BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14698_g1_i1 len=885 path=[1:0-544 1884:545-783 546:784-884]

Length=885
                                                                      Score     E

emb|CDP03214.1|  unnamed protein product                              85.1    3e-16   
ref|XP_004239323.1|  PREDICTED: vacuolar protein sorting-associat...  84.7    4e-16   
ref|XP_007202552.1|  hypothetical protein PRUPE_ppa011232mg           84.0    8e-16   
ref|XP_008242449.1|  PREDICTED: vacuolar protein sorting-associat...  84.0    8e-16   
ref|XP_009765362.1|  PREDICTED: vacuolar protein sorting-associat...  84.0    8e-16   
ref|XP_009593196.1|  PREDICTED: vacuolar protein sorting-associat...  84.0    9e-16   
ref|XP_006338191.1|  PREDICTED: vacuolar protein sorting-associat...  83.2    1e-15   
ref|XP_010042633.1|  PREDICTED: vacuolar protein sorting-associat...  79.0    3e-15   
ref|XP_008387512.1|  PREDICTED: vacuolar protein sorting-associat...  82.0    3e-15   
ref|XP_009352595.1|  PREDICTED: vacuolar protein sorting-associat...  81.6    4e-15   
ref|XP_004287507.1|  PREDICTED: vacuolar protein sorting-associat...  81.6    5e-15   
ref|XP_010086896.1|  Vacuolar protein sorting-associated protein ...  82.0    7e-15   
gb|ABK25790.1|  unknown                                               78.6    9e-15   Picea sitchensis
ref|XP_010244367.1|  PREDICTED: vacuolar protein sorting-associat...  80.5    1e-14   
gb|ABK23499.1|  unknown                                               79.3    1e-14   Picea sitchensis
ref|XP_008812733.1|  PREDICTED: vacuolar protein sorting-associat...  80.5    1e-14   
ref|XP_008337624.1|  PREDICTED: vacuolar protein sorting-associat...  80.1    2e-14   
ref|XP_010047627.1|  PREDICTED: vacuolar protein sorting-associat...  80.1    2e-14   
gb|ABK25827.1|  unknown                                               79.7    2e-14   Picea sitchensis
gb|KDP33761.1|  hypothetical protein JCGZ_07332                       79.3    3e-14   
ref|XP_002275998.1|  PREDICTED: vacuolar protein sorting-associat...  79.3    3e-14   Vitis vinifera
ref|XP_002514179.1|  Charged multivesicular body protein 4b, puta...  79.3    3e-14   Ricinus communis
ref|XP_010929019.1|  PREDICTED: vacuolar protein sorting-associat...  79.0    5e-14   
gb|AFK48250.1|  unknown                                               77.8    1e-13   
ref|XP_011077951.1|  PREDICTED: vacuolar protein sorting-associat...  77.4    1e-13   
ref|XP_010267087.1|  PREDICTED: vacuolar protein sorting-associat...  76.6    3e-13   
emb|CDY48599.1|  BnaA01g07660D                                        79.7    4e-13   
ref|XP_006853757.1|  hypothetical protein AMTR_s00056p00189660        73.9    5e-13   
ref|XP_006580488.1|  PREDICTED: vacuolar protein sorting-associat...  74.3    1e-12   
ref|XP_004513085.1|  PREDICTED: vacuolar protein sorting-associat...  75.1    1e-12   
ref|XP_002437263.1|  hypothetical protein SORBIDRAFT_10g023830        75.1    1e-12   Sorghum bicolor [broomcorn]
ref|XP_004141038.1|  PREDICTED: vacuolar protein sorting-associat...  74.7    1e-12   
ref|XP_006451365.1|  hypothetical protein CICLE_v10009534mg           74.3    1e-12   
ref|XP_007152939.1|  hypothetical protein PHAVU_004G173000g           74.7    1e-12   
ref|NP_001152491.1|  charged multivesicular body protein 4b           74.7    1e-12   Zea mays [maize]
ref|XP_008459153.1|  PREDICTED: vacuolar protein sorting-associat...  74.7    1e-12   
ref|XP_007160256.1|  hypothetical protein PHAVU_002G305900g           74.7    1e-12   
ref|XP_004503518.1|  PREDICTED: vacuolar protein sorting-associat...  74.7    1e-12   
ref|XP_006371958.1|  hypothetical protein POPTR_0018s06680g           74.3    1e-12   
ref|XP_006451366.1|  hypothetical protein CICLE_v10009534mg           74.3    2e-12   
gb|AFK38664.1|  unknown                                               74.3    2e-12   
ref|XP_004503516.1|  PREDICTED: vacuolar protein sorting-associat...  74.3    2e-12   
ref|XP_003525301.1|  PREDICTED: vacuolar protein sorting-associat...  74.3    2e-12   
ref|XP_010526425.1|  PREDICTED: vacuolar protein sorting-associat...  74.3    2e-12   
ref|XP_006572922.1|  PREDICTED: vacuolar protein sorting-associat...  74.3    2e-12   
gb|AFK45318.1|  unknown                                               74.3    2e-12   
gb|EMT22613.1|  Vacuolar protein sorting-associated 32-1-like pro...  74.3    2e-12   
dbj|BAJ86054.1|  predicted protein                                    74.3    2e-12   
ref|XP_004965917.1|  PREDICTED: vacuolar protein sorting-associat...  74.3    2e-12   
ref|XP_007012940.1|  Vacuolar protein sorting-associated protein ...  74.3    2e-12   
dbj|BAJ98801.1|  predicted protein                                    74.3    2e-12   
ref|NP_001058040.1|  Os06g0608500                                     74.3    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006656230.1|  PREDICTED: vacuolar protein sorting-associat...  74.3    2e-12   
ref|XP_002283066.1|  PREDICTED: vacuolar protein sorting-associat...  74.3    2e-12   Vitis vinifera
ref|XP_011016035.1|  PREDICTED: vacuolar protein sorting-associat...  73.9    2e-12   
ref|XP_006381691.1|  hypothetical protein POPTR_0006s15890g           73.9    2e-12   
ref|XP_006355308.1|  PREDICTED: vacuolar protein sorting-associat...  73.9    2e-12   
ref|XP_011093673.1|  PREDICTED: vacuolar protein sorting-associat...  73.9    2e-12   
gb|KHG25043.1|  VPS32.2: Vacuolar protein sorting-associated prot...  73.9    2e-12   
ref|XP_004245128.1|  PREDICTED: vacuolar protein sorting-associat...  73.9    2e-12   
gb|ACN85265.1|  charged multivesicular body protein 4b                73.9    2e-12   Oryza alta
ref|XP_006340250.1|  PREDICTED: vacuolar protein sorting-associat...  73.9    2e-12   
ref|XP_011081721.1|  PREDICTED: vacuolar protein sorting-associat...  73.9    2e-12   
ref|XP_009800252.1|  PREDICTED: vacuolar protein sorting-associat...  73.9    2e-12   
ref|XP_009610483.1|  PREDICTED: vacuolar protein sorting-associat...  73.9    2e-12   
gb|AFK39612.1|  unknown                                               73.9    2e-12   
ref|XP_009398754.1|  PREDICTED: vacuolar protein sorting-associat...  73.9    2e-12   
ref|XP_004251182.1|  PREDICTED: vacuolar protein sorting-associat...  73.9    2e-12   
ref|XP_006381690.1|  hypothetical protein POPTR_0006s15890g           72.8    2e-12   
gb|KHG25044.1|  VPS32.2: Vacuolar protein sorting-associated prot...  73.6    2e-12   
ref|XP_003563642.1|  PREDICTED: vacuolar protein sorting-associat...  73.9    2e-12   
ref|XP_008782995.1|  PREDICTED: vacuolar protein sorting-associat...  73.2    2e-12   
ref|XP_008803193.1|  PREDICTED: vacuolar protein sorting-associat...  73.9    2e-12   
ref|XP_006284502.1|  hypothetical protein CARUB_v10005703mg           73.9    3e-12   
gb|KHG00434.1|  Vacuolar sorting-associated protein 32 -like protein  73.9    3e-12   
gb|ACJ83886.1|  unknown                                               73.9    3e-12   Medicago truncatula
ref|XP_009399850.1|  PREDICTED: vacuolar protein sorting-associat...  73.9    3e-12   
ref|XP_006412871.1|  hypothetical protein EUTSA_v10026202mg           73.9    3e-12   
ref|XP_010433129.1|  PREDICTED: vacuolar protein sorting-associat...  73.9    3e-12   
ref|XP_002883967.1|  hypothetical protein ARALYDRAFT_343220           73.2    3e-12   
ref|XP_003630667.1|  Vacuolar protein sorting-associated protein-...  73.9    3e-12   
emb|CDY47783.1|  BnaC07g41770D                                        73.6    3e-12   
ref|XP_009137831.1|  PREDICTED: vacuolar protein sorting-associat...  73.6    3e-12   
gb|ADE77819.1|  unknown                                               73.6    3e-12   
gb|EYU20388.1|  hypothetical protein MIMGU_mgv1a013694mg              73.6    3e-12   
ref|XP_010548688.1|  PREDICTED: vacuolar protein sorting-associat...  73.6    3e-12   
ref|XP_010540987.1|  PREDICTED: vacuolar protein sorting-associat...  73.6    3e-12   
ref|XP_010942547.1|  PREDICTED: vacuolar protein sorting-associat...  73.6    3e-12   
ref|XP_010447884.1|  PREDICTED: vacuolar protein sorting-associat...  73.6    3e-12   
ref|XP_011094781.1|  PREDICTED: vacuolar protein sorting-associat...  73.6    3e-12   
emb|CDY06832.1|  BnaC01g09310D                                        73.6    3e-12   
ref|XP_010489126.1|  PREDICTED: vacuolar protein sorting-associat...  73.6    4e-12   
ref|XP_010416624.1|  PREDICTED: vacuolar protein sorting-associat...  73.6    4e-12   
ref|XP_010467924.1|  PREDICTED: vacuolar protein sorting-associat...  73.2    4e-12   
ref|NP_179573.1|  vacuolar protein sorting-associated protein 32-1    73.2    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002281551.1|  PREDICTED: vacuolar protein sorting-associat...  73.2    4e-12   Vitis vinifera
gb|KHG10442.1|  Uncharacterized protein F383_09141                    73.2    4e-12   
ref|XP_009112635.1|  PREDICTED: vacuolar protein sorting-associat...  73.2    4e-12   
emb|CDY48731.1|  BnaA09g10060D                                        73.2    4e-12   
ref|XP_006408902.1|  hypothetical protein EUTSA_v10002096mg           73.2    5e-12   
ref|XP_009394690.1|  PREDICTED: vacuolar protein sorting-associat...  73.2    5e-12   
ref|XP_009361474.1|  PREDICTED: vacuolar protein sorting-associat...  73.2    5e-12   
ref|XP_007227580.1|  hypothetical protein PRUPE_ppa011190mg           72.0    5e-12   
emb|CDY03333.1|  BnaC09g10150D                                        72.8    5e-12   
ref|XP_006583569.1|  PREDICTED: vacuolar protein sorting-associat...  72.8    7e-12   
ref|XP_007227579.1|  hypothetical protein PRUPE_ppa011190mg           72.8    7e-12   
ref|XP_008377929.1|  PREDICTED: vacuolar protein sorting-associat...  72.8    7e-12   
ref|XP_010942907.1|  PREDICTED: vacuolar protein sorting-associat...  72.8    7e-12   
ref|XP_010438334.1|  PREDICTED: vacuolar protein sorting-associat...  72.8    7e-12   
ref|XP_004158431.1|  PREDICTED: vacuolar protein sorting-associat...  72.0    7e-12   
ref|XP_009337137.1|  PREDICTED: vacuolar protein sorting-associat...  72.8    7e-12   
ref|XP_008393670.1|  PREDICTED: vacuolar protein sorting-associat...  72.4    8e-12   
ref|XP_009128967.1|  PREDICTED: vacuolar protein sorting-associat...  72.4    9e-12   
ref|XP_008450809.1|  PREDICTED: vacuolar protein sorting-associat...  72.4    9e-12   
ref|XP_004135686.1|  PREDICTED: vacuolar protein sorting-associat...  72.4    9e-12   
ref|XP_006371957.1|  SNF7 family protein                              72.0    9e-12   
ref|NP_974635.1|  vacuolar protein sorting-associated protein 32-2    72.0    9e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ85894.1|  unknown                                               72.0    1e-11   Medicago truncatula
gb|ACJ86115.1|  unknown                                               72.0    1e-11   Medicago truncatula
gb|ACU23713.1|  unknown                                               71.2    1e-11   Glycine max [soybeans]
ref|XP_009784949.1|  PREDICTED: vacuolar protein sorting-associat...  72.0    1e-11   
ref|XP_006298305.1|  hypothetical protein CARUB_v10014370mg           72.8    1e-11   
ref|XP_006584796.1|  PREDICTED: vacuolar protein sorting-associat...  72.0    1e-11   
ref|XP_009586832.1|  PREDICTED: vacuolar protein sorting-associat...  72.0    1e-11   
ref|XP_008220429.1|  PREDICTED: vacuolar protein sorting-associat...  72.0    1e-11   
ref|NP_194645.1|  vacuolar protein sorting-associated protein 32-2    71.6    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAM66053.1|  copia-like retroelement pol polyprotein               71.6    1e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CBI35999.3|  unnamed protein product                              71.6    2e-11   
gb|KHN40351.1|  Vacuolar protein sorting-associated protein 32 li...  71.6    2e-11   
ref|XP_004291010.1|  PREDICTED: vacuolar protein sorting-associat...  71.2    2e-11   
ref|XP_010237993.1|  PREDICTED: vacuolar protein sorting-associat...  72.4    2e-11   
gb|EMS60758.1|  Vacuolar protein sorting-associated protein 32-li...  73.2    3e-11   
gb|EYU27236.1|  hypothetical protein MIMGU_mgv1a019968mg              70.9    3e-11   
gb|AET05142.2|  charged multivesicular body protein                   70.9    3e-11   
dbj|BAJ91819.1|  predicted protein                                    70.1    3e-11   
ref|XP_011008899.1|  PREDICTED: vacuolar protein sorting-associat...  70.5    3e-11   
ref|XP_009395523.1|  PREDICTED: vacuolar protein sorting-associat...  70.5    4e-11   
ref|XP_011014015.1|  PREDICTED: vacuolar protein sorting-associat...  70.5    4e-11   
ref|XP_003630666.1|  Vacuolar protein sorting-associated protein-...  70.9    4e-11   
ref|XP_002466250.1|  hypothetical protein SORBIDRAFT_01g004370        70.1    4e-11   Sorghum bicolor [broomcorn]
ref|XP_001769849.1|  predicted protein                                70.1    4e-11   
ref|NP_001130264.1|  uncharacterized protein LOC100191358             69.7    5e-11   Zea mays [maize]
gb|ACG30556.1|  charged multivesicular body protein 4b                70.1    6e-11   Zea mays [maize]
ref|XP_004969169.1|  PREDICTED: vacuolar protein sorting-associat...  70.1    6e-11   
ref|NP_001241771.1|  charged multivesicular body protein 4b           70.1    6e-11   
ref|XP_002455955.1|  hypothetical protein SORBIDRAFT_03g027900        70.1    6e-11   Sorghum bicolor [broomcorn]
ref|XP_006660479.1|  PREDICTED: vacuolar protein sorting-associat...  70.1    6e-11   
gb|EMS65379.1|  Vacuolar protein sorting-associated protein 32-li...  70.1    6e-11   
ref|NP_001062723.1|  Os09g0267600                                     70.1    6e-11   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK08135.1|  predicted protein                                    70.1    6e-11   
ref|XP_003577910.1|  PREDICTED: vacuolar protein sorting-associat...  70.1    6e-11   
ref|XP_003564850.1|  PREDICTED: vacuolar protein sorting-associat...  70.1    7e-11   
ref|NP_001130288.1|  uncharacterized protein LOC100191382             69.7    7e-11   Zea mays [maize]
ref|NP_001147424.1|  charged multivesicular body protein 4b           69.7    7e-11   Zea mays [maize]
ref|XP_010690124.1|  PREDICTED: vacuolar protein sorting-associat...  69.7    9e-11   
emb|CDY35892.1|  BnaA07g00950D                                        69.3    1e-10   
ref|XP_009102133.1|  PREDICTED: vacuolar protein sorting-associat...  69.3    1e-10   
ref|XP_009396303.1|  PREDICTED: vacuolar protein sorting-associat...  69.3    1e-10   
gb|ABG21860.1|  SNF7 family protein, expressed                        68.2    1e-10   
ref|XP_008673975.1|  PREDICTED: charged multivesicular body prote...  69.7    1e-10   
gb|EAZ08368.1|  hypothetical protein OsI_30625                        71.2    2e-10   Oryza sativa Indica Group [Indian rice]
gb|EEE69315.1|  hypothetical protein OsJ_28603                        71.2    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010931424.1|  PREDICTED: vacuolar protein sorting-associat...  68.9    2e-10   
gb|EYU30671.1|  hypothetical protein MIMGU_mgv1a013622mg              68.6    2e-10   
ref|XP_006842643.1|  hypothetical protein AMTR_s00077p00189740        68.2    3e-10   
ref|XP_010695089.1|  PREDICTED: vacuolar protein sorting-associat...  68.2    3e-10   
gb|EYU29306.1|  hypothetical protein MIMGU_mgv1a014523mg              67.4    4e-10   
ref|XP_007152943.1|  hypothetical protein PHAVU_004G173400g           67.8    4e-10   
ref|XP_010922839.1|  PREDICTED: vacuolar protein sorting-associat...  67.4    4e-10   
ref|XP_008788033.1|  PREDICTED: vacuolar protein sorting-associat...  67.4    5e-10   
ref|XP_010931425.1|  PREDICTED: vacuolar protein sorting-associat...  67.4    5e-10   
gb|EMT15574.1|  Vacuolar protein sorting-associated 32-2-like pro...  67.0    5e-10   
ref|XP_008660967.1|  PREDICTED: uncharacterized protein LOC103640100  69.3    7e-10   
ref|XP_006662688.1|  PREDICTED: vacuolar protein sorting-associat...  65.5    2e-09   
gb|EEC67568.1|  hypothetical protein OsI_34912                        66.2    2e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001065616.1|  Os11g0123500                                     66.2    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066025.2|  Os12g0121400                                     65.5    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663763.1|  PREDICTED: vacuolar protein sorting-associat...  65.5    2e-09   
ref|XP_010049158.1|  PREDICTED: vacuolar protein sorting-associat...  65.1    2e-09   
ref|XP_006662689.1|  PREDICTED: vacuolar protein sorting-associat...  65.5    2e-09   
ref|XP_010049157.1|  PREDICTED: vacuolar protein sorting-associat...  65.5    2e-09   
ref|XP_003579007.1|  PREDICTED: vacuolar protein sorting-associat...  65.5    2e-09   
ref|XP_006662687.1|  PREDICTED: vacuolar protein sorting-associat...  64.7    3e-09   
gb|ACG47769.1|  hypothetical protein                                  62.4    4e-09   Zea mays [maize]
ref|XP_002450174.1|  hypothetical protein SORBIDRAFT_05g001480        65.1    4e-09   Sorghum bicolor [broomcorn]
ref|XP_008804654.1|  PREDICTED: vacuolar protein sorting-associat...  64.7    4e-09   
ref|XP_004978491.1|  PREDICTED: vacuolar protein sorting-associat...  64.7    5e-09   
dbj|BAJ97352.1|  predicted protein                                    64.3    6e-09   
ref|XP_008679351.1|  PREDICTED: vacuolar protein sorting-associat...  64.3    7e-09   
emb|CDX82742.1|  BnaC07g01240D                                        63.9    8e-09   
gb|EMT02888.1|  Vacuolar protein sorting-associated 32-1-like pro...  65.1    9e-09   
gb|EMS66152.1|  Vacuolar protein sorting-associated protein 32-li...  64.7    1e-08   
ref|XP_009767750.1|  PREDICTED: vacuolar protein sorting-associat...  62.4    3e-08   
gb|EPS70822.1|  hypothetical protein M569_03937                       60.1    4e-08   
ref|XP_009620038.1|  PREDICTED: vacuolar protein sorting-associat...  61.6    6e-08   
gb|AFM35785.1|  hypothetical protein                                  58.9    1e-07   
ref|XP_009418535.1|  PREDICTED: vacuolar protein sorting-associat...  60.8    1e-07   
gb|AFW87250.1|  putative SNF domain containing family protein         57.4    2e-07   
gb|KCW44188.1|  hypothetical protein EUGRSUZ_L02392                   58.5    7e-07   
gb|KCW44187.1|  hypothetical protein EUGRSUZ_L02392                   57.0    2e-06   
gb|AFW61107.1|  hypothetical protein ZEAMMB73_096269                  57.0    2e-06   
ref|XP_006837368.1|  hypothetical protein AMTR_s00111p00112330        52.8    8e-05   
ref|XP_010041560.1|  PREDICTED: vacuolar protein sorting-associat...  51.6    2e-04   
ref|XP_008464119.1|  PREDICTED: uncharacterized protein LOC103502...  49.3    4e-04   
ref|XP_008464118.1|  PREDICTED: uncharacterized protein LOC103502...  49.3    4e-04   
ref|XP_008464117.1|  PREDICTED: uncharacterized protein LOC103502...  49.3    4e-04   
ref|XP_010041559.1|  PREDICTED: vacuolar protein sorting-associat...  50.8    4e-04   
ref|XP_008464115.1|  PREDICTED: uncharacterized protein LOC103502...  49.3    4e-04   
gb|KHN40354.1|  Vacuolar protein sorting-associated protein 32 li...  48.9    5e-04   
ref|XP_004297109.1|  PREDICTED: vacuolar protein sorting-associat...  50.1    7e-04   



>emb|CDP03214.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK+E+NA+T+++KLNETLEMLEKKEKVLQKKAS EVEKAKEFTRAKNKR  +
Sbjct  1    MFTRIFGKPKQETNAVTTLDKLNETLEMLEKKEKVLQKKASAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91



>ref|XP_004239323.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Solanum lycopersicum]
Length=218

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFSRIFGKPK+E+NAL +++KLNETLEMLEKKEKVLQKKAS EVEKAK+FTRAKNKR  +
Sbjct  1    MFSRIFGKPKQETNALMTLDKLNETLEMLEKKEKVLQKKASTEVEKAKDFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91



>ref|XP_007202552.1| hypothetical protein PRUPE_ppa011232mg [Prunus persica]
 ref|XP_007202553.1| hypothetical protein PRUPE_ppa011232mg [Prunus persica]
 gb|EMJ03751.1| hypothetical protein PRUPE_ppa011232mg [Prunus persica]
 gb|EMJ03752.1| hypothetical protein PRUPE_ppa011232mg [Prunus persica]
Length=218

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E NALT+++KLNETLEMLEKKEKVLQKKA+ EVE+AKEFTRAKNKR  +
Sbjct  1    MFTRLFGKPKQEGNALTTLDKLNETLEMLEKKEKVLQKKAAAEVERAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91



>ref|XP_008242449.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Prunus mume]
Length=218

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E NALT+++KLNETLEMLEKKEKVLQKKA+ EVE+AKEFTRAKNKR  +
Sbjct  1    MFTRLFGKPKQEGNALTTLDKLNETLEMLEKKEKVLQKKAAAEVERAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91



>ref|XP_009765362.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nicotiana sylvestris]
Length=218

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFS+IFGKPK+E+NAL +++KLNETLEMLEKKEKVLQKKAS EVEKAK+FTRAKNKR  +
Sbjct  1    MFSKIFGKPKQETNALATLDKLNETLEMLEKKEKVLQKKASAEVEKAKDFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91



>ref|XP_009593196.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nicotiana tomentosiformis]
 ref|XP_009593197.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nicotiana tomentosiformis]
Length=218

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFS+IFGKPK+E+NAL +++KLNETLEMLEKKEKVLQKKAS EVEKAK+FTRAKNKR  +
Sbjct  1    MFSKIFGKPKQETNALATLDKLNETLEMLEKKEKVLQKKASAEVEKAKDFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91



>ref|XP_006338191.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum tuberosum]
Length=218

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFSR+FGKPK+E+NAL +++KLNETLEMLEKKEKVLQKKAS EVEKAK+FTRAKNKR  +
Sbjct  1    MFSRMFGKPKQETNALMTLDKLNETLEMLEKKEKVLQKKASTEVEKAKDFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91



>ref|XP_010042633.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like, partial [Eucalyptus grandis]
Length=86

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NALT+++KLNETLEMLEKKEKVL KKAS EVEKAKEFTRAKNKR  +
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLIKKASQEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/29 (100%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQ  870
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQ
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQ  86



>ref|XP_008387512.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
Length=218

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKP++E++ALT+++KLNETLEMLEKKEKVLQKKA+ EV++AK+FTRAKNKR  +
Sbjct  1    MFTRIFGKPRQENSALTTLDKLNETLEMLEKKEKVLQKKAAGEVDRAKDFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91



>ref|XP_009352595.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
 ref|XP_009352596.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
Length=221

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK+E++ALT+++KLNETLEMLEKKEKVLQKKA+ EV++AK+FT+AKNKR  +
Sbjct  4    MFTRIFGKPKQENSALTTLDKLNETLEMLEKKEKVLQKKAAAEVDRAKDFTKAKNKRAAI  63

Query  542  DCI  550
             C+
Sbjct  64   QCL  66


 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  61   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  94



>ref|XP_004287507.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Fragaria vesca subsp. vesca]
Length=218

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK E++ALT+++KLNETLEMLEKKEKVLQKKA+ EVE+AKEFTRAKNKR  +
Sbjct  1    MFTRIFGKPKTETSALTTLDKLNETLEMLEKKEKVLQKKAAAEVERAKEFTRAKNKRSAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            +AIQCLKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   SAIQCLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  91



>ref|XP_010086896.1| Vacuolar protein sorting-associated protein 32-2-like protein 
[Morus notabilis]
 gb|EXB24687.1| Vacuolar protein sorting-associated protein 32-2-like protein 
[Morus notabilis]
Length=283

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK+E+NAL +++KLNETLEMLEKKEKVLQKKAS EVE+AKEFTRAKNK+  +
Sbjct  66   MFTRIFGKPKQETNALATLDKLNETLEMLEKKEKVLQKKASAEVERAKEFTRAKNKKAAI  125

Query  542  DCI  550
             C+
Sbjct  126  QCL  128


 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  123  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  156



>gb|ABK25790.1| unknown [Picea sitchensis]
Length=108

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFSR+FG+PKEE+N +++++KLNETLEMLEKKEKVLQKK   EVEKA++FTRAKNK+  +
Sbjct  2    MFSRLFGRPKEEANPISTLDKLNETLEMLEKKEKVLQKKIQAEVEKARDFTRAKNKKAAI  61

Query  542  DCI  550
             C+
Sbjct  62   QCL  64


 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYE QIEQLGN+QLRIHDQMIMLE
Sbjct  59   AAIQCLKRKRLYEVQIEQLGNYQLRIHDQMIMLE  92



>ref|XP_010244367.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nelumbo nucifera]
 ref|XP_010244368.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nelumbo nucifera]
Length=218

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK+E+NAL +++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTRAKNKR  +
Sbjct  1    MFTRIFGKPKQETNALATLDKLNETLEMLEKKEKVLIKKAASEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91



>gb|ABK23499.1| unknown [Picea sitchensis]
Length=155

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFSR+FG+PKEE+N +++++KLNETLEMLEKKEKVLQKK   EVEKA++FTRAKNK+  +
Sbjct  2    MFSRLFGRPKEEANPISTLDKLNETLEMLEKKEKVLQKKIQAEVEKARDFTRAKNKKAAI  61

Query  542  DCI  550
             C+
Sbjct  62   QCL  64


 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYE QIEQLGN+QLRIHDQMIMLE
Sbjct  59   AAIQCLKRKRLYEVQIEQLGNYQLRIHDQMIMLE  92



>ref|XP_008812733.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Phoenix dactylifera]
Length=218

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFSRIFGKPKE++NAL +++KLNETLEMLEKKE+VL KK + EVEKAKEFTRAKNKR  +
Sbjct  1    MFSRIFGKPKEQANALATLDKLNETLEMLEKKERVLLKKVAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91



>ref|XP_008337624.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
 ref|XP_008337625.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
 ref|XP_008337626.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
Length=221

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK+E++ALT+++KLNETLEMLEKKEKVLQKKA+ EV++AK+FT+AKNK+  +
Sbjct  4    MFTRIFGKPKQENSALTTLDKLNETLEMLEKKEKVLQKKAAAEVDRAKDFTKAKNKKAAI  63

Query  542  DCI  550
             C+
Sbjct  64   QCL  66


 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  61   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  94



>ref|XP_010047627.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Eucalyptus grandis]
 gb|KCW79566.1| hypothetical protein EUGRSUZ_C00934 [Eucalyptus grandis]
 gb|KCW79567.1| hypothetical protein EUGRSUZ_C00934 [Eucalyptus grandis]
Length=219

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NALT+++KLNETLEMLEKKEKVL KKAS EVEKAKEFTRAKNKR  +
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLIKKASQEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91



>gb|ABK25827.1| unknown [Picea sitchensis]
 gb|ACN40190.1| unknown [Picea sitchensis]
 gb|ACN40855.1| unknown [Picea sitchensis]
Length=217

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFSR+FG+PKEE+N +++++KLNETLEMLEKKEKVLQKK   EVEKA++FTRAKNK+  +
Sbjct  2    MFSRLFGRPKEEANPISTLDKLNETLEMLEKKEKVLQKKIQAEVEKARDFTRAKNKKAAI  61

Query  542  DCI  550
             C+
Sbjct  62   QCL  64


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYE QIEQLGN+QLRIHDQMIMLE
Sbjct  59   AAIQCLKRKRLYEVQIEQLGNYQLRIHDQMIMLE  92



>gb|KDP33761.1| hypothetical protein JCGZ_07332 [Jatropha curcas]
Length=218

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NALT+++KLNETLEMLEKKEKVL KKA+ EVEKA+EFTRA+NKR  +
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLIKKAAAEVEKAREFTRARNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91



>ref|XP_002275998.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 emb|CAN68229.1| hypothetical protein VITISV_026042 [Vitis vinifera]
 emb|CBI20606.3| unnamed protein product [Vitis vinifera]
Length=216

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NALT+++KLNETLEMLEKKE VL KKA+ EVEKAKEFTRAKNKR  +
Sbjct  1    MFTRLFGKPKQEANALTTLDKLNETLEMLEKKEGVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLE  91



>ref|XP_002514179.1| Charged multivesicular body protein 4b, putative [Ricinus communis]
 gb|EEF48133.1| Charged multivesicular body protein 4b, putative [Ricinus communis]
Length=218

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NALT+++KLNETLEMLEKKEKVL KKA  EVE+AKEFTR KNKR  +
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLSKKAIAEVERAKEFTRTKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91



>ref|XP_010929019.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Elaeis guineensis]
Length=221

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFSRIFGKPKE++NAL +++KLNETLE+LEK+EKVL KK + EVE+AKEFTRAKNKR  +
Sbjct  4    MFSRIFGKPKEQTNALATLDKLNETLELLEKREKVLLKKVAAEVERAKEFTRAKNKRAAI  63

Query  542  DCI  550
             C+
Sbjct  64   QCL  66


 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLK+KR+YEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  61   AAIQCLKKKRIYEQQVEQLGNFQLRIHDQMIMLE  94



>gb|AFK48250.1| unknown [Lotus japonicus]
Length=218

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK+E+NAL +++KLNETL+MLEKKEKVL KKAS EVEKAK+FT+AKNKR  +
Sbjct  1    MFTRIFGKPKQEANALATLDKLNETLDMLEKKEKVLIKKASQEVEKAKDFTKAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91



>ref|XP_011077951.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Sesamum indicum]
Length=218

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RI GKPK+E+NAL +++KLNETLEMLEKKE VLQKKAS EVEKAK +T+AKNKR  +
Sbjct  1    MFARILGKPKQETNALATLDKLNETLEMLEKKESVLQKKASGEVEKAKAYTKAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRK+LYE+QI QL NFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKKLYEEQIGQLANFQLRIHDQMIMLE  91



>ref|XP_010267087.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nelumbo nucifera]
Length=218

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NAL +++KLNETLEMLEKKE VL KKA+ EVEKAKEFTRAKNKR  +
Sbjct  1    MFTRLFGKPKQETNALETLDKLNETLEMLEKKENVLLKKAASEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  91



>emb|CDY48599.1| BnaA01g07660D [Brassica napus]
Length=1014

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            +AIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   SAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            M +R+FGKPK E NAL +++KLNETLEMLEKKEKVL KKA  EVEKAKE+TRAKNKR  +
Sbjct  1    MMNRLFGKPKHEGNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRAKNKRSAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_006853757.1| hypothetical protein AMTR_s00056p00189660 [Amborella trichopoda]
 gb|ERN15224.1| hypothetical protein AMTR_s00056p00189660 [Amborella trichopoda]
Length=117

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+++FGKPK+++  L +++KLNETLEMLEKKEKVLQKK + EVEKAKEFTRAKNKR  +
Sbjct  1    MFNKLFGKPKQDTTPLATLDKLNETLEMLEKKEKVLQKKVAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYE Q+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEAQVEQLGNFQLRIHDQMIMLE  91



>ref|XP_006580488.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X3 [Glycine max]
Length=191

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  31   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  64



>ref|XP_004513085.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Cicer arietinum]
Length=219

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  59   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  92


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +2

Query  362  MFSRIFGKPKEE-SNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            MFSR+FGKPK+E SNA+ +++KLNETLEMLEKKEKVL KKA  EVEKAKEFT+ KNK+  
Sbjct  1    MFSRVFGKPKQETSNAVATLDKLNETLEMLEKKEKVLLKKAGAEVEKAKEFTKGKNKKAA  60

Query  539  LDCI  550
            + C+
Sbjct  61   IQCL  64



>ref|XP_002437263.1| hypothetical protein SORBIDRAFT_10g023830 [Sorghum bicolor]
 gb|EER88630.1| hypothetical protein SORBIDRAFT_10g023830 [Sorghum bicolor]
Length=224

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  63   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  96


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            +F R+FGK K +S A  L S++KLNETLEMLEKKE +L KKA++EVEKAK FT+AKNKR 
Sbjct  4    VFGRVFGKSKAQSQATALASLDKLNETLEMLEKKENLLVKKANLEVEKAKNFTKAKNKRA  63

Query  536  LLDCI  550
             + C+
Sbjct  64   AIQCL  68



>ref|XP_004141038.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Cucumis sativus]
 ref|XP_004157906.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Cucumis sativus]
 gb|KGN60554.1| hypothetical protein Csa_2G000620 [Cucumis sativus]
Length=218

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NAL ++EKL+ETLEMLEKKE VL KKA+ EVE+AKEFTR KNKR  +
Sbjct  1    MFNRLFGKPKQEANALATLEKLSETLEMLEKKENVLVKKAAAEVERAKEFTRGKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91



>ref|XP_006451365.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
 gb|ESR64605.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
Length=200

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  39   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  72



>ref|XP_007152939.1| hypothetical protein PHAVU_004G173000g [Phaseolus vulgaris]
 gb|ESW24933.1| hypothetical protein PHAVU_004G173000g [Phaseolus vulgaris]
Length=218

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFSR+FGKPK+E+NA+ +++KLNETLEMLEKKEKVL KK S EVEKAKEFTR KNKR  +
Sbjct  1    MFSRMFGKPKQETNAVATLDKLNETLEMLEKKEKVLLKKVSAEVEKAKEFTRGKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|NP_001152491.1| charged multivesicular body protein 4b [Zea mays]
 gb|ACG47853.1| charged multivesicular body protein 4b [Zea mays]
 gb|AFW87249.1| putative SNF domain containing family protein [Zea mays]
Length=226

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  63   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  96


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            +F R+FGK KE+S A  L S++KLNETLEMLEKKE +L KKA++EVEKAK FT+AKNKR 
Sbjct  4    VFGRVFGKSKEQSQATALASLDKLNETLEMLEKKENLLVKKANLEVEKAKNFTKAKNKRA  63

Query  536  LLDCI  550
             + C+
Sbjct  64   AIQCL  68



>ref|XP_008459153.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Cucumis melo]
 ref|XP_008459161.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Cucumis melo]
 ref|XP_008459166.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Cucumis melo]
Length=218

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NAL ++EKL+ETLEMLEKKE VL KKA+ EVE+AKEFTR KNKR  +
Sbjct  1    MFNRLFGKPKQEANALATLEKLSETLEMLEKKENVLVKKAAAEVERAKEFTRVKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_007160256.1| hypothetical protein PHAVU_002G305900g [Phaseolus vulgaris]
 ref|XP_007160257.1| hypothetical protein PHAVU_002G305900g [Phaseolus vulgaris]
 gb|ESW32250.1| hypothetical protein PHAVU_002G305900g [Phaseolus vulgaris]
 gb|ESW32251.1| hypothetical protein PHAVU_002G305900g [Phaseolus vulgaris]
Length=218

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK+E+N LT+++KLNETLEMLEKKEKVL KKA+ EVE+AK+FTRAKNKR  +
Sbjct  1    MFTRIFGKPKQEANTLTTLDKLNETLEMLEKKEKVLLKKAAAEVERAKDFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_004503518.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Cicer arietinum]
 ref|XP_004503519.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Cicer arietinum]
 ref|XP_004503520.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X3 [Cicer arietinum]
 ref|XP_004503521.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X4 [Cicer arietinum]
Length=218

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK+E+NALT+++KLNETLEMLEKKEKVL KK++ EVEKAKEFTRAKNKR  +
Sbjct  1    MFTRIFGKPKQEANALTTLDKLNETLEMLEKKEKVLLKKSAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_006371958.1| hypothetical protein POPTR_0018s06680g [Populus trichocarpa]
 gb|ERP49755.1| hypothetical protein POPTR_0018s06680g [Populus trichocarpa]
Length=215

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK ES+ALTS++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTR KNKR  +
Sbjct  1    MFNRLFGKPKLESSALTSLDKLNETLEMLEKKEKVLVKKAAAEVEKAKEFTRGKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_006451366.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
 ref|XP_006451367.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
 ref|XP_006475370.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Citrus sinensis]
 gb|ESR64606.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
 gb|ESR64607.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
 gb|KDO55910.1| hypothetical protein CISIN_1g027751mg [Citrus sinensis]
 gb|KDO55911.1| hypothetical protein CISIN_1g027751mg [Citrus sinensis]
 gb|KDO55912.1| hypothetical protein CISIN_1g027751mg [Citrus sinensis]
 gb|KDO55913.1| hypothetical protein CISIN_1g027751mg [Citrus sinensis]
 gb|KDO55914.1| hypothetical protein CISIN_1g027751mg [Citrus sinensis]
Length=219

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 37/42 (88%), Gaps = 4/42 (10%)
 Frame = +1

Query  772  YSLA----AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            YS A    AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  50   YSKAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NALT+++KLNETLEMLEKKEKVL KKASVEVEKAK++++AKNKR  +
Sbjct  1    MFTRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLLKKASVEVEKAKDYSKAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>gb|AFK38664.1| unknown [Medicago truncatula]
 gb|KEH27240.1| charged multivesicular body protein [Medicago truncatula]
Length=220

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  60   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  93


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 55/65 (85%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEE--SNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            MF+R+FGKPK++  SNAL +++KLNETLEMLEKKE VL KKA+ EVEKAKE+T+ KNK+ 
Sbjct  1    MFTRVFGKPKQDTSSNALATLDKLNETLEMLEKKENVLLKKAAAEVEKAKEYTKRKNKKA  60

Query  536  LLDCI  550
             + C+
Sbjct  61   AIQCL  65



>ref|XP_004503516.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Cicer arietinum]
 ref|XP_004503517.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Cicer arietinum]
Length=218

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFSRIFGKPK+E+N LT+++KLNETLEMLEKKEKVL KKA  EVEKAKEFTRAKNKR  +
Sbjct  1    MFSRIFGKPKQEANTLTTLDKLNETLEMLEKKEKVLLKKAGAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_003525301.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoformX2 [Glycine max]
 gb|KHM99831.1| Vacuolar protein sorting-associated protein 32 like 1 [Glycine 
soja]
Length=218

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK E N LT++++LN+ LEMLEKKEKVL KKA+ EVEKAKEFTRAKNKR  +
Sbjct  1    MFTRIFGKPKPEVNTLTALDELNDKLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_010526425.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
 ref|XP_010526426.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
 ref|XP_010526428.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
 ref|XP_010526429.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
 ref|XP_010526430.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
Length=220

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  59   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  92


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +2

Query  362  MF-SRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            MF +R+FGKPK ESNAL +++KLNETLEMLEKKEKVL KKAS EVEKAKEFTR KNKR  
Sbjct  1    MFVNRLFGKPKPESNALQTLDKLNETLEMLEKKEKVLLKKASAEVEKAKEFTRLKNKRAA  60

Query  539  LDCI  550
            + C+
Sbjct  61   IQCL  64



>ref|XP_006572922.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Glycine max]
 ref|XP_006572923.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Glycine max]
 gb|KHN32901.1| Vacuolar protein sorting-associated protein 32 like 2 [Glycine 
soja]
Length=218

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFSR+FGKPK+E+NA+ +++KLNETLEMLEKKEKVL KK + EVEKAKEFTR KNKR  +
Sbjct  1    MFSRMFGKPKQETNAVATLDKLNETLEMLEKKEKVLLKKVAAEVEKAKEFTRGKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>gb|AFK45318.1| unknown [Lotus japonicus]
Length=218

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK+E+NALT+ +KLNETLEMLEKKEKVL KKAS EVEKAKEFTRAKNKR  +
Sbjct  1    MFTRIFGKPKQEANALTTFDKLNETLEMLEKKEKVLLKKASAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>gb|EMT22613.1| Vacuolar protein sorting-associated 32-1-like protein [Aegilops 
tauschii]
Length=222

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  63   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  96


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = +2

Query  365  FSRIFGKPKEES--NALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            F R+FGK KE+S  +AL SI+KL+ETLEMLEKKE +L KKA++EVEKAK FT+AKNK+  
Sbjct  5    FGRVFGKSKEQSQASALASIDKLSETLEMLEKKENLLMKKANLEVEKAKAFTKAKNKKAA  64

Query  539  LDCI  550
            + C+
Sbjct  65   IQCL  68



>dbj|BAJ86054.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=222

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  63   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  96


 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 54/65 (83%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEES--NALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            +F R+FGK KE+S  +AL SI+KL+ETLEMLEKKE +L KKA++EVEKAK FT+AKNK+ 
Sbjct  4    VFGRVFGKSKEQSQASALASIDKLSETLEMLEKKENLLMKKANLEVEKAKAFTKAKNKKA  63

Query  536  LLDCI  550
             + C+
Sbjct  64   AIQCL  68



>ref|XP_004965917.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Setaria italica]
Length=224

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  63   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  96


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 53/65 (82%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            +F ++FGK K++S A  L S++KLNETLEMLEKKE +L KKA++EVEKAK FT+AKNKR 
Sbjct  4    VFGKVFGKSKQQSQATALASLDKLNETLEMLEKKENLLVKKANLEVEKAKNFTKAKNKRA  63

Query  536  LLDCI  550
             + C+
Sbjct  64   AIQCL  68



>ref|XP_007012940.1| Vacuolar protein sorting-associated protein 32 isoform 1 [Theobroma 
cacao]
 ref|XP_007012941.1| Vacuolar protein sorting-associated protein 32 isoform 1 [Theobroma 
cacao]
 gb|EOY30559.1| Vacuolar protein sorting-associated protein 32 isoform 1 [Theobroma 
cacao]
 gb|EOY30560.1| Vacuolar protein sorting-associated protein 32 isoform 1 [Theobroma 
cacao]
Length=218

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NALT+++KLNETLEMLEKKEKVL KKA+ EVEKAKEF + +NKR  +
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLVKKAAAEVEKAKEFAKGRNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>dbj|BAJ98801.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=222

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  63   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  96


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 54/65 (83%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEES--NALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            +F R+FGK KE+S  +AL SI+KL+ETLEMLEKK+ +L KKA++EVEKAK FT+AKNK+ 
Sbjct  4    VFGRVFGKSKEQSQASALASIDKLSETLEMLEKKKNLLMKKANLEVEKAKAFTKAKNKKA  63

Query  536  LLDCI  550
             + C+
Sbjct  64   AIQCL  68



>ref|NP_001058040.1| Os06g0608500 [Oryza sativa Japonica Group]
 dbj|BAD35619.1| SNF7 protein-like [Oryza sativa Japonica Group]
 dbj|BAF19954.1| Os06g0608500 [Oryza sativa Japonica Group]
 gb|EAZ01625.1| hypothetical protein OsI_23660 [Oryza sativa Indica Group]
 gb|EAZ37600.1| hypothetical protein OsJ_21933 [Oryza sativa Japonica Group]
 dbj|BAG92085.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87318.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACN85161.1| charged multivesicular body protein 4b [Oryza nivara]
Length=220

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  63   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  96


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            +F ++FGK K +S A  L SI+KL+ETLEMLEKKE +L KKA++EVEKAK FT+AKNKR 
Sbjct  4    VFGKVFGKSKAQSQATALASIDKLSETLEMLEKKENLLVKKANLEVEKAKTFTKAKNKRA  63

Query  536  LLDCI  550
             + C+
Sbjct  64   AIQCL  68



>ref|XP_006656230.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Oryza brachyantha]
 gb|ACN85311.1| charged multivesicular body protein 4b [Oryza brachyantha]
Length=221

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  63   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  96


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            +F ++FGK K +S A  L SI+KL+ETLEMLEKKE +L KKA++EVEKAK FT+AKNKR 
Sbjct  4    VFGKVFGKSKAQSQATALASIDKLSETLEMLEKKENLLVKKANLEVEKAKGFTKAKNKRA  63

Query  536  LLDCI  550
             + C+
Sbjct  64   AIQCL  68



>ref|XP_002283066.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 emb|CAN61998.1| hypothetical protein VITISV_007873 [Vitis vinifera]
 emb|CBI27961.3| unnamed protein product [Vitis vinifera]
Length=218

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK+E+NALT+++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTRAKNKR  +
Sbjct  1    MFTRIFGKPKQEANALTTLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_011016035.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Populus euphratica]
Length=215

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NALT+++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTR KNKR  +
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRGKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_006381691.1| hypothetical protein POPTR_0006s15890g [Populus trichocarpa]
 ref|XP_006381692.1| hypothetical protein POPTR_0006s15890g [Populus trichocarpa]
 gb|ERP59488.1| hypothetical protein POPTR_0006s15890g [Populus trichocarpa]
 gb|ERP59489.1| hypothetical protein POPTR_0006s15890g [Populus trichocarpa]
Length=212

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NALT+++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTR KNKR  +
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRGKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_006355308.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum tuberosum]
Length=216

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NAL +++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTRAKNKR  +
Sbjct  1    MFTRMFGKPKQETNALATLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_011093673.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Sesamum indicum]
Length=218

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            M +R+ GKPK+E+NAL +++KLNETLEMLEKKE VLQKKAS EVEKAKE+T+AKNKR  +
Sbjct  1    MIARLLGKPKQEANALATLDKLNETLEMLEKKEGVLQKKASAEVEKAKEYTKAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYE+QI QL NFQLRIHDQ+IMLE
Sbjct  58   AAIQCLKRKRLYEEQIGQLANFQLRIHDQVIMLE  91



>gb|KHG25043.1| VPS32.2: Vacuolar protein sorting-associated protein 32 2 [Gossypium 
arboreum]
Length=218

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NALT+++KLNETLEMLEKKEKVL KKA+ EVEKAKEF + +NKR  +
Sbjct  1    MFNRLFGKPKQEANALTTLDKLNETLEMLEKKEKVLVKKAAAEVEKAKEFAKGRNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_004245128.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Solanum lycopersicum]
Length=216

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NAL +++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTRAKNKR  +
Sbjct  1    MFTRMFGKPKQETNALATLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>gb|ACN85265.1| charged multivesicular body protein 4b [Oryza alta]
Length=220

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  63   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  96


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            +F ++FGK K +S A  L SI+KL+ETLEMLEKKE +L KKA++EVEKAK FT+AKNKR 
Sbjct  4    VFGKVFGKSKAQSQATALASIDKLSETLEMLEKKENLLVKKANLEVEKAKGFTKAKNKRA  63

Query  536  LLDCI  550
             + C+
Sbjct  64   AIQCL  68



>ref|XP_006340250.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum tuberosum]
Length=218

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF R+ GKPK+E+NAL +++KLNETLEMLEKKE VL KKA+ EVE+AKEFTRAKNKR  +
Sbjct  1    MFKRLLGKPKQETNALATLDKLNETLEMLEKKESVLLKKATAEVERAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMI+LE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMILLE  91



>ref|XP_011081721.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Sesamum indicum]
Length=214

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK+E++AL +++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTRAKNKR  +
Sbjct  1    MFTRIFGKPKQETSALATLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_009800252.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana sylvestris]
 ref|XP_009800253.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana sylvestris]
Length=216

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF R+FGKPK+E+NAL +++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTRAKNKR  +
Sbjct  1    MFPRLFGKPKQETNALATLDKLNETLEMLEKKEKVLLKKAAGEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_009610483.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana tomentosiformis]
 ref|XP_009610484.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana tomentosiformis]
 ref|XP_009610485.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana tomentosiformis]
Length=216

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF R+FGKPK+E+NAL +++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTRAKNKR  +
Sbjct  1    MFPRLFGKPKQETNALATLDKLNETLEMLEKKEKVLLKKAAGEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>gb|AFK39612.1| unknown [Medicago truncatula]
 gb|AET05143.2| charged multivesicular body protein [Medicago truncatula]
Length=222

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  64   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  97


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 54/65 (83%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKE--ESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            MFS++FGK K+  ++N L+++EKLNETL MLEKKE VL KKA+ EVE+AKEFTRAKNKR 
Sbjct  5    MFSKLFGKTKQDQQANTLSTLEKLNETLGMLEKKESVLLKKAAAEVERAKEFTRAKNKRA  64

Query  536  LLDCI  550
             + C+
Sbjct  65   AIQCL  69



>ref|XP_009398754.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Musa acuminata subsp. malaccensis]
 ref|XP_009398755.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Musa acuminata subsp. malaccensis]
 ref|XP_009398756.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Musa acuminata subsp. malaccensis]
 ref|XP_009398757.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Musa acuminata subsp. malaccensis]
Length=218

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFSR+FGKPKE++NA+ +++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTRAKNKR  +
Sbjct  1    MFSRLFGKPKEQTNAVATLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_004251182.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum lycopersicum]
 ref|XP_010313446.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum lycopersicum]
 ref|XP_010313447.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum lycopersicum]
Length=218

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF R+ GKPK+E+NAL +++KLNETLEMLEKKE VL KKA+ EVE+AKEFTRAKNKR  +
Sbjct  1    MFKRLLGKPKQETNALATLDKLNETLEMLEKKESVLLKKATAEVERAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMI+LE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMILLE  91



>ref|XP_006381690.1| hypothetical protein POPTR_0006s15890g [Populus trichocarpa]
 gb|ERP59487.1| hypothetical protein POPTR_0006s15890g [Populus trichocarpa]
Length=160

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NALT+++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTR KNKR  +
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRGKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>gb|KHG25044.1| VPS32.2: Vacuolar protein sorting-associated protein 32 2 [Gossypium 
arboreum]
Length=203

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NALT+++KLNETLEMLEKKEKVL KKA+ EVEKAKEF + +NKR  +
Sbjct  1    MFNRLFGKPKQEANALTTLDKLNETLEMLEKKEKVLVKKAAAEVEKAKEFAKGRNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_003563642.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
 ref|XP_010227519.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
 ref|XP_010227520.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
 ref|XP_010227521.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
 ref|XP_010227522.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
Length=222

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  63   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  96


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 54/65 (83%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEES--NALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            +F R+FGK KE+S  +AL SI+KL+ETLEMLEKKE +L KKA++EVEKAK FT+AKNK+ 
Sbjct  4    VFGRVFGKSKEQSQASALASIDKLSETLEMLEKKENLLMKKANLEVEKAKAFTKAKNKKA  63

Query  536  LLDCI  550
             + C+
Sbjct  64   AIQCL  68



>ref|XP_008782995.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
Length=171

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  769  FYSLAAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            F  + AAIQCLKRKRLYEQQ+EQLGNFQLR+HDQMIMLE
Sbjct  6    FVFMLAAIQCLKRKRLYEQQVEQLGNFQLRLHDQMIMLE  44



>ref|XP_008803193.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
 ref|XP_008803194.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
 ref|XP_008803195.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
 ref|XP_008803197.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
Length=219

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPKE++NALT+++KL+ETLEMLEKKEKVL+KK + EVEKAKEFTRAKNKR  +
Sbjct  1    MFNRLFGKPKEQANALTTLDKLHETLEMLEKKEKVLEKKVAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_006284502.1| hypothetical protein CARUB_v10005703mg [Capsella rubella]
 ref|XP_006284503.1| hypothetical protein CARUB_v10005703mg [Capsella rubella]
 gb|EOA17400.1| hypothetical protein CARUB_v10005703mg [Capsella rubella]
 gb|EOA17401.1| hypothetical protein CARUB_v10005703mg [Capsella rubella]
Length=218

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            M +R+FGKPK+ESNAL +++KLNETLEMLEKKEKVL KKA  EVEKAKE++R+KNKR  +
Sbjct  1    MMNRLFGKPKQESNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYSRSKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>gb|KHG00434.1| Vacuolar sorting-associated protein 32 -like protein [Gossypium 
arboreum]
Length=219

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+ GKPK+E NALTS++KL+ETLEMLEKKEKVL KKAS EVEKAKEFT+AKNKR  +
Sbjct  1    MFNRLLGKPKQEPNALTSLDKLHETLEMLEKKEKVLLKKASAEVEKAKEFTKAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>gb|ACJ83886.1| unknown [Medicago truncatula]
Length=221

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  64   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  97


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 53/65 (82%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKE--ESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            MFS++FGK K+  ++N L+ +EKLNETL +LEKKE VL KKA+ EVE+AKEFTRAKNKR 
Sbjct  5    MFSKLFGKTKQDQQANTLSILEKLNETLGILEKKESVLLKKAAAEVERAKEFTRAKNKRA  64

Query  536  LLDCI  550
             + C+
Sbjct  65   AIQCL  69



>ref|XP_009399850.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009399858.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
Length=218

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF R+FGKPKE+++ L +++KLNETLEMLEKKEKVL KK S EVEKAKEFTRAKNKR  +
Sbjct  1    MFGRLFGKPKEQTSTLATLDKLNETLEMLEKKEKVLLKKVSAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_006412871.1| hypothetical protein EUTSA_v10026202mg [Eutrema salsugineum]
 ref|XP_006412872.1| hypothetical protein EUTSA_v10026202mg [Eutrema salsugineum]
 ref|XP_006412873.1| hypothetical protein EUTSA_v10026202mg [Eutrema salsugineum]
 ref|XP_006412874.1| hypothetical protein EUTSA_v10026202mg [Eutrema salsugineum]
 gb|ESQ54324.1| hypothetical protein EUTSA_v10026202mg [Eutrema salsugineum]
 gb|ESQ54325.1| hypothetical protein EUTSA_v10026202mg [Eutrema salsugineum]
 gb|ESQ54326.1| hypothetical protein EUTSA_v10026202mg [Eutrema salsugineum]
 gb|ESQ54327.1| hypothetical protein EUTSA_v10026202mg [Eutrema salsugineum]
Length=218

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            M +R+FGKPK+ESNAL +++KLNETLEMLEKKEKVL KKA  EVEKAKE+TRAKNKR  +
Sbjct  1    MMNRLFGKPKQESNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_010433129.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Camelina sativa]
Length=218

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            M +R+FGKPK+ESNAL +++KLNETLEMLEKKEKVL KKA  EVEKAKE+TRAKNKR  +
Sbjct  1    MMNRLFGKPKQESNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_002883967.1| hypothetical protein ARALYDRAFT_343220 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60226.1| hypothetical protein ARALYDRAFT_343220 [Arabidopsis lyrata subsp. 
lyrata]
Length=186

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  31   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  64



>ref|XP_003630667.1| Vacuolar protein sorting-associated protein-like protein [Medicago 
truncatula]
Length=227

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  69   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  102


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 2/67 (3%)
 Frame = +2

Query  356  VKMFSRIFGKPKE--ESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNK  529
            V   + +FGK K+  ++N L+++EKLNETL MLEKKE VL KKA+ EVE+AKEFTRAKNK
Sbjct  8    VAGHAVLFGKTKQDQQANTLSTLEKLNETLGMLEKKESVLLKKAAAEVERAKEFTRAKNK  67

Query  530  RVLLDCI  550
            R  + C+
Sbjct  68   RAAIQCL  74



>emb|CDY47783.1| BnaC07g41770D [Brassica napus]
Length=213

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            M +R+FGKPK E+NAL +++KLNETLEMLEKKEKVL KKA  EVEKAKE+TR+KNKR  +
Sbjct  1    MMNRLFGKPKPETNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRSKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_009137831.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Brassica rapa]
 emb|CDY30232.1| BnaA03g49380D [Brassica napus]
Length=213

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            M +R+FGKPK E+NAL +++KLNETLEMLEKKEKVL KKA  EVEKAKE+TRAKNKR  +
Sbjct  1    MMNRLFGKPKPETNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>gb|ADE77819.1| unknown [Picea sitchensis]
Length=223

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+++F KPKEE++AL +I+KLNETLEMLEKKEKVLQKK SVE+EKAKEFTR KNKR  +
Sbjct  1    MFNKLFKKPKEETSALATIDKLNETLEMLEKKEKVLQKKISVEIEKAKEFTRRKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63


 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRK+LYE Q+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKKLYETQVEQLGNFQLRIHDQMIMLE  91



>gb|EYU20388.1| hypothetical protein MIMGU_mgv1a013694mg [Erythranthe guttata]
 gb|EYU20389.1| hypothetical protein MIMGU_mgv1a013694mg [Erythranthe guttata]
Length=213

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK+E+NAL +++KLNETLEMLEKKEKVL KKA  EVEKAKEFTRAKNKR  +
Sbjct  1    MFTRIFGKPKQETNALATLDKLNETLEMLEKKEKVLLKKAGAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_010548688.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Tarenaya hassleriana]
 ref|XP_010548689.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Tarenaya hassleriana]
Length=220

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  59   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  92


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 57/64 (89%), Gaps = 1/64 (2%)
 Frame = +2

Query  362  MF-SRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            MF +R+FGKPK+ESNAL +++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTRAKNKR  
Sbjct  1    MFMNRLFGKPKQESNALQTLDKLNETLEMLEKKEKVLLKKAAGEVEKAKEFTRAKNKRAA  60

Query  539  LDCI  550
            + C+
Sbjct  61   IQCL  64



>ref|XP_010540987.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
 ref|XP_010540988.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
Length=220

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  59   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  92


 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 1/64 (2%)
 Frame = +2

Query  362  MF-SRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            MF +R+FGKPK+ESNAL +++KLNETLEMLEKKE VL KKAS EVEKAKEFTRAKNKR  
Sbjct  1    MFVNRLFGKPKQESNALQTLDKLNETLEMLEKKENVLLKKASAEVEKAKEFTRAKNKRAA  60

Query  539  LDCI  550
            + C+
Sbjct  61   IQCL  64



>ref|XP_010942547.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Elaeis guineensis]
 ref|XP_010942548.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Elaeis guineensis]
Length=218

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF RIFGKPKE++NAL +++KLNETLEMLEKKEKVL KK + EVEKAKEFTRAKNKR  +
Sbjct  1    MFGRIFGKPKEQTNALATLDKLNETLEMLEKKEKVLLKKVAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_010447884.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Camelina sativa]
Length=218

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            M +R+FGKPK+ESNAL +++KLNETLEMLEKKEKVL KKA  EVEKAKE+TRAKNKR  +
Sbjct  1    MMNRLFGKPKQESNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_011094781.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Sesamum indicum]
 ref|XP_011094857.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Sesamum indicum]
 ref|XP_011094936.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Sesamum indicum]
Length=214

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK+E+NAL +++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTRAKNKR  +
Sbjct  1    MFTRIFGKPKQETNALATLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>emb|CDY06832.1| BnaC01g09310D [Brassica napus]
Length=212

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            M +R+FGKPK E NAL +++KLNETLEMLEKKEKVL KKA  EVEKAKE+TRAKNKR  +
Sbjct  1    MMNRLFGKPKHEGNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_010489126.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1 [Camelina sativa]
Length=214

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  59   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  92


 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +2

Query  362  MF-SRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            MF +R+FGKPK E+N L +++KLNETLEMLEKKE VL KKA+ EVEKAKEF+R KNKR  
Sbjct  1    MFMNRLFGKPKPEANTLQTLDKLNETLEMLEKKEGVLLKKAAGEVEKAKEFSRVKNKRAA  60

Query  539  LDCI  550
            + C+
Sbjct  61   IQCL  64



>ref|XP_010416624.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like [Camelina sativa]
Length=214

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  59   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  92


 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +2

Query  362  MF-SRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            MF +R+FGKPK E+N L +++KLNETLEMLEKKE VL KKA+ EVEKAKEF+R KNKR  
Sbjct  1    MFMNRLFGKPKPEANTLQTLDKLNETLEMLEKKEGVLLKKAAGEVEKAKEFSRVKNKRAA  60

Query  539  LDCI  550
            + C+
Sbjct  61   IQCL  64



>ref|XP_010467924.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like [Camelina sativa]
Length=214

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  59   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  92


 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +2

Query  362  MF-SRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            MF +R+FGKPK E+N L +++KLNETLEMLEKKE VL KKA+ EVEKAKEF+R KNKR  
Sbjct  1    MFMNRLFGKPKPEANTLQTLDKLNETLEMLEKKEGVLIKKAAGEVEKAKEFSRVKNKRAA  60

Query  539  LDCI  550
            + C+
Sbjct  61   IQCL  64



>ref|NP_179573.1| vacuolar protein sorting-associated protein 32-1 [Arabidopsis 
thaliana]
 sp|O82197.1|VP321_ARATH RecName: Full=Vacuolar protein sorting-associated protein 32 
homolog 1; Short=AtVPS32-1; AltName: Full=Charged multivesicular 
body protein 4 homolog 1; AltName: Full=ESCRT-III complex 
subunit VPS32 homolog 1 [Arabidopsis thaliana]
 gb|AAC62133.1| copia-like retroelement pol polyprotein [Arabidopsis thaliana]
 gb|AAK76585.1| putative copia retroelement pol polyprotein [Arabidopsis thaliana]
 gb|AAL85152.1| putative copia retroelement pol polyprotein [Arabidopsis thaliana]
 gb|AEC06931.1| vacuolar protein sorting-associated protein 32-1 [Arabidopsis 
thaliana]
Length=213

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  59   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  92


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +2

Query  362  MF-SRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            MF +R+FGKPK+E++ L +++KLNETLEMLEKKE VL KKA+ EVEKAKEF+RAKNKR  
Sbjct  1    MFMNRLFGKPKQETSTLQTLDKLNETLEMLEKKENVLLKKATGEVEKAKEFSRAKNKRAA  60

Query  539  LDCI  550
            + C+
Sbjct  61   IQCL  64



>ref|XP_002281551.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 ref|XP_010654573.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 ref|XP_010654574.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 ref|XP_010654575.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 emb|CAN76335.1| hypothetical protein VITISV_021984 [Vitis vinifera]
Length=220

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LE
Sbjct  60   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLE  93


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 55/65 (85%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEES--NALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            MFSR+F K KE+S  NA+ +++KLNETLEMLEKKE+VL KKAS EVEKAKE+T+AKNKR 
Sbjct  1    MFSRVFRKGKEQSQTNAVATLDKLNETLEMLEKKERVLIKKASAEVEKAKEYTKAKNKRA  60

Query  536  LLDCI  550
             + C+
Sbjct  61   AIQCL  65



>gb|KHG10442.1| Uncharacterized protein F383_09141 [Gossypium arboreum]
Length=218

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRK+LYEQQIEQLGNFQLR+HDQMIMLE
Sbjct  58   AAIQCLKRKKLYEQQIEQLGNFQLRVHDQMIMLE  91


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF  IFGK K E+NALT+++KLNETLEMLEKKE VL KK + EVEKAKE+ + +NK+  +
Sbjct  1    MFKGIFGKTKPETNALTTLDKLNETLEMLEKKESVLLKKTAAEVEKAKEYAKGRNKKAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_009112635.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like [Brassica rapa]
 ref|XP_009112636.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like [Brassica rapa]
Length=212

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK E+N L +++KLNETLEMLEKKE VL KKA+ EVE+AKEF++AKNKR  +
Sbjct  1    MFNRLFGKPKVETNTLHTLDKLNETLEMLEKKEGVLLKKAAGEVERAKEFSKAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>emb|CDY48731.1| BnaA09g10060D [Brassica napus]
Length=212

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK E+N L +++KLNETLEMLEKKE VL KKA+ EVE+AKEF++AKNKR  +
Sbjct  1    MFNRLFGKPKVETNTLHTLDKLNETLEMLEKKEGVLLKKAAGEVERAKEFSKAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_006408902.1| hypothetical protein EUTSA_v10002096mg [Eutrema salsugineum]
 gb|ESQ50355.1| hypothetical protein EUTSA_v10002096mg [Eutrema salsugineum]
Length=215

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            M +R+FGKPK+E+N L +++KLNETLEMLEKKE VL KKA+ EVE+AKEF+R KNKR  +
Sbjct  1    MLNRLFGKPKQETNTLQTLDKLNETLEMLEKKENVLLKKAAGEVERAKEFSRVKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_009394690.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
Length=218

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQ++EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQEVEQLGNFQLRIHDQMIMLE  91


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            M  R+FGKPKE+ NAL +++KLNETLEMLEKKEKVL KK + EVEKAKEFT+ KNKR  +
Sbjct  1    MLGRLFGKPKEQPNALATLDKLNETLEMLEKKEKVLLKKMATEVEKAKEFTKVKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_009361474.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
 ref|XP_009361482.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
Length=223

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAI+CLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIKCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91



>ref|XP_007227580.1| hypothetical protein PRUPE_ppa011190mg [Prunus persica]
 gb|EMJ28779.1| hypothetical protein PRUPE_ppa011190mg [Prunus persica]
Length=156

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAI+CLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIKCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF R+FGK K+E+NAL +I KLN+TLEMLEKKEKVL KKA+ EVEKAK+FT+A+N+   +
Sbjct  1    MFKRVFGKAKQEANALPTIHKLNDTLEMLEKKEKVLVKKAAAEVEKAKQFTQARNRTAAI  60

Query  542  DCI  550
             C+
Sbjct  61   KCL  63



>emb|CDY03333.1| BnaC09g10150D [Brassica napus]
Length=212

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK E+N L +++KLNETLEMLEKKE VL KKA+ EVE+AKEF++AKNKR  +
Sbjct  1    MFNRLFGKPKVETNTLHTLDKLNETLEMLEKKEGVLLKKAAGEVERAKEFSKAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_006583569.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Glycine max]
Length=218

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLE  91


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFSR+FGKPK+E+NA+ +++KLNETLEMLEKKEKVL KK + EVEKAKEFTR KNKR  +
Sbjct  1    MFSRMFGKPKQETNAVATLDKLNETLEMLEKKEKVLLKKVAAEVEKAKEFTRGKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_007227579.1| hypothetical protein PRUPE_ppa011190mg [Prunus persica]
 gb|EMJ28778.1| hypothetical protein PRUPE_ppa011190mg [Prunus persica]
Length=220

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAI+CLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIKCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF R+FGK K+E+NAL +I KLN+TLEMLEKKEKVL KKA+ EVEKAK+FT+A+N+   +
Sbjct  1    MFKRVFGKAKQEANALPTIHKLNDTLEMLEKKEKVLVKKAAAEVEKAKQFTQARNRTAAI  60

Query  542  DCI  550
             C+
Sbjct  61   KCL  63



>ref|XP_008377929.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
 ref|XP_008377930.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
 ref|XP_008377931.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
Length=220

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAI+CLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIKCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF R+FGK K+E+N L +I KLN+TLEMLEKKEKVL KKA+ EVEKAK+FT+AKN+   +
Sbjct  1    MFKRVFGKAKQEANPLPTIHKLNDTLEMLEKKEKVLVKKAAQEVEKAKQFTQAKNRNAAI  60

Query  542  DCI  550
             C+
Sbjct  61   KCL  63



>ref|XP_010942907.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Elaeis guineensis]
Length=219

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQMEQLGNFQLRIHDQMIMLE  91


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPKE++NALT++EKL+ETLEMLEKKEKVL+KK + EVEKAKEFTRAKNKR  +
Sbjct  1    MFNRLFGKPKEQANALTTLEKLHETLEMLEKKEKVLEKKVAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_010438334.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Camelina sativa]
Length=218

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            +AIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   SAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            M +R+FGKPK+ESNAL +++KLNETLEMLEKKEKVL KKA  EVEKAKE+TRAKNKR  +
Sbjct  1    MMNRLFGKPKQESNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRAKNKRSAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_004158431.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Cucumis sativus]
Length=191

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LE
Sbjct  31   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLE  64



>ref|XP_009337137.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
 ref|XP_009337138.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
 ref|XP_009337139.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
 ref|XP_009337140.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
Length=220

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAI+CLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIKCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF R+FGK K+E+N L +I KLN+TLEMLEKKEKVL KKA+ EVEKAK+FT+AKN+   +
Sbjct  1    MFKRVFGKAKQEANPLPTIHKLNDTLEMLEKKEKVLVKKAAQEVEKAKQFTQAKNRNAAI  60

Query  542  DCI  550
             C+
Sbjct  61   KCL  63



>ref|XP_008393670.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
Length=223

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAI+CLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIKCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91



>ref|XP_009128967.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brassica rapa]
Length=212

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            +AIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  58   SAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  91


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            M +R+FGKPK E NAL +++KLNETLEMLEKKEKVL KKA  EVEKAKE+TRAKNKR  +
Sbjct  1    MMNRLFGKPKHEGNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRAKNKRSAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_008450809.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Cucumis melo]
 ref|XP_008450810.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Cucumis melo]
Length=220

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LE
Sbjct  60   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLE  93


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  356  VKMFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            + M +++FGKPK+ESNAL +++KLNETLEMLEKKEKVL KKAS EVEKAK++TRAKNKR 
Sbjct  1    MSMLNKLFGKPKQESNALATLDKLNETLEMLEKKEKVLLKKASTEVEKAKDYTRAKNKRA  60

Query  536  LLDCI  550
             + C+
Sbjct  61   AIQCL  65



>ref|XP_004135686.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Cucumis sativus]
 gb|KGN66200.1| hypothetical protein Csa_1G575160 [Cucumis sativus]
Length=220

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LE
Sbjct  60   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLE  93


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  356  VKMFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            + MF+++FGKPK+ESNAL +++KLNETLEMLEKKEKVL KKAS EVEKAK++TRAKNKR 
Sbjct  1    MSMFNKLFGKPKQESNALATLDKLNETLEMLEKKEKVLLKKASTEVEKAKDYTRAKNKRA  60

Query  536  LLDCI  550
             + C+
Sbjct  61   AIQCL  65



>ref|XP_006371957.1| SNF7 family protein [Populus trichocarpa]
 gb|ERP49754.1| SNF7 family protein [Populus trichocarpa]
Length=207

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK ES+ALTS++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTR KNKR  +
Sbjct  1    MFNRLFGKPKLESSALTSLDKLNETLEMLEKKEKVLVKKAAAEVEKAKEFTRGKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|NP_974635.1| vacuolar protein sorting-associated protein 32-2 [Arabidopsis 
thaliana]
 gb|AEE85594.1| vacuolar protein sorting-associated protein 32-2 [Arabidopsis 
thaliana]
Length=192

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYE Q+EQLGNFQLRIHDQMIMLE
Sbjct  31   AAIQCLKRKRLYEGQVEQLGNFQLRIHDQMIMLE  64



>gb|ACJ85894.1| unknown [Medicago truncatula]
Length=206

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRI+DQMIMLE
Sbjct  60   AAIQCLKRKRLYEQQVEQLGNFQLRIYDQMIMLE  93


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 55/65 (85%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEE--SNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            MF+R+FGKPK++  SNAL +++KLNETLEMLEKKE VL KKA+ EVEKAKE+T+ KNK+ 
Sbjct  1    MFTRVFGKPKQDTSSNALATLDKLNETLEMLEKKENVLLKKAAAEVEKAKEYTKRKNKKA  60

Query  536  LLDCI  550
             + C+
Sbjct  61   AIQCL  65



>gb|ACJ86115.1| unknown [Medicago truncatula]
 gb|AFK44534.1| unknown [Medicago truncatula]
Length=221

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLY+QQ+EQLGNFQLRIHDQMIMLE
Sbjct  62   AAIQCLKRKRLYDQQVEQLGNFQLRIHDQMIMLE  95


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            + +R+ GKPK + +A  +I KLNETLEMLEKKE VL KKA  EVEKAKEFTR+KNKR  +
Sbjct  5    LLTRLLGKPKPKVSAQETIAKLNETLEMLEKKETVLLKKAGAEVEKAKEFTRSKNKRAAI  64

Query  542  DCI  550
             C+
Sbjct  65   QCL  67



>gb|ACU23713.1| unknown [Glycine max]
Length=164

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LE
Sbjct  54   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLE  87


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +2

Query  374  IFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLLDCI  550
            +FGKPK+E+NA+ +++KLNETLEMLEKKEKVL KK + EVEKAKEFTR KNKR  + C+
Sbjct  1    MFGKPKQETNAVATLDKLNETLEMLEKKEKVLLKKVAAEVEKAKEFTRGKNKRAAIQCL  59



>ref|XP_009784949.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana sylvestris]
Length=219

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMI+LE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMILLE  91


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK+E+NAL +++KLNETLEMLEKKEKVL KK + EVEKAKEFTRAKNKR  +
Sbjct  1    MFTRIFGKPKQETNALATLDKLNETLEMLEKKEKVLLKKTAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_006298305.1| hypothetical protein CARUB_v10014370mg, partial [Capsella rubella]
 ref|XP_006298306.1| hypothetical protein CARUB_v10014370mg, partial [Capsella rubella]
 gb|EOA31203.1| hypothetical protein CARUB_v10014370mg, partial [Capsella rubella]
 gb|EOA31204.1| hypothetical protein CARUB_v10014370mg, partial [Capsella rubella]
Length=273

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  118  AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  151


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  356  VKMF-SRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKR  532
            V MF +R+FGKPK+E N L +++KLNETLEMLEKKE VL KKA+ EVEKAKEF+R KNKR
Sbjct  58   VAMFMNRLFGKPKQEGNTLQTLDKLNETLEMLEKKEGVLIKKAAGEVEKAKEFSRVKNKR  117

Query  533  VLLDCI  550
              + C+
Sbjct  118  AAIQCL  123



>ref|XP_006584796.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Glycine max]
 ref|XP_006584797.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Glycine max]
 ref|XP_006584798.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X3 [Glycine max]
 gb|KHN16666.1| Vacuolar protein sorting-associated protein 32 like 1 [Glycine 
soja]
Length=218

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQ +EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEQHVEQLGNFQLRIHDQMIMLE  91


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+RIFGKPK+E+N LT+++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTRAKNKR  +
Sbjct  1    MFTRIFGKPKQEANTLTTLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_009586832.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana tomentosiformis]
Length=218

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMI+LE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMILLE  91


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF++IFGKPK+E+NAL +++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTRAKNKR  +
Sbjct  1    MFTKIFGKPKQETNALATLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_008220429.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Prunus mume]
Length=220

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAI+CLKRKRLYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIKCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF R+FGK K+E NAL +I KLN+TLEMLEKKEK+L KKA+ EVEKAK+FT+A+N+   +
Sbjct  1    MFKRVFGKAKQEPNALPTIHKLNDTLEMLEKKEKLLVKKAAAEVEKAKQFTQARNRTAAI  60

Query  542  DCI  550
             C+
Sbjct  61   KCL  63



>ref|NP_194645.1| vacuolar protein sorting-associated protein 32-2 [Arabidopsis 
thaliana]
 ref|NP_001078468.1| vacuolar protein sorting-associated protein 32-2 [Arabidopsis 
thaliana]
 sp|Q9SZE4.1|VP322_ARATH RecName: Full=Vacuolar protein sorting-associated protein 32 
homolog 2; Short=AtVPS32-2; AltName: Full=Charged multivesicular 
body protein 4 homolog 2; AltName: Full=ESCRT-III complex 
subunit VPS32 homolog 2 [Arabidopsis thaliana]
 emb|CAB43930.1| putative protein [Arabidopsis thaliana]
 emb|CAB79674.1| putative protein [Arabidopsis thaliana]
 gb|AAK68793.1| putative protein [Arabidopsis thaliana]
 gb|AAL66905.1| putative protein [Arabidopsis thaliana]
 gb|AEE85593.1| vacuolar protein sorting-associated protein 32-2 [Arabidopsis 
thaliana]
 gb|AEE85595.1| vacuolar protein sorting-associated protein 32-2 [Arabidopsis 
thaliana]
Length=219

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYE Q+EQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLYEGQVEQLGNFQLRIHDQMIMLE  91


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            M +R+FGKPK+E+NAL +++KLNETLEMLEKKEKVL KKA  EVEKAKE++RAKNKR  +
Sbjct  1    MMNRLFGKPKQEANALQTLDKLNETLEMLEKKEKVLLKKAGAEVEKAKEYSRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>gb|AAM66053.1| copia-like retroelement pol polyprotein [Arabidopsis thaliana]
Length=218

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYE Q+EQLGNFQLRIHDQMIMLE
Sbjct  57   AAIQCLKRKRLYEGQVEQLGNFQLRIHDQMIMLE  90


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  365  FSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLLD  544
             +R+FGKPK+E+NAL +++KLNETLEMLEKKEKVL KKA  EVEKAKE++RAKNKR  + 
Sbjct  1    MNRLFGKPKQEANALQTLDKLNETLEMLEKKEKVLLKKAGAEVEKAKEYSRAKNKRAAIQ  60

Query  545  CI  550
            C+
Sbjct  61   CL  62



>emb|CBI35999.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LE
Sbjct  60   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLE  93


 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 55/65 (85%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEES--NALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            MFSR+F K KE+S  NA+ +++KLNETLEMLEKKE+VL KKAS EVEKAKE+T+AKNKR 
Sbjct  1    MFSRVFRKGKEQSQTNAVATLDKLNETLEMLEKKERVLIKKASAEVEKAKEYTKAKNKRA  60

Query  536  LLDCI  550
             + C+
Sbjct  61   AIQCL  65



>gb|KHN40351.1| Vacuolar protein sorting-associated protein 32 like 2 [Glycine 
soja]
Length=241

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LE
Sbjct  81   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLE  114



>ref|XP_004291010.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Fragaria vesca subsp. vesca]
Length=220

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  781  AAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            ++AI+CLKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  57   SSAIKCLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  91



>ref|XP_010237993.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Brachypodium distachyon]
Length=304

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 59/72 (82%), Gaps = 2/72 (3%)
 Frame = +2

Query  341  IYIESVKMFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFT  514
            ++I    MF+R+FGKPKE++NA  L +++KLNETL+MLEKKEKVL+K A+ E+E+AKEF+
Sbjct  78   VHITGATMFNRLFGKPKEQANAGALATLDKLNETLDMLEKKEKVLEKNAAAELERAKEFS  137

Query  515  RAKNKRVLLDCI  550
            +AKNKR  +  +
Sbjct  138  KAKNKRAAIQAL  149


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  144  AAIQALKRKKLYEQQIEQLGNFQLRIHDQMIMLE  177



>gb|EMS60758.1| Vacuolar protein sorting-associated protein 32-like protein 1 
[Triticum urartu]
Length=374

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLE
Sbjct  215  AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLE  248


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 51/61 (84%), Gaps = 2/61 (3%)
 Frame = +2

Query  374  IFGKPKEES--NALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLLDC  547
            +FGK KE+S  +AL SI+KL+ETLEMLEKKE +L KKA++EVEKAK FT+AKNK+  + C
Sbjct  160  VFGKSKEQSQASALASIDKLSETLEMLEKKENLLMKKANLEVEKAKAFTKAKNKKAAIQC  219

Query  548  I  550
            +
Sbjct  220  L  220



>gb|EYU27236.1| hypothetical protein MIMGU_mgv1a019968mg [Erythranthe guttata]
Length=207

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +2

Query  362  MFSRIFGKPK-EESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            MF+R+ GKPK EE+NAL +++KLNETLEMLEKKE VLQKKAS E++KAKE T+AKNKR  
Sbjct  1    MFTRLLGKPKQEEANALATLDKLNETLEMLEKKEGVLQKKASAELDKAKEHTKAKNKRAA  60

Query  539  LDCI  550
            + C+
Sbjct  61   IQCL  64



>gb|AET05142.2| charged multivesicular body protein [Medicago truncatula]
Length=205

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  763  VLFYSLAAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            VL      AIQCLKRKRLY+QQ+EQLGNFQLRIHDQMIMLE
Sbjct  39   VLLKKGWTAIQCLKRKRLYDQQVEQLGNFQLRIHDQMIMLE  79



>dbj|BAJ91819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=182

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  22   AAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  55



>ref|XP_011008899.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Populus euphratica]
 ref|XP_011008900.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Populus euphratica]
Length=215

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRL EQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLDEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NALTS++KLNETLEMLEKKEKVL KKA+ EVEKAKE+TR KNKR  +
Sbjct  1    MFNRLFGKPKQETNALTSLDKLNETLEMLEKKEKVLVKKAAAEVEKAKEYTRGKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_009395523.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009395524.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009395525.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009395526.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
Length=218

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQLGNFQLR+HDQ+IMLE
Sbjct  58   AAIQCLKRKRLYEQQVEQLGNFQLRLHDQIIMLE  91


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFS +F +P+E+ +  ++I+KLN+TL MLEKKE+VL KKA+ EVEKAKEFTRAKNKR  +
Sbjct  1    MFSMLFWRPREQPHTFSTIDKLNKTLAMLEKKEQVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_011014015.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Populus euphratica]
 ref|XP_011014016.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Populus euphratica]
Length=215

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRL EQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   AAIQCLKRKRLDEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF+R+FGKPK+E+NALT+++KLNETLEMLEKKEKVL KKA+ EVEKAKEFTR KNKR  +
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRGKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_003630666.1| Vacuolar protein sorting-associated protein-like protein [Medicago 
truncatula]
Length=230

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  763  VLFYSLAAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            VL      AIQCLKRKRLY+QQ+EQLGNFQLRIHDQMIMLE
Sbjct  39   VLLKKGWTAIQCLKRKRLYDQQVEQLGNFQLRIHDQMIMLE  79



>ref|XP_002466250.1| hypothetical protein SORBIDRAFT_01g004370 [Sorghum bicolor]
 gb|EER93248.1| hypothetical protein SORBIDRAFT_01g004370 [Sorghum bicolor]
Length=191

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  31   AAIQALKRKKLYEQQIEQLGNFQLRIHDQMIMLE  64



>ref|XP_001769849.1| predicted protein [Physcomitrella patens]
 gb|EDQ65411.1| predicted protein [Physcomitrella patens]
Length=189

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 3/42 (7%)
 Frame = +1

Query  769  FYSLA---AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            F SL    AAIQCLKRK+LYE Q+EQLGNFQLRIHDQMIMLE
Sbjct  23   FTSLKNKRAAIQCLKRKKLYEVQVEQLGNFQLRIHDQMIMLE  64



>ref|NP_001130264.1| uncharacterized protein LOC100191358 [Zea mays]
 gb|ACF78433.1| unknown [Zea mays]
Length=196

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  36   AAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  69



>gb|ACG30556.1| charged multivesicular body protein 4b [Zea mays]
Length=208

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  62   AAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  95


 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 57/67 (85%), Gaps = 2/67 (3%)
 Frame = +2

Query  356  VKMFSRIFGKPKEESN--ALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNK  529
            + MF+RIFGKPKE++N  AL +++KLN+TL+MLEKKEKVL KKA+ E+E+AKEF++AKNK
Sbjct  1    MSMFNRIFGKPKEQANSSALATLDKLNDTLDMLEKKEKVLDKKAAAELERAKEFSKAKNK  60

Query  530  RVLLDCI  550
            R  +  +
Sbjct  61   RAAIQSL  67



>ref|XP_004969169.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Setaria italica]
Length=221

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  62   AAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  95


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 58/67 (87%), Gaps = 2/67 (3%)
 Frame = +2

Query  356  VKMFSRIFGKPKEE--SNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNK  529
            + MF+RIFGKPKE+  SNAL +++KLNETL+MLEKKEKVL+KKA+ E+E+AKEF++AKNK
Sbjct  1    MSMFNRIFGKPKEQANSNALATLDKLNETLDMLEKKEKVLEKKAAAELERAKEFSKAKNK  60

Query  530  RVLLDCI  550
            R  +  +
Sbjct  61   RAAIQSL  67



>ref|NP_001241771.1| charged multivesicular body protein 4b [Zea mays]
 ref|XP_008654219.1| PREDICTED: uncharacterized protein LOC100191358 isoform X1 [Zea 
mays]
 ref|XP_008654220.1| PREDICTED: uncharacterized protein LOC100191358 isoform X1 [Zea 
mays]
 gb|ACG36930.1| charged multivesicular body protein 4b [Zea mays]
 gb|ACN31860.1| unknown [Zea mays]
 gb|AFW83261.1| putative SNF domain containing family protein isoform 1 [Zea 
mays]
 gb|AFW83262.1| putative SNF domain containing family protein isoform 2 [Zea 
mays]
 gb|AFW83263.1| putative SNF domain containing family protein isoform 3 [Zea 
mays]
Length=222

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  62   AAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  95


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 58/67 (87%), Gaps = 2/67 (3%)
 Frame = +2

Query  356  VKMFSRIFGKPKEE--SNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNK  529
            + MF+RIFGKPKE+  SNAL +++KLNETL+MLEKKEKVL+KKA+ E+E+AKEF++AKNK
Sbjct  1    MSMFNRIFGKPKEQANSNALATLDKLNETLDMLEKKEKVLEKKAAAELERAKEFSKAKNK  60

Query  530  RVLLDCI  550
            R  +  +
Sbjct  61   RAAIQSL  67



>ref|XP_002455955.1| hypothetical protein SORBIDRAFT_03g027900 [Sorghum bicolor]
 gb|EES01075.1| hypothetical protein SORBIDRAFT_03g027900 [Sorghum bicolor]
Length=222

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  62   AAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  95


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 58/67 (87%), Gaps = 2/67 (3%)
 Frame = +2

Query  356  VKMFSRIFGKPKEE--SNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNK  529
            + MF+RIFGKPKE+  SNAL +++KLNETL+MLEKKEKVL+KKA+ E+E+AKEF++AKNK
Sbjct  1    MSMFNRIFGKPKEQANSNALATLDKLNETLDMLEKKEKVLEKKAAAELERAKEFSKAKNK  60

Query  530  RVLLDCI  550
            R  +  +
Sbjct  61   RAAIQSL  67



>ref|XP_006660479.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Oryza brachyantha]
Length=218

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  60   AAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  93


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 57/65 (88%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            MF+RIFGKPKE++NA  L +++KLNETL+MLEKKEKVL+KKA+ E+E+AK+F++AKNKR 
Sbjct  1    MFNRIFGKPKEQANASALATLDKLNETLDMLEKKEKVLEKKAAAELERAKDFSKAKNKRA  60

Query  536  LLDCI  550
             +  +
Sbjct  61   AIQSL  65



>gb|EMS65379.1| Vacuolar protein sorting-associated protein 32-like protein 2 
[Triticum urartu]
Length=220

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  60   AAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  93


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 56/65 (86%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            MF+R+FGKPKE++NA  L +++KLNETL+MLEKKEKVL+KKA  E+E+AKEF++AKNKR 
Sbjct  1    MFNRLFGKPKEQANAGALATLDKLNETLDMLEKKEKVLEKKAGAELERAKEFSKAKNKRA  60

Query  536  LLDCI  550
             +  +
Sbjct  61   AIQSL  65



>ref|NP_001062723.1| Os09g0267600 [Oryza sativa Japonica Group]
 dbj|BAF24637.1| Os09g0267600 [Oryza sativa Japonica Group]
 dbj|BAG89645.1| unnamed protein product [Oryza sativa Japonica Group]
Length=220

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  60   AAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  93


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 57/65 (88%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            MF+R+FGKPKE++NA  L +++KLNETL+MLEKKEKVL+KKA+ E+E+AKEF++AKNKR 
Sbjct  1    MFNRLFGKPKEQANASALATLDKLNETLDMLEKKEKVLEKKAAAELERAKEFSKAKNKRA  60

Query  536  LLDCI  550
             +  +
Sbjct  61   AIQSL  65



>dbj|BAK08135.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89470.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=220

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  60   AAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  93


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 56/65 (86%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            MF+R+FGKPKE++NA  L +++KLNETL+MLEKKEKVL+KKA  E+E+AKEF++AKNKR 
Sbjct  1    MFNRLFGKPKEQANAGALATLDKLNETLDMLEKKEKVLEKKAGAELERAKEFSKAKNKRA  60

Query  536  LLDCI  550
             +  +
Sbjct  61   AIQSL  65



>ref|XP_003577910.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Brachypodium distachyon]
 ref|XP_010237994.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Brachypodium distachyon]
Length=220

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  60   AAIQALKRKKLYEQQIEQLGNFQLRIHDQMIMLE  93


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 56/65 (86%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            MF+R+FGKPKE++NA  L +++KLNETL+MLEKKEKVL+K A+ E+E+AKEF++AKNKR 
Sbjct  1    MFNRLFGKPKEQANAGALATLDKLNETLDMLEKKEKVLEKNAAAELERAKEFSKAKNKRA  60

Query  536  LLDCI  550
             +  +
Sbjct  61   AIQAL  65



>ref|XP_003564850.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
 ref|XP_010232698.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
Length=220

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  60   AAIQALKRKKLYEQQIEQLGNFQLRIHDQMIMLE  93


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 57/65 (88%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            MF+R+FGKPKE++NA  L +++KLNETL+MLEKKEKVL+KKA+ E+E+AK+F++AKNKR 
Sbjct  1    MFNRLFGKPKEQANAGALATLDKLNETLDMLEKKEKVLEKKAAAELERAKDFSKAKNKRA  60

Query  536  LLDCI  550
             +  +
Sbjct  61   AIQAL  65



>ref|NP_001130288.1| uncharacterized protein LOC100191382 [Zea mays]
 ref|XP_008672012.1| PREDICTED: uncharacterized protein LOC100191382 isoform X1 [Zea 
mays]
 ref|XP_008672013.1| PREDICTED: uncharacterized protein LOC100191382 isoform X1 [Zea 
mays]
 ref|XP_008672014.1| PREDICTED: uncharacterized protein LOC100191382 isoform X1 [Zea 
mays]
 gb|ACF78462.1| unknown [Zea mays]
Length=222

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  62   AAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  95


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 57/67 (85%), Gaps = 2/67 (3%)
 Frame = +2

Query  356  VKMFSRIFGKPKEESN--ALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNK  529
            + MF+RIFGKPKE++N  AL +++KLNETL+MLEKKEKVL KKA+ E+E+AKEF++AKNK
Sbjct  1    MSMFNRIFGKPKEQANSSALATLDKLNETLDMLEKKEKVLDKKAAAELERAKEFSKAKNK  60

Query  530  RVLLDCI  550
            R  +  +
Sbjct  61   RAAIQSL  67



>ref|NP_001147424.1| charged multivesicular body protein 4b [Zea mays]
 ref|XP_008673987.1| PREDICTED: charged multivesicular body protein 4b isoform X1 
[Zea mays]
 ref|XP_008673991.1| PREDICTED: charged multivesicular body protein 4b isoform X1 
[Zea mays]
 gb|ACF81163.1| unknown [Zea mays]
 gb|ACF87539.1| unknown [Zea mays]
 gb|ACG27468.1| charged multivesicular body protein 4b [Zea mays]
 gb|ACN28696.1| unknown [Zea mays]
Length=222

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  62   AAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  95


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 58/67 (87%), Gaps = 2/67 (3%)
 Frame = +2

Query  356  VKMFSRIFGKPKEE--SNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNK  529
            + MF+RIFGKPKE+  SNAL +++KLNETL+MLEKKEKVL+KKA+ E+E+AKEF++AKNK
Sbjct  1    MSMFNRIFGKPKEQANSNALATLDKLNETLDMLEKKEKVLEKKANAELERAKEFSKAKNK  60

Query  530  RVLLDCI  550
            R  +  +
Sbjct  61   RAAIQSL  67



>ref|XP_010690124.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like [Beta vulgaris subsp. vulgaris]
Length=224

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQQ+EQ+GNFQLRIHDQ+IML+
Sbjct  66   AAIQCLKRKRLYEQQVEQVGNFQLRIHDQIIMLD  99


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 4/70 (6%)
 Frame = +2

Query  353  SVKMFSRIFGKPKEESNALTSIE----KLNETLEMLEKKEKVLQkkasvevekakeFTRA  520
            S  MFSR+FG    ++    +      KLNETLEMLEKKE++L KKA+ EVEKAKEFTRA
Sbjct  2    SANMFSRLFGAKSRDAATTETTLSTLEKLNETLEMLEKKEQLLMKKATAEVEKAKEFTRA  61

Query  521  KNKRVLLDCI  550
            KNKR  + C+
Sbjct  62   KNKRAAIQCL  71



>emb|CDY35892.1| BnaA07g00950D [Brassica napus]
Length=215

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AA+QCLKRKR+YEQQ+EQLGN+QLRIHDQMIMLE
Sbjct  59   AAMQCLKRKRVYEQQVEQLGNYQLRIHDQMIMLE  92


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +2

Query  362  MFSRIFGKPKE-ESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            MF+R+F KPK+ E++ L ++EKLNETL+MLEKKE +L K+A+ EVE+AKEFTRAKNKR  
Sbjct  1    MFTRLFRKPKKKETDTLQTLEKLNETLDMLEKKESLLLKRAAQEVERAKEFTRAKNKRAA  60

Query  539  LDCI  550
            + C+
Sbjct  61   MQCL  64



>ref|XP_009102133.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1 [Brassica rapa]
Length=215

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AA+QCLKRKR+YEQQ+EQLGN+QLRIHDQMIMLE
Sbjct  59   AAMQCLKRKRVYEQQVEQLGNYQLRIHDQMIMLE  92


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +2

Query  362  MFSRIFGKPKE-ESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            MF+R+F KPK+ E++ L ++EKLNETL+MLEKKE +L K+A+ EVE+AKEFTRAKNKR  
Sbjct  1    MFTRLFRKPKKKETDTLQTLEKLNETLDMLEKKESLLLKRAAQEVERAKEFTRAKNKRAA  60

Query  539  LDCI  550
            + C+
Sbjct  61   MQCL  64



>ref|XP_009396303.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
Length=216

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRL+EQQ+EQLGNFQLRIHDQ+IMLE
Sbjct  58   AAIQCLKRKRLHEQQVEQLGNFQLRIHDQIIMLE  91


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFSR+FGKP E++  L++++KL ETL MLEKKE+ L KK + E+EKAKEFT+A NKR  +
Sbjct  1    MFSRLFGKPNEKAYDLSTMDKLYETLAMLEKKEQALMKKVAAEIEKAKEFTKANNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>gb|ABG21860.1| SNF7 family protein, expressed [Oryza sativa Japonica Group]
Length=162

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  769  FYSLAAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            F  +AAAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE
Sbjct  5    FLFVAAAIQCLKKKKLYETQIEQLANFQLRVHDQIIMLE  43



>ref|XP_008673975.1| PREDICTED: charged multivesicular body protein 4b isoform X2 
[Zea mays]
 ref|XP_008673980.1| PREDICTED: charged multivesicular body protein 4b isoform X2 
[Zea mays]
 gb|ACF83653.1| unknown [Zea mays]
Length=251

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  91   AAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  124


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 69/87 (79%), Gaps = 3/87 (3%)
 Frame = +2

Query  296  IFNVL*SEYWFEAVVIYIESVKMFSRIFGKPKEE--SNALTSIEKLNETLEMLEKKEKVL  469
            I +V  SE  FE+V   + ++ MF+RIFGKPKE+  SNAL +++KLNETL+MLEKKEKVL
Sbjct  11   ILSVFGSEGVFESVASVV-AMSMFNRIFGKPKEQANSNALATLDKLNETLDMLEKKEKVL  69

Query  470  QkkasvevekakeFTRAKNKRVLLDCI  550
            +KKA+ E+E+AKEF++AKNKR  +  +
Sbjct  70   EKKANAELERAKEFSKAKNKRAAIQSL  96



>gb|EAZ08368.1| hypothetical protein OsI_30625 [Oryza sativa Indica Group]
Length=990

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  830  AAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  863


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 58/70 (83%), Gaps = 2/70 (3%)
 Frame = +2

Query  347  IESVKMFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRA  520
            I    MF+R+FGKPKE++NA  L +++KLNETL+MLEKKEKVL+KKA+ E+E+AKEF++A
Sbjct  766  ITGAAMFNRLFGKPKEQANASALATLDKLNETLDMLEKKEKVLEKKAAAELERAKEFSKA  825

Query  521  KNKRVLLDCI  550
            KNKR  +  +
Sbjct  826  KNKRAAIQSL  835



>gb|EEE69315.1| hypothetical protein OsJ_28603 [Oryza sativa Japonica Group]
Length=1003

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  843  AAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  876


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 58/70 (83%), Gaps = 2/70 (3%)
 Frame = +2

Query  347  IESVKMFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRA  520
            I    MF+R+FGKPKE++NA  L +++KLNETL+MLEKKEKVL+KKA+ E+E+AKEF++A
Sbjct  779  ITGAAMFNRLFGKPKEQANASALATLDKLNETLDMLEKKEKVLEKKAAAELERAKEFSKA  838

Query  521  KNKRVLLDCI  550
            KNKR  +  +
Sbjct  839  KNKRAAIQSL  848



>ref|XP_010931424.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Elaeis guineensis]
Length=236

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 1/43 (2%)
 Frame = +1

Query  757  KPVLFYSLAAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            KPV+  + ++AIQCLK+K+LYE QIEQLGNFQLR+HDQMI+LE
Sbjct  71   KPVMDLT-SSAIQCLKKKKLYEAQIEQLGNFQLRVHDQMIVLE  112


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = +2

Query  362  MFSRIFGKPKEES-NALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            M  R+  KPK++  +AL+++++L+ETLEMLEKKE VLQKK S EVEKAK++T+AKNK+V
Sbjct  1    MLKRLLTKPKKQPPSALSTLDRLHETLEMLEKKEHVLQKKISGEVEKAKDYTKAKNKKV  59



>gb|EYU30671.1| hypothetical protein MIMGU_mgv1a013622mg [Erythranthe guttata]
Length=215

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLK+K+LYE+QI QLGNFQLRIHDQMIMLE
Sbjct  59   AAIQCLKKKKLYEEQIAQLGNFQLRIHDQMIMLE  92


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +2

Query  362  MFSRIFGK-PKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            MFSRI  K PK+E++ LTS++KLNETLEMLEKKE VLQKKA  EVEKAK +T++KNK+  
Sbjct  1    MFSRILRKQPKQETSTLTSLDKLNETLEMLEKKENVLQKKAYAEVEKAKAYTKSKNKKAA  60

Query  539  LDCI  550
            + C+
Sbjct  61   IQCL  64



>ref|XP_006842643.1| hypothetical protein AMTR_s00077p00189740 [Amborella trichopoda]
 gb|ERN04318.1| hypothetical protein AMTR_s00077p00189740 [Amborella trichopoda]
Length=218

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRK+LYE QIEQLGNFQLRIHDQMI LE
Sbjct  58   AAIQCLKRKKLYEAQIEQLGNFQLRIHDQMITLE  91


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF ++F K KE  + L++I+KLNETLEMLEKKE VLQ+K S E++KAK+FTR KNKR  +
Sbjct  1    MFEKLFKKSKETLSPLSTIDKLNETLEMLEKKENVLQRKMSSEIQKAKDFTRMKNKRAAI  60

Query  542  DCI  550
             C+
Sbjct  61   QCL  63



>ref|XP_010695089.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010695090.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Beta vulgaris subsp. vulgaris]
Length=219

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAI CLKRKRLYEQQIEQLGN QLRIHDQMI+LE
Sbjct  59   AAITCLKRKRLYEQQIEQLGNMQLRIHDQMILLE  92


 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +2

Query  362  MFSRIFGKPKE-ESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            MF+R+FGKPKE  ++A+ +++KL+ETLEMLEKKE+VL KKA  EVEKAKEFTRAKNKR  
Sbjct  1    MFTRVFGKPKEGTTSAVATLDKLSETLEMLEKKEQVLLKKAGAEVEKAKEFTRAKNKRAA  60

Query  539  LDCI  550
            + C+
Sbjct  61   ITCL  64



>gb|EYU29306.1| hypothetical protein MIMGU_mgv1a014523mg [Erythranthe guttata]
Length=186

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRK+LYEQQIEQLGN QLRIHDQMIM+E
Sbjct  31   AAIQCLKRKKLYEQQIEQLGNSQLRIHDQMIMIE  64



>ref|XP_007152943.1| hypothetical protein PHAVU_004G173400g [Phaseolus vulgaris]
 gb|ESW24937.1| hypothetical protein PHAVU_004G173400g [Phaseolus vulgaris]
Length=215

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
             A QC+KRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  58   GAAQCVKRKKLYEQQIEQLGNFQLRIHDQMIMLE  91


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF   FGK K E N +  ++KLN+TLE+LEKKE VL KK + E EKA EF R KNKR   
Sbjct  1    MFRNFFGKSKPEHNPIAVLDKLNQTLELLEKKEDVLLKKVNAEKEKAIEFIRGKNKRGAA  60

Query  542  DCI  550
             C+
Sbjct  61   QCV  63



>ref|XP_010922839.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Elaeis guineensis]
Length=217

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLK+K+LYE QIEQLGNFQLR+HDQMI+LE
Sbjct  60   AAIQCLKKKKLYEAQIEQLGNFQLRVHDQMIVLE  93



>ref|XP_008788033.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
Length=216

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLK+K+LYE QIEQLGNFQLR+HDQMI+LE
Sbjct  59   AAIQCLKKKKLYEAQIEQLGNFQLRVHDQMIVLE  92


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  362  MFSRIFGKPKEES-NALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            M  R+  KPK+E  +AL+++++L+ETLEMLEKKE VLQKK S+EVEKAK+ T+AKNK+  
Sbjct  1    MLKRLLTKPKKEPPSALSTLDRLHETLEMLEKKEHVLQKKISIEVEKAKDCTKAKNKKAA  60

Query  539  LDCI  550
            + C+
Sbjct  61   IQCL  64



>ref|XP_010931425.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Elaeis guineensis]
Length=216

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLK+K+LYE QIEQLGNFQLR+HDQMI+LE
Sbjct  59   AAIQCLKKKKLYEAQIEQLGNFQLRVHDQMIVLE  92


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  362  MFSRIFGKPKEES-NALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            M  R+  KPK++  +AL+++++L+ETLEMLEKKE VLQKK S EVEKAK++T+AKNK+  
Sbjct  1    MLKRLLTKPKKQPPSALSTLDRLHETLEMLEKKEHVLQKKISGEVEKAKDYTKAKNKKAA  60

Query  539  LDCI  550
            + C+
Sbjct  61   IQCL  64



>gb|EMT15574.1| Vacuolar protein sorting-associated 32-2-like protein [Aegilops 
tauschii]
Length=186

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  787  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  27   AIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  59



>ref|XP_008660967.1| PREDICTED: uncharacterized protein LOC103640100 [Zea mays]
Length=519

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 36/45 (80%), Gaps = 3/45 (7%)
 Frame = +1

Query  760  PVLFYSLA---AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            P  F SL    A IQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  382  PSEFVSLVGFVATIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLE  426



>ref|XP_006662688.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Oryza brachyantha]
Length=184

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  781  AAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            +AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE
Sbjct  30   SAAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLE  64



>gb|EEC67568.1| hypothetical protein OsI_34912 [Oryza sativa Indica Group]
Length=216

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  781  AAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            +AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE
Sbjct  62   SAAIQCLKKKKLYETQIEQLANFQLRVHDQIIMLE  96



>ref|NP_001065616.1| Os11g0123500 [Oryza sativa Japonica Group]
 gb|ABA91256.1| SNF7 family protein, expressed [Oryza sativa Japonica Group]
 gb|ABA91257.1| SNF7 family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF27461.1| Os11g0123500 [Oryza sativa Japonica Group]
 gb|EEE51554.1| hypothetical protein OsJ_32766 [Oryza sativa Japonica Group]
Length=216

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  781  AAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            +AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE
Sbjct  62   SAAIQCLKKKKLYETQIEQLANFQLRVHDQIIMLE  96



>ref|NP_001066025.2| Os12g0121400 [Oryza sativa Japonica Group]
 gb|ABA95683.2| SNF7 family protein, expressed [Oryza sativa Japonica Group]
 gb|EEC68756.1| hypothetical protein OsI_37279 [Oryza sativa Indica Group]
 gb|EEE52665.1| hypothetical protein OsJ_35039 [Oryza sativa Japonica Group]
 dbj|BAF29044.2| Os12g0121400 [Oryza sativa Japonica Group]
Length=216

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  781  AAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            +AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE
Sbjct  63   SAAIQCLKKKKLYETQIEQLANFQLRVHDQIIMLE  97



>ref|XP_006663763.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Oryza brachyantha]
Length=217

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  781  AAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            +AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE
Sbjct  63   SAAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLE  97



>ref|XP_010049158.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Eucalyptus grandis]
Length=191

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLK+K++YE QIEQLG++QLRIHDQMIMLE
Sbjct  31   AAIQCLKKKKMYETQIEQLGSYQLRIHDQMIMLE  64



>ref|XP_006662689.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X3 [Oryza brachyantha]
Length=217

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  781  AAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            +AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE
Sbjct  63   SAAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLE  97



>ref|XP_010049157.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Eucalyptus grandis]
 gb|KCW81634.1| hypothetical protein EUGRSUZ_C02996 [Eucalyptus grandis]
 gb|KCW81635.1| hypothetical protein EUGRSUZ_C02996 [Eucalyptus grandis]
Length=219

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLK+K++YE QIEQLG++QLRIHDQMIMLE
Sbjct  59   AAIQCLKKKKMYETQIEQLGSYQLRIHDQMIMLE  92



>ref|XP_003579007.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
 ref|XP_010238790.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
 ref|XP_010238791.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
 ref|XP_010238792.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
Length=219

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE
Sbjct  64   AAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLE  97



>ref|XP_006662687.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Oryza brachyantha]
Length=195

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  781  AAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            +AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE
Sbjct  30   SAAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLE  64



>gb|ACG47769.1| hypothetical protein [Zea mays]
Length=88

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 2/65 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRV  535
            +F R+FGK KE+S A  L S++KLNETLEMLEKKE +L KKA++EVEKAK FT+AKNKR 
Sbjct  4    VFGRVFGKSKEQSQATALASLDKLNETLEMLEKKENLLVKKANLEVEKAKNFTKAKNKRA  63

Query  536  LLDCI  550
             + C+
Sbjct  64   AIQCL  68



>ref|XP_002450174.1| hypothetical protein SORBIDRAFT_05g001480 [Sorghum bicolor]
 gb|EES09162.1| hypothetical protein SORBIDRAFT_05g001480 [Sorghum bicolor]
Length=220

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE
Sbjct  64   AAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLE  97



>ref|XP_008804654.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
Length=216

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLK+K+LYE QIEQLG FQLR+HDQMI LE
Sbjct  59   AAIQCLKKKKLYEAQIEQLGKFQLRVHDQMITLE  92



>ref|XP_004978491.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Setaria italica]
Length=219

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE
Sbjct  64   AAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLE  97



>dbj|BAJ97352.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=218

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE
Sbjct  64   AAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLE  97



>ref|XP_008679351.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Zea mays]
 ref|XP_008679352.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Zea mays]
 ref|XP_008679353.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Zea mays]
 ref|XP_008679354.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Zea mays]
Length=223

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE
Sbjct  64   AAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLE  97



>emb|CDX82742.1| BnaC07g01240D [Brassica napus]
Length=201

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AA+ CLKRK +YEQQ+EQLGN+QLRIHDQMIMLE
Sbjct  46   AAMLCLKRKSVYEQQVEQLGNYQLRIHDQMIMLE  79


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 43/64 (67%), Gaps = 14/64 (22%)
 Frame = +2

Query  362  MFSRIFGKPKE-ESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVL  538
            MF+R+F KPK+ E++ L ++EKLNETL+MLEKKE              KEFTRAKNKR  
Sbjct  1    MFTRLFRKPKKKETDTLQTLEKLNETLDMLEKKE-------------TKEFTRAKNKRAA  47

Query  539  LDCI  550
            + C+
Sbjct  48   MLCL  51



>gb|EMT02888.1| Vacuolar protein sorting-associated 32-1-like protein [Aegilops 
tauschii]
Length=306

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE
Sbjct  153  AAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLE  186



>gb|EMS66152.1| Vacuolar protein sorting-associated protein 32-like protein 1 
[Triticum urartu]
Length=278

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE
Sbjct  124  AAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLE  157



>ref|XP_009767750.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nicotiana sylvestris]
Length=219

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +1

Query  778  LAAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            + AAIQCLKRK+LYEQ+IE+LG+ QLRIHDQMI+LE
Sbjct  57   IVAAIQCLKRKKLYEQEIERLGSSQLRIHDQMIILE  92



>gb|EPS70822.1| hypothetical protein M569_03937, partial [Genlisea aurea]
Length=86

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  781  AAAIQCLKRKRLYEQQIEQLGNFQLRIHDQ  870
             AAI+CLKRKRLYEQQIE LGNFQLRIHDQ
Sbjct  57   TAAIRCLKRKRLYEQQIENLGNFQLRIHDQ  86



>ref|XP_009620038.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana tomentosiformis]
Length=217

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLK+K+LYEQ+IE+LG+ QLRIHDQMI+LE
Sbjct  57   AAIQCLKKKKLYEQEIERLGSSQLRIHDQMIILE  90


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MF R+ GKPKEE N L ++EKLNE LE LEKKEKV  KK SVEVEKAKEFT+AKNKR  +
Sbjct  1    MF-RLLGKPKEEPNILATLEKLNEHLENLEKKEKVFLKKVSVEVEKAKEFTKAKNKRAAI  59

Query  542  DCI  550
             C+
Sbjct  60   QCL  62



>gb|AFM35785.1| hypothetical protein, partial [Oryza eichingeri]
Length=95

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +1

Query  802  KRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            KRK+LYEQQIEQLGNFQLRIHDQMIMLE
Sbjct  1    KRKKLYEQQIEQLGNFQLRIHDQMIMLE  28



>ref|XP_009418535.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
Length=218

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCL+RK+L+EQ++E+LGN+QLRIHDQ+I+LE
Sbjct  59   AAIQCLRRKKLHEQEVERLGNYQLRIHDQIILLE  92


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKRVLL  541
            MFS +FGK KE+ N L ++E+LNE L+MLEK+E+ L KK + EVEKAKEFTR  NKR  +
Sbjct  2    MFSWLFGKRKEQPNTLATLEELNEKLKMLEKREQFLLKKMAAEVEKAKEFTRENNKRAAI  61

Query  542  DCI  550
             C+
Sbjct  62   QCL  64



>gb|AFW87250.1| putative SNF domain containing family protein [Zea mays]
Length=65

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 2/59 (3%)
 Frame = +2

Query  362  MFSRIFGKPKEESNA--LTSIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNKR  532
            +F R+FGK KE+S A  L S++KLNETLEMLEKKE +L KKA++EVEKAK FT+AKNKR
Sbjct  4    VFGRVFGKSKEQSQATALASLDKLNETLEMLEKKENLLVKKANLEVEKAKNFTKAKNKR  62



>gb|KCW44188.1| hypothetical protein EUGRSUZ_L02392 [Eucalyptus grandis]
Length=213

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  781  AAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAAIQCLKRKRLYEQ+IEQL  FQL I DQ+IMLE
Sbjct  65   AAAIQCLKRKRLYEQRIEQLRYFQLPIRDQIIMLE  99



>gb|KCW44187.1| hypothetical protein EUGRSUZ_L02392 [Eucalyptus grandis]
Length=206

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AAIQCLKRKRLYEQ+IEQL  FQL I DQ+IMLE
Sbjct  59   AAIQCLKRKRLYEQRIEQLRYFQLPIRDQIIMLE  92



>gb|AFW61107.1| hypothetical protein ZEAMMB73_096269 [Zea mays]
Length=228

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQM  873
            AAIQ LKRK+LYEQQIEQLGNFQLR HDQ+
Sbjct  114  AAIQSLKRKKLYEQQIEQLGNFQLRNHDQI  143



>ref|XP_006837368.1| hypothetical protein AMTR_s00111p00112330 [Amborella trichopoda]
 gb|ERN00222.1| hypothetical protein AMTR_s00111p00112330 [Amborella trichopoda]
Length=227

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  784  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            A IQCLKRKRL+E+Q+EQL +FQ RIH Q++MLE
Sbjct  71   ATIQCLKRKRLFEEQVEQLRDFQYRIHIQILMLE  104



>ref|XP_010041560.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like isoform X2 [Eucalyptus grandis]
Length=218

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  787  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AI CLKRKRLYEQ+IEQL  FQL I DQ+IMLE
Sbjct  82   AILCLKRKRLYEQRIEQLRYFQLPIRDQIIMLE  114



>ref|XP_008464119.1| PREDICTED: uncharacterized protein LOC103502077 isoform X4 [Cucumis 
melo]
Length=121

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVL  469
            MF+R+FGK ++E+NAL ++EKL+ETLEM+EKKE  L
Sbjct  45   MFNRLFGKLEQEANALATLEKLSETLEMVEKKENDL  80



>ref|XP_008464118.1| PREDICTED: uncharacterized protein LOC103502077 isoform X3 [Cucumis 
melo]
Length=136

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVL  469
            MF+R+FGK ++E+NAL ++EKL+ETLEM+EKKE  L
Sbjct  45   MFNRLFGKLEQEANALATLEKLSETLEMVEKKENDL  80



>ref|XP_008464117.1| PREDICTED: uncharacterized protein LOC103502077 isoform X2 [Cucumis 
melo]
Length=139

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVL  469
            MF+R+FGK ++E+NAL ++EKL+ETLEM+EKKE  L
Sbjct  45   MFNRLFGKLEQEANALATLEKLSETLEMVEKKENDL  80



>ref|XP_010041559.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like isoform X1 [Eucalyptus grandis]
Length=237

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  787  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            AI CLKRKRLYEQ+IEQL  FQL I DQ+IMLE
Sbjct  101  AILCLKRKRLYEQRIEQLRYFQLPIRDQIIMLE  133



>ref|XP_008464115.1| PREDICTED: uncharacterized protein LOC103502077 isoform X1 [Cucumis 
melo]
 ref|XP_008464116.1| PREDICTED: uncharacterized protein LOC103502077 isoform X1 [Cucumis 
melo]
Length=144

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  362  MFSRIFGKPKEESNALTSIEKLNETLEMLEKKEKVL  469
            MF+R+FGK ++E+NAL ++EKL+ETLEM+EKKE  L
Sbjct  45   MFNRLFGKLEQEANALATLEKLSETLEMVEKKENDL  80



>gb|KHN40354.1| Vacuolar protein sorting-associated protein 32 like 2 [Glycine 
soja]
Length=124

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  805  RKRLYEQQIEQLGNFQLRIHDQMIMLE  885
            RK+LYE  IEQL NFQ+RIHDQMIMLE
Sbjct  2    RKKLYENHIEQLRNFQMRIHDQMIMLE  28



>ref|XP_004297109.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like [Fragaria vesca subsp. vesca]
Length=226

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +2

Query  362  MFSRIFGKPK--EESNALT--SIEKLNETLEMLEKKEKVLQkkasvevekakeFTRAKNK  529
            MF+R+ GK K  E   ALT  S++KLNE L+MLE++EKVL++KA+ E+EKAK F  AKN+
Sbjct  1    MFTRLLGKHKKDESHGALTRKSLKKLNEQLQMLEQQEKVLERKAAAELEKAKTFNNAKNR  60

Query  530  RVLLDCI  550
            +  L C+
Sbjct  61   KAALRCL  67



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1790173656348