BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14710_g1_i1 len=625 path=[3117:0-624]

Length=625
                                                                      Score     E

ref|XP_009622745.1|  PREDICTED: protein FANTASTIC FOUR 4                100   9e-22   
ref|XP_009803742.1|  PREDICTED: SPX and EXS domain-containing pro...    100   1e-21   
ref|XP_004230162.1|  PREDICTED: protein FANTASTIC FOUR 3              98.6    3e-21   
ref|XP_002512326.1|  conserved hypothetical protein                   97.4    1e-20   Ricinus communis
ref|XP_006361886.1|  PREDICTED: protein FANTASTIC FOUR 3-like         95.5    4e-20   
emb|CDP17975.1|  unnamed protein product                              91.7    9e-19   
ref|XP_009769809.1|  PREDICTED: uncharacterized protein LOC104220609  87.4    2e-18   
ref|XP_007205364.1|  hypothetical protein PRUPE_ppa007207mg           91.3    3e-18   
ref|XP_006382634.1|  hypothetical protein POPTR_0005s03980g           89.7    5e-18   
ref|XP_010660073.1|  PREDICTED: protein FANTASTIC FOUR 1-like         89.7    6e-18   
ref|XP_011036749.1|  PREDICTED: protein FANTASTIC FOUR 1-like         88.6    1e-17   
ref|XP_008246530.1|  PREDICTED: protein FANTASTIC FOUR 4              88.6    3e-17   
ref|XP_010414916.1|  PREDICTED: protein FANTASTIC FOUR 1-like         87.0    4e-17   
ref|XP_009787499.1|  PREDICTED: uncharacterized protein LOC104235435  85.9    6e-17   
ref|XP_004494646.1|  PREDICTED: protein FANTASTIC FOUR 1-like         86.3    7e-17   
ref|XP_007030782.1|  Uncharacterized protein TCM_026518               86.3    8e-17   
ref|XP_010242556.1|  PREDICTED: protein FANTASTIC FOUR 1-like         85.1    2e-16   
ref|XP_010111868.1|  hypothetical protein L484_020661                 84.7    3e-16   
ref|XP_002894601.1|  hypothetical protein ARALYDRAFT_892713           83.6    6e-16   
gb|ABK96485.1|  unknown                                               83.6    8e-16   Populus trichocarpa x Populus deltoides
ref|XP_010470373.1|  PREDICTED: protein FANTASTIC FOUR 1-like         83.2    9e-16   
ref|XP_002319567.1|  hypothetical protein POPTR_0013s02810g           82.8    1e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006433196.1|  hypothetical protein CICLE_v10002008mg           82.8    1e-15   
ref|XP_010025140.1|  PREDICTED: putative uncharacterized protein ...  82.4    2e-15   
ref|XP_010511208.1|  PREDICTED: uncharacterized protein LOC104787337  81.6    3e-15   
ref|XP_011023531.1|  PREDICTED: protein FANTASTIC FOUR 1-like         81.6    3e-15   
ref|XP_007147086.1|  hypothetical protein PHAVU_006G095100g           80.9    4e-15   
dbj|BAF01254.1|  hypothetical protein                                 80.9    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175873.2|  uncharacterized protein                             80.9    6e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAC64886.1|  ESTs gb|R65549 and gb|AA651123 come from this gene    80.9    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009785796.1|  PREDICTED: protein FANTASTIC FOUR 1-like         78.6    7e-15   
gb|ABN09012.1|  hypothetical protein MtrDRAFT_AC172101g17v1           80.1    8e-15   Medicago truncatula
ref|XP_006302651.1|  hypothetical protein CARUB_v10020764mg           79.7    1e-14   
ref|XP_003626330.1|  hypothetical protein MTR_7g113950                79.3    2e-14   
gb|KGN60862.1|  hypothetical protein Csa_2G020850                     79.3    2e-14   
ref|XP_009373954.1|  PREDICTED: protein FANTASTIC FOUR 3-like         80.5    2e-14   
ref|XP_008370523.1|  PREDICTED: protein FANTASTIC FOUR 3-like         80.5    2e-14   
gb|KHN04022.1|  hypothetical protein glysoja_022708                   78.2    3e-14   
ref|XP_006604829.1|  PREDICTED: protein FANTASTIC FOUR 3-like         77.8    5e-14   
gb|KHN43257.1|  hypothetical protein glysoja_001840                   76.3    6e-14   
ref|XP_008455263.1|  PREDICTED: protein FANTASTIC FOUR 1              77.8    7e-14   
ref|XP_008388603.1|  PREDICTED: protein FAF-like, chloroplastic       78.6    1e-13   
ref|XP_009335643.1|  PREDICTED: protein FANTASTIC FOUR 1-like         77.8    1e-13   
ref|XP_006392488.1|  hypothetical protein EUTSA_v10023602mg           76.6    2e-13   
ref|XP_007144766.1|  hypothetical protein PHAVU_007G182900g           75.5    4e-13   
gb|AES61304.2|  DUF3049 family protein                                74.3    4e-13   
ref|XP_004495755.1|  PREDICTED: protein FANTASTIC FOUR 1-like         72.4    3e-12   
ref|XP_003591053.1|  hypothetical protein MTR_1g082320                74.3    3e-12   
gb|KHN16155.1|  hypothetical protein glysoja_012131                   72.0    4e-12   
ref|XP_003535351.1|  PREDICTED: lateral signaling target protein ...  72.4    4e-12   
ref|NP_001240900.1|  uncharacterized protein LOC100777087             71.6    8e-12   
gb|KHN20195.1|  hypothetical protein glysoja_023758                   69.3    4e-11   
ref|XP_006845797.1|  hypothetical protein AMTR_s00019p00255280        69.7    5e-11   
ref|XP_008784032.1|  PREDICTED: protein FANTASTIC FOUR 3              66.2    4e-10   
ref|XP_007205978.1|  hypothetical protein PRUPE_ppa012110mg           65.5    5e-10   
ref|XP_008795136.1|  PREDICTED: protein FANTASTIC FOUR 2-like         65.5    5e-10   
ref|XP_010327367.1|  PREDICTED: uncharacterized protein LOC104649597  67.8    6e-10   
ref|XP_010912304.1|  PREDICTED: protein FANTASTIC FOUR 1-like         65.9    6e-10   
ref|XP_009377827.1|  PREDICTED: protein FANTASTIC FOUR 3              67.0    6e-10   
ref|XP_008360841.1|  PREDICTED: protein FANTASTIC FOUR 3              67.0    7e-10   
ref|XP_010553744.1|  PREDICTED: sarcoplasmic reticulum histidine-...  65.5    1e-09   
ref|XP_010674996.1|  PREDICTED: protein FANTASTIC FOUR 1-like         65.1    2e-09   
ref|XP_010931123.1|  PREDICTED: protein FANTASTIC FOUR 3              64.3    3e-09   
ref|XP_007015792.1|  Uncharacterized protein TCM_041386               64.3    4e-09   
ref|XP_006424217.1|  hypothetical protein CICLE_v10028879mg           64.3    5e-09   
ref|XP_004293063.1|  PREDICTED: uncharacterized protein LOC101302043  63.9    6e-09   
ref|XP_006487900.1|  PREDICTED: protein FANTASTIC FOUR 3-like         63.9    6e-09   
ref|XP_006648694.1|  PREDICTED: protein FANTASTIC FOUR 1-like         62.0    7e-09   
ref|XP_009390037.1|  PREDICTED: protein FANTASTIC FOUR 1-like         62.8    7e-09   
ref|XP_011090336.1|  PREDICTED: uncharacterized protein LOC105171038  63.2    1e-08   
ref|XP_009613421.1|  PREDICTED: uncharacterized serine-rich prote...  63.2    1e-08   
ref|XP_009763642.1|  PREDICTED: protein AF-9-like                     62.8    1e-08   
ref|XP_002523822.1|  conserved hypothetical protein                   62.8    2e-08   Ricinus communis
gb|EYU36063.1|  hypothetical protein MIMGU_mgv1a026980mg              62.4    2e-08   
ref|XP_008645751.1|  PREDICTED: protein FAF-like, chloroplastic       60.8    2e-08   
ref|XP_002453935.1|  hypothetical protein SORBIDRAFT_04g021800        60.5    3e-08   Sorghum bicolor [broomcorn]
ref|XP_006362880.1|  PREDICTED: uncharacterized serine-rich prote...  62.0    4e-08   
gb|KCW87360.1|  hypothetical protein EUGRSUZ_B03842                   61.6    4e-08   
ref|XP_008229224.1|  PREDICTED: protein FANTASTIC FOUR 3              61.6    5e-08   
gb|EEC73331.1|  hypothetical protein OsI_07531                        59.7    5e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_010045198.1|  PREDICTED: uncharacterized protein LOC104433969  61.2    6e-08   
ref|XP_010651876.1|  PREDICTED: suppressor protein SRP40              60.8    7e-08   
ref|XP_003596832.1|  hypothetical protein MTR_2g086590                60.5    7e-08   
ref|NP_001173007.1|  Os02g0534000                                     59.3    8e-08   
ref|XP_008351291.1|  PREDICTED: protein FAF-like, chloroplastic       60.5    1e-07   
ref|XP_003572581.2|  PREDICTED: protein FAF-like, chloroplastic       58.9    1e-07   
ref|XP_009391142.1|  PREDICTED: uncharacterized protein LOC103977374  59.3    1e-07   
ref|XP_006593034.1|  PREDICTED: protein FANTASTIC FOUR 3-like         58.9    1e-07   
dbj|BAD28434.1|  hypothetical protein                                 58.2    1e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CBI28308.3|  unnamed protein product                              58.5    2e-07   
ref|XP_003539471.1|  PREDICTED: protein FANTASTIC FOUR 3              58.5    3e-07   
ref|XP_006594929.1|  PREDICTED: protein FANTASTIC FOUR 3-like         58.2    3e-07   
dbj|BAJ85079.1|  predicted protein                                    57.4    3e-07   
ref|XP_010689881.1|  PREDICTED: uncharacterized protein LOC104903534  57.0    4e-07   
emb|CDP06900.1|  unnamed protein product                              58.5    5e-07   
gb|KDP34411.1|  hypothetical protein JCGZ_12692                       58.5    5e-07   
ref|XP_002312824.1|  hypothetical protein POPTR_0009s16430g           58.2    5e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011004308.1|  PREDICTED: uncharacterized protein LOC105110829  57.8    7e-07   
ref|XP_007150063.1|  hypothetical protein PHAVU_005G123200g           57.4    8e-07   
ref|XP_002450291.1|  hypothetical protein SORBIDRAFT_05g003300        57.8    9e-07   Sorghum bicolor [broomcorn]
ref|XP_003539162.1|  PREDICTED: protein FAF-like, chloroplastic-like  56.6    1e-06   
gb|KHN38624.1|  Protein FANTASTIC FOUR 3                              56.6    1e-06   
ref|XP_010686193.1|  PREDICTED: rho GTPase-activating protein 1-like  56.2    5e-06   
ref|XP_004139585.1|  PREDICTED: uncharacterized protein LOC101210424  55.1    5e-06   
gb|EMT28160.1|  hypothetical protein F775_09016                       53.9    6e-06   
ref|XP_008461212.1|  PREDICTED: protein FANTASTIC FOUR 4-like         55.1    6e-06   
ref|XP_009774952.1|  PREDICTED: protein FANTASTIC FOUR 1-like         55.1    6e-06   
ref|XP_010089810.1|  hypothetical protein L484_022326                 55.1    7e-06   
ref|XP_006851427.1|  hypothetical protein AMTR_s00040p00091720        54.7    1e-05   
ref|XP_009586842.1|  PREDICTED: protein FANTASTIC FOUR 1-like         54.7    1e-05   
ref|XP_006384794.1|  hypothetical protein POPTR_0004s21170g           54.3    1e-05   
gb|EMS58017.1|  hypothetical protein TRIUR3_34065                     52.8    1e-05   
ref|NP_001142440.1|  uncharacterized protein LOC100274630             54.3    1e-05   Zea mays [maize]
ref|XP_004978706.1|  PREDICTED: protein FAF-like, chloroplastic-l...  53.9    2e-05   
tpg|DAA39151.1|  TPA: hypothetical protein ZEAMMB73_815968            53.9    2e-05   
ref|XP_010271631.1|  PREDICTED: protein FANTASTIC FOUR 1              53.9    2e-05   
tpg|DAA39153.1|  TPA: hypothetical protein ZEAMMB73_815968            53.9    2e-05   
ref|XP_004242110.1|  PREDICTED: protein FAF-like, chloroplastic       53.9    2e-05   
ref|XP_010248433.1|  PREDICTED: protein FANTASTIC FOUR 1-like         53.5    3e-05   
ref|XP_004952650.1|  PREDICTED: protein FAF-like, chloroplastic-like  53.1    3e-05   
ref|XP_006303556.1|  hypothetical protein CARUB_v10011015mg           53.1    4e-05   
gb|EMT04427.1|  hypothetical protein F775_19219                       50.8    4e-05   
ref|XP_002874068.1|  hypothetical protein ARALYDRAFT_489095           51.6    5e-05   
ref|XP_008449578.1|  PREDICTED: protein FANTASTIC FOUR 3              52.4    5e-05   
ref|NP_001183691.1|  hypothetical protein                             50.4    5e-05   
gb|KEH29848.1|  DUF3049 family protein                                52.4    5e-05   
gb|KGN48031.1|  hypothetical protein Csa_6G425190                     52.4    6e-05   
ref|XP_006358458.1|  PREDICTED: uncharacterized protein LOC102584004  49.3    1e-04   
ref|XP_009614911.1|  PREDICTED: uncharacterized protein LOC104107737  50.4    1e-04   
gb|EMT32339.1|  hypothetical protein F775_12429                       51.6    1e-04   
ref|XP_008788986.1|  PREDICTED: protein FANTASTIC FOUR 3-like         50.8    2e-04   
ref|XP_008790293.1|  PREDICTED: protein FANTASTIC FOUR 3-like         50.8    2e-04   
ref|NP_173630.1|  structural constituent of ribosome                  51.2    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009419497.1|  PREDICTED: protein FANTASTIC FOUR 1-like         50.8    2e-04   
ref|XP_010943776.1|  PREDICTED: uncharacterized protein LOC105061432  50.4    2e-04   
ref|XP_004975573.1|  PREDICTED: uncharacterized protein LOC101767657  48.9    3e-04   
ref|XP_010664293.1|  PREDICTED: uncharacterized protein LOC104882477  50.1    4e-04   
ref|XP_003581204.1|  PREDICTED: uncharacterized protein LOC100825177  49.3    4e-04   
ref|XP_006653373.1|  PREDICTED: uncharacterized protein LOC102707118  49.3    5e-04   
ref|XP_002312517.1|  hypothetical protein POPTR_0008s14890g           49.3    7e-04   Populus trichocarpa [western balsam poplar]
ref|XP_007034674.1|  Uncharacterized protein isoform 1                49.3    7e-04   
ref|NP_001052746.1|  Os04g0413100                                     48.5    7e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011026040.1|  PREDICTED: protein FANTASTIC FOUR 3-like         49.3    7e-04   
ref|XP_009401093.1|  PREDICTED: uncharacterized protein LOC103985187  48.5    7e-04   
ref|XP_002520750.1|  conserved hypothetical protein                   49.3    7e-04   Ricinus communis
emb|CAE02064.2|  OJ000126_13.6                                        48.5    8e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67361.1|  OSIGBa0134P10.7                                      48.5    9e-04   Oryza sativa [red rice]
ref|XP_002893211.1|  hypothetical protein ARALYDRAFT_472444           48.9    0.001   
emb|CBI32338.3|  unnamed protein product                              48.9    0.001   



>ref|XP_009622745.1| PREDICTED: protein FANTASTIC FOUR 4 [Nicotiana tomentosiformis]
Length=276

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = +2

Query  320  HSSSYSWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPE  499
            +S+S  W R     +E+++ K+FPPP+SSL+QDGKP FF+R VR+DGRL+L +V+  RPE
Sbjct  121  YSNSRCWQR--SINSEKKEIKKFPPPLSSLNQDGKPNFFMRAVRKDGRLELTEVKIGRPE  178

Query  500  TLLASRKDGRLRMHLI  547
            TLLASR+DGRLR+HLI
Sbjct  179  TLLASRQDGRLRLHLI  194



>ref|XP_009803742.1| PREDICTED: SPX and EXS domain-containing protein 5-like [Nicotiana 
sylvestris]
Length=332

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 63/82 (77%), Gaps = 4/82 (5%)
 Frame = +2

Query  302  STSPVKHSSSYSWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQV  481
            ST+   +S+S  W R        +K K+FPPP+SSL+QDGKP FF+R VR+DGRL+L +V
Sbjct  166  STNMASYSNSKCWQR----SNSEKKEKKFPPPLSSLNQDGKPNFFMRAVRKDGRLELTEV  221

Query  482  RSNRPETLLASRKDGRLRMHLI  547
            + +RPETLLASR+DGRLR+HLI
Sbjct  222  KISRPETLLASRQDGRLRLHLI  243



>ref|XP_004230162.1| PREDICTED: protein FANTASTIC FOUR 3 [Solanum lycopersicum]
Length=272

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 62/81 (77%), Gaps = 3/81 (4%)
 Frame = +2

Query  308  SPVKHS-SSYSWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVR  484
            S   HS +S  W R      E+++ KEFPPP+SSLSQDGKP FF+R VR+DGRL+L +V+
Sbjct  120  SSCSHSNTSRCWQR--SNLGEKKEKKEFPPPLSSLSQDGKPNFFMRAVRKDGRLELTEVK  177

Query  485  SNRPETLLASRKDGRLRMHLI  547
             +RPETL ASR+DGRLR+HLI
Sbjct  178  IDRPETLRASRQDGRLRLHLI  198



>ref|XP_002512326.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49778.1| conserved hypothetical protein [Ricinus communis]
Length=328

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = +2

Query  323  SSSYSWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPET  502
            ++  +W + G    ERR+ K+FPPP+SSL+ +G+P+FFLRPVR+DGRL+L +VR +RPE 
Sbjct  140  TTKVNWKKFG----ERREVKKFPPPLSSLNHNGQPSFFLRPVRKDGRLELTEVRIDRPEI  195

Query  503  LLASRKDGRLRMHLI  547
            L ASR+DGRLR+HLI
Sbjct  196  LRASREDGRLRLHLI  210



>ref|XP_006361886.1| PREDICTED: protein FANTASTIC FOUR 3-like [Solanum tuberosum]
Length=274

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 62/85 (73%), Gaps = 2/85 (2%)
 Frame = +2

Query  293  TTASTSPVKHSSSYSWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKL  472
            +  S +    ++S  W R      E+++ KEFPPP+SSLSQDGKP FF+R VR+DGRL+L
Sbjct  120  SNCSNNNTASTNSRCWQR--SNLGEKKEKKEFPPPLSSLSQDGKPNFFMRAVRKDGRLEL  177

Query  473  RQVRSNRPETLLASRKDGRLRMHLI  547
             +V+ +RP+T  ASR+DGRLR+HLI
Sbjct  178  TEVKIDRPKTFRASRQDGRLRLHLI  202



>emb|CDP17975.1| unnamed protein product [Coffea canephora]
Length=282

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +2

Query  329  SYSWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLL  508
            S + SR  R  A +R++ +FPPP+SSL+QDGKP FFLRPVR+DG+L+L++V+  R E L 
Sbjct  127  SMAGSRWKREHA-KREASQFPPPLSSLNQDGKPTFFLRPVRKDGKLELQEVKIGRQEILR  185

Query  509  ASRKDGRLRMHLI  547
            ASR+DGRLR+HLI
Sbjct  186  ASREDGRLRLHLI  198



>ref|XP_009769809.1| PREDICTED: uncharacterized protein LOC104220609 [Nicotiana sylvestris]
Length=105

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 4/74 (5%)
 Frame = +2

Query  326  SSYSWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETL  505
            SS  W R        +K K+FPPP+SSL+QDGKP FF+R VR+DGRL+L +V+  RPETL
Sbjct  15   SSRCWQR----SNSEKKEKKFPPPLSSLNQDGKPNFFMRAVRKDGRLELTEVKIGRPETL  70

Query  506  LASRKDGRLRMHLI  547
            LAS +DG+LR+ LI
Sbjct  71   LASGQDGQLRLRLI  84



>ref|XP_007205364.1| hypothetical protein PRUPE_ppa007207mg [Prunus persica]
 gb|EMJ06563.1| hypothetical protein PRUPE_ppa007207mg [Prunus persica]
Length=378

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 3/84 (4%)
 Frame = +2

Query  311  PVKHSSSYSWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSN  490
            PV+  +   W R G   AE   +K+FPPP+SSL+Q+G+P +FLRPVR++GRL+L +VR  
Sbjct  216  PVEEDALSKWKRTGEKRAE---AKKFPPPLSSLNQNGQPRYFLRPVRKEGRLELTEVRIY  272

Query  491  RPETLLASRKDGRLRMHLIYSDDD  562
            RPE L A R+DGRLR+HL+  + D
Sbjct  273  RPEILRAYRQDGRLRLHLVTREPD  296



>ref|XP_006382634.1| hypothetical protein POPTR_0005s03980g [Populus trichocarpa]
 gb|ERP60431.1| hypothetical protein POPTR_0005s03980g [Populus trichocarpa]
Length=325

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 59/74 (80%), Gaps = 4/74 (5%)
 Frame = +2

Query  338  WSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASR  517
            W   G    E++++K+FPPP+SSL+ +G+P+FFL+PVR+DGRL+L +VR +R E L ASR
Sbjct  151  WREFG----EKKEAKKFPPPLSSLNHNGQPSFFLKPVRKDGRLELTEVRIDRHEILRASR  206

Query  518  KDGRLRMHLIYSDD  559
            +DGRLR+HL+  ++
Sbjct  207  QDGRLRLHLVEDEE  220



>ref|XP_010660073.1| PREDICTED: protein FANTASTIC FOUR 1-like [Vitis vinifera]
Length=296

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  353  RTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRL  532
            R   ERR++++FPPP+ SL+ +G+P+FFLR VR+DGRL+L +VR +RPE L ASR+DGRL
Sbjct  137  RNSRERREARKFPPPLPSLNHNGQPSFFLRSVRKDGRLELTEVRIDRPEILRASRQDGRL  196

Query  533  RMHLIYSDDD  562
             +HLI  +D+
Sbjct  197  TLHLIKEEDN  206



>ref|XP_011036749.1| PREDICTED: protein FANTASTIC FOUR 1-like [Populus euphratica]
Length=316

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 56/70 (80%), Gaps = 4/70 (6%)
 Frame = +2

Query  338  WSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASR  517
            W   G    E++++K+FPPP+SSL+ +G+P FFL+PVR+DGRL+L +VR +R E L ASR
Sbjct  152  WREFG----EKKEAKKFPPPLSSLNHNGQPNFFLKPVRKDGRLELTEVRIDRHEILRASR  207

Query  518  KDGRLRMHLI  547
            +DGRLR+HL+
Sbjct  208  QDGRLRLHLV  217



>ref|XP_008246530.1| PREDICTED: protein FANTASTIC FOUR 4 [Prunus mume]
Length=402

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  341  SRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRK  520
            S+  RT  +R ++K+FPPP+SSL+Q+G+P ++LRPVR+DGRL+L +VR  RPE L A R+
Sbjct  244  SKWKRTGEKREEAKKFPPPLSSLNQNGQPRYYLRPVRKDGRLELTEVRIYRPEILRAYRQ  303

Query  521  DGRLRMHLIYSDDD  562
            DGRLR+HL+  + D
Sbjct  304  DGRLRLHLVTPEPD  317



>ref|XP_010414916.1| PREDICTED: protein FANTASTIC FOUR 1-like [Camelina sativa]
Length=281

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  368  RRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            R + +EFPPP+SSL+  G+P+F+LRPVR+DGRL+L QV  +RPE   ASR+DGRLR+HL+
Sbjct  84   REQKREFPPPLSSLNGLGQPSFYLRPVRKDGRLELTQVMIDRPEIFHASREDGRLRLHLV  143



>ref|XP_009787499.1| PREDICTED: uncharacterized protein LOC104235435 [Nicotiana sylvestris]
Length=216

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +2

Query  374  KSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIY  550
            K K+F PP+SSL+QDGKP FF+R VR+DGRL+L +V   RPETLLA  +DGRLR+HLI+
Sbjct  61   KEKKFLPPLSSLNQDGKPNFFMRAVRKDGRLELTEVNIGRPETLLAFGQDGRLRLHLIH  119



>ref|XP_004494646.1| PREDICTED: protein FANTASTIC FOUR 1-like [Cicer arietinum]
Length=284

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  353  RTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRL  532
            R E      + FPPP+SSL+++GKP F+LRPVR+DGRL+L +VR +RPE L ASR DGRL
Sbjct  150  RCENRGNLMRSFPPPLSSLNRNGKPCFYLRPVRKDGRLELTEVRIHRPEILHASRHDGRL  209

Query  533  RMHLI  547
             +HLI
Sbjct  210  TLHLI  214



>ref|XP_007030782.1| Uncharacterized protein TCM_026518 [Theobroma cacao]
 gb|EOY11284.1| Uncharacterized protein TCM_026518 [Theobroma cacao]
Length=310

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  374  KSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYS  553
            +SK+FPPP+SSL+Q+G+P F+L+PVR +GRL+L +VR  RPE L A R++GRLR+HL+ S
Sbjct  162  QSKKFPPPLSSLNQNGQPCFYLKPVRTNGRLELTEVRIERPEILRAVRQNGRLRLHLVSS  221

Query  554  D  556
            D
Sbjct  222  D  222



>ref|XP_010242556.1| PREDICTED: protein FANTASTIC FOUR 1-like [Nelumbo nucifera]
Length=290

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  356  TEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLR  535
             E  R KS ++PPP++SLS +G+P F+L+PVR+DGRL+L +V+ NRPE L+ASR+DGRLR
Sbjct  126  AEKFRSKSMKYPPPLTSLSMNGQPTFYLKPVRKDGRLELTEVKINRPEILVASRQDGRLR  185

Query  536  MHLI  547
            +  I
Sbjct  186  LQFI  189



>ref|XP_010111868.1| hypothetical protein L484_020661 [Morus notabilis]
 gb|EXC31833.1| hypothetical protein L484_020661 [Morus notabilis]
Length=292

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  353  RTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRL  532
            R     ++ K FPP +SSL+++G+P+FFLRPVR+DGRL+L +VR NRPE L A R DGRL
Sbjct  140  RMSGSSKEVKRFPPLLSSLNRNGQPSFFLRPVRKDGRLELTEVRINRPEILRAYRGDGRL  199

Query  533  RMHLI  547
            R+HLI
Sbjct  200  RLHLI  204



>ref|XP_002894601.1| hypothetical protein ARALYDRAFT_892713 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70860.1| hypothetical protein ARALYDRAFT_892713 [Arabidopsis lyrata subsp. 
lyrata]
Length=258

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 52/75 (69%), Gaps = 10/75 (13%)
 Frame = +2

Query  353  RTEAERRKSKE----------FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPET  502
            R E +RRK+KE          FPPP+SS +  GK +F+LRPVR+DGRL+L QV  NRPE 
Sbjct  69   RVETKRRKTKENVVAREPGKKFPPPLSSFNGRGKRSFYLRPVRKDGRLELTQVMINRPEI  128

Query  503  LLASRKDGRLRMHLI  547
              ASR+DGRLR+H +
Sbjct  129  FHASREDGRLRLHFV  143



>gb|ABK96485.1| unknown [Populus trichocarpa x Populus deltoides]
Length=310

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  353  RTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRL  532
            R   E++++K+FPPP+SSL+ +G+P FFL+ VR+DGRL+L +VR +R E L ASR+DGRL
Sbjct  154  RKPGEKKEAKKFPPPLSSLNHNGQPNFFLKSVRKDGRLELTEVRIHRHEILRASRQDGRL  213

Query  533  RMHLI  547
            R+H +
Sbjct  214  RLHFV  218



>ref|XP_010470373.1| PREDICTED: protein FANTASTIC FOUR 1-like [Camelina sativa]
Length=281

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  368  RRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            R K +EFPPP+SSL+  G+P+F+LRPVR+DGRL+L +V  +RPE   ASR+DGRLR+ L+
Sbjct  84   REKKREFPPPLSSLNGLGQPSFYLRPVRKDGRLELTRVMIDRPEIFHASREDGRLRLQLV  143



>ref|XP_002319567.1| hypothetical protein POPTR_0013s02810g [Populus trichocarpa]
 gb|EEE95490.1| hypothetical protein POPTR_0013s02810g [Populus trichocarpa]
Length=311

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  353  RTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRL  532
            R   E++++K FPPP+SSL+ +G+P FFL+ VR+DGRL+L +VR +R E L ASR+DGRL
Sbjct  154  RKLGEKKEAKRFPPPLSSLNHNGQPNFFLKSVRKDGRLELTEVRIDRHEILRASRQDGRL  213

Query  533  RMHLI  547
            R+H +
Sbjct  214  RLHFV  218



>ref|XP_006433196.1| hypothetical protein CICLE_v10002008mg [Citrus clementina]
 ref|XP_006471875.1| PREDICTED: uncharacterized protein LOC102625322 [Citrus sinensis]
 gb|ESR46436.1| hypothetical protein CICLE_v10002008mg [Citrus clementina]
Length=297

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +2

Query  371  RKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIY  550
            +++K+FPPP+SSL+++G+P+F+LR VR DGRL+L +VR +RPE L ASR+ GRLR+HL+ 
Sbjct  157  KEAKKFPPPLSSLNRNGQPSFYLRSVRTDGRLELTEVRIDRPEILRASREGGRLRLHLVR  216

Query  551  SDD  559
              D
Sbjct  217  EGD  219



>ref|XP_010025140.1| PREDICTED: putative uncharacterized protein DDB_G0279653 [Eucalyptus 
grandis]
 gb|KCW61737.1| hypothetical protein EUGRSUZ_H04442 [Eucalyptus grandis]
Length=345

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  KEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIY  550
            K+FPPP+SSL+  G+P FFLRPVR+DGRL+L +VR +RPE L +SR+DGRLR+  I 
Sbjct  159  KKFPPPLSSLNHKGQPCFFLRPVRRDGRLELTEVRIDRPEILRSSRQDGRLRLEFIV  215



>ref|XP_010511208.1| PREDICTED: uncharacterized protein LOC104787337 [Camelina sativa]
Length=281

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +2

Query  368  RRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            R + +EF PP+ SL+  G+P+F+LRPVR+DGRL+L QV  +RPE   ASR+DGRLR+HL+
Sbjct  83   REQKREFSPPLPSLNGLGQPSFYLRPVRKDGRLELTQVMIDRPEIFHASREDGRLRLHLV  142



>ref|XP_011023531.1| PREDICTED: protein FANTASTIC FOUR 1-like [Populus euphratica]
Length=314

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  353  RTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRL  532
            R   E++++K+FPPP+SSL+ +G+P FFL+ VR+DGRL+L +VR +R E L ASR++GRL
Sbjct  154  RKLGEKKEAKKFPPPLSSLNHNGQPNFFLKSVRKDGRLELTEVRIDRHEILRASRQNGRL  213

Query  533  RMHLI  547
            R+H +
Sbjct  214  RLHFV  218



>ref|XP_007147086.1| hypothetical protein PHAVU_006G095100g [Phaseolus vulgaris]
 gb|ESW19080.1| hypothetical protein PHAVU_006G095100g [Phaseolus vulgaris]
Length=263

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  368  RRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            R K++ FPPP+SSL+++GKP+F+LRPVR+DGRL+L +VR  RPE L ASR++GRL + L+
Sbjct  138  RAKARTFPPPLSSLNRNGKPSFYLRPVRKDGRLELMEVRIERPEILHASRENGRLTLRLV  197



>dbj|BAF01254.1| hypothetical protein [Arabidopsis thaliana]
Length=299

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 10/75 (13%)
 Frame = +2

Query  353  RTEAERRKSKE----------FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPET  502
            R EA+RRK+KE          FPPP+SSL+  G+  F+LRPVR+DGRL+L QV  +RPE 
Sbjct  71   RVEAKRRKTKENVVVQAQKKQFPPPLSSLNSRGQRYFYLRPVRKDGRLELTQVMVDRPEI  130

Query  503  LLASRKDGRLRMHLI  547
               SR DGRLR+H +
Sbjct  131  FHVSRVDGRLRLHFV  145



>ref|NP_175873.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE33142.1| uncharacterized protein AT1G54740 [Arabidopsis thaliana]
Length=299

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 10/75 (13%)
 Frame = +2

Query  353  RTEAERRKSKE----------FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPET  502
            R EA+RRK+KE          FPPP+SSL+  G+  F+LRPVR+DGRL+L QV  +RPE 
Sbjct  71   RVEAKRRKTKENVVVQAQKKQFPPPLSSLNSRGQRYFYLRPVRKDGRLELTQVMVDRPEI  130

Query  503  LLASRKDGRLRMHLI  547
               SR DGRLR+H +
Sbjct  131  FHVSRVDGRLRLHFV  145



>gb|AAC64886.1| ESTs gb|R65549 and gb|AA651123 come from this gene [Arabidopsis 
thaliana]
Length=280

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 10/75 (13%)
 Frame = +2

Query  353  RTEAERRKSKE----------FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPET  502
            R EA+RRK+KE          FPPP+SSL+  G+  F+LRPVR+DGRL+L QV  +RPE 
Sbjct  52   RVEAKRRKTKENVVVQAQKKQFPPPLSSLNSRGQRYFYLRPVRKDGRLELTQVMVDRPEI  111

Query  503  LLASRKDGRLRMHLI  547
               SR DGRLR+H +
Sbjct  112  FHVSRVDGRLRLHFV  126



>ref|XP_009785796.1| PREDICTED: protein FANTASTIC FOUR 1-like [Nicotiana sylvestris]
Length=140

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            FPPP+SSL+QD KP FF+R VR+D RL+L +V+  RPETLLAS +DGRLR++LI
Sbjct  2    FPPPLSSLNQDVKPNFFMRAVRKDERLELTEVKIGRPETLLASNQDGRLRLYLI  55



>gb|ABN09012.1| hypothetical protein MtrDRAFT_AC172101g17v1 [Medicago truncatula]
Length=249

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 54/72 (75%), Gaps = 3/72 (4%)
 Frame = +2

Query  353  RTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRL  532
            + E+     + FPPP+ SL+++GKP+F+LRPVR++GRL+L +VR +RP+ L ASR DGRL
Sbjct  147  KAESRGYLKRSFPPPLPSLNRNGKPSFYLRPVRKNGRLELTEVRIHRPDILHASRHDGRL  206

Query  533  RMHLIYSDDDQN  568
             +HLI    DQN
Sbjct  207  TLHLI---PDQN  215



>ref|XP_006302651.1| hypothetical protein CARUB_v10020764mg [Capsella rubella]
 gb|EOA35549.1| hypothetical protein CARUB_v10020764mg [Capsella rubella]
Length=279

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  368  RRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            R   +EFPPP+S+L+  G+ +F+LRPVR+DGRL+L QV  +RPE   ASR++GRLR+HL+
Sbjct  86   REGKREFPPPLSTLNGLGQRSFYLRPVRKDGRLELTQVMIDRPEIFHASRENGRLRLHLV  145

Query  548  YS  553
             S
Sbjct  146  DS  147



>ref|XP_003626330.1| hypothetical protein MTR_7g113950 [Medicago truncatula]
 gb|AES82548.1| DUF3049 family protein [Medicago truncatula]
Length=278

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  353  RTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRL  532
            + E+     + FPPP+ SL+++GKP+F+LRPVR++GRL+L +VR +RP+ L ASR DGRL
Sbjct  147  KAESRGYLKRSFPPPLPSLNRNGKPSFYLRPVRKNGRLELTEVRIHRPDILHASRHDGRL  206

Query  533  RMHLI  547
             +HLI
Sbjct  207  TLHLI  211



>gb|KGN60862.1| hypothetical protein Csa_2G020850 [Cucumis sativus]
Length=279

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 53/75 (71%), Gaps = 4/75 (5%)
 Frame = +2

Query  353  RTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRL  532
            +  AE RK   FPPP++SL+Q G P F+LR VR+DGRL+L +VR  R E L A R DGRL
Sbjct  138  KVVAEERK---FPPPLTSLNQHGHPNFYLRSVRKDGRLELTEVRIERTEILRACRGDGRL  194

Query  533  RMHLIYSDDDQNSRE  577
            R+HLI  D++Q  ++
Sbjct  195  RLHLI-KDEEQGEKD  208



>ref|XP_009373954.1| PREDICTED: protein FANTASTIC FOUR 3-like [Pyrus x bretschneideri]
Length=396

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 55/71 (77%), Gaps = 5/71 (7%)
 Frame = +2

Query  338  WSRLGRTEAERR-KSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLAS  514
            W+++G    ERR + K++PPP+SSL+Q+G P ++LRP R+DGRL+L +VR  RPE   A 
Sbjct  233  WTKMG----ERRVEPKKYPPPLSSLNQNGHPRYYLRPERKDGRLELTEVRIYRPEIFRAY  288

Query  515  RKDGRLRMHLI  547
            R+DGRLR+HL+
Sbjct  289  REDGRLRLHLV  299



>ref|XP_008370523.1| PREDICTED: protein FANTASTIC FOUR 3-like [Malus domestica]
Length=398

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  338  WSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASR  517
            W+++G    E    K+FPPP+SSL+Q+G P ++LRP R+DGRL+L +VR  RPE L A R
Sbjct  237  WTKMGERRVE---PKKFPPPLSSLNQNGHPRYYLRPERKDGRLELTEVRIYRPEILRAYR  293

Query  518  KDGRLRMHLI  547
            + GRLR+HLI
Sbjct  294  EGGRLRLHLI  303



>gb|KHN04022.1| hypothetical protein glysoja_022708 [Glycine soja]
Length=236

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 2/70 (3%)
 Frame = +2

Query  338  WSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASR  517
            W R  RT     + K  PPP+SSL+++GKP+F+LRPVR+DGRL+L +VR  R E L ASR
Sbjct  107  WRR--RTMKAEGRGKVHPPPLSSLNRNGKPSFYLRPVRRDGRLQLTEVRIQRSEILHASR  164

Query  518  KDGRLRMHLI  547
             +GRL +HL+
Sbjct  165  HNGRLTLHLV  174



>ref|XP_006604829.1| PREDICTED: protein FANTASTIC FOUR 3-like [Glycine max]
Length=243

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +2

Query  338  WSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASR  517
            W R       R K + FPPP+SSL+++GKP+F+LRPVR+DGRL+L +VR  R E L ASR
Sbjct  117  WRRRTMKAEGRGKVRSFPPPLSSLNRNGKPSFYLRPVRKDGRLELTEVRIQRSEILHASR  176

Query  518  KDGRLRMHLI  547
             +GRL + L+
Sbjct  177  HNGRLTLRLV  186



>gb|KHN43257.1| hypothetical protein glysoja_001840 [Glycine soja]
Length=158

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +2

Query  338  WSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASR  517
            W R       R K + FPPP+SSL+++GKP+F+LRPVR+DGRL+L +VR  R E L ASR
Sbjct  60   WRRRTMKAEGRGKVRSFPPPLSSLNRNGKPSFYLRPVRKDGRLELTEVRIQRSEILHASR  119

Query  518  KDGRLRMHLI  547
             +GRL + L+
Sbjct  120  HNGRLTLRLV  129



>ref|XP_008455263.1| PREDICTED: protein FANTASTIC FOUR 1 [Cucumis melo]
Length=295

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +2

Query  374  KSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYS  553
            + ++FPPP++SL+Q G P F+LR VR+DGRL+L +VR  R E L A R DGRLR+HLI  
Sbjct  143  EERKFPPPLTSLNQHGHPNFYLRSVRKDGRLELTEVRIERTEILRACRGDGRLRLHLI-K  201

Query  554  DDDQNSRE  577
            D++Q  ++
Sbjct  202  DEEQGEKD  209



>ref|XP_008388603.1| PREDICTED: protein FAF-like, chloroplastic [Malus domestica]
Length=394

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  338  WSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASR  517
            W+++G+   E +K   FPPP+SSL+Q+G P ++LRP R+DGRL+L +VR  RPE   A R
Sbjct  233  WTKMGKRRVEPKK---FPPPLSSLNQNGHPRYYLRPERKDGRLELTEVRIYRPEIFRAYR  289

Query  518  KDGRLRMHLI  547
            +DGRLR+ L+
Sbjct  290  EDGRLRLLLV  299



>ref|XP_009335643.1| PREDICTED: protein FANTASTIC FOUR 1-like [Pyrus x bretschneideri]
Length=358

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  338  WSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASR  517
            W+++G   AE    K+FPPP+SSL+Q+G P ++LRP R+DGRL+L +V+  RPE L A R
Sbjct  197  WTKMGERRAE---PKKFPPPLSSLNQNGHPRYYLRPERKDGRLELTEVKIYRPEILRAYR  253

Query  518  KDGRLRMHLI  547
            + GRLR++LI
Sbjct  254  EGGRLRLNLI  263



>ref|XP_006392488.1| hypothetical protein EUTSA_v10023602mg [Eutrema salsugineum]
 gb|ESQ29774.1| hypothetical protein EUTSA_v10023602mg [Eutrema salsugineum]
Length=312

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 53/78 (68%), Gaps = 13/78 (17%)
 Frame = +2

Query  353  RTEAERRKSKE-------------FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNR  493
            R E +R+K+KE             FPPP+SSL+  G+ +F+LRPVR+DGRL+L +V  +R
Sbjct  84   RVETKRKKTKEENVVATSRDRKNQFPPPLSSLNARGERSFYLRPVRKDGRLELTRVMIDR  143

Query  494  PETLLASRKDGRLRMHLI  547
            PE   ASR +GRLR+HL+
Sbjct  144  PEIFHASRANGRLRLHLV  161



>ref|XP_007144766.1| hypothetical protein PHAVU_007G182900g [Phaseolus vulgaris]
 gb|ESW16760.1| hypothetical protein PHAVU_007G182900g [Phaseolus vulgaris]
Length=261

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            FPPPISSL++ G+P F L PVR++GR++L +VR  RPE L A+R+DGRLR+ LI
Sbjct  110  FPPPISSLNKLGQPTFILVPVRENGRMQLNKVRIRRPEILYATREDGRLRLFLI  163



>gb|AES61304.2| DUF3049 family protein [Medicago truncatula]
Length=182

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +2

Query  284  FMPTTASTSPVKHSSSYSWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGR  463
             M  T S +  +    Y        E     +  FPPP+SSL  + +P++ L PVR+DGR
Sbjct  4    LMTCTESINEYQ-GDEYCLRNTRAVEGGVNSNNTFPPPLSSLDNNCQPSYILLPVRKDGR  62

Query  464  LKLRQVRSNRPETLLASRKDGRLRMHLI  547
            L+L ++R +RP+ L A+R+DGRLR++L+
Sbjct  63   LQLNKMRVDRPDILYANRQDGRLRLYLV  90



>ref|XP_004495755.1| PREDICTED: protein FANTASTIC FOUR 1-like [Cicer arietinum]
Length=249

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = +2

Query  293  TTASTSPVKHSSSYSWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKL  472
            TT     V   + Y W R    E +   S  FPPP+SSL  +G+ +F L P R+DGRL+L
Sbjct  68   TTLHEMQVDDHNEYCW-RTKPAEGDV-YSNSFPPPLSSLDGNGQRSFVLLPTRKDGRLQL  125

Query  473  RQVRSNRPETLLASRKDGRLRMHLI---YSDDD  562
             +V+  RPE ++A+R++GRLR++++   Y +DD
Sbjct  126  YKVKLRRPEIMVANRQNGRLRLYIVRDQYIEDD  158



>ref|XP_003591053.1| hypothetical protein MTR_1g082320 [Medicago truncatula]
Length=446

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  356  TEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLR  535
             E     +  FPPP+SSL  + +P++ L PVR+DGRL+L ++R +RP+ L A+R+DGRLR
Sbjct  291  VEGGVNSNNTFPPPLSSLDNNCQPSYILLPVRKDGRLQLNKMRVDRPDILYANRQDGRLR  350

Query  536  MHLI  547
            ++L+
Sbjct  351  LYLV  354



>gb|KHN16155.1| hypothetical protein glysoja_012131 [Glycine soja]
Length=245

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            FPPP+SSL+ +G+P+F L PVR++GRL+L +VR  RP+ L A+R+DGRLR+ L+
Sbjct  91   FPPPLSSLNGNGQPSFILVPVRKNGRLQLTKVRIKRPKILYATRQDGRLRLLLV  144



>ref|XP_003535351.1| PREDICTED: lateral signaling target protein 2 homolog [Glycine 
max]
Length=287

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            FPPP+SSL+ +G+P+F L PVR++GRL+L +VR  RP+ L A+R+DGRLR+ L+
Sbjct  133  FPPPLSSLNGNGQPSFILVPVRKNGRLQLTKVRIKRPKILYATRQDGRLRLLLV  186



>ref|NP_001240900.1| uncharacterized protein LOC100777087 [Glycine max]
 gb|ACU18706.1| unknown [Glycine max]
Length=274

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 50/71 (70%), Gaps = 4/71 (6%)
 Frame = +2

Query  335  SWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLAS  514
             W +   TE +      FPPP+SSL+ +G+P+F L PVR++GRL+L +VR  +P+ L A+
Sbjct  100  CWRKTRVTEGK----GNFPPPLSSLNGNGQPSFILVPVRKNGRLQLSKVRIKKPKILYAT  155

Query  515  RKDGRLRMHLI  547
            R+DGRL++ L+
Sbjct  156  RQDGRLKLFLV  166



>gb|KHN20195.1| hypothetical protein glysoja_023758, partial [Glycine soja]
Length=275

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 49/71 (69%), Gaps = 4/71 (6%)
 Frame = +2

Query  335  SWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLAS  514
             W +   TE +      FPPP+S L+ +G+P+F L PVR++GRL+L +VR  +P+ L A+
Sbjct  101  CWRKTRVTEGK----GNFPPPLSLLNGNGQPSFILVPVRKNGRLQLSKVRIKKPKILYAT  156

Query  515  RKDGRLRMHLI  547
            R+DGRL++ L+
Sbjct  157  RQDGRLKLFLV  167



>ref|XP_006845797.1| hypothetical protein AMTR_s00019p00255280 [Amborella trichopoda]
 gb|ERN07472.1| hypothetical protein AMTR_s00019p00255280 [Amborella trichopoda]
Length=285

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYSDD  559
            FPPP+S+LS++G+ ++FL+PV+ +GR  LR+V   R E L A R++GRLR+H+I S D
Sbjct  151  FPPPLSTLSKNGQVSYFLKPVKTEGRFILREVVILRQEVLRACRENGRLRLHMIRSSD  208



>ref|XP_008784032.1| PREDICTED: protein FANTASTIC FOUR 3 [Phoenix dactylifera]
Length=246

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +2

Query  356  TEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLR  535
            +E   R    FPPPISS+ + GKP    +  R+DGR  LR++R    E L ASR+DGRL+
Sbjct  139  SEVRSRSGGGFPPPISSIGKSGKPWISFKSYREDGRFVLREIRIPTYEFLQASREDGRLK  198

Query  536  MHLIYSDD  559
            +H+++ D+
Sbjct  199  LHIVHPDE  206



>ref|XP_007205978.1| hypothetical protein PRUPE_ppa012110mg [Prunus persica]
 gb|EMJ07177.1| hypothetical protein PRUPE_ppa012110mg [Prunus persica]
Length=183

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 45/77 (58%), Gaps = 4/77 (5%)
 Frame = +2

Query  341  SRLGRTEAERRKSK----EFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLL  508
            S +     E R+S+     FPPPIS +S+ GKP    +  RQDGR  L+++R    E L 
Sbjct  52   SEMNGCGGESRRSRTSVGGFPPPISCISKSGKPWVCFKSYRQDGRFVLKEIRIPTQEFLH  111

Query  509  ASRKDGRLRMHLIYSDD  559
            A R+DGRL++H +  DD
Sbjct  112  AYREDGRLKLHFVMPDD  128



>ref|XP_008795136.1| PREDICTED: protein FANTASTIC FOUR 2-like [Phoenix dactylifera]
Length=214

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = +2

Query  350  GRTEAER-RKSKEFPPPISSL-SQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKD  523
            GRT + R R   +FPPP+  L  +DG+ + F+R VR+DGR+ L +VR  RPE L ASR+D
Sbjct  124  GRTRSRRWRAEAKFPPPLPWLVGRDGRRSRFMRVVREDGRIVLSEVRIERPEVLRASRRD  183

Query  524  GRLRMHLIYSDDDQ  565
            GRLR+ L+ S + Q
Sbjct  184  GRLRLELVGSPNLQ  197



>ref|XP_010327367.1| PREDICTED: uncharacterized protein LOC104649597 [Solanum lycopersicum]
Length=409

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 52/66 (79%), Gaps = 2/66 (3%)
 Frame = +2

Query  353  RTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLA-SRKDGR  529
            ++ A+ RK ++ PPP+SSL+QDGKP F L+P R+DG+L+L +V+ + P +++  SR+ GR
Sbjct  319  KSYADSRK-RDLPPPLSSLNQDGKPIFSLKPTRKDGKLELNEVKMDIPSSIVVTSRQQGR  377

Query  530  LRMHLI  547
            LR++LI
Sbjct  378  LRLNLI  383



>ref|XP_010912304.1| PREDICTED: protein FANTASTIC FOUR 1-like [Elaeis guineensis]
Length=247

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +2

Query  350  GRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGR  529
            G +E   R    FPPPISS+ + GKP    R  R+DGR  LR++R    E L ASR+DGR
Sbjct  138  GLSEVRSRSGGGFPPPISSIGKSGKPWISFRSYREDGRFVLREIRIPTHEFLQASREDGR  197

Query  530  LRMHLIY  550
            L++H+++
Sbjct  198  LKLHMLH  204



>ref|XP_009377827.1| PREDICTED: protein FANTASTIC FOUR 3 [Pyrus x bretschneideri]
Length=335

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +2

Query  335  SWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLAS  514
            S  +LG   +       FPPPIS +S++GKP    +  R DGR  L+++R    E L A 
Sbjct  204  SGGKLGFRRSRSTSVGGFPPPISCISKNGKPWVCFKSYRHDGRFVLKEIRIPTQEFLHAY  263

Query  515  RKDGRLRMHLIYSDDD  562
            R+DGRL++H + SDD+
Sbjct  264  REDGRLKLHFVMSDDE  279



>ref|XP_008360841.1| PREDICTED: protein FANTASTIC FOUR 3 [Malus domestica]
Length=345

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYSDDD  562
            FPPPIS +S++GKP    +  R DGR  L+++R    E L A R+DGRL++H + SDD+
Sbjct  221  FPPPISCISKNGKPWVCFKSYRHDGRFVLKEIRIPTQEFLHAYREDGRLKLHFVMSDDE  279



>ref|XP_010553744.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding 
protein [Tarenaya hassleriana]
Length=303

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +2

Query  362  AERRKSKEFPPPISSLSQDGKPAFF-LRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRM  538
            AER K K FPP ++SL+  G   +F LR VR+DGRL++ QV   RPE L  SR++GRLR+
Sbjct  79   AEREKKKTFPPLLTSLADGGGRRWFNLRQVRRDGRLEISQVSIQRPEILRTSRENGRLRL  138

Query  539  HLIYSDDD  562
             L+ + D+
Sbjct  139  DLVEAADN  146



>ref|XP_010674996.1| PREDICTED: protein FANTASTIC FOUR 1-like [Beta vulgaris subsp. 
vulgaris]
Length=300

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  374  KSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            + K FPPP++SLS++G+  F L+ +R +GRL++  V +  PE L ASR +GRLR+HL+
Sbjct  146  EEKNFPPPLTSLSENGRRNFTLKSMRNNGRLQIVGVMTEHPEILYASRDNGRLRLHLV  203



>ref|XP_010931123.1| PREDICTED: protein FANTASTIC FOUR 3 [Elaeis guineensis]
Length=244

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 51/95 (54%), Gaps = 21/95 (22%)
 Frame = +2

Query  338  WSRLGRTEAERRKSKE---------------------FPPPISSLSQDGKPAFFLRPVRQ  454
            WS LG+ +   R+S+                      FPPPISS+ + GKP    +  R+
Sbjct  112  WSDLGKEKGTERRSRHDGVNGAYSRSLSQVRSRSRGGFPPPISSIGKSGKPLISFKSYRE  171

Query  455  DGRLKLRQVRSNRPETLLASRKDGRLRMHLIYSDD  559
            DGR  LR++R    E L ASR+DGRL++H+++ ++
Sbjct  172  DGRFVLREIRIPTYEFLQASREDGRLKLHIVHPEE  206



>ref|XP_007015792.1| Uncharacterized protein TCM_041386 [Theobroma cacao]
 gb|EOY33411.1| Uncharacterized protein TCM_041386 [Theobroma cacao]
Length=290

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  368  RRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            R +   FPPPIS + + GKP    +  RQDGR  L++VR    E L A R+DGRL++H +
Sbjct  189  RTRGGAFPPPISCIGKSGKPWVCFKSYRQDGRFVLKEVRIPTQEFLHACREDGRLKLHFV  248

Query  548  YSDD  559
              +D
Sbjct  249  QPED  252



>ref|XP_006424217.1| hypothetical protein CICLE_v10028879mg [Citrus clementina]
 gb|ESR37457.1| hypothetical protein CICLE_v10028879mg [Citrus clementina]
Length=312

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  368  RRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            R    EFPPPIS + + GKP    +  R DGR  L+++R    E L A R+DGRL++  +
Sbjct  193  RTSGGEFPPPISCIGKSGKPWVCFKSYRHDGRFVLKEIRMPSQEFLHACREDGRLKLQFV  252

Query  548  YSDDD  562
            + +DD
Sbjct  253  HPNDD  257



>ref|XP_004293063.1| PREDICTED: uncharacterized protein LOC101302043 [Fragaria vesca 
subsp. vesca]
Length=318

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYSDDDQ  565
            FPPPIS +S+ GKP    +  R DGR  L+++R    E L A R+ GRL++H I+ +D+Q
Sbjct  196  FPPPISCISKSGKPWVCFKSYRHDGRFVLKEIRIPTQEFLHAYREGGRLKLHFIHHEDEQ  255



>ref|XP_006487900.1| PREDICTED: protein FANTASTIC FOUR 3-like [Citrus sinensis]
Length=318

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  368  RRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            R    EFPPPIS + + GKP    +  R DGR  L+++R    E L A R+DGRL++  +
Sbjct  199  RTSGGEFPPPISCIGKSGKPWVCFKSYRHDGRFVLKEIRMPSQEFLHACREDGRLKLQFV  258

Query  548  YSDDD  562
            + +DD
Sbjct  259  HPNDD  263



>ref|XP_006648694.1| PREDICTED: protein FANTASTIC FOUR 1-like [Oryza brachyantha]
Length=187

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  KEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIY  550
            + FPPPIS +   GKP  +LRP R+DGRL LR+VR    E L A R++GR ++H  +
Sbjct  104  RAFPPPISVIGAGGKPWLYLRPHREDGRLVLREVRIPSRELLQACREEGRFKLHFAH  160



>ref|XP_009390037.1| PREDICTED: protein FANTASTIC FOUR 1-like [Musa acuminata subsp. 
malaccensis]
Length=228

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  368  RRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            R K+  FPPPISS+ + GKP  + +  R +GR  LR++R    E L ASR+DGRL++ L+
Sbjct  124  RTKTGGFPPPISSIGKSGKPWIYFKSYRHEGRFVLREIRIPTKEFLHASREDGRLKLQLV  183

Query  548  Y  550
            +
Sbjct  184  H  184



>ref|XP_011090336.1| PREDICTED: uncharacterized protein LOC105171038 [Sesamum indicum]
Length=300

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYSDDDQ  565
            FPPPIS + Q GKP   L+  R+DGR  L+++R    E L A R++GRL++  I  DD+ 
Sbjct  199  FPPPISCIGQCGKPWVCLKSFREDGRFILKEIRIPTQELLHACRENGRLKLQFIQPDDEA  258

Query  566  NSRE  577
            +  E
Sbjct  259  SEEE  262



>ref|XP_009613421.1| PREDICTED: uncharacterized serine-rich protein C215.13 [Nicotiana 
tomentosiformis]
Length=306

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYS  553
            FPPPIS + + GKP    +  R+DGR  L+++R    E L A R+DGRL MH+I+S
Sbjct  218  FPPPISCIGRSGKPWVCFKSFREDGRFILKEIRIPTQEFLHACREDGRLMMHVIHS  273



>ref|XP_009763642.1| PREDICTED: protein AF-9-like [Nicotiana sylvestris]
Length=315

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYS  553
            FPPPIS + + GKP    +  R+DGR  L+++R    E L A R+DGRL MH+I+S
Sbjct  225  FPPPISCIGRSGKPWVCFKSFREDGRFILKEIRIPTQEFLHACREDGRLMMHVIHS  280



>ref|XP_002523822.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38548.1| conserved hypothetical protein [Ricinus communis]
Length=291

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +2

Query  341  SRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRK  520
            S+ G     R +   FPPPIS + + GKP    +  R DGR  L+QVR    E L A R+
Sbjct  181  SQAGEIRRSRLRIGAFPPPISCIGKSGKPWVSFKSYRHDGRFVLKQVRIPSQEFLHAHRE  240

Query  521  DGRLRMHLIYSDD  559
            DGRL++H +  +D
Sbjct  241  DGRLKLHFVQPND  253



>gb|EYU36063.1| hypothetical protein MIMGU_mgv1a026980mg [Erythranthe guttata]
Length=274

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  380  KEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYSDD  559
            +EFPPPIS + + GKP   +   R+DGR  L++V+    E L A R++GRL+M  ++SDD
Sbjct  193  REFPPPISCVGRSGKPWTCIISFREDGRFILKEVKIPTQEFLHACRENGRLKMQFVHSDD  252

Query  560  D  562
            +
Sbjct  253  E  253



>ref|XP_008645751.1| PREDICTED: protein FAF-like, chloroplastic [Zea mays]
 gb|AFW71687.1| hypothetical protein ZEAMMB73_470508 [Zea mays]
Length=173

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYSDDD  562
            FPPPIS +   GKP  +LRP+R+DGRL LR+VR    E L A R+DGR ++       D
Sbjct  111  FPPPISLIGAGGKPWLYLRPLREDGRLVLREVRIPLRELLQARREDGRFKLQFAQPQPD  169



>ref|XP_002453935.1| hypothetical protein SORBIDRAFT_04g021800 [Sorghum bicolor]
 gb|EES06911.1| hypothetical protein SORBIDRAFT_04g021800 [Sorghum bicolor]
Length=208

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI--YSDD  559
            FPPPIS +   GKP  +LRP R+DGRL LR+VR    E L A R+DGR ++       DD
Sbjct  143  FPPPISLIGAGGKPWLYLRPQREDGRLVLREVRIPSRELLQARREDGRFKLQYAQPQPDD  202

Query  560  DQN  568
            D++
Sbjct  203  DED  205



>ref|XP_006362880.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Solanum 
tuberosum]
Length=324

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  371  RKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIY  550
            +K   FPPPIS + + GKP    +  R+DGR  L+++R    E L A R+DGRL MH+I 
Sbjct  227  KKRSSFPPPISCIGRSGKPWVCFKSFREDGRFILKEIRIPTQEFLHACREDGRLMMHVIQ  286

Query  551  S  553
            S
Sbjct  287  S  287



>gb|KCW87360.1| hypothetical protein EUGRSUZ_B03842 [Eucalyptus grandis]
Length=281

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 48/93 (52%), Gaps = 5/93 (5%)
 Frame = +2

Query  299  ASTSPVKHSSSY-----SWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGR  463
            +++S  KHS  Y        RL      R     FPPPISSLS +GKP    +  R DGR
Sbjct  134  SASSSFKHSPQYYPHNDHHHRLHEFRRSRSIGSGFPPPISSLSMNGKPWVCFKSYRNDGR  193

Query  464  LKLRQVRSNRPETLLASRKDGRLRMHLIYSDDD  562
              L+++R    E L ASR+ GRL +  ++  DD
Sbjct  194  FVLKEIRFPTQEFLHASREGGRLTLQFVHPGDD  226



>ref|XP_008229224.1| PREDICTED: protein FANTASTIC FOUR 3 [Prunus mume]
Length=373

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  341  SRLGRTEAERRKSKE----FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLL  508
            S +     E R+S+     FPPPIS +S+ GKP    +  RQDGR  L+++R    E L 
Sbjct  242  SEMNGCGGESRRSRTSVGGFPPPISCISKSGKPWVCFKSYRQDGRFVLKEIRIPTQEFLH  301

Query  509  ASRKDGRLRMHLI  547
            A R+DGRL++H +
Sbjct  302  AYREDGRLKLHFV  314



>gb|EEC73331.1| hypothetical protein OsI_07531 [Oryza sativa Indica Group]
Length=191

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYSD  556
            FPPPIS +   GKP  +LR  R DGRL LR+VR    E L   R+DGR ++H  + D
Sbjct  113  FPPPISVIGAGGKPWLYLRAHRGDGRLVLREVRIPSRELLHGRREDGRFKLHFAHPD  169



>ref|XP_010045198.1| PREDICTED: uncharacterized protein LOC104433969 [Eucalyptus grandis]
Length=320

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 48/93 (52%), Gaps = 5/93 (5%)
 Frame = +2

Query  299  ASTSPVKHSSSY-----SWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGR  463
            +++S  KHS  Y        RL      R     FPPPISSLS +GKP    +  R DGR
Sbjct  173  SASSSFKHSPQYYPHNDHHHRLHEFRRSRSIGSGFPPPISSLSMNGKPWVCFKSYRNDGR  232

Query  464  LKLRQVRSNRPETLLASRKDGRLRMHLIYSDDD  562
              L+++R    E L ASR+ GRL +  ++  DD
Sbjct  233  FVLKEIRFPTQEFLHASREGGRLTLQFVHPGDD  265



>ref|XP_010651876.1| PREDICTED: suppressor protein SRP40 [Vitis vinifera]
Length=308

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +2

Query  368  RRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            R +   FPPPIS + + GKP    +  R DGR  L+++R    E L A R+DGRL++H +
Sbjct  184  RTQGGAFPPPISCIGKSGKPWVSFKSYRHDGRFVLKEIRIPNQELLHACREDGRLKLHFV  243

Query  548  YSDD  559
              D+
Sbjct  244  QPDE  247



>ref|XP_003596832.1| hypothetical protein MTR_2g086590 [Medicago truncatula]
 gb|AES67083.1| DUF3049 family protein [Medicago truncatula]
Length=261

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  359  EAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRM  538
            E  R +  E+PPPISS+ + GKP  + R +R +GR  L +VR    E L A R+DGRL++
Sbjct  157  ECRRLRVSEYPPPISSIGRTGKPWVYFRSIRNNGRFVLEEVRIPTQEVLRAYREDGRLKL  216

Query  539  HLI  547
              +
Sbjct  217  QFV  219



>ref|NP_001173007.1| Os02g0534000 [Oryza sativa Japonica Group]
 dbj|BAH91736.1| Os02g0534000 [Oryza sativa Japonica Group]
Length=189

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYSDD  559
            FPPPIS +   GKP  +LR  R DGRL LR+VR    E L   R+DGR ++H  + D+
Sbjct  111  FPPPISVIGAGGKPWLYLRAHRGDGRLVLREVRIPSRELLHGRREDGRFKLHFAHPDE  168



>ref|XP_008351291.1| PREDICTED: protein FAF-like, chloroplastic [Malus domestica]
Length=324

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  305  TSPVKHSSSYSWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVR  484
             S + ++++     LG   +       FPPPIS +S  GKP    +  R +GR  L+++R
Sbjct  191  VSEISYNNNCCGGELGFRRSRSTSVGGFPPPISCISNSGKPWVCFKSYRHNGRFVLKEIR  250

Query  485  SNRPETLLASRKDGRLRMHLIYSDDD  562
                E L A R+DGRL++H +  +D+
Sbjct  251  IPTQEFLHAHREDGRLKLHFVMPNDE  276



>ref|XP_003572581.2| PREDICTED: protein FAF-like, chloroplastic [Brachypodium distachyon]
Length=204

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +2

Query  362  AERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMH  541
            A  R  + FPPPIS +   GKP  +LR  R  GRL L++VR    E L A R+DGRL++H
Sbjct  123  ARTRGRRVFPPPISVIGAAGKPWQYLRAHRGGGRLVLQEVRIPSRELLQACREDGRLKLH  182

Query  542  LIYSDDDQNSREY  580
              + ++ Q   +Y
Sbjct  183  FAHPEERQQLADY  195



>ref|XP_009391142.1| PREDICTED: uncharacterized protein LOC103977374 [Musa acuminata 
subsp. malaccensis]
Length=241

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = +2

Query  350  GRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGR  529
            G     R ++  FPPP+SS+ + G+P  + +  R+DGR  L ++R    E L ASR+DGR
Sbjct  144  GNCSDVRTRTGGFPPPVSSIGKSGRPWIYYQSYRKDGRFVLTEIRIPTQEFLRASRQDGR  203

Query  530  LRMHLIYSDDD  562
            L + L+  D D
Sbjct  204  LTLQLVQPDGD  214



>ref|XP_006593034.1| PREDICTED: protein FANTASTIC FOUR 3-like [Glycine max]
 gb|KHN21156.1| Protein FANTASTIC FOUR 3 [Glycine soja]
Length=220

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +2

Query  383  EFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            E+PPPISS+ + GKP       R +GR  L++VR+   E L A R+DGRL++H +
Sbjct  138  EYPPPISSIGRSGKPCVSFMSYRDNGRFVLKEVRTPIQEFLHAHREDGRLKLHFV  192



>dbj|BAD28434.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD29289.1| hypothetical protein [Oryza sativa Japonica Group]
Length=174

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYSDD  559
            FPPPIS +   GKP  +LR  R DGRL LR+VR    E L   R+DGR ++H  + D+
Sbjct  96   FPPPISVIGAGGKPWLYLRAHRGDGRLVLREVRIPSRELLHGRREDGRFKLHFAHPDE  153



>emb|CBI28308.3| unnamed protein product [Vitis vinifera]
Length=217

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +2

Query  368  RRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHL  544
            R +   FPPPIS + + GKP    +  R DGR  L+++R    E L A R+DGRL++H 
Sbjct  115  RTQGGAFPPPISCIGKSGKPWVSFKSYRHDGRFVLKEIRIPNQELLHACREDGRLKLHF  173



>ref|XP_003539471.1| PREDICTED: protein FANTASTIC FOUR 3 [Glycine max]
 gb|KHN27641.1| Protein FAF-like, chloroplastic [Glycine soja]
Length=236

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +2

Query  383  EFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIY  550
            E+PPPIS + + GKP    R  R +GR  L ++R    E L A R+DGRL++H ++
Sbjct  141  EYPPPISCIGRSGKPWVCFRSYRSEGRFVLEEIRIPTHEFLHACREDGRLKLHFVH  196



>ref|XP_006594929.1| PREDICTED: protein FANTASTIC FOUR 3-like [Glycine max]
 gb|KHN32870.1| Protein FAF-like, chloroplastic [Glycine soja]
Length=232

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +2

Query  383  EFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIY  550
            E+PPPIS + + GKP    R  R +GR  L ++R    E L A R+DGRL++H ++
Sbjct  140  EYPPPISCIGRSGKPWVCFRSYRSEGRFVLEEIRIPTHEFLHACREDGRLKLHFVH  195



>dbj|BAJ85079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=196

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = +2

Query  374  KSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYS  553
            + + FPPPIS +   GKP  +LR  R  GRL LR+VR    E L A R DGRL++H    
Sbjct  124  RKRAFPPPISVIGAAGKPWQYLRAQRGGGRLVLREVRIPSRELLRACRADGRLKLHFARP  183

Query  554  DDDQNSRE  577
            D D +  +
Sbjct  184  DPDPDPEQ  191



>ref|XP_010689881.1| PREDICTED: uncharacterized protein LOC104903534 [Beta vulgaris 
subsp. vulgaris]
Length=168

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  380  KEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMH  541
            K F PP++SLS++ +  F L+P+R+DGRL++  V +  PE L ASR +GRL +H
Sbjct  96   KNFLPPLTSLSENERRNFTLKPIRKDGRLQIVGVMTEHPEILDASRDNGRLTLH  149



>emb|CDP06900.1| unnamed protein product [Coffea canephora]
Length=293

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYS  553
            FPPPIS + + G+P    R  RQDGR  L+++R    E L A R+DGRLR+ LI S
Sbjct  199  FPPPISCIGRTGRPWVSFRSYRQDGRFILQEIRFPTQEFLHACREDGRLRLQLIQS  254



>gb|KDP34411.1| hypothetical protein JCGZ_12692 [Jatropha curcas]
Length=295

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = +2

Query  350  GRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGR  529
            G     R   + FPPPIS + + GKP    +  R DGR  L+Q+ +   E L A R++GR
Sbjct  183  GEIRRSRSSGRAFPPPISCIGKSGKPWVSFKSYRHDGRFVLKQILTPSQEFLHAHRENGR  242

Query  530  LRMHLIYSDDD  562
            L++HL+   D+
Sbjct  243  LKLHLVQPRDE  253



>ref|XP_002312824.1| hypothetical protein POPTR_0009s16430g [Populus trichocarpa]
 gb|EEE86779.1| hypothetical protein POPTR_0009s16430g [Populus trichocarpa]
Length=270

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  368  RRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            R   + FPPPIS + + GKP    +  R DGR  L++VR    E L A R+DGRL +  +
Sbjct  173  RSGGRAFPPPISCIGRSGKPQVIFKSYRHDGRFVLKEVRMPTLEFLRACREDGRLTLQFV  232

Query  548  YSDDD  562
            + +D+
Sbjct  233  HPNDE  237



>ref|XP_011004308.1| PREDICTED: uncharacterized protein LOC105110829 [Populus euphratica]
Length=270

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  368  RRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            R   + FPPPIS + + GKP    +  R DGR  L++VR    E L A R+DGRL +  +
Sbjct  173  RSGGRAFPPPISCIGRTGKPQVIFKSYRHDGRFVLKEVRKPTLEFLHACREDGRLTLQFV  232

Query  548  YSDDD  562
            + +D+
Sbjct  233  HPNDE  237



>ref|XP_007150063.1| hypothetical protein PHAVU_005G123200g [Phaseolus vulgaris]
 gb|ESW22057.1| hypothetical protein PHAVU_005G123200g [Phaseolus vulgaris]
Length=244

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 46/83 (55%), Gaps = 4/83 (5%)
 Frame = +2

Query  314  VKHSSSYSWSRLGRTEAERR----KSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQV  481
            +K  ++ +W      E  +R    +  E+PPPISS+ + GKP    +  R +GR  L ++
Sbjct  107  LKDGTNENWETFKEKEGVKRYVISRVSEYPPPISSIGRSGKPWVCFKSYRSEGRFVLEEI  166

Query  482  RSNRPETLLASRKDGRLRMHLIY  550
            R    E L A R+DGRL+++ ++
Sbjct  167  RIPTHEFLHACREDGRLKLNFVH  189



>ref|XP_002450291.1| hypothetical protein SORBIDRAFT_05g003300 [Sorghum bicolor]
 gb|EES09279.1| hypothetical protein SORBIDRAFT_05g003300 [Sorghum bicolor]
Length=290

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  353  RTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRL  532
            + + E R+ K FPPPI S+ + GKP    R +R+DGR  LR+V     E L A+R+ GRL
Sbjct  201  KVKEEERQPKTFPPPIRSIGRGGKPYVCFRSLREDGRFVLREVVIPGKELLQATREGGRL  260

Query  533  RMHL  544
            R+  
Sbjct  261  RLQF  264



>ref|XP_003539162.1| PREDICTED: protein FAF-like, chloroplastic-like [Glycine max]
Length=242

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +2

Query  383  EFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            E+PPPISS+ + GKP       R +GR  L++VR    E L A R+DGRL++H +
Sbjct  144  EYPPPISSIGRSGKPCVSFMSYRDNGRFVLKEVRIPIQEFLHAHREDGRLKLHFV  198



>gb|KHN38624.1| Protein FANTASTIC FOUR 3 [Glycine soja]
Length=244

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +2

Query  383  EFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            E+PPPISS+ + GKP       R +GR  L++VR    E L A R+DGRL++H +
Sbjct  146  EYPPPISSIGRSGKPCVSFMSYRDNGRFVLKEVRIPIQEFLHAHREDGRLKLHFV  200



>ref|XP_010686193.1| PREDICTED: rho GTPase-activating protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=785

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            FPPPI  + Q GKP+   +  R++GR  L++VR+   E L ASR+DGRLR+  +
Sbjct  659  FPPPIPYIGQTGKPSVSFKSYRKNGRFVLKEVRTPTHECLQASREDGRLRLTFV  712



>ref|XP_004139585.1| PREDICTED: uncharacterized protein LOC101210424 [Cucumis sativus]
 gb|KGN64947.1| hypothetical protein Csa_1G166760 [Cucumis sativus]
Length=256

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  380  KEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYSDD  559
            ++FPPPIS + + GKP    +  R  GR  L++VR    E L ASR++GRL++H++  ++
Sbjct  168  EDFPPPISCMGKSGKPWVGFKSYRYGGRFILKEVRVPTHEFLHASRENGRLKLHILVPNE  227



>gb|EMT28160.1| hypothetical protein F775_09016 [Aegilops tauschii]
Length=174

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +2

Query  371  RKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHL  544
            R  + FPPPIS + + G+P   LR  R+DGRL LRQ+R    E L + ++DGR ++ +
Sbjct  94   RSGRAFPPPISVIGKGGRPWLTLRAHREDGRLVLRQMRLPSQELLQSCKEDGRFKLFM  151



>ref|XP_008461212.1| PREDICTED: protein FANTASTIC FOUR 4-like [Cucumis melo]
Length=257

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  380  KEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYSDD  559
            ++FPPPIS + + GKP    +  R  GR  L++VR    E L ASR++GRL++H++  ++
Sbjct  169  EDFPPPISCMGKSGKPWVGFKSYRYGGRFILKEVRVPTHEFLHASRENGRLKLHILVPNE  228



>ref|XP_009774952.1| PREDICTED: protein FANTASTIC FOUR 1-like [Nicotiana sylvestris]
Length=273

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 45/87 (52%), Gaps = 5/87 (6%)
 Frame = +2

Query  293  TTASTSPVKHSSSYSWSRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKL  472
            +T   S +++   YS  R  RT     K    PPPIS +   GKP    +  R+DGR  L
Sbjct  151  STCINSKLENHHEYS-KRYSRT----NKGSLLPPPISCIGGSGKPWVCFKSYREDGRFIL  205

Query  473  RQVRSNRPETLLASRKDGRLRMHLIYS  553
            +++R    E L A R+DGRL++  I S
Sbjct  206  KEIRIPEWEFLHACREDGRLKLQYIQS  232



>ref|XP_010089810.1| hypothetical protein L484_022326 [Morus notabilis]
 gb|EXB38426.1| hypothetical protein L484_022326 [Morus notabilis]
Length=297

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +2

Query  398  ISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYSDD  559
            IS LS+ GKP    +  RQDGR  L+++R    E L A R+DGRL++H +  +D
Sbjct  200  ISCLSKSGKPWVCFKSYRQDGRFVLKEIRVRSQEFLHACREDGRLKLHFVQPND  253



>ref|XP_006851427.1| hypothetical protein AMTR_s00040p00091720 [Amborella trichopoda]
 gb|ERN13008.1| hypothetical protein AMTR_s00040p00091720 [Amborella trichopoda]
Length=318

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +2

Query  350  GRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRP-ETLLASRKDG  526
            G +  +R +   FPPPIS + ++G+P   LR  R DGR  LR++R     E L A R+DG
Sbjct  237  GSSVRKRERVGNFPPPISCIGRNGQPWVSLRSYRHDGRFVLREIRVPIAHEFLRACREDG  296

Query  527  RLRMHLIYS  553
            RL++  I S
Sbjct  297  RLKLRFIQS  305



>ref|XP_009586842.1| PREDICTED: protein FANTASTIC FOUR 1-like [Nicotiana tomentosiformis]
Length=283

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +2

Query  374  KSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYS  553
            K    PPPIS +   GKP    +  R+DGR  L+++R    E L A R+DGRL++  I S
Sbjct  175  KGSLLPPPISCIGGSGKPWVCFKSYREDGRFILKEIRIPEWEFLHACREDGRLKLQYIQS  234



>ref|XP_006384794.1| hypothetical protein POPTR_0004s21170g [Populus trichocarpa]
 gb|ERP62591.1| hypothetical protein POPTR_0004s21170g [Populus trichocarpa]
Length=288

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIYSDDD  562
            FPPPIS +   GKP    +  R DGR  L++VR    + L A R+DGRL +  ++ +D+
Sbjct  196  FPPPISCIGWGGKPRAIFKSYRHDGRFVLKEVRMPTFKFLHACREDGRLTLQFVHPNDE  254



>gb|EMS58017.1| hypothetical protein TRIUR3_34065 [Triticum urartu]
Length=175

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +2

Query  371  RKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHL  544
            R  + FPPPIS + + G+P   LR  R+DGRL LR++R    E L + ++DGR ++ +
Sbjct  94   RSGRAFPPPISVIGKGGRPWLTLRAHREDGRLVLREMRLPSQELLQSCKEDGRFKLFM  151



>ref|NP_001142440.1| uncharacterized protein LOC100274630 [Zea mays]
 gb|ACG23996.1| hypothetical protein [Zea mays]
Length=302

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +2

Query  365  ERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHL  544
            E R+ K FPPPI S+ + GKP    R  R+DGR  L +V     E L A+R+ GRLR+  
Sbjct  203  EERQPKTFPPPIPSIGRGGKPYVCFRSFREDGRFVLLEVVIPGKELLQATREGGRLRLQF  262



>ref|XP_004978706.1| PREDICTED: protein FAF-like, chloroplastic-like isoform X1 [Setaria 
italica]
 ref|XP_004978707.1| PREDICTED: protein FAF-like, chloroplastic-like isoform X2 [Setaria 
italica]
Length=277

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +2

Query  365  ERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHL  544
            E R+ K FPPPI S+ + GKP    R  R+DGR  L +V     E L A+R+ GRLR+  
Sbjct  193  EERQPKAFPPPIRSIGRGGKPYVCFRSFREDGRFVLLEVVIPGKELLQATREGGRLRLQF  252



>tpg|DAA39151.1| TPA: hypothetical protein ZEAMMB73_815968 [Zea mays]
 tpg|DAA39152.1| TPA: hypothetical protein ZEAMMB73_815968 [Zea mays]
Length=299

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +2

Query  365  ERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHL  544
            E R+ K FPPPI S+ + GKP    R  R+DGR  L +V     E L A+R+ GRLR+  
Sbjct  197  EERQPKTFPPPIPSIGRGGKPYVCFRSFREDGRFVLLEVVIPGKELLQATREGGRLRLQF  256



>ref|XP_010271631.1| PREDICTED: protein FANTASTIC FOUR 1 [Nelumbo nucifera]
Length=317

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +2

Query  350  GRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGR  529
            G  +  R   + FPPPIS + + GKP    +  R DGR  L+++R    E L A R++GR
Sbjct  194  GEFKRSRTTGRPFPPPISCIGRSGKPWICFKSYRYDGRFILKEIRIPTREFLHARRENGR  253

Query  530  LRMHLI  547
            L++H +
Sbjct  254  LKLHFV  259



>tpg|DAA39153.1| TPA: hypothetical protein ZEAMMB73_815968 [Zea mays]
Length=303

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +2

Query  365  ERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHL  544
            E R+ K FPPPI S+ + GKP    R  R+DGR  L +V     E L A+R+ GRLR+  
Sbjct  201  EERQPKTFPPPIPSIGRGGKPYVCFRSFREDGRFVLLEVVIPGKELLQATREGGRLRLQF  260



>ref|XP_004242110.1| PREDICTED: protein FAF-like, chloroplastic [Solanum lycopersicum]
Length=276

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  353  RTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRL  532
            + ++   K    PPPIS + ++GKP       R++GR  L++V+    E L A R+DGRL
Sbjct  177  KIKSRTNKGALLPPPISCIGRNGKPCVCFESFRENGRFILKEVKIPEWEFLHACREDGRL  236

Query  533  RMHLI  547
            ++ ++
Sbjct  237  KLQIV  241



>ref|XP_010248433.1| PREDICTED: protein FANTASTIC FOUR 1-like [Nelumbo nucifera]
Length=315

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query  335  SW-SRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLA  511
            SW ++ G  +  +   + FPPPIS +   GKP    +  R DGR  L+++R    E L A
Sbjct  177  SWENKSGEFKRSKATGRPFPPPISCIGSSGKPWVCFKSYRYDGRFILKEIRIPTQEFLHA  236

Query  512  SRKDGRLRMHLIYSD  556
             R+DGRL++  + S+
Sbjct  237  RREDGRLKIRFVQSE  251



>ref|XP_004952650.1| PREDICTED: protein FAF-like, chloroplastic-like [Setaria italica]
Length=228

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHL  544
            FPPPIS +   GKP  +LRP R+ GRL LR++R    E L A R+ GR ++  
Sbjct  139  FPPPISVIGAGGKPWLYLRPHREGGRLVLRELRIPSRELLQARREGGRFKLQF  191



>ref|XP_006303556.1| hypothetical protein CARUB_v10011015mg [Capsella rubella]
 gb|EOA36454.1| hypothetical protein CARUB_v10011015mg [Capsella rubella]
Length=297

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 49/95 (52%), Gaps = 5/95 (5%)
 Frame = +2

Query  293  TTASTSPVKHSSSYSWSRLGRTEAERRKSKEFPPPISSLSQDGK-----PAFFLRPVRQD  457
             +A++ PVK    Y   R    EA    ++EFPPPI  L+Q G      P    R V  D
Sbjct  73   VSAASEPVKSRFRYGGRRREEREARAAAAREFPPPIPLLAQTGNLLPHMPWVLKRVVTSD  132

Query  458  GRLKLRQVRSNRPETLLASRKDGRLRMHLIYSDDD  562
            GRL LR+ +    E   A+R +GRL +HL+  DDD
Sbjct  133  GRLILREEKVRHHEYFRANRSNGRLTLHLVPLDDD  167



>gb|EMT04427.1| hypothetical protein F775_19219 [Aegilops tauschii]
Length=125

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHL  544
            FPPPI S+ + GKP    R  R DGR  L QV     E L ASR+ GRLR+  
Sbjct  41   FPPPIRSIGRGGKPCVCFRTFRADGRFVLTQVVIPGKELLQASREGGRLRLRF  93



>ref|XP_002874068.1| hypothetical protein ARALYDRAFT_489095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50327.1| hypothetical protein ARALYDRAFT_489095 [Arabidopsis lyrata subsp. 
lyrata]
Length=194

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 8/73 (11%)
 Frame = +2

Query  359  EAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRM  538
            E  R++ KE+PP ++ +S         +  R++GRL L +VR  R E L ASR+DGRLR+
Sbjct  130  EPRRKERKEYPPAMTRMS--------FKTYRKEGRLVLEEVRIPRREFLRASREDGRLRL  181

Query  539  HLIYSDDDQNSRE  577
             L+  +DD +  E
Sbjct  182  KLVQPEDDHDEEE  194



>ref|XP_008449578.1| PREDICTED: protein FANTASTIC FOUR 3 [Cucumis melo]
Length=262

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 48/89 (54%), Gaps = 10/89 (11%)
 Frame = +2

Query  305  TSPVKHSSSYSWSRLGRTEAERRKS----KEFPPPISSLSQDGKPAFFLRPVRQDGRLKL  472
            ++ VKH +S      G +  E R+S    + FPPP+S + +  K        RQDGR  L
Sbjct  153  SASVKHVAS------GTSSGELRRSRTSRQAFPPPLSFIGKSAKTGVRFTSYRQDGRFVL  206

Query  473  RQVRSNRPETLLASRKDGRLRMHLIYSDD  559
            +++R    E L A R+DGRL++ ++  +D
Sbjct  207  KEIRIPTQEFLQARREDGRLKLQIVQPND  235



>ref|NP_001183691.1| hypothetical protein [Zea mays]
 gb|ACR37984.1| unknown [Zea mays]
 tpg|DAA37904.1| TPA: hypothetical protein ZEAMMB73_582160 [Zea mays]
Length=134

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  371  RKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRM  538
            R  + FPPPIS + + G+P   LR  R+ GRL LRQ+R    E L   ++DGR ++
Sbjct  55   RSGRAFPPPISVIGKGGRPWLCLRAHREGGRLVLRQMRLPSQELLQPCKEDGRFKL  110



>gb|KEH29848.1| DUF3049 family protein [Medicago truncatula]
Length=246

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 7/74 (9%)
 Frame = +2

Query  350  GRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGR  529
            GRT    ++  E+PPPIS + + GKP    +  R++GR  L+Q+     + L A R+DGR
Sbjct  155  GRT----KRLNEYPPPISCIGRSGKPCVRFKSYRENGRFILKQIPIQ--DFLHAHREDGR  208

Query  530  LRMHLIYSD-DDQN  568
            L +H I  D ++QN
Sbjct  209  LTLHFIQHDVEEQN  222



>gb|KGN48031.1| hypothetical protein Csa_6G425190 [Cucumis sativus]
Length=262

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 48/89 (54%), Gaps = 10/89 (11%)
 Frame = +2

Query  305  TSPVKHSSSYSWSRLGRTEAERRKS----KEFPPPISSLSQDGKPAFFLRPVRQDGRLKL  472
            ++ VKH +S      G +  E R+S    ++FPPP+S + +  K        RQDGR  L
Sbjct  153  SASVKHVAS------GTSSGELRRSRTSRQDFPPPLSFIGKSAKTGVRFTSYRQDGRFVL  206

Query  473  RQVRSNRPETLLASRKDGRLRMHLIYSDD  559
            +++R    E L A R+DGRL++ ++   D
Sbjct  207  KEIRIPIQEFLQARREDGRLKLQIVQPSD  235



>ref|XP_006358458.1| PREDICTED: uncharacterized protein LOC102584004 [Solanum tuberosum]
Length=136

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 41/62 (66%), Gaps = 5/62 (8%)
 Frame = +2

Query  380  KEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLL-----ASRKDGRLRMHL  544
            ++FPP +SSL ++G+P F L+ VR++GRL++ +V++ RPE ++         DG +   +
Sbjct  67   RDFPPLLSSLFENGRPRFDLKKVRENGRLQISRVKNTRPEVIVERIHPGEESDGSMNDLI  126

Query  545  IY  550
            ++
Sbjct  127  VF  128



>ref|XP_009614911.1| PREDICTED: uncharacterized protein LOC104107737 [Nicotiana tomentosiformis]
Length=186

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 45/85 (53%), Gaps = 16/85 (19%)
 Frame = +2

Query  341  SRLGRTEAERRKSKE-------FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPE  499
            SR   TE   R+ +E       FPP +SSL  +G+P   L  VR++GRL++  VR+NRPE
Sbjct  78   SRTNTTEMRTRQQREGKLAVTSFPPLLSSLKMNGRPRSSLVKVRENGRLQISSVRNNRPE  137

Query  500  TLLA---------SRKDGRLRMHLI  547
             L+          S   GR+R+  I
Sbjct  138  VLVVRSPPSADDESGNSGRVRVKFI  162



>gb|EMT32339.1| hypothetical protein F775_12429 [Aegilops tauschii]
Length=389

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = +2

Query  371  RKSKEFPPPISSLSQ----DGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRM  538
            R  + FPPP+ S+S+    DG P   +RP R+DGRL L  V +     L A R+DGRL++
Sbjct  135  RPQRAFPPPLPSMSRHRGDDGGPCLRVRPHRRDGRLVLEAVAAKPQGYLHAQRQDGRLKL  194

Query  539  HLI-YSDDD  562
              + YS  D
Sbjct  195  CFVDYSASD  203



>ref|XP_008788986.1| PREDICTED: protein FANTASTIC FOUR 3-like [Phoenix dactylifera]
Length=242

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = +2

Query  368  RRKSKE-FPPPISSLSQDG-KPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMH  541
            R  SKE FPPPI+++ + G +P  + +  R+DGR  L+++R    + L A+R++GRL + 
Sbjct  163  RSGSKEKFPPPITTIGRGGGRPWIYFKSYRKDGRFVLKEIRIPTQQCLQATRENGRLVLQ  222

Query  542  LIYSDD  559
             ++ D+
Sbjct  223  FVHPDE  228



>ref|XP_008790293.1| PREDICTED: protein FANTASTIC FOUR 3-like, partial [Phoenix dactylifera]
Length=221

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  386  FPPPISSLSQDG-KPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLI  547
            FPPP+S L+ +G + + +L P R+DGRL ++    +RPE   A+R++GRL +HLI
Sbjct  147  FPPPLSWLAGNGGRRSKYLAPERKDGRLVIKLKTVDRPEIFSATRENGRLLLHLI  201



>ref|NP_173630.1| structural constituent of ribosome [Arabidopsis thaliana]
 gb|AAF86557.1|AC069252_16 F2E2.18 [Arabidopsis thaliana]
 gb|AAU44390.1| hypothetical protein AT1G22110 [Arabidopsis thaliana]
 gb|AAV63845.1| hypothetical protein At1g22110 [Arabidopsis thaliana]
 gb|AEE30198.1| structural constituent of ribosome [Arabidopsis thaliana]
Length=282

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 48/95 (51%), Gaps = 5/95 (5%)
 Frame = +2

Query  293  TTASTSPVKHSSSYSWSRLGRTEAERRKSKEFPPPISSLSQDGK-----PAFFLRPVRQD  457
             + ++ PVK    Y   R    EA    ++EFPPPI  L+Q G      P    R V  D
Sbjct  71   VSVASEPVKSRFRYGGRRREEREARAAAAREFPPPIPLLAQTGNLLPHMPWVLKRVVTSD  130

Query  458  GRLKLRQVRSNRPETLLASRKDGRLRMHLIYSDDD  562
            GRL LR+ +    E   A+R +GRL +HL+  DDD
Sbjct  131  GRLILREEKVRHHEYFRANRSNGRLTLHLVPLDDD  165



>ref|XP_009419497.1| PREDICTED: protein FANTASTIC FOUR 1-like [Musa acuminata subsp. 
malaccensis]
Length=249

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = +2

Query  341  SRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRK  520
            S +G T  E      FPPPIS++ +  KP  +L+  ++DGRL L++++    + L A+R+
Sbjct  151  SDIGLTGGE----AVFPPPISTIGKGVKPWVYLKSFKKDGRLVLKKIKLPTQQCLQATRE  206

Query  521  DGRLRMHLIY  550
            +GRL + L +
Sbjct  207  NGRLLLQLAH  216



>ref|XP_010943776.1| PREDICTED: uncharacterized protein LOC105061432 [Elaeis guineensis]
Length=240

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 44/66 (67%), Gaps = 2/66 (3%)
 Frame = +2

Query  368  RRKSKE-FPPPISSLSQDG-KPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMH  541
            R  SKE FPPPI+++ + G +P  + +  R++GR  L+++R    + L A+R++GRL + 
Sbjct  158  RSGSKEKFPPPITTIGRGGGRPWIYFKSYRKEGRFVLKEIRIPMQQCLQATRENGRLVLQ  217

Query  542  LIYSDD  559
            L++ D+
Sbjct  218  LVHPDE  223



>ref|XP_004975573.1| PREDICTED: uncharacterized protein LOC101767657 [Setaria italica]
Length=143

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  371  RKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIY  550
            R  + FPPPIS + + G+P   LR  R+ GRL LR++R    E L   ++DGR ++ LI+
Sbjct  57   RSGRAFPPPISVIGKGGRPWLSLRAHREGGRLVLREMRLPSQELLQPCKEDGRFKL-LIH  115

Query  551  SD  556
             +
Sbjct  116  PE  117



>ref|XP_010664293.1| PREDICTED: uncharacterized protein LOC104882477 [Vitis vinifera]
Length=248

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 42/79 (53%), Gaps = 6/79 (8%)
 Frame = +2

Query  341  SRLGRTEAERRKSKEFPPPISSLSQ-----DGKPAFFLRPVRQDGRLKLRQVRSNRPETL  505
             R+GR+ +E +  KEFPPPI  L+Q        P    R    DGRL +R+ +    E  
Sbjct  88   GRIGRS-SEMKTKKEFPPPIPWLAQTENLLSHMPWVMKRYHTSDGRLIIREEKVKHHEYF  146

Query  506  LASRKDGRLRMHLIYSDDD  562
             A R +GRL +HLI  +DD
Sbjct  147  RAHRANGRLTLHLIPMNDD  165



>ref|XP_003581204.1| PREDICTED: uncharacterized protein LOC100825177 [Brachypodium 
distachyon]
Length=187

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +2

Query  371  RKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRM  538
            R  + FPPPIS + + G+P   LR  R+DGRL LR+++    E L   R+DGR ++
Sbjct  102  RSGRAFPPPISVIGKSGRPWLSLRAQREDGRLVLREMQLPSQELLQQCREDGRFKL  157



>ref|XP_006653373.1| PREDICTED: uncharacterized protein LOC102707118 [Oryza brachyantha]
Length=201

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHL  544
            FPPPIS + + G+P   LR  R+DGRL LR++R    E L   ++DGR ++ +
Sbjct  120  FPPPISVIGKGGRPWLTLRAHREDGRLVLREMRLPSQELLQPCKEDGRFKLFI  172



>ref|XP_002312517.1| hypothetical protein POPTR_0008s14890g [Populus trichocarpa]
 gb|EEE89884.1| hypothetical protein POPTR_0008s14890g [Populus trichocarpa]
Length=326

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = +2

Query  362  AERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRS-NRPETLLASRKDGRLRM  538
            A++  S+ FPPP++++   G  +  +RP R+DGRL +R V + +R   L A RKDGRLR+
Sbjct  171  AKKANSRSFPPPLTTMR--GSKSLQVRPHREDGRLIIRAVEAPSRHTCLHAERKDGRLRL  228

Query  539  HLI  547
              +
Sbjct  229  SFV  231



>ref|XP_007034674.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007034675.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY05600.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY05601.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=340

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +2

Query  362  AERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLL-ASRKDGRLRM  538
            A++  S+ FPPP++++S  G  +  +RP R+DGRL ++ V++    TL  A R +GRLR+
Sbjct  173  AKKATSRNFPPPLTTIS--GSDSLQVRPHREDGRLVIKAVKAPSANTLFQAERSNGRLRL  230

Query  539  HLI  547
             L+
Sbjct  231  CLL  233



>ref|NP_001052746.1| Os04g0413100 [Oryza sativa Japonica Group]
 dbj|BAF14660.1| Os04g0413100, partial [Oryza sativa Japonica Group]
Length=182

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  371  RKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIY  550
            R  + FPPPIS + + G+P   LR  R+ GRL LR++R    E L   ++DGR ++ LI+
Sbjct  96   RSGRAFPPPISVIGKGGRPWLSLRAHREAGRLVLREMRLPSQELLQPCKEDGRFKL-LIH  154

Query  551  SD  556
             +
Sbjct  155  PE  156



>ref|XP_011026040.1| PREDICTED: protein FANTASTIC FOUR 3-like [Populus euphratica]
Length=326

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = +2

Query  362  AERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRS-NRPETLLASRKDGRLRM  538
            A++  S+ FPPP++++   G  +  +RP R+DGRL +R V + +R   L A RKDGRLR+
Sbjct  171  AKKANSRSFPPPLTTMR--GSKSLQVRPHREDGRLIIRAVEAPSRHTCLHAERKDGRLRL  228

Query  539  HLI  547
              +
Sbjct  229  SFV  231



>ref|XP_009401093.1| PREDICTED: uncharacterized protein LOC103985187 [Musa acuminata 
subsp. malaccensis]
Length=195

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 40/72 (56%), Gaps = 6/72 (8%)
 Frame = +2

Query  371  RKSKEFPPPISSLSQDGK-----PAFFLRPVRQDGR-LKLRQVRSNRPETLLASRKDGRL  532
            R+S+ FPPP+  L++ GK     P    R    DGR L +R+VR NR E   A R  GRL
Sbjct  61   RRSRRFPPPLPLLARTGKLTSHMPWILERIHEDDGRRLVIREVRVNRHEYFRARRGGGRL  120

Query  533  RMHLIYSDDDQN  568
             +HL+   D Q+
Sbjct  121  TLHLVELHDHQS  132



>ref|XP_002520750.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41712.1| conserved hypothetical protein [Ricinus communis]
Length=302

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 3/59 (5%)
 Frame = +2

Query  386  FPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLL-ASRKDGRLRMHLIYSDD  559
            FPPP++S+S  G     +RP R+ GRL L  V  +  E    A R DGRLR+HLI ++D
Sbjct  167  FPPPLTSIS--GSTNVQVRPHREGGRLILEAVSVSSCEAFFHAERIDGRLRLHLISNND  223



>emb|CAE02064.2| OJ000126_13.6 [Oryza sativa Japonica Group]
 gb|EAZ30679.1| hypothetical protein OsJ_14737 [Oryza sativa Japonica Group]
Length=205

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  371  RKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIY  550
            R  + FPPPIS + + G+P   LR  R+ GRL LR++R    E L   ++DGR ++ LI+
Sbjct  119  RSGRAFPPPISVIGKGGRPWLSLRAHREAGRLVLREMRLPSQELLQPCKEDGRFKL-LIH  177

Query  551  SD  556
             +
Sbjct  178  PE  179



>emb|CAH67361.1| OSIGBa0134P10.7 [Oryza sativa Indica Group]
 gb|EAY94040.1| hypothetical protein OsI_15819 [Oryza sativa Indica Group]
Length=205

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  371  RKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIY  550
            R  + FPPPIS + + G+P   LR  R+ GRL LR++R    E L   ++DGR ++ LI+
Sbjct  119  RSGRAFPPPISVIGKGGRPWLSLRAHREAGRLVLREMRLPSQELLQPCKEDGRFKL-LIH  177

Query  551  SD  556
             +
Sbjct  178  PE  179



>ref|XP_002893211.1| hypothetical protein ARALYDRAFT_472444 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69470.1| hypothetical protein ARALYDRAFT_472444 [Arabidopsis lyrata subsp. 
lyrata]
Length=290

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 35/64 (55%), Gaps = 5/64 (8%)
 Frame = +2

Query  386  FPPPISSLSQDGK-----PAFFLRPVRQDGRLKLRQVRSNRPETLLASRKDGRLRMHLIY  550
            FPPPI  L+Q G      P    R V  DGRL LR+ +    E   A+R +GRL +HL+ 
Sbjct  102  FPPPIPLLAQTGNLLPHMPWVLKRVVTSDGRLILREEKVRHHEYFRANRSNGRLTLHLVP  161

Query  551  SDDD  562
             DDD
Sbjct  162  LDDD  165



>emb|CBI32338.3| unnamed protein product [Vitis vinifera]
Length=292

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 41/78 (53%), Gaps = 2/78 (3%)
 Frame = +2

Query  341  SRLGRTEAERRKSKEFPPPISSLSQDGKPAFFLRPVRQDGRLKLRQVRSNRPETLL-ASR  517
            S+L  T     +S  FPPP++S+S  G     +RP R+DGRL +  V      +   A R
Sbjct  119  SKLSATLPLMTRSTSFPPPLTSISSRGGGGLQVRPHREDGRLVIEAVAIPACHSYFHADR  178

Query  518  KDGRLRMHLIYSDDDQNS  571
             DGRLR+ L+  D  QN 
Sbjct  179  SDGRLRLQLL-KDCFQNC  195



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 826660453344