP ++AFF+GT  P+ D   +Y N  D N DTLV +L K G+  + I++G
Sbjct  207   PFISLYNDPNFPVEFAFFDGTGTPINDNGRIYDNVLDANYDTLVWSLQKNGFGNLTIIVG  266

Query  932   EVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILP  753
             EVGWPTDG  SAN+  AR +NQG +     NKGTP+RPG   +D YLF L DE  KSI P
Sbjct  267   EVGWPTDGDKSANMLYARRYNQGFMNRQKANKGTPMRPGA--MDAYLFGLIDEDAKSIQP  324

Query  752   GDFERHWGVFSFDGQLKYPLDLGNGQ-LKNARDVPYLPYRWCIVNPNKDLS--AVSNHIR  582
             G+FERHWG+F  DGQ KY L LGNG  L  A+DV YL  +WCI+ PN +L    +   + 
Sbjct  325   GNFERHWGIFFIDGQPKYQLSLGNGNGLIPAKDVHYLAKKWCILAPNANLQDPQLGPSVS  384

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
              AC  ADCT+L YG SC  +    N+SYAFNSYYQ+  Q   +C F GL ++T  DPSV 
Sbjct  385   YACDHADCTSLGYGSSCGSLNLAQNVSYAFNSYYQVSNQLDSACKFPGLSIITNRDPSVG  444

Query  401   ECRFLVGVTDTNNSSG  354
              C+F + +   ++S  
Sbjct  445   SCKFKIMIKSDDSSEA  460



>gb|KHG29709.1| hypothetical protein F383_09866 [Gossypium arboreum]
Length=485

 Score =   452 bits (1163),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 230/443 (52%), Positives = 301/443 (68%), Gaps = 11/443 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S IGVNWGT A H LPP T+V LLR+N  Q+VKLFDAD   L  L  +GIEVMVGIPN+M
Sbjct  25    SGIGVNWGTQASHPLPPDTIVRLLRDNGFQRVKLFDADYDTLKTLGKTGIEVMVGIPNDM  84

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA V  S  AA+ WVA+N+T+++ +  VNI+YVAVGNEPFL +Y+G +     PA+ N+Q
Sbjct  85    LAIVGGSMKAAEKWVAKNVTQHITSNNVNIRYVAVGNEPFLETYNGSYLGITFPALRNIQ  144

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA     VK+ VP NAD YES+   PS G FR ++  IM  +V+ L+ +A+PF VN
Sbjct  145   SALVKAGHNNQVKVTVPLNADVYESTNGSPSGGDFRADIHDIMLTIVNFLSLSAAPFTVN  204

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY + +FP +YAFF+G A PV DG  +Y N FD NLDTL  AL K G++ +PI+
Sbjct  205   IYPFISLYSDPNFPVEYAFFDGNASPVSDGGTLYYNMFDANLDTLAHALQKNGFADLPII  264

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +AN   AR FNQG + H+ G +GTP+RPG  PID YLFSL DE  KSI
Sbjct  265   VGEIGWPTDGDRNANTEYARRFNQGFMSHISGGRGTPMRPG--PIDAYLFSLIDEDAKSI  322

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG+FERHWG+F+FDGQ KYPL+LG   +G L  A+ V YL  +WC++ P+  L    V 
Sbjct  323   APGNFERHWGIFTFDGQAKYPLNLGTTNSGALIPAKGVQYLEKKWCVMKPSARLDDPQVE  382

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC  ADCT L YG SC  +  +GNISYAFNSY+Q + Q  ++C F  + ++T  D
Sbjct  383   PSVSFACGSADCTCLGYGTSCGNLDARGNISYAFNSYFQKNNQLEEACKFPNVSMITKTD  442

Query  413   PSVD--ECRFLVGVTDTNNSSGF  351
             P+     C+F + +     S+G+
Sbjct  443   PTPTGGNCKFHIMIQPYYGSAGW  465



>ref|XP_003619009.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=449

 Score =   451 bits (1159),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 230/433 (53%), Positives = 297/433 (69%), Gaps = 15/433 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
               +GVNWGT A H L P TVV +L++N IQKVKLFDAD   +SAL GSGIEVMV IPN  
Sbjct  16    EGLGVNWGTQATHPLKPDTVVQMLKDNGIQKVKLFDADEETMSALGGSGIEVMVAIPNNQ  75

Query  1472  LaavsssssaADLWVAQNLTRY-LVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNV  1296
             LA +S    A   WV +N+TRY   +GGVNIKYVAVGNEPFL +Y+  F +   PA+ N+
Sbjct  76    LAEMSDYDRALQ-WVRKNVTRYNFKSGGVNIKYVAVGNEPFLKAYNNSFLNVTFPALMNI  134

Query  1295  QQSLAKANLGGAVKLVVPCNADAYES-----SLPSQGAFRPELTQIMTQLVSLLNSNASP  1131
             Q +L +  LG ++K  VP NAD YES     ++PS G FRP+L+++MTQ+V  L+ N +P
Sbjct  135   QNALNQVGLGDSIKATVPLNADVYESPDSNNAVPSAGIFRPDLSELMTQIVQFLSKNNAP  194

Query  1130  FVVNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQ  951
             F VNIYPFLSLYGN +FP DYAFF+G ++P+ D   +Y+N FD N DTLV+AL  +G+  
Sbjct  195   FTVNIYPFLSLYGNDNFPFDYAFFDGVSNPINDNGVLYTNVFDANFDTLVSALKSIGFGN  254

Query  950   MPIVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEA  771
             MPI +GEVGWPTDG  +AN+  A  F  GL+  +  NKGTP R G   I+VYLF L DE 
Sbjct  255   MPIFVGEVGWPTDGDKNANIQNALRFYNGLLPRLASNKGTPRRQGY--IEVYLFGLIDED  312

Query  770   GKSILPGDFERHWGVFSFDGQLKYPLDLGNGQLKN-----ARDVPYLPYRWCIVNPN-KD  609
              KSI PG+FERHWG+FSFDG+ K+P+ + N   +N     A+DV YL  +WC+ NPN  +
Sbjct  313   AKSIEPGNFERHWGIFSFDGKPKFPMHVSNQHGQNKLLVGAKDVHYLDPKWCMFNPNANN  372

Query  608   LSAVSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGL  429
             LS ++++I  AC+ ADCT L YG SCN +   GN SYAFN YYQ+  QN  +C+F+GL +
Sbjct  373   LSNLADNINYACTFADCTPLGYGSSCNNLDANGNASYAFNMYYQVQNQNDLACNFEGLAM  432

Query  428   VTFLDPSVDECRF  390
             +T  + S   C F
Sbjct  433   LTTNNISTPTCVF  445



>ref|XP_009793269.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
sylvestris]
Length=480

 Score =   452 bits (1162),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 226/432 (52%), Positives = 294/432 (68%), Gaps = 12/432 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
               +GVNWGT+A H L P  VV +L+EN I+KVKLFDAD   ++AL G+ IEVMV IPN+ 
Sbjct  25    EGLGVNWGTMASHPLEPKIVVQMLKENGIKKVKLFDADKTSMNALAGTDIEVMVAIPNDQ  84

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  ++    A D WV +N+TRY +  GVNIKYVAVGNEPFL +Y+  F +   PA+ N+Q
Sbjct  85    LLTMTDYDRAKD-WVRRNVTRYNIKSGVNIKYVAVGNEPFLTAYNNSFVNLTFPALQNIQ  143

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L +A +G  +K  VP NAD Y S     +PS G FRP++ ++MTQ+V  ++ N +PF 
Sbjct  144   NALNEAGVGDYIKATVPLNADVYFSPESNPVPSAGRFRPDIAELMTQIVQFMSKNQAPFT  203

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLY N  FP D+AFF+G ++PVVD    Y+N FD N DTL +AL  +GY  M 
Sbjct  204   VNIYPFLSLYANEHFPFDFAFFDGASNPVVDNGVEYTNVFDANFDTLYSALKAVGYGNMT  263

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +ANL  A  F +GL   +  NKGTPLRPG   I+VYLF L DE  K
Sbjct  264   ILVGEVGWPTDGDKNANLNNAYRFYKGLFSRLGANKGTPLRPGY--IEVYLFGLIDEDAK  321

Query  764   SILPGDFERHWGVFSFDGQLKYPLDL-GNGQLKN---ARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG+FERHWG+F +DGQ K+ +D+ G G  K+   A++V YLP RWC++NPN  +LS 
Sbjct  322   SISPGNFERHWGIFRYDGQPKFAMDISGQGHEKHLVAAKNVQYLPKRWCMLNPNANNLSI  381

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             ++N+I  AC+ +DCT L YG SCN +   GN SYAFN YYQ+  Q   SCDF GL +VT 
Sbjct  382   LANNIDYACTFSDCTALGYGSSCNNLDANGNASYAFNMYYQVQNQLDLSCDFQGLAMVTD  441

Query  419   LDPSVDECRFLV  384
              + S   C F++
Sbjct  442   KNISQGTCNFII  453



>gb|KHN16471.1| Glucan endo-1,3-beta-glucosidase 5 [Glycine soja]
Length=481

 Score =   452 bits (1162),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 225/436 (52%), Positives = 305/436 (70%), Gaps = 10/436 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S IGVNWGT + H L PS VV +L++N IQKVKLFDAD  +L AL  SGI+VMVGIPN+M
Sbjct  21    SGIGVNWGTQSTHPLSPSKVVKMLKDNGIQKVKLFDADAGILDALKKSGIQVMVGIPNDM  80

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  +++S  AA+ WV++N+++++ +GGV+I+YVAVGNEPFL++Y+G F++  +PA+ N+Q
Sbjct  81    LYTLANSVEAAEKWVSKNVSKHVSSGGVDIRYVAVGNEPFLSTYNGSFEATTLPALQNIQ  140

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L K+ L   VK+ VP NAD Y+SS   PS G FRP++  +M Q+V  LN+N +PF VN
Sbjct  141   AALTKSGLSKRVKVTVPLNADVYQSSSEKPSDGGFRPDINNVMLQIVKFLNNNGAPFTVN  200

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY + +FP DYAFF G    + D    Y N FD N DTLV AL K G+  +PI+
Sbjct  201   IYPFISLYADPNFPVDYAFFNGYQPAINDNGRNYDNVFDANHDTLVWALQKNGFGNLPII  260

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +ANL  A+ FNQG +   +  KGTP+RPG  PID YLFSL DE  KSI
Sbjct  261   VGEIGWPTDGDRNANLQYAQRFNQGFMSRYMSGKGTPMRPG--PIDAYLFSLIDEDAKSI  318

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGNGQ---LKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG+FERHWG+F FD Q KY L+LG+ +   L  A  V +L  +WC++ P+ +L+   ++
Sbjct  319   QPGNFERHWGMFYFDAQPKYQLNLGSARGNGLVGASGVDHLAKKWCVLKPSANLNDDQLA  378

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC  ADCT+L YG SC  +   GNISYAFNSYYQ++ Q   +C F  L ++T  D
Sbjct  379   PSVAYACQNADCTSLGYGTSCGNLDVHGNISYAFNSYYQINDQMDSACKFPSLSMITDKD  438

Query  413   PSVDECRFLVGV-TDT  369
             PSV +C+F + + TD+
Sbjct  439   PSVGDCKFRIMIQTDS  454



>ref|XP_006401129.1| hypothetical protein EUTSA_v10013422mg [Eutrema salsugineum]
 gb|ESQ42582.1| hypothetical protein EUTSA_v10013422mg [Eutrema salsugineum]
Length=478

 Score =   452 bits (1162),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 233/428 (54%), Positives = 289/428 (68%), Gaps = 9/428 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S+IG NWGT A H LPP  VV +LR+N IQKVKLFDA+   L AL  SGIEVMVGIPNEM
Sbjct  20    SSIGANWGTQASHPLPPDIVVRMLRDNGIQKVKLFDAEYDTLRALGKSGIEVMVGIPNEM  79

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA ++SS  AA+ WVA+N++ ++    VNI+YVAVGNEPFL++Y+G + S   PA+ N+Q
Sbjct  80    LATLASSLKAAEKWVAKNVSTHISTDNVNIRYVAVGNEPFLSTYNGSYLSTTFPALRNIQ  139

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA L   VK+  P NAD Y+SS   PS G FR  +  +M  +V  L+ N  PF VN
Sbjct  140   IALIKAGLRDQVKVTCPLNADVYDSSTTFPSGGDFRANIRDLMITIVKFLSDNGGPFTVN  199

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY +++FP DYAFF+G + PV DG   Y N FD N DTLV AL K G+  MPI+
Sbjct  200   IYPFISLYNDANFPVDYAFFDGNSQPVSDGGTFYYNMFDANYDTLVHALEKNGFGNMPII  259

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +AN+  AR FNQG + H+ G KGTP RPG  PID YLFSL DE  KS+
Sbjct  260   VGEIGWPTDGDRNANVEYARKFNQGFMSHISGGKGTPRRPG--PIDAYLFSLIDEDAKSV  317

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG FERHWG+F+FDG  KY L+LG    G L  A+ V YL  +WC++ PN  L    V+
Sbjct  318   QPGYFERHWGIFTFDGLPKYALNLGTTNTGALIQAKGVRYLQRKWCVMKPNVRLDDPQVA  377

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  ACSL DCT+L  G SC  +  K NISYAFNSYYQ++ Q   +C F  +  VT  D
Sbjct  378   PSVSYACSLGDCTSLGVGTSCGNLDGKENISYAFNSYYQINDQLDTACKFPNISEVTKTD  437

Query  413   PSVDECRF  390
             PS   CRF
Sbjct  438   PSTGTCRF  445



>ref|XP_006826313.1| hypothetical protein AMTR_s00004p00082670 [Amborella trichopoda]
 gb|ERM93550.1| hypothetical protein AMTR_s00004p00082670 [Amborella trichopoda]
Length=481

 Score =   452 bits (1162),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 229/432 (53%), Positives = 300/432 (69%), Gaps = 12/432 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             IGVNWGT+A+ +LPP TVV LL++N  QKVKLFDAD + +S+L GSGIEVMV IPN  L 
Sbjct  26    IGVNWGTMAIRRLPPDTVVQLLKDNGFQKVKLFDADQSTMSSLAGSGIEVMVAIPNNQLE  85

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
             A++   +A   WV +N+T Y  +GGVNIKYVAVGNEPFL SY+G F +   PA+ N+Q +
Sbjct  86    AMNDYETAKR-WVDRNITLYNFDGGVNIKYVAVGNEPFLKSYNGSFLNTTFPALQNIQNA  144

Query  1286  LAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L +A  G  +K  VP NAD Y+S    S+PS G FR ++  +M Q+V  LN++ +PF VN
Sbjct  145   LNEAGAGDTIKATVPLNADVYDSPKDNSVPSAGRFRSDINDLMVQIVQFLNNSNAPFTVN  204

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYP+LSLYGN+ FP DYAFF+GT+ PV D   +Y N FD N DTLV++L   G+  +PI+
Sbjct  205   IYPYLSLYGNTGFPIDYAFFDGTSKPVDDNGVMYDNVFDANFDTLVSSLRAAGFPDLPIL  264

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGEVGWPTDG   A    A+ F  GL+  +  NKG+PLRPG   + VYLF L DE  KSI
Sbjct  265   IGEVGWPTDGDMFATSLYAQRFYNGLLKRLAQNKGSPLRPG--HLVVYLFGLIDEDAKSI  322

Query  758   LPGDFERHWGVFSFDGQLKYPLDL-GNGQLK---NARDVPYLPYRWCIVNPN-KDLSAVS  594
              PG+FERHWG+FS+DGQ K+P+DL G GQ      A +V YLP +WC++N N KD+S + 
Sbjct  323   APGNFERHWGIFSYDGQPKFPMDLSGQGQSSLPIGANNVKYLPAQWCVLNTNAKDMSTLP  382

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
             ++I  AC+ +DCT+L YG +CN +  +GN SYAFN YYQ+     +SCDF GL +VT  +
Sbjct  383   DNINYACTYSDCTSLGYGSTCNKLDAQGNASYAFNMYYQVQGHKDESCDFGGLAVVTTQN  442

Query  413   PSVDECRFLVGV  378
              S D C+F + +
Sbjct  443   ASQDPCKFPIQI  454



>gb|KHG03269.1| hypothetical protein F383_27500 [Gossypium arboreum]
 gb|KHG25768.1| hypothetical protein F383_09975 [Gossypium arboreum]
Length=486

 Score =   452 bits (1162),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 232/442 (52%), Positives = 304/442 (69%), Gaps = 11/442 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             + IGVNWGT   H LPP TVV +LREN IQKVKLFDAD  +L AL  +GIEVMVGIPN+M
Sbjct  21    NGIGVNWGTQTSHPLPPDTVVRMLRENGIQKVKLFDADYGILKALGKTGIEVMVGIPNDM  80

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA+V  S  AA+ WVA+N++ ++ +  VNI+YVAVGNEPFL +Y+G +    +PA++N+Q
Sbjct  81    LASVGGSMKAAEKWVAKNVSEHISSNNVNIRYVAVGNEPFLETYNGSYLHITLPALSNIQ  140

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              +L KA +G  VK+ VP NAD Y SS   PS G FR ++   M ++V  LN + SPF VN
Sbjct  141   SALIKAGIGSQVKVTVPLNADVYASSNTYPSGGDFRTDIFDPMLKIVKFLNDSNSPFTVN  200

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY +S+FP +YAFF+G A P+ DG  +Y N FD NLDTL  AL K G+  +PI+
Sbjct  201   IYPFISLYTDSNFPVEYAFFDGNATPLNDGGTLYYNMFDANLDTLAHALQKNGFGNLPII  260

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GE+GWPTDG  +AN+  AR FNQG + H+ G KGTP+RP   PID YLFSL DE  KSI
Sbjct  261   VGEIGWPTDGDRNANIEYARRFNQGFMSHISGGKGTPMRP--IPIDAYLFSLIDEDAKSI  318

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG+FERHWG+F FDGQ+KYPL+LG   +G L  A+ V YL  +WC++  +  L    V+
Sbjct  319   DPGNFERHWGIFYFDGQVKYPLNLGTTNSGALIPAKGVQYLERKWCVMKLSAPLDDPQVA  378

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  AC  ADCT+L YG SC  +  +GNISYAFNSY+Q + Q   +C F  + ++T  D
Sbjct  379   QSVSYACGRADCTSLGYGTSCGNLDARGNISYAFNSYFQKNNQLEDACKFPNVSVITKTD  438

Query  413   --PSVDECRFLVGVTDTNNSSG  354
               P+V  C+F + +     S+G
Sbjct  439   PTPTVGNCKFPIMIQPYYESAG  460



>gb|EYU23029.1| hypothetical protein MIMGU_mgv1a006384mg [Erythranthe guttata]
Length=446

 Score =   450 bits (1158),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 231/434 (53%), Positives = 293/434 (68%), Gaps = 20/434 (5%)
 Frame = -3

Query  1625  IAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLaavsssss  1446
             +A H+LPP +VVD+L++N   KVKLFDAD ++L AL G+GIEVM+ +PN ML  +S  S 
Sbjct  1     MASHQLPPESVVDMLKDNGFDKVKLFDADESILEALSGTGIEVMLAVPNYMLEQMSLDSG  60

Query  1445  -aADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQSLAKANL  1269
              AADLWV  NLT Y   GGVNI+YVAVGNEPFL +Y+  +    +PA+ N+Q+++ +A  
Sbjct  61    GAADLWVEANLTAYAYPGGVNIRYVAVGNEPFLKTYNDTYLKNTLPALRNIQEAINRAGF  120

Query  1268  GGAVKLVVPCNADAYESS----LPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIYPFLS  1101
             G  +K  VP NAD Y S     +PS G FRPE+  +  Q++  L+ N +PFVVNIYPFLS
Sbjct  121   GAEIKATVPFNADIYYSPESNPVPSSGDFRPEIRDLTIQIIQYLHLNDAPFVVNIYPFLS  180

Query  1100  LYGNSDFPQDYAFFEG----TAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIG  933
             LY N  FP D+AFFE       HP+ DG N+Y+N FD NLDTLV +L+K GY  M I+IG
Sbjct  181   LYSNPYFPIDFAFFEAGPTKNNHPIRDGQNLYTNVFDANLDTLVWSLTKAGYPDMKILIG  240

Query  932   EVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILP  753
             EVGWPTDG   A++  A+ FNQGL+ HVLGN+GTP R G  PID+YLFSL DE  KSI P
Sbjct  241   EVGWPTDGDKHADIEKAKRFNQGLVQHVLGNEGTPARKG--PIDIYLFSLIDEDSKSIDP  298

Query  752   GDFERHWGVFSFDGQLKYPLDLG----NGQLKNARDVPYLPYRWCIVNP-----NKDLSA  600
             G FERHWG+F FDG+ KY LDL     N  L   + V Y+  RWC++ P     + D   
Sbjct  299   GSFERHWGIFEFDGKPKYELDLSGREENKGLVAVQGVRYMVRRWCVLRPRGKDDDVDDRE  358

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             +  ++  ACSL+DCT L YG SCN +  KGN SYAFN YYQ   QN   CDF+GLG++T 
Sbjct  359   LGRNVDYACSLSDCTALGYGSSCNHLSAKGNASYAFNMYYQSKNQNEWDCDFEGLGVITE  418

Query  419   LDPSVDECRFLVGV  378
              DPS ++CRF V +
Sbjct  419   EDPSDNKCRFPVMI  432



>gb|KDP32321.1| hypothetical protein JCGZ_13246 [Jatropha curcas]
Length=489

 Score =   452 bits (1162),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 224/434 (52%), Positives = 294/434 (68%), Gaps = 11/434 (3%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             + IGVNWGT+  H L P  V++++R+N  Q++KLF+AD  +++AL+G+ IEVM+ IPN M
Sbjct  8     TTIGVNWGTMTTHLLRPENVINMMRDNGFQRLKLFEADERIMAALIGTDIEVMLAIPNYM  67

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             L  +S   +AA  WV  N+T +L +GGVNIKYVAVGNEPFL +Y+G +    +PA+ N+Q
Sbjct  68    LQQMSEDPAAATNWVDANVTSWLYSGGVNIKYVAVGNEPFLQTYNGSYLQVTLPALRNIQ  127

Query  1292  QSLAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFV  1125
              +L  A +G  VK  VP NAD Y S     +PS G FRPE+     +++  L+SN +PF 
Sbjct  128   LALNHAKIGSRVKATVPFNADVYYSPDPNQIPSAGDFRPEVRDPTLEIIQFLHSNDAPFT  187

Query  1124  VNIYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMP  945
             VNIYPFLSLY + +FP D+AFF+G  +P+ DG  VY+N FD N DTLV AL+K GY  M 
Sbjct  188   VNIYPFLSLYSDENFPVDFAFFDGAKNPIKDGNLVYTNVFDANFDTLVWALNKAGYPDMK  247

Query  944   IVIGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGK  765
             I++GEVGWPTDG  +AN+  A+ FNQGLI HVL  KGTP R G   IDVYLFSL DE  K
Sbjct  248   ILVGEVGWPTDGDKNANIQNAKKFNQGLIQHVLSGKGTPARKG--KIDVYLFSLIDENAK  305

Query  764   SILPGDFERHWGVFSFDGQLKYPLDLG----NGQLKNARDVPYLPYRWCIVNPN-KDLSA  600
             SI PG FERHWG+F +DG+ KY LDL     +  L     V Y+  RWC++NP+  DL  
Sbjct  306   SIAPGSFERHWGIFEYDGKPKYELDLSGLKEDKALAPVEGVKYMLRRWCVLNPDASDLEE  365

Query  599   VSNHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTF  420
             + + I  ACSL+DCT+L YG SCN +  +GN SYAFN YYQ++ Q   +CDF GL  +T 
Sbjct  366   LPDSINYACSLSDCTSLGYGSSCNHLSVEGNASYAFNMYYQVNNQKDWTCDFSGLAAITD  425

Query  419   LDPSVDECRFLVGV  378
              DPS  +C F + +
Sbjct  426   QDPSDGDCEFPIMI  439



>ref|XP_010483379.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Camelina sativa]
Length=477

 Score =   451 bits (1160),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 234/432 (54%), Positives = 291/432 (67%), Gaps = 9/432 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S+IG NWGT A H LPP  VV +LREN IQKVKLFDA+   L AL  SGIEVMVGIPNEM
Sbjct  20    SSIGANWGTQASHPLPPDIVVRMLRENGIQKVKLFDAEYDTLRALGKSGIEVMVGIPNEM  79

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA+++SS  AA+ WVA+N++ ++    VNI+YVAVGNEPFL++Y+G + S   PA+ N+Q
Sbjct  80    LASLASSLKAAEKWVAKNVSVHISTDKVNIRYVAVGNEPFLSTYNGSYLSTTFPALRNIQ  139

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              ++ KA L   VK+  P NAD YESS   PS G FR  +  +M  +V  L+ N  PF VN
Sbjct  140   IAIIKAGLQNQVKVTCPLNADVYESSTTFPSGGDFRANIRDLMITIVKFLSENGGPFTVN  199

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPF+SLY +++FP DYAFF+G + PV DG   Y N FD N DTLV AL K G+  MPI+
Sbjct  200   IYPFISLYNDANFPVDYAFFDGNSQPVSDGGTFYYNMFDANYDTLVHALEKNGFGNMPII  259

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWPTDG  +ANL  AR FNQG + H+ G KGTP RPG  PID YLFSL DE  KS+
Sbjct  260   IGEIGWPTDGDRNANLDYARKFNQGFMAHISGGKGTPRRPG--PIDAYLFSLIDEDAKSV  317

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG FERHWG+F+FDG  KY L+LG    G L  A+ V YL  +WC++ PN  L    V+
Sbjct  318   QPGYFERHWGIFTFDGLPKYALNLGTTNTGALIQAKGVRYLQRKWCVMKPNVKLDDPQVA  377

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  ACS  DCT+L  G SC  +  K NISYAFNSY+Q++ Q   +C F  +  VT  D
Sbjct  378   PSVSYACSRGDCTSLGVGTSCADLDGKQNISYAFNSYFQINDQLDTACKFPNISEVTKTD  437

Query  413   PSVDECRFLVGV  378
             PS   CRF + +
Sbjct  438   PSTGTCRFPIMI  449



>gb|AAL24251.1| AT5g58090/k21l19_70 [Arabidopsis thaliana]
 gb|AAN18179.1| At5g58090/k21l19_70 [Arabidopsis thaliana]
Length=477

 Score =   451 bits (1160),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 234/432 (54%), Positives = 289/432 (67%), Gaps = 9/432 (2%)
 Frame = -3

Query  1652  SAIGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEM  1473
             S+IG NWGT A H LPP  VV +LREN IQKVKLFDA+   L AL  SGIEVMVGIPNEM
Sbjct  20    SSIGANWGTQASHPLPPDIVVRMLRENGIQKVKLFDAEYDTLRALGKSGIEVMVGIPNEM  79

Query  1472  LaavsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQ  1293
             LA ++SS  AA+ WVA+N++ ++    VNI+YVAVGNEPFL++Y+G + S   PA+ N+Q
Sbjct  80    LATLASSLKAAEKWVAKNVSTHISTDNVNIRYVAVGNEPFLSTYNGSYLSTTFPALRNIQ  139

Query  1292  QSLAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
              ++ KA L   VK+  P NAD Y+SS   PS G FR  +  +M  +V  L+ N  PF VN
Sbjct  140   IAIIKAGLQNQVKVTCPLNADVYDSSTTFPSGGDFRANIRDLMITIVKFLSENGGPFTVN  199

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYP++SLY N DFP DYAF +G A P+ DG   Y N FD N DTLV AL K G+  MPI+
Sbjct  200   IYPYISLYTNPDFPVDYAFLDGNAQPLNDGGTFYYNMFDANYDTLVHALEKNGFGNMPII  259

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             IGE+GWPTDG ++ANL  A+ FNQG + H+ G KGTP RPG  PID YLFSL DE  KS+
Sbjct  260   IGEIGWPTDGDSNANLDYAKKFNQGFMAHISGGKGTPRRPG--PIDAYLFSLIDEDAKSV  317

Query  758   LPGDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNPNKDLS--AVS  594
              PG FERHWG+F+FDG  KY L+LG    G L  A+ V YL  +WC++ PN  L    V+
Sbjct  318   QPGYFERHWGIFTFDGLPKYALNLGTTNTGALIQAKGVRYLERKWCVMKPNVRLDDPQVA  377

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
               +  ACSL DCT+L  G SC  +  K NISYAFNSYYQ+  Q   +C F  +  VT  D
Sbjct  378   PAVSYACSLGDCTSLGVGTSCANLDGKQNISYAFNSYYQIQDQLDTACKFPNISEVTKTD  437

Query  413   PSVDECRFLVGV  378
             PS   CRF + +
Sbjct  438   PSTGTCRFPIMI  449



>ref|XP_004513603.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Cicer arietinum]
Length=484

 Score =   451 bits (1160),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 222/428 (52%), Positives = 291/428 (68%), Gaps = 11/428 (3%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             +GVNWGT+A H+LPP  VV +L EN  +K+KLFDAD +++ ALMG+ IEVM+ IPN ML 
Sbjct  30    VGVNWGTMATHQLPPKKVVKMLMENGFRKLKLFDADDSIMVALMGTDIEVMLAIPNVMLH  89

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              +S++  AAD WV +N+T YL  GGVNIKYVAVGNEPFL +Y+G + +  +PA+ N+Q S
Sbjct  90    KISNTPKAADSWVYENVTCYLFTGGVNIKYVAVGNEPFLKAYNGTYLNKTLPALKNIQTS  149

Query  1286  LAKANLGGAVKLVVPCNADAYES----SLPSQGAFRPELTQIMTQLVSLLNSNASPFVVN  1119
             L KA LG  +K+ VP NAD Y S     LPS G FRPE+  +  +++  L SN + F VN
Sbjct  150   LYKAGLGSKIKVTVPFNADIYYSPDLNPLPSAGDFRPEIRDLTIEIIQFLYSNNATFTVN  209

Query  1118  IYPFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIV  939
             IYPFLSLYGN +FP D+AFF+G   P+ DG  VY+N FD NLDTL+ AL K GY  + + 
Sbjct  210   IYPFLSLYGNDNFPFDFAFFDGKNKPLQDGKAVYTNVFDANLDTLMWALDKAGYPDLHVT  269

Query  938   IGEVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSI  759
             +GEVGWPTDG  +AN   A+ FNQG I H L   GTP R G+  +D YLFSL DE  KS+
Sbjct  270   VGEVGWPTDGDKNANAKNAKRFNQGFIKHALSGNGTPKRKGM--MDFYLFSLIDENAKSV  327

Query  758   LPGDFERHWGVFSFDGQLKYPLDLGNGQLKNA----RDVPYLPYRWCIVNPN-KDLSAVS  594
              PG+FERHWG+F FDG+ KY LD+     +N       + YL  RWC+++P+  +L  ++
Sbjct  328   APGNFERHWGIFEFDGKPKYELDIRGKHKENGLVPVEGIKYLKKRWCVLDPDATNLDDLA  387

Query  593   NHIRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLD  414
             + I  AC+ +DCT L YG +CN +  +GN SYAFN YYQ++ Q    CDF GL ++T  D
Sbjct  388   HSIDYACTKSDCTALGYGSTCNNLSLQGNASYAFNMYYQVNNQMDWDCDFSGLAIITHED  447

Query  413   PSVDECRF  390
             PS   C+F
Sbjct  448   PSEKGCQF  455



>ref|XP_002869343.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45602.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=484

 Score =   451 bits (1160),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 224/436 (51%), Positives = 300/436 (69%), Gaps = 7/436 (2%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             IGVNWG+ A H LPP+TVV LLR+N IQKVKLF+AD A+L AL  SGI+VMVGIPN++LA
Sbjct  27    IGVNWGSQARHPLPPATVVRLLRDNGIQKVKLFEADSAILKALSRSGIQVMVGIPNDLLA  86

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              ++ S +AA+ WV+QN++ ++ + GV+I+YVAVGNEPFL +++G F+S  +PA+ N+Q +
Sbjct  87    PLAGSVAAAERWVSQNVSAHVSSNGVDIRYVAVGNEPFLKAFNGTFESITLPALQNIQSA  146

Query  1286  LAKANLGGAVKLVVPCNADAYESS--LPSQGAFRPELTQIMTQLVSLLNSNASPFVVNIY  1113
             + KA L   VK+ VP NAD Y+S+  LPS G FRPE+  +M  +V  L+ N +PF +NIY
Sbjct  147   IIKAGLATQVKVTVPLNADVYQSASNLPSDGDFRPEIRDLMLNIVKFLSDNQAPFTINIY  206

Query  1112  PFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIG  933
             PF+SLY + +FP ++AFF+GT  P+ D   +Y N  D N DTLV +L K G+  + I++G
Sbjct  207   PFISLYNDPNFPVEFAFFDGTGTPINDNGRIYDNVLDANYDTLVWSLQKNGFGNLTIIVG  266

Query  932   EVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILP  753
             EVGWPTDG  +AN+  AR +NQG +     NKGTP+RPG   +D YLF L DE  KSI P
Sbjct  267   EVGWPTDGDKNANMMYARRYNQGFMNRQKANKGTPMRPGA--MDAYLFGLIDEDAKSIQP  324

Query  752   GDFERHWGVFSFDGQLKYPLDLGNGQ-LKNARDVPYLPYRWCIVNPNKDLS--AVSNHIR  582
             G+FERHWG+F  DGQ KY L LGNG  L  A+DV YL  +WCI+ PN +L    +   + 
Sbjct  325   GNFERHWGIFYIDGQPKYQLSLGNGNGLIPAKDVHYLAKKWCILAPNANLQDPQLGPSVS  384

Query  581   LACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDFDGLGLVTFLDPSVD  402
              AC  ADCT+L YG SC  +    N+SYAFNSYYQ+  Q   +C F GL +V+  DPSV 
Sbjct  385   YACDHADCTSLGYGSSCGNLNLAQNVSYAFNSYYQVSNQLDSACKFPGLSIVSTRDPSVG  444

Query  401   ECRFLVGVTDTNNSSG  354
              C+F + +   + S  
Sbjct  445   SCKFKIMIKSEDASEA  460



>ref|XP_010252157.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Nelumbo nucifera]
Length=483

 Score =   451 bits (1160),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 232/427 (54%), Positives = 294/427 (69%), Gaps = 10/427 (2%)
 Frame = -3

Query  1646  IGVNWGTIAVHKLPPSTVVDLLRENNIQKVKLFDADPAVLSALMGSGIEVMVGIPNEMLa  1467
             IG NWGT + H LPPSTVV LLR+N  QKVKLFDAD A L AL  +GIEVMVGIPN+MLA
Sbjct  23    IGANWGTQSSHPLPPSTVVRLLRDNGFQKVKLFDADSATLRALGKTGIEVMVGIPNDMLA  82

Query  1466  avsssssaADLWVAQNLTRYLVNGGVNIKYVAVGNEPFLASYSGQFQSYVVPAVTNVQQS  1287
              ++ S  AA+ WV+ N++  + N GVNIKYVAVGNEPFL +Y+G F +   PA+ N+Q +
Sbjct  83    TIAGSMKAAEKWVSNNVSSPISNDGVNIKYVAVGNEPFLETYNGSFLTTTFPALQNIQSA  142

Query  1286  LAKANLGGAVKLVVPCNADAYESSL--PSQGAFRPELTQIMTQLVSLLNSNASPFVVNIY  1113
             L K+ L   VK+ +P NAD Y+S+   PS G FR ++  +M  +V  L+ N   F VNIY
Sbjct  143   LIKSGLSSQVKVTIPLNADVYQSTTDAPSGGDFRSDIHDLMITIVKFLSDNGGSFTVNIY  202

Query  1112  PFLSLYGNSDFPQDYAFFEGTAHPVVDGPNVYSNAFDGNLDTLVAALSKLGYSQMPIVIG  933
             PFL LY + +FP DYAFF+ T   V D  N Y N FD NLDTLV AL K GY  +PI++G
Sbjct  203   PFLGLYTDPNFPVDYAFFDSTTARVTDNGNAYYNMFDANLDTLVWALQKNGYGNLPIIVG  262

Query  932   EVGWPTDGATSANLTAARAFNQGLIYHVLGNKGTPLRPGVPPIDVYLFSLFDEAGKSILP  753
             E+GWPTDG  +AN+  A+ FNQG + H+   KGTP+RPG+  ID YLFSL DE  KSI P
Sbjct  263   EIGWPTDGDKNANMDYAQRFNQGFMNHISTGKGTPMRPGL--IDAYLFSLIDEDAKSIAP  320

Query  752   GDFERHWGVFSFDGQLKYPLDLG---NGQLKNARDVPYLPYRWCIVNP--NKDLSAVSNH  588
             G FERHWG+F +DG  KY L+LG   +G L  AR+V YL  +WC+++P  N D S V+  
Sbjct  321   GYFERHWGIFYYDGVPKYMLNLGTTNSGTLVPARNVHYLEKKWCVMSPKANLDDSQVAPS  380

Query  587   IRLACSLADCTTLKYGGSCNGIGEKGNISYAFNSYYQLHKQNPQSCDF-DGLGLVTFLDP  411
             +  ACSLADCT+L YG SC  +  +GNISYAFN+YYQ++ Q   +C F D L ++T  DP
Sbjct  381   VSYACSLADCTSLGYGTSCGNLDARGNISYAFNNYYQINNQLDSACQFPDHLSIITKTDP  440

Query  410   SVDECRF  390
             S+  CRF
Sbjct  441   SIGSCRF  447



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5415623577640