BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14684_g1_i1 len=1374 path=[1:0-409 411:410-447 449:448-471
473:472-1373]

Length=1374
                                                                      Score     E

ref|XP_009621687.1|  PREDICTED: pentatricopeptide repeat-containi...    501   1e-168   
ref|XP_009762816.1|  PREDICTED: pentatricopeptide repeat-containi...    497   3e-167   
ref|XP_011092285.1|  PREDICTED: pentatricopeptide repeat-containi...    486   4e-165   
ref|XP_011092259.1|  PREDICTED: pentatricopeptide repeat-containi...    488   2e-163   
emb|CAN75306.1|  hypothetical protein VITISV_040403                     458   2e-149   Vitis vinifera
ref|XP_010661790.1|  PREDICTED: putative pentatricopeptide repeat...    453   6e-147   
ref|XP_010670405.1|  PREDICTED: pentatricopeptide repeat-containi...    437   1e-143   
ref|XP_004231185.2|  PREDICTED: pentatricopeptide repeat-containi...    432   5e-142   
gb|EYU32118.1|  hypothetical protein MIMGU_mgv1a019324mg                420   9e-139   
emb|CDP08816.1|  unnamed protein product                                422   4e-138   
gb|EPS65170.1|  hypothetical protein M569_09608                         400   4e-130   
ref|XP_010255652.1|  PREDICTED: pentatricopeptide repeat-containi...    400   4e-130   
ref|XP_007051809.1|  Basic helix-loop-helix DNA-binding superfami...    417   1e-129   
ref|XP_002511861.1|  pentatricopeptide repeat-containing protein,...    393   3e-125   Ricinus communis
ref|XP_008810412.1|  PREDICTED: pentatricopeptide repeat-containi...    354   1e-111   
ref|XP_010914721.1|  PREDICTED: pentatricopeptide repeat-containi...    348   3e-109   
ref|XP_008439351.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    313   7e-94    
ref|XP_010660692.1|  PREDICTED: pentatricopeptide repeat-containi...    303   1e-91    
ref|XP_002300144.1|  phosphoglycerate/bisphosphoglycerate mutase ...    303   2e-91    Populus trichocarpa [western balsam poplar]
ref|XP_011045805.1|  PREDICTED: pentatricopeptide repeat-containi...    302   4e-91    
ref|XP_004493063.1|  PREDICTED: pentatricopeptide repeat-containi...    301   4e-91    
emb|CBI21289.3|  unnamed protein product                                295   1e-89    
ref|XP_006338732.1|  PREDICTED: pentatricopeptide repeat-containi...    297   1e-89    
ref|XP_010908711.1|  PREDICTED: pentatricopeptide repeat-containi...    298   2e-89    
ref|XP_008813688.1|  PREDICTED: pentatricopeptide repeat-containi...    296   3e-89    
ref|XP_003624481.1|  Pentatricopeptide repeat-containing protein        296   6e-89    
ref|XP_010661013.1|  PREDICTED: pentatricopeptide repeat-containi...    291   6e-89    
ref|XP_010028951.1|  PREDICTED: pentatricopeptide repeat-containi...    295   9e-89    
ref|XP_008806115.1|  PREDICTED: pentatricopeptide repeat-containi...    295   1e-88    
ref|XP_010260583.1|  PREDICTED: pentatricopeptide repeat-containi...    296   1e-88    
gb|KHN28625.1|  Pentatricopeptide repeat-containing protein, chlo...    298   2e-88    
ref|XP_008231188.1|  PREDICTED: pentatricopeptide repeat-containi...    294   3e-88    
ref|XP_010538669.1|  PREDICTED: pentatricopeptide repeat-containi...    292   4e-88    
ref|XP_006597484.1|  PREDICTED: pentatricopeptide repeat-containi...    298   5e-88    
ref|XP_007161642.1|  hypothetical protein PHAVU_001G086300g             293   6e-88    
ref|XP_009599644.1|  PREDICTED: pentatricopeptide repeat-containi...    293   1e-87    
gb|KGN58242.1|  hypothetical protein Csa_3G598390                       293   1e-87    
ref|XP_009415688.1|  PREDICTED: pentatricopeptide repeat-containi...    293   1e-87    
ref|XP_009800271.1|  PREDICTED: pentatricopeptide repeat-containi...    292   1e-87    
ref|XP_004233581.1|  PREDICTED: pentatricopeptide repeat-containi...    292   1e-87    
ref|XP_009387668.1|  PREDICTED: pentatricopeptide repeat-containi...    292   1e-87    
ref|XP_010273754.1|  PREDICTED: putative pentatricopeptide repeat...    288   1e-87    
ref|XP_004306318.1|  PREDICTED: pentatricopeptide repeat-containi...    295   1e-87    
ref|XP_004304909.1|  PREDICTED: putative pentatricopeptide repeat...    291   2e-87    
ref|NP_001078415.1|  pentatricopeptide repeat-containing protein        286   3e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007214267.1|  hypothetical protein PRUPE_ppa025121mg             295   3e-87    
ref|XP_006436291.1|  hypothetical protein CICLE_v10033724mg             289   5e-87    
ref|XP_010943831.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    294   6e-87    
ref|XP_003629790.1|  Pentatricopeptide repeat-containing protein        296   7e-87    
ref|XP_006485864.1|  PREDICTED: pentatricopeptide repeat-containi...    288   8e-87    
ref|XP_009419424.1|  PREDICTED: pentatricopeptide repeat-containi...    289   1e-86    
ref|XP_002869909.1|  binding protein                                    288   1e-86    
ref|XP_008450012.1|  PREDICTED: pentatricopeptide repeat-containi...    290   1e-86    
ref|XP_010439529.1|  PREDICTED: pentatricopeptide repeat-containi...    288   2e-86    
ref|XP_010248645.1|  PREDICTED: pentatricopeptide repeat-containi...    288   2e-86    
gb|KCW54802.1|  hypothetical protein EUGRSUZ_I00741                     285   2e-86    
ref|XP_004504288.1|  PREDICTED: pentatricopeptide repeat-containi...    294   3e-86    
ref|XP_010101198.1|  hypothetical protein L484_015002                   284   3e-86    
ref|XP_010246449.1|  PREDICTED: pentatricopeptide repeat-containi...    293   4e-86    
ref|XP_008790066.1|  PREDICTED: pentatricopeptide repeat-containi...    293   4e-86    
ref|XP_007148025.1|  hypothetical protein PHAVU_006G174200g             293   5e-86    
ref|XP_010096042.1|  hypothetical protein L484_008698                   288   6e-86    
ref|XP_007031998.1|  Tetratricopeptide repeat (TPR)-like superfam...    288   7e-86    
ref|NP_001078414.1|  pentatricopeptide repeat-containing protein        286   7e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008225340.1|  PREDICTED: pentatricopeptide repeat-containi...    293   7e-86    
ref|XP_010904754.1|  PREDICTED: pentatricopeptide repeat-containi...    283   8e-86    
ref|XP_009378030.1|  PREDICTED: pentatricopeptide repeat-containi...    287   1e-85    
ref|XP_010682981.1|  PREDICTED: pentatricopeptide repeat-containi...    288   1e-85    
gb|KHM99224.1|  Pentatricopeptide repeat-containing protein, mito...    284   1e-85    
ref|XP_003608008.1|  Pentatricopeptide repeat-containing protein        296   1e-85    
gb|ABR17838.1|  unknown                                                 290   2e-85    Picea sitchensis
ref|XP_002278128.1|  PREDICTED: pentatricopeptide repeat-containi...    285   2e-85    Vitis vinifera
ref|XP_010502622.1|  PREDICTED: pentatricopeptide repeat-containi...    287   2e-85    
ref|XP_007047423.1|  Tetratricopeptide repeat (TPR)-like superfam...    286   2e-85    
ref|XP_010449130.1|  PREDICTED: pentatricopeptide repeat-containi...    285   3e-85    
gb|KGN56518.1|  hypothetical protein Csa_3G122420                       283   3e-85    
ref|XP_007212650.1|  hypothetical protein PRUPE_ppa018206mg             285   3e-85    
ref|XP_002305733.2|  hypothetical protein POPTR_0004s05810g             289   3e-85    Populus trichocarpa [western balsam poplar]
ref|XP_010248175.1|  PREDICTED: pentatricopeptide repeat-containi...    285   4e-85    
ref|XP_010918777.1|  PREDICTED: pentatricopeptide repeat-containi...    289   4e-85    
ref|XP_009392630.1|  PREDICTED: pentatricopeptide repeat-containi...    285   4e-85    
ref|XP_010449129.1|  PREDICTED: pentatricopeptide repeat-containi...    285   4e-85    
ref|XP_008225544.1|  PREDICTED: pentatricopeptide repeat-containi...    285   5e-85    
ref|XP_008776306.1|  PREDICTED: pentatricopeptide repeat-containi...    285   6e-85    
ref|XP_002303975.2|  pentatricopeptide repeat-containing family p...    282   7e-85    Populus trichocarpa [western balsam poplar]
ref|XP_010937492.1|  PREDICTED: pentatricopeptide repeat-containi...    288   8e-85    
ref|XP_010028149.1|  PREDICTED: pentatricopeptide repeat-containi...    284   9e-85    
ref|XP_006599001.1|  PREDICTED: pentatricopeptide repeat-containi...    284   1e-84    
emb|CBI33742.3|  unnamed protein product                                282   1e-84    
ref|XP_010999774.1|  PREDICTED: pentatricopeptide repeat-containi...    289   1e-84    
ref|XP_009388285.1|  PREDICTED: pentatricopeptide repeat-containi...    284   2e-84    
ref|XP_011025095.1|  PREDICTED: pentatricopeptide repeat-containi...    281   2e-84    
ref|XP_010430773.1|  PREDICTED: pentatricopeptide repeat-containi...    282   2e-84    
ref|XP_004295634.1|  PREDICTED: pentatricopeptide repeat-containi...    282   3e-84    
emb|CAN77232.1|  hypothetical protein VITISV_001089                     281   3e-84    Vitis vinifera
ref|XP_009121419.1|  PREDICTED: pentatricopeptide repeat-containi...    283   3e-84    
ref|XP_008341243.1|  PREDICTED: pentatricopeptide repeat-containi...    283   3e-84    
ref|XP_010068636.1|  PREDICTED: pentatricopeptide repeat-containi...    283   3e-84    
ref|XP_010315902.1|  PREDICTED: pentatricopeptide repeat-containi...    283   3e-84    
ref|XP_010916743.1|  PREDICTED: pentatricopeptide repeat-containi...    288   4e-84    
emb|CDY63199.1|  BnaA09g52240D                                          283   5e-84    
ref|XP_010274829.1|  PREDICTED: pentatricopeptide repeat-containi...    286   5e-84    
ref|XP_010100741.1|  hypothetical protein L484_005808                   287   6e-84    
ref|XP_002279137.1|  PREDICTED: pentatricopeptide repeat-containi...    282   6e-84    Vitis vinifera
gb|EYU38858.1|  hypothetical protein MIMGU_mgv1a002593mg                283   7e-84    
ref|XP_006395522.1|  hypothetical protein EUTSA_v10003772mg             283   7e-84    
gb|KDP41842.1|  hypothetical protein JCGZ_26860                         283   7e-84    
gb|EYU34329.1|  hypothetical protein MIMGU_mgv1a001967mg                284   8e-84    
ref|XP_004159154.1|  PREDICTED: uncharacterized protein LOC101226880    293   1e-83    
ref|XP_009352737.1|  PREDICTED: pentatricopeptide repeat-containi...    286   1e-83    
ref|XP_011094314.1|  PREDICTED: putative pentatricopeptide repeat...    281   1e-83    
ref|XP_006643885.1|  PREDICTED: pentatricopeptide repeat-containi...    281   1e-83    
ref|XP_010274720.1|  PREDICTED: pentatricopeptide repeat-containi...    281   2e-83    
ref|XP_004289184.1|  PREDICTED: pentatricopeptide repeat-containi...    280   2e-83    
ref|XP_008801333.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    284   2e-83    
ref|XP_007147940.1|  hypothetical protein PHAVU_006G167300g             280   3e-83    
ref|XP_011083605.1|  PREDICTED: pentatricopeptide repeat-containi...    281   3e-83    
ref|XP_004145727.1|  PREDICTED: uncharacterized protein LOC101212001    292   4e-83    
ref|XP_010655542.1|  PREDICTED: pentatricopeptide repeat-containi...    285   4e-83    
gb|KGN65613.1|  hypothetical protein Csa_1G470290                       285   4e-83    
ref|XP_007198996.1|  hypothetical protein PRUPE_ppa002176mg             281   4e-83    
ref|XP_004150218.1|  PREDICTED: pentatricopeptide repeat-containi...    286   5e-83    
ref|XP_009600379.1|  PREDICTED: pentatricopeptide repeat-containi...    276   5e-83    
ref|XP_008366040.1|  PREDICTED: pentatricopeptide repeat-containi...    285   5e-83    
ref|XP_002875341.1|  binding protein                                    280   5e-83    
ref|XP_007025334.1|  Pentatricopeptide, putative                        285   6e-83    
ref|XP_006413827.1|  hypothetical protein EUTSA_v10027143mg             278   7e-83    
ref|XP_006658490.1|  PREDICTED: pentatricopeptide repeat-containi...    278   8e-83    
gb|AHB18405.1|  pentatricopeptide repeat-containing protein             284   8e-83    
ref|XP_008791994.1|  PREDICTED: pentatricopeptide repeat-containi...    279   8e-83    
ref|XP_010241118.1|  PREDICTED: pentatricopeptide repeat-containi...    282   9e-83    
ref|XP_003632994.1|  PREDICTED: pentatricopeptide repeat-containi...    278   1e-82    
ref|NP_001042337.2|  Os01g0205200                                       280   1e-82    Oryza sativa Japonica Group [Japonica rice]
gb|KDO63496.1|  hypothetical protein CISIN_1g005512mg                   280   1e-82    
ref|XP_006446876.1|  hypothetical protein CICLE_v10017898mg             281   1e-82    
emb|CBI30711.3|  unnamed protein product                                280   1e-82    
emb|CBI31859.3|  unnamed protein product                                275   1e-82    
ref|XP_008388704.1|  PREDICTED: pentatricopeptide repeat-containi...    282   1e-82    
ref|XP_007159470.1|  hypothetical protein PHAVU_002G240000g             278   1e-82    
ref|XP_008777053.1|  PREDICTED: pentatricopeptide repeat-containi...    276   1e-82    
ref|XP_006290700.1|  hypothetical protein CARUB_v10016795mg             279   1e-82    
ref|XP_010518818.1|  PREDICTED: pentatricopeptide repeat-containi...    283   2e-82    
dbj|BAF00431.1|  hypothetical protein                                   279   2e-82    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078212.1|  pentatricopeptide repeat-containing protein        279   2e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514342.1|  PREDICTED: pentatricopeptide repeat-containi...    279   2e-82    
emb|CDM82055.1|  unnamed protein product                                278   3e-82    
ref|XP_006433564.1|  hypothetical protein CICLE_v10000630mg             277   3e-82    
ref|XP_008236588.1|  PREDICTED: pentatricopeptide repeat-containi...    281   3e-82    
gb|EMT07478.1|  hypothetical protein F775_00276                         279   4e-82    
ref|XP_002274432.2|  PREDICTED: pentatricopeptide repeat-containi...    280   4e-82    Vitis vinifera
ref|XP_010035215.1|  PREDICTED: pentatricopeptide repeat-containi...    280   4e-82    
ref|XP_006585174.1|  PREDICTED: pentatricopeptide repeat-containi...    281   4e-82    
ref|XP_006468878.1|  PREDICTED: pentatricopeptide repeat-containi...    278   5e-82    
gb|KDP32019.1|  hypothetical protein JCGZ_12480                         277   5e-82    
ref|XP_010912878.1|  PREDICTED: pentatricopeptide repeat-containi...    276   5e-82    
ref|XP_009782695.1|  PREDICTED: pentatricopeptide repeat-containi...    277   6e-82    
ref|XP_008350091.1|  PREDICTED: pentatricopeptide repeat-containi...    275   6e-82    
ref|XP_010242076.1|  PREDICTED: pentatricopeptide repeat-containi...    276   7e-82    
gb|EAZ03563.1|  hypothetical protein OsI_25699                          274   7e-82    Oryza sativa Indica Group [Indian rice]
ref|XP_010243344.1|  PREDICTED: pentatricopeptide repeat-containi...    275   7e-82    
gb|KDO81629.1|  hypothetical protein CISIN_1g007288mg                   276   9e-82    
ref|XP_009337652.1|  PREDICTED: putative pentatricopeptide repeat...    276   1e-81    
ref|XP_002267596.1|  PREDICTED: pentatricopeptide repeat-containi...    276   1e-81    Vitis vinifera
ref|XP_007205016.1|  hypothetical protein PRUPE_ppa003703mg             274   1e-81    
ref|XP_004973954.1|  PREDICTED: pentatricopeptide repeat-containi...    284   1e-81    
gb|KHN48006.1|  Pentatricopeptide repeat-containing protein, chlo...    281   1e-81    
ref|XP_003572732.1|  PREDICTED: pentatricopeptide repeat-containi...    277   1e-81    
ref|XP_010258198.1|  PREDICTED: pentatricopeptide repeat-containi...    278   1e-81    
ref|XP_008371807.1|  PREDICTED: pentatricopeptide repeat-containi...    276   1e-81    
ref|XP_008663973.1|  PREDICTED: pentatricopeptide repeat-containi...    283   1e-81    
ref|XP_010270856.1|  PREDICTED: putative pentatricopeptide repeat...    275   1e-81    
ref|XP_009768550.1|  PREDICTED: putative pentatricopeptide repeat...    276   2e-81    
ref|XP_008802225.1|  PREDICTED: pentatricopeptide repeat-containi...    279   2e-81    
emb|CAB45902.1|  putative protein (fragment)                            286   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007037265.1|  Tetratricopeptide repeat-like superfamily pr...    277   2e-81    
gb|KDP46510.1|  hypothetical protein JCGZ_08482                         277   2e-81    
ref|XP_009600225.1|  PREDICTED: pentatricopeptide repeat-containi...    275   2e-81    
emb|CDY00184.1|  BnaC09g01170D                                          276   2e-81    
ref|XP_008238575.1|  PREDICTED: pentatricopeptide repeat-containi...    275   2e-81    
ref|XP_009348813.1|  PREDICTED: pentatricopeptide repeat-containi...    273   2e-81    
ref|XP_007047157.1|  Pentatricopeptide repeat (PPR) superfamily p...    276   3e-81    
gb|KFK33599.1|  hypothetical protein AALP_AA5G034800                    276   3e-81    
ref|NP_001043491.2|  Os01g0600400                                       266   3e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010276178.1|  PREDICTED: putative pentatricopeptide repeat...    275   3e-81    
ref|XP_004294643.1|  PREDICTED: pentatricopeptide repeat-containi...    280   3e-81    
emb|CAN62101.1|  hypothetical protein VITISV_033310                     268   3e-81    Vitis vinifera
ref|XP_008804951.1|  PREDICTED: pentatricopeptide repeat-containi...    277   4e-81    
ref|XP_006469116.1|  PREDICTED: uncharacterized protein LOC102612526    285   4e-81    
ref|XP_004955182.1|  PREDICTED: pentatricopeptide repeat-containi...    273   4e-81    
ref|XP_009362269.1|  PREDICTED: pentatricopeptide repeat-containi...    275   4e-81    
ref|XP_006436815.1|  hypothetical protein CICLE_v10030936mg             275   4e-81    
ref|XP_008235102.1|  PREDICTED: pentatricopeptide repeat-containi...    273   4e-81    
emb|CDP08643.1|  unnamed protein product                                267   5e-81    
gb|EPS64087.1|  hypothetical protein M569_10688                         274   5e-81    
ref|XP_008454056.1|  PREDICTED: pentatricopeptide repeat-containi...    276   5e-81    
ref|XP_003633947.1|  PREDICTED: pentatricopeptide repeat-containi...    271   5e-81    
ref|XP_009380649.1|  PREDICTED: pentatricopeptide repeat-containi...    281   6e-81    
ref|XP_004305658.1|  PREDICTED: putative pentatricopeptide repeat...    274   6e-81    
gb|KDP28448.1|  hypothetical protein JCGZ_14219                         271   6e-81    
ref|XP_009372472.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    274   6e-81    
ref|XP_007208505.1|  hypothetical protein PRUPE_ppa026465mg             273   6e-81    
emb|CDP00394.1|  unnamed protein product                                276   6e-81    
ref|XP_008781334.1|  PREDICTED: pentatricopeptide repeat-containi...    270   6e-81    
ref|XP_011038529.1|  PREDICTED: pentatricopeptide repeat-containi...    278   7e-81    
ref|XP_010247889.1|  PREDICTED: pentatricopeptide repeat-containi...    274   8e-81    
gb|EMT00538.1|  hypothetical protein F775_11073                         282   8e-81    
ref|XP_004145327.1|  PREDICTED: pentatricopeptide repeat-containi...    274   8e-81    
ref|XP_006467621.1|  PREDICTED: pentatricopeptide repeat-containi...    279   8e-81    
ref|XP_011042533.1|  PREDICTED: pentatricopeptide repeat-containi...    273   8e-81    
ref|XP_006393385.1|  hypothetical protein EUTSA_v10011302mg             274   1e-80    
gb|KDO47355.1|  hypothetical protein CISIN_1g0064572mg                  273   1e-80    
gb|KDO79045.1|  hypothetical protein CISIN_1g038395mg                   269   1e-80    
emb|CDY40596.1|  BnaC06g02120D                                          277   1e-80    
ref|XP_007203758.1|  hypothetical protein PRUPE_ppa003558mg             272   1e-80    
ref|XP_002445851.1|  hypothetical protein SORBIDRAFT_07g026890          281   1e-80    Sorghum bicolor [broomcorn]
ref|XP_008462579.1|  PREDICTED: putative pentatricopeptide repeat...    273   1e-80    
gb|KHN17508.1|  Pentatricopeptide repeat-containing protein             274   1e-80    
ref|XP_009364458.1|  PREDICTED: pentatricopeptide repeat-containi...    278   1e-80    
gb|KCW90768.1|  hypothetical protein EUGRSUZ_A02839                     270   1e-80    
ref|XP_004485987.1|  PREDICTED: pentatricopeptide repeat-containi...    273   1e-80    
ref|XP_004143385.1|  PREDICTED: putative pentatricopeptide repeat...    273   1e-80    
ref|XP_009374255.1|  PREDICTED: pentatricopeptide repeat-containi...    276   1e-80    
ref|XP_004250510.1|  PREDICTED: pentatricopeptide repeat-containi...    274   1e-80    
ref|XP_002872815.1|  pentatricopeptide repeat-containing protein        276   1e-80    
ref|XP_011075783.1|  PREDICTED: pentatricopeptide repeat-containi...    275   1e-80    
ref|XP_011004546.1|  PREDICTED: pentatricopeptide repeat-containi...    272   1e-80    
gb|KCW50044.1|  hypothetical protein EUGRSUZ_K03486                     270   1e-80    
ref|XP_006588587.1|  PREDICTED: pentatricopeptide repeat-containi...    271   2e-80    
ref|XP_009147955.1|  PREDICTED: pentatricopeptide repeat-containi...    276   2e-80    
ref|XP_010260649.1|  PREDICTED: pentatricopeptide repeat-containi...    273   2e-80    
ref|XP_010250014.1|  PREDICTED: pentatricopeptide repeat-containi...    275   2e-80    
ref|XP_007016122.1|  Tetratricopeptide repeat (TPR)-like superfam...    275   2e-80    
ref|XP_007201172.1|  hypothetical protein PRUPE_ppa003481mg             271   2e-80    
ref|XP_008443463.1|  PREDICTED: pentatricopeptide repeat-containi...    278   2e-80    
ref|XP_001776621.1|  predicted protein                                  275   2e-80    
ref|XP_002323921.2|  hypothetical protein POPTR_0017s00440g             273   2e-80    Populus trichocarpa [western balsam poplar]
ref|XP_004156253.1|  PREDICTED: putative pentatricopeptide repeat...    272   2e-80    
ref|XP_002283791.1|  PREDICTED: pentatricopeptide repeat-containi...    271   2e-80    Vitis vinifera
emb|CAN72397.1|  hypothetical protein VITISV_041201                     271   2e-80    Vitis vinifera
ref|XP_006472235.1|  PREDICTED: putative pentatricopeptide repeat...    272   2e-80    
ref|XP_009384043.1|  PREDICTED: pentatricopeptide repeat-containi...    276   2e-80    
ref|XP_003541672.2|  PREDICTED: pentatricopeptide repeat-containi...    272   2e-80    
ref|XP_008225136.1|  PREDICTED: pentatricopeptide repeat-containi...    279   2e-80    
ref|XP_004304765.1|  PREDICTED: pentatricopeptide repeat-containi...    274   2e-80    
ref|XP_010106807.1|  hypothetical protein L484_005353                   272   2e-80    
ref|XP_008246376.1|  PREDICTED: putative pentatricopeptide repeat...    272   3e-80    
ref|XP_004304914.1|  PREDICTED: pentatricopeptide repeat-containi...    274   3e-80    
gb|KDO54539.1|  hypothetical protein CISIN_1g010575mg                   265   3e-80    
ref|XP_006354595.1|  PREDICTED: pentatricopeptide repeat-containi...    272   3e-80    
emb|CDX93683.1|  BnaA06g03650D                                          276   3e-80    
emb|CDP05407.1|  unnamed protein product                                272   3e-80    
emb|CDX79030.1|  BnaA01g10970D                                          271   3e-80    
ref|XP_008243533.1|  PREDICTED: putative pentatricopeptide repeat...    271   3e-80    
ref|XP_010941187.1|  PREDICTED: pentatricopeptide repeat-containi...    275   3e-80    
ref|XP_010243684.1|  PREDICTED: pentatricopeptide repeat-containi...    270   3e-80    
ref|XP_008220652.1|  PREDICTED: pentatricopeptide repeat-containi...    275   3e-80    
ref|XP_010929909.1|  PREDICTED: pentatricopeptide repeat-containi...    269   3e-80    
ref|XP_010921440.1|  PREDICTED: pentatricopeptide repeat-containi...    273   3e-80    
ref|XP_009417951.1|  PREDICTED: pentatricopeptide repeat-containi...    270   4e-80    
ref|XP_007206426.1|  hypothetical protein PRUPE_ppa001946mg             275   4e-80    
gb|KDP37060.1|  hypothetical protein JCGZ_06116                         265   4e-80    
ref|XP_006353232.1|  PREDICTED: pentatricopeptide repeat-containi...    272   4e-80    
ref|XP_010917757.1|  PREDICTED: pentatricopeptide repeat-containi...    274   4e-80    
gb|KDO43309.1|  hypothetical protein CISIN_1g040576mg                   272   5e-80    
ref|XP_010662540.1|  PREDICTED: pentatricopeptide repeat-containi...    272   5e-80    
ref|XP_010262488.1|  PREDICTED: pentatricopeptide repeat-containi...    270   5e-80    
ref|XP_008785055.1|  PREDICTED: pentatricopeptide repeat-containi...    275   5e-80    
ref|XP_009598931.1|  PREDICTED: putative pentatricopeptide repeat...    272   5e-80    
ref|XP_002277458.1|  PREDICTED: pentatricopeptide repeat-containi...    273   5e-80    Vitis vinifera
ref|XP_010271319.1|  PREDICTED: pentatricopeptide repeat-containi...    266   6e-80    
ref|XP_010922018.1|  PREDICTED: pentatricopeptide repeat-containi...    270   6e-80    
ref|XP_006339746.1|  PREDICTED: pentatricopeptide repeat-containi...    268   6e-80    
emb|CBI24015.3|  unnamed protein product                                270   6e-80    
ref|XP_008810240.1|  PREDICTED: pentatricopeptide repeat-containi...    270   6e-80    
gb|KFK36081.1|  hypothetical protein AALP_AA4G075000                    275   6e-80    
ref|XP_002322762.2|  hypothetical protein POPTR_0016s06560g             269   6e-80    Populus trichocarpa [western balsam poplar]
gb|KDP23699.1|  hypothetical protein JCGZ_23532                         275   6e-80    
ref|XP_010455917.1|  PREDICTED: pentatricopeptide repeat-containi...    275   6e-80    
gb|EYU46694.1|  hypothetical protein MIMGU_mgv1a022667mg                266   7e-80    
ref|XP_010264131.1|  PREDICTED: pentatricopeptide repeat-containi...    271   7e-80    
ref|XP_008778507.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    275   7e-80    
ref|XP_010038224.1|  PREDICTED: pentatricopeptide repeat-containi...    270   7e-80    
gb|EMS54140.1|  hypothetical protein TRIUR3_08732                       271   7e-80    
ref|XP_008787192.1|  PREDICTED: pentatricopeptide repeat-containi...    273   7e-80    
ref|XP_010106557.1|  hypothetical protein L484_025317                   272   7e-80    
ref|XP_008811403.1|  PREDICTED: pentatricopeptide repeat-containi...    273   7e-80    
ref|XP_011009779.1|  PREDICTED: pentatricopeptide repeat-containi...    271   8e-80    
gb|KDO48636.1|  hypothetical protein CISIN_1g005000mg                   273   8e-80    
ref|XP_008370927.1|  PREDICTED: putative pentatricopeptide repeat...    272   8e-80    
ref|XP_010931516.1|  PREDICTED: pentatricopeptide repeat-containi...    272   8e-80    
ref|XP_007207414.1|  hypothetical protein PRUPE_ppa014644mg             272   8e-80    
ref|XP_010061651.1|  PREDICTED: pentatricopeptide repeat-containi...    271   9e-80    
ref|XP_008379058.1|  PREDICTED: pentatricopeptide repeat-containi...    271   9e-80    
ref|XP_008785475.1|  PREDICTED: putative pentatricopeptide repeat...    274   9e-80    
ref|XP_010922662.1|  PREDICTED: putative pentatricopeptide repeat...    272   9e-80    
ref|XP_003550682.1|  PREDICTED: pentatricopeptide repeat-containi...    274   9e-80    
ref|XP_008377650.1|  PREDICTED: pentatricopeptide repeat-containi...    270   1e-79    
ref|XP_004230005.1|  PREDICTED: pentatricopeptide repeat-containi...    268   1e-79    
ref|XP_004136090.1|  PREDICTED: putative pentatricopeptide repeat...    273   1e-79    
ref|XP_006465305.1|  PREDICTED: putative pentatricopeptide repeat...    273   1e-79    
gb|ADE77505.1|  unknown                                                 268   1e-79    
ref|XP_004145320.1|  PREDICTED: pentatricopeptide repeat-containi...    273   1e-79    
ref|XP_010248664.1|  PREDICTED: pentatricopeptide repeat-containi...    272   1e-79    
gb|KCW90543.1|  hypothetical protein EUGRSUZ_A02655                     270   1e-79    
ref|XP_010906663.1|  PREDICTED: pentatricopeptide repeat-containi...    271   1e-79    
ref|XP_002302824.2|  hypothetical protein POPTR_0002s22590g             271   1e-79    
emb|CDP16379.1|  unnamed protein product                                270   1e-79    
ref|XP_009377863.1|  PREDICTED: putative pentatricopeptide repeat...    270   1e-79    
ref|XP_010265577.1|  PREDICTED: pentatricopeptide repeat-containi...    270   1e-79    
ref|XP_010325898.1|  PREDICTED: pentatricopeptide repeat-containi...    270   1e-79    
gb|EMT07476.1|  hypothetical protein F775_15307                         272   2e-79    
ref|XP_008781031.1|  PREDICTED: pentatricopeptide repeat-containi...    270   2e-79    
gb|KEH36690.1|  PPR containing plant-like protein                       270   2e-79    
gb|EYU25997.1|  hypothetical protein MIMGU_mgv1a020660mg                270   2e-79    
ref|XP_006466653.1|  PREDICTED: pentatricopeptide repeat-containi...    272   2e-79    
gb|EYU39273.1|  hypothetical protein MIMGU_mgv1a025401mg                270   2e-79    
ref|XP_006444275.1|  hypothetical protein CICLE_v10020732mg             263   2e-79    
ref|XP_008373135.1|  PREDICTED: pentatricopeptide repeat-containi...    274   2e-79    
ref|XP_004158817.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    273   2e-79    
ref|XP_010111526.1|  hypothetical protein L484_001076                   270   2e-79    
ref|XP_009362516.1|  PREDICTED: pentatricopeptide repeat-containi...    269   2e-79    
ref|XP_006380676.1|  hypothetical protein POPTR_0007s10370g             270   2e-79    
ref|XP_008338038.1|  PREDICTED: pentatricopeptide repeat-containi...    271   2e-79    
emb|CBI36868.3|  unnamed protein product                                268   2e-79    
ref|XP_010251319.1|  PREDICTED: pentatricopeptide repeat-containi...    269   2e-79    
ref|XP_009346255.1|  PREDICTED: pentatricopeptide repeat-containi...    274   2e-79    
ref|XP_004971712.1|  PREDICTED: putative pentatricopeptide repeat...    271   2e-79    
ref|XP_002267998.1|  PREDICTED: pentatricopeptide repeat-containi...    270   3e-79    
ref|XP_010323176.1|  PREDICTED: pentatricopeptide repeat-containi...    270   3e-79    
ref|XP_002309422.2|  hypothetical protein POPTR_0006s22800g             269   3e-79    
ref|XP_008799333.1|  PREDICTED: pentatricopeptide repeat-containi...    273   3e-79    
ref|XP_008456885.1|  PREDICTED: pentatricopeptide repeat-containi...    271   3e-79    
ref|XP_008457379.1|  PREDICTED: pentatricopeptide repeat-containi...    272   3e-79    
ref|XP_010274081.1|  PREDICTED: pentatricopeptide repeat-containi...    271   3e-79    
ref|XP_009134331.1|  PREDICTED: pentatricopeptide repeat-containi...    268   3e-79    
ref|XP_008391851.1|  PREDICTED: putative pentatricopeptide repeat...    269   3e-79    
ref|XP_006427322.1|  hypothetical protein CICLE_v10025000mg             272   3e-79    
ref|XP_011085507.1|  PREDICTED: pentatricopeptide repeat-containi...    271   3e-79    
ref|XP_002282081.2|  PREDICTED: pentatricopeptide repeat-containi...    267   3e-79    
emb|CAN70142.1|  hypothetical protein VITISV_032085                     272   3e-79    
ref|XP_010919614.1|  PREDICTED: pentatricopeptide repeat-containi...    268   3e-79    
ref|XP_010059751.1|  PREDICTED: putative pentatricopeptide repeat...    270   4e-79    
ref|NP_001059421.1|  Os07g0299800                                       270   4e-79    
ref|XP_010245702.1|  PREDICTED: pentatricopeptide repeat-containi...    269   4e-79    
ref|XP_010315403.1|  PREDICTED: pentatricopeptide repeat-containi...    276   4e-79    
ref|XP_010430241.1|  PREDICTED: pentatricopeptide repeat-containi...    272   4e-79    
gb|KDP38705.1|  hypothetical protein JCGZ_04058                         273   4e-79    
ref|XP_010047061.1|  PREDICTED: pentatricopeptide repeat-containi...    273   4e-79    
ref|XP_010257116.1|  PREDICTED: pentatricopeptide repeat-containi...    270   5e-79    
ref|XP_007214178.1|  hypothetical protein PRUPE_ppa019185mg             274   5e-79    
ref|XP_011039111.1|  PREDICTED: pentatricopeptide repeat-containi...    272   5e-79    
emb|CBI21243.3|  unnamed protein product                                272   5e-79    
ref|XP_010940859.1|  PREDICTED: pentatricopeptide repeat-containi...    266   5e-79    
ref|XP_009336304.1|  PREDICTED: putative pentatricopeptide repeat...    271   5e-79    
ref|XP_008457445.1|  PREDICTED: pentatricopeptide repeat-containi...    270   5e-79    
gb|KCW48819.1|  hypothetical protein EUGRSUZ_K02455                     268   5e-79    
ref|XP_010261135.1|  PREDICTED: pentatricopeptide repeat-containi...    269   5e-79    
ref|XP_008785897.1|  PREDICTED: pentatricopeptide repeat-containi...    266   6e-79    
ref|XP_008803874.1|  PREDICTED: pentatricopeptide repeat-containi...    267   6e-79    
ref|XP_006290208.1|  hypothetical protein CARUB_v10003899mg             271   6e-79    
ref|XP_006466530.1|  PREDICTED: pentatricopeptide repeat-containi...    268   6e-79    
gb|EAZ25232.1|  hypothetical protein OsJ_09035                          270   6e-79    
ref|XP_010921572.1|  PREDICTED: pentatricopeptide repeat-containi...    271   7e-79    
gb|EMT13280.1|  hypothetical protein F775_05245                         269   7e-79    
ref|XP_007038564.1|  Pentatricopeptide repeat-containing protein,...    268   7e-79    
ref|XP_008450526.1|  PREDICTED: putative pentatricopeptide repeat...    268   7e-79    
gb|KDO54538.1|  hypothetical protein CISIN_1g010575mg                   265   7e-79    
ref|XP_009412940.1|  PREDICTED: pentatricopeptide repeat-containi...    268   7e-79    
ref|XP_010230598.1|  PREDICTED: pentatricopeptide repeat-containi...    276   7e-79    
ref|XP_006445545.1|  hypothetical protein CICLE_v10014960mg             265   7e-79    
ref|XP_006425825.1|  hypothetical protein CICLE_v10024955mg             271   8e-79    
emb|CDY68156.1|  BnaAnng26310D                                          268   8e-79    
emb|CDM82015.1|  unnamed protein product                                276   8e-79    
emb|CDP09178.1|  unnamed protein product                                271   8e-79    
ref|XP_002275298.1|  PREDICTED: pentatricopeptide repeat-containi...    272   8e-79    
ref|XP_010683031.1|  PREDICTED: pentatricopeptide repeat-containi...    266   8e-79    
ref|XP_010928067.1|  PREDICTED: pentatricopeptide repeat-containi...    268   8e-79    
gb|KCW50540.1|  hypothetical protein EUGRSUZ_J00262                     270   9e-79    
emb|CDO96840.1|  unnamed protein product                                273   9e-79    
emb|CDY42793.1|  BnaC01g22730D                                          268   9e-79    
ref|XP_010521548.1|  PREDICTED: pentatricopeptide repeat-containi...    265   9e-79    
gb|KDP20037.1|  hypothetical protein JCGZ_05806                         274   1e-78    
ref|XP_008356686.1|  PREDICTED: pentatricopeptide repeat-containi...    272   1e-78    
ref|XP_010910301.1|  PREDICTED: pentatricopeptide repeat-containi...    273   1e-78    
gb|KGN45255.1|  hypothetical protein Csa_7G432370                       273   1e-78    
ref|XP_010533968.1|  PREDICTED: pentatricopeptide repeat-containi...    271   1e-78    
ref|XP_009366723.1|  PREDICTED: putative pentatricopeptide repeat...    268   1e-78    
ref|XP_006348495.1|  PREDICTED: pentatricopeptide repeat-containi...    275   1e-78    
ref|XP_010039060.1|  PREDICTED: pentatricopeptide repeat-containi...    268   1e-78    
gb|AAT64016.1|  putative pentatricopeptide repeat protein               272   1e-78    
ref|XP_002282128.1|  PREDICTED: pentatricopeptide repeat-containi...    266   1e-78    
ref|XP_010104643.1|  hypothetical protein L484_022020                   270   1e-78    
ref|XP_008799870.1|  PREDICTED: putative pentatricopeptide repeat...    270   1e-78    
ref|XP_007140043.1|  hypothetical protein PHAVU_008G079600g             270   1e-78    
ref|XP_010256086.1|  PREDICTED: pentatricopeptide repeat-containi...    270   1e-78    
ref|XP_010542661.1|  PREDICTED: pentatricopeptide repeat-containi...    270   1e-78    
ref|XP_008794371.1|  PREDICTED: pentatricopeptide repeat-containi...    270   1e-78    
gb|KEH23349.1|  PPR containing plant-like protein                       266   1e-78    
ref|XP_007139896.1|  hypothetical protein PHAVU_008G067700g             266   1e-78    
ref|XP_007041101.1|  Tetratricopeptide repeat (TPR)-like superfam...    267   1e-78    
ref|XP_010054980.1|  PREDICTED: pentatricopeptide repeat-containi...    265   1e-78    
ref|XP_007215279.1|  hypothetical protein PRUPE_ppa004841mg             264   2e-78    
ref|XP_007051479.1|  Pentatricopeptide repeat (PPR) superfamily p...    265   2e-78    
ref|XP_007029178.1|  Pentatricopeptide repeat (PPR) superfamily p...    268   2e-78    
ref|XP_010277978.1|  PREDICTED: pentatricopeptide repeat-containi...    266   2e-78    
ref|XP_004241167.1|  PREDICTED: pentatricopeptide repeat-containi...    270   2e-78    
ref|XP_004292662.1|  PREDICTED: uncharacterized protein LOC101314253    275   2e-78    
ref|XP_010275265.1|  PREDICTED: pentatricopeptide repeat-containi...    271   2e-78    
gb|AEB39777.1|  pentatricopeptide repeat protein 91                     273   2e-78    
ref|XP_010422542.1|  PREDICTED: pentatricopeptide repeat-containi...    271   2e-78    
ref|XP_004292867.1|  PREDICTED: pentatricopeptide repeat-containi...    265   2e-78    
ref|XP_006451657.1|  hypothetical protein CICLE_v10007619mg             269   2e-78    
ref|XP_007155872.1|  hypothetical protein PHAVU_003G238900g             267   2e-78    
ref|NP_192184.1|  pentatricopeptide repeat-containing protein           271   2e-78    
emb|CDP15436.1|  unnamed protein product                                268   2e-78    
ref|XP_010244917.1|  PREDICTED: pentatricopeptide repeat-containi...    268   2e-78    
gb|EMT25938.1|  hypothetical protein F775_17347                         271   2e-78    
gb|ACD56635.1|  putative pentatricopeptide repeat protein               268   2e-78    
ref|XP_011004222.1|  PREDICTED: putative pentatricopeptide repeat...    267   2e-78    
ref|XP_008439577.1|  PREDICTED: pentatricopeptide repeat-containi...    266   2e-78    
ref|XP_010548633.1|  PREDICTED: pentatricopeptide repeat-containi...    271   3e-78    
ref|XP_010109889.1|  hypothetical protein L484_013224                   270   3e-78    
ref|XP_010679561.1|  PREDICTED: pentatricopeptide repeat-containi...    267   3e-78    
emb|CBI30968.3|  unnamed protein product                                276   3e-78    
ref|XP_004288724.1|  PREDICTED: pentatricopeptide repeat-containi...    270   3e-78    
ref|XP_008787969.1|  PREDICTED: pentatricopeptide repeat-containi...    268   3e-78    
ref|XP_010031274.1|  PREDICTED: pentatricopeptide repeat-containi...    270   3e-78    
gb|KGN66343.1|  hypothetical protein Csa_1G598880                       265   3e-78    
ref|XP_006488968.1|  PREDICTED: pentatricopeptide repeat-containi...    265   3e-78    
ref|XP_008358674.1|  PREDICTED: pentatricopeptide repeat-containi...    273   3e-78    
ref|XP_009408591.1|  PREDICTED: pentatricopeptide repeat-containi...    268   3e-78    
ref|XP_004494285.1|  PREDICTED: pentatricopeptide repeat-containi...    266   3e-78    
ref|XP_010270723.1|  PREDICTED: pentatricopeptide repeat-containi...    271   4e-78    
ref|XP_010267483.1|  PREDICTED: pentatricopeptide repeat-containi...    263   4e-78    
gb|ACD56662.1|  putative pentatricopeptide                              270   4e-78    
ref|XP_010259532.1|  PREDICTED: pentatricopeptide repeat-containi...    265   4e-78    
ref|XP_006449535.1|  hypothetical protein CICLE_v10014413mg             269   4e-78    
gb|KDP31879.1|  hypothetical protein JCGZ_12340                         265   4e-78    
ref|XP_004308608.1|  PREDICTED: pentatricopeptide repeat-containi...    271   4e-78    
ref|XP_010313676.1|  PREDICTED: pentatricopeptide repeat-containi...    270   4e-78    
ref|XP_010542852.1|  PREDICTED: pentatricopeptide repeat-containi...    265   4e-78    
ref|XP_004956000.1|  PREDICTED: pentatricopeptide repeat-containi...    267   4e-78    
ref|XP_008453471.1|  PREDICTED: pentatricopeptide repeat-containi...    270   5e-78    
ref|XP_010256585.1|  PREDICTED: pentatricopeptide repeat-containi...    269   5e-78    
ref|XP_010252817.1|  PREDICTED: pentatricopeptide repeat-containi...    266   5e-78    
ref|XP_010552432.1|  PREDICTED: putative pentatricopeptide repeat...    265   5e-78    
ref|XP_010100697.1|  hypothetical protein L484_023466                   263   5e-78    
ref|XP_007210320.1|  hypothetical protein PRUPE_ppa002162mg             268   5e-78    
ref|XP_004144134.1|  PREDICTED: pentatricopeptide repeat-containi...    264   5e-78    
ref|XP_009611587.1|  PREDICTED: pentatricopeptide repeat-containi...    265   5e-78    
ref|XP_010931126.1|  PREDICTED: pentatricopeptide repeat-containi...    266   5e-78    
ref|XP_009768660.1|  PREDICTED: pentatricopeptide repeat-containi...    268   5e-78    
ref|NP_001042180.1|  Os01g0176300                                       267   5e-78    
ref|XP_010937131.1|  PREDICTED: pentatricopeptide repeat-containi...    268   5e-78    
gb|EMT16922.1|  hypothetical protein F775_05289                         263   5e-78    
ref|XP_008374684.1|  PREDICTED: pentatricopeptide repeat-containi...    272   6e-78    
ref|XP_010232898.1|  PREDICTED: pentatricopeptide repeat-containi...    268   6e-78    
ref|XP_002870024.1|  pentatricopeptide repeat-containing protein        271   6e-78    
ref|XP_010929172.1|  PREDICTED: pentatricopeptide repeat-containi...    269   6e-78    
emb|CBI15839.3|  unnamed protein product                                263   6e-78    
ref|XP_008803058.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    263   6e-78    
ref|XP_010680447.1|  PREDICTED: pentatricopeptide repeat-containi...    268   6e-78    
ref|XP_002274884.1|  PREDICTED: pentatricopeptide repeat-containi...    268   6e-78    
ref|XP_008230115.1|  PREDICTED: pentatricopeptide repeat-containi...    268   7e-78    
ref|XP_009410154.1|  PREDICTED: pentatricopeptide repeat-containi...    268   7e-78    
ref|XP_002882733.1|  pentatricopeptide repeat-containing protein        266   7e-78    
ref|XP_010920594.1|  PREDICTED: pentatricopeptide repeat-containi...    272   7e-78    
ref|XP_006480111.1|  PREDICTED: pentatricopeptide repeat-containi...    261   8e-78    
gb|KFK25048.1|  hypothetical protein AALP_AA8G059800                    260   8e-78    
ref|XP_004306162.1|  PREDICTED: putative pentatricopeptide repeat...    266   8e-78    
ref|XP_009404762.1|  PREDICTED: pentatricopeptide repeat-containi...    266   8e-78    
gb|KGN53015.1|  hypothetical protein Csa_4G011620                       267   8e-78    
ref|XP_009369855.1|  PREDICTED: pentatricopeptide repeat-containi...    268   8e-78    
ref|XP_011075559.1|  PREDICTED: pentatricopeptide repeat-containi...    267   9e-78    
ref|XP_006490750.1|  PREDICTED: pentatricopeptide repeat-containi...    269   9e-78    
ref|XP_006412675.1|  hypothetical protein EUTSA_v10024455mg             269   9e-78    
ref|XP_009607936.1|  PREDICTED: pentatricopeptide repeat-containi...    267   9e-78    
ref|XP_009380782.1|  PREDICTED: pentatricopeptide repeat-containi...    267   9e-78    
gb|KHN29477.1|  Pentatricopeptide repeat-containing protein, mito...    261   9e-78    
ref|XP_010657333.1|  PREDICTED: putative pentatricopeptide repeat...    268   9e-78    
gb|EPS57626.1|  hypothetical protein M569_17191                         266   9e-78    
ref|XP_010090626.1|  hypothetical protein L484_003942                   269   1e-77    
ref|XP_009622457.1|  PREDICTED: pentatricopeptide repeat-containi...    265   1e-77    
ref|XP_002314110.1|  pentatricopeptide repeat-containing family p...    268   1e-77    
ref|XP_009347240.1|  PREDICTED: pentatricopeptide repeat-containi...    267   1e-77    
ref|XP_009348084.1|  PREDICTED: pentatricopeptide repeat-containi...    267   1e-77    
ref|XP_010257292.1|  PREDICTED: pentatricopeptide repeat-containi...    268   1e-77    
ref|XP_011079701.1|  PREDICTED: pentatricopeptide repeat-containi...    261   1e-77    
emb|CBI20961.3|  unnamed protein product                                263   1e-77    
gb|KDO62894.1|  hypothetical protein CISIN_1g004024mg                   268   1e-77    
ref|XP_006588340.1|  PREDICTED: pentatricopeptide repeat-containi...    266   1e-77    
ref|XP_002458407.1|  hypothetical protein SORBIDRAFT_03g032890          267   1e-77    
ref|XP_011003599.1|  PREDICTED: pentatricopeptide repeat-containi...    267   1e-77    
gb|ACD56648.1|  putative pentatricopeptide repeat protein               269   1e-77    
ref|XP_004288820.1|  PREDICTED: pentatricopeptide repeat-containi...    266   1e-77    
emb|CAN80796.1|  hypothetical protein VITISV_034275                     268   1e-77    
gb|KCW82874.1|  hypothetical protein EUGRSUZ_C04243                     267   1e-77    
ref|XP_010913037.1|  PREDICTED: pentatricopeptide repeat-containi...    267   1e-77    
ref|XP_002279360.1|  PREDICTED: pentatricopeptide repeat-containi...    268   2e-77    
gb|KHN29377.1|  Pentatricopeptide repeat-containing protein, mito...    264   2e-77    



>ref|XP_009621687.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like 
[Nicotiana tomentosiformis]
 ref|XP_009621688.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like 
[Nicotiana tomentosiformis]
 ref|XP_009621689.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like 
[Nicotiana tomentosiformis]
Length=652

 Score =   501 bits (1291),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 231/321 (72%), Positives = 271/321 (84%), Gaps = 0/321 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G+L+ + VVTALL MY +   IES+R LFD L  +D+IAWS MI+AYAQS+ PSNA  
Sbjct  322  KQGYLRFVSVVTALLHMYGDLCEIESARSLFDRLKPRDLIAWSTMIAAYAQSELPSNAFD  381

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++ +MQ  + KPNE  + SLLQACSSMAA+++GE IH QV+K+   SN FL S LIDMYC
Sbjct  382  IYWQMQSANEKPNEIIYVSLLQACSSMAAEEIGEGIHAQVIKIVNISNPFLISSLIDMYC  441

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            KFGRI QG  IF E P+KDLICWSSMINGYG+NGHGN+ALECFLDML+ GI+PNDVVFIS
Sbjct  442  KFGRISQGTAIFSEFPNKDLICWSSMINGYGINGHGNKALECFLDMLNSGIKPNDVVFIS  501

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VLSACSHC LEYEGWNWF+AMEE++D+TPKLAHYACMVDMLSRQGN+EEALEFVN MPIE
Sbjct  502  VLSACSHCDLEYEGWNWFYAMEERFDVTPKLAHYACMVDMLSRQGNIEEALEFVNNMPIE  561

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PDKRIWG LLAGCRKT  S+EISE+VAK+LI+LDP N SY+VILSNLYA+QGRW EVE+L
Sbjct  562  PDKRIWGTLLAGCRKTRVSTEISEIVAKRLIALDPENTSYFVILSNLYAEQGRWKEVEEL  621

Query  902  RQLMDGKKRKKGMGYSVVEVN  964
            RQLMD K  KK +GYS++E +
Sbjct  622  RQLMDEKNLKKELGYSLIETS  642


 Score =   119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 131/253 (52%), Gaps = 5/253 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   +P+VTAL+ +Y+ + N++++  LF+    KD+I WSAM+SA  +S +  +A+ 
Sbjct  121  KLGFELELPIVTALVGVYSTW-NMDAALKLFNRTRYKDVILWSAMVSACVKSGEYVDAIE  179

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +FR+M     +PN  +   ++ AC+++ A  VG+ IH   MK+ + S+  + + L+DMY 
Sbjct  180  LFRKMLSSSVEPNYISIVGIVPACANLGALKVGKEIHAYSMKISFISHVNIQNSLVDMYA  239

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +     +F     KDL+ W +MI+G   N   NEAL  F  M     +P+D V   
Sbjct  240  KCGSLKASVAVFRGIEKKDLVSWRTMIHGCVENDRFNEALSLFSQMRYCCFEPDDSVIRE  299

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            V+ A S    E +    FH++  K      ++    ++ M      +E A    +++  +
Sbjct  300  VIGALSELD-EIKIGQCFHSLVLKQGYLRFVSVVTALLHMYGDLCEIESARSLFDRL--K  356

Query  722  PDKRI-WGALLAG  757
            P   I W  ++A 
Sbjct  357  PRDLIAWSTMIAA  369


 Score =   117 bits (294),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 80/339 (24%), Positives = 158/339 (47%), Gaps = 19/339 (6%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K  F+  + +  +L+ MYA  G++++S  +F  + +KD+++W  MI    ++D+ + AL+
Sbjct  221  KISFISHVNIQNSLVDMYAKCGSLKASVAVFRGIEKKDLVSWRTMIHGCVENDRFNEALS  280

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F +M+    +P++     ++ A S +    +G+  H+ V+K GY     + + L+ MY 
Sbjct  281  LFSQMRYCCFEPDDSVIREVIGALSELDEIKIGQCFHSLVLKQGYLRFVSVVTALLHMYG  340

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
                I   +++FD    +DLI WS+MI  Y  +   + A + +  M S   +PN+++++S
Sbjct  341  DLCEIESARSLFDRLKPRDLIAWSTMIAAYAQSELPSNAFDIYWQMQSANEKPNEIIYVS  400

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L ACS    E  G    HA   K          + ++DM  + G + +     ++ P  
Sbjct  401  LLQACSSMAAEEIG-EGIHAQVIKIVNISNPFLISSLIDMYCKFGRISQGTAIFSEFP-N  458

Query  722  PDKRIWGALLAGCR-KTHGSSEISELVAKQLISLDPTNASYYVILSN-------------  859
             D   W +++ G     HG+  +   +      + P +  +  +LS              
Sbjct  459  KDLICWSSMINGYGINGHGNKALECFLDMLNSGIKPNDVVFISVLSACSHCDLEYEGWNW  518

Query  860  LYADQGRWDEVEKLRQ---LMDGKKRKKGMGYSVVEVNN  967
             YA + R+D   KL     ++D   R+  +  ++  VNN
Sbjct  519  FYAMEERFDVTPKLAHYACMVDMLSRQGNIEEALEFVNN  557


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 105/218 (48%), Gaps = 5/218 (2%)
 Frame = +2

Query  107  QKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGET  286
            ++++ +W++ IS   + +Q   A+  F+ M     KPN     S+++A  ++  +     
Sbjct  57   KQNVRSWTSKISNLVRENQSIEAINFFKTMLRNEHKPNYVTVLSVIRAAENL--ESTARC  114

Query  287  IHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGH  466
            +H   +KLG+     + + L+ +Y  +  +     +F+    KD+I WS+M++    +G 
Sbjct  115  VHGFAIKLGFELELPIVTALVGVYSTWN-MDAALKLFNRTRYKDVILWSAMVSACVKSGE  173

Query  467  GNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYA  646
              +A+E F  MLS  ++PN +  + ++ AC++ G    G    HA   K      +    
Sbjct  174  YVDAIELFRKMLSSSVEPNYISIVGIVPACANLGALKVG-KEIHAYSMKISFISHVNIQN  232

Query  647  CMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
             +VDM ++ G+++ ++     +  + D   W  ++ GC
Sbjct  233  SLVDMYAKCGSLKASVAVFRGIE-KKDLVSWRTMIHGC  269



>ref|XP_009762816.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like 
[Nicotiana sylvestris]
Length=629

 Score =   497 bits (1280),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 230/321 (72%), Positives = 271/321 (84%), Gaps = 0/321 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G+ + + VVTALL MY +FG+IES+R LFD L  KD+IAWS MI+AYAQS+ PSNA  
Sbjct  308  KQGYSRSVSVVTALLHMYGDFGDIESARSLFDHLKPKDLIAWSTMIAAYAQSELPSNAFD  367

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++++M+  + KPNE  + SLL+ACSSMAA+++GE IH QV+K+G TSNAFL S LIDMYC
Sbjct  368  IYQQMRSANEKPNEIIYVSLLRACSSMAAEEIGEGIHAQVVKIGNTSNAFLISSLIDMYC  427

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            KFGRI QG+ IF E P KDLICWSSMINGYG+NGHGNEAL+CFLDML+ GI+PNDVVFIS
Sbjct  428  KFGRISQGEAIFSECPSKDLICWSSMINGYGINGHGNEALQCFLDMLNTGIKPNDVVFIS  487

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
             LSACSHCGLEYE WNWF+AMEE++ +TPKLAHYACMVDMLSRQGNVEEALEFVN MP+E
Sbjct  488  ALSACSHCGLEYEAWNWFYAMEERFSVTPKLAHYACMVDMLSRQGNVEEALEFVNNMPVE  547

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PDKRIWG LLAGCRKT  S EI E+VAK+LI+LDP N S +VILSNLYA+QGRW EVE+L
Sbjct  548  PDKRIWGTLLAGCRKTCISIEICEIVAKRLIALDPENTSSFVILSNLYAEQGRWKEVEQL  607

Query  902  RQLMDGKKRKKGMGYSVVEVN  964
            RQLMD K  KK  GYS++E +
Sbjct  608  RQLMDEKNLKKDFGYSLIETS  628


 Score =   119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/252 (28%), Positives = 131/252 (52%), Gaps = 2/252 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            KS F+  + +  +L+ MYA  G++++S  +F  + +KD+++W  MI    ++D  S +L+
Sbjct  207  KSLFISHVNIQNSLVDMYAKCGSLKTSLTVFHGIEKKDLVSWRTMIHGCVENDSFSESLS  266

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M+    +P+E     ++ A S +    +G+  H+ V+K GY+ +  + + L+ MY 
Sbjct  267  LFSEMRYCCYEPDESVIREVIGALSQLDEIKIGQCFHSLVLKQGYSRSVSVVTALLHMYG  326

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
             FG I   +++FD    KDLI WS+MI  Y  +   + A + +  M S   +PN+++++S
Sbjct  327  DFGDIESARSLFDHLKPKDLIAWSTMIAAYAQSELPSNAFDIYQQMRSANEKPNEIIYVS  386

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L ACS    E  G    HA   K   T      + ++DM  + G + +     ++ P  
Sbjct  387  LLRACSSMAAEEIG-EGIHAQVVKIGNTSNAFLISSLIDMYCKFGRISQGEAIFSECP-S  444

Query  722  PDKRIWGALLAG  757
             D   W +++ G
Sbjct  445  KDLICWSSMING  456


 Score =   100 bits (249),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 79/285 (28%), Positives = 143/285 (50%), Gaps = 5/285 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   +PVVTAL+ +  +  +++++  LFD    KD+I WSAM+SA  +S +   A+ 
Sbjct  107  KMGFELELPVVTALVGV-NSIWDMDTAWKLFDHTRGKDVILWSAMVSACVKSGEYVEAVE  165

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +FR+M     +PN  +   ++ AC+++ A  VG+ IH   +K  + S+  + + L+DMY 
Sbjct  166  LFRKMLSFGVEPNYVSIVGIVPACANLGALKVGKEIHAYSIKSLFISHVNIQNSLVDMYA  225

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +    T+F     KDL+ W +MI+G   N   +E+L  F +M     +P++ V   
Sbjct  226  KCGSLKTSLTVFHGIEKKDLVSWRTMIHGCVENDSFSESLSLFSEMRYCCYEPDESVIRE  285

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            V+ A S    E +    FH++  K   +  ++    ++ M    G++E A    + +  +
Sbjct  286  VIGALSQLD-EIKIGQCFHSLVLKQGYSRSVSVVTALLHMYGDFGDIESARSLFDHL--K  342

Query  722  PDKRI-WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
            P   I W  ++A   ++   S   ++  +   + +  N   YV L
Sbjct  343  PKDLIAWSTMIAAYAQSELPSNAFDIYQQMRSANEKPNEIIYVSL  387


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/218 (25%), Positives = 106/218 (49%), Gaps = 5/218 (2%)
 Frame = +2

Query  107  QKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGET  286
            ++++ +W++ IS+  + +Q   A+ +F+ M     KPN     S+++A         G  
Sbjct  43   KQNVRSWTSKISSLVRENQSIEAIYLFKTMLRNEHKPNYVTVLSIIRAVEKWEPMVKG--  100

Query  287  IHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGH  466
            IH   +K+G+     + + L+ +   +  +     +FD    KD+I WS+M++    +G 
Sbjct  101  IHGFTIKMGFELELPVVTALVGVNSIWD-MDTAWKLFDHTRGKDVILWSAMVSACVKSGE  159

Query  467  GNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYA  646
              EA+E F  MLS G++PN V  + ++ AC++ G    G    HA   K      +    
Sbjct  160  YVEAVELFRKMLSFGVEPNYVSIVGIVPACANLGALKVG-KEIHAYSIKSLFISHVNIQN  218

Query  647  CMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
             +VDM ++ G+++ +L   + +  + D   W  ++ GC
Sbjct  219  SLVDMYAKCGSLKTSLTVFHGIE-KKDLVSWRTMIHGC  255



>ref|XP_011092285.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, 
chloroplastic isoform X2 [Sesamum indicum]
Length=477

 Score =   486 bits (1252),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 222/318 (70%), Positives = 259/318 (81%), Gaps = 0/318 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   I V+T LLQ+Y  FG+I+S+R +FD L  KD IAWS+MI+ YAQS QP NA  
Sbjct  160  KMGFTAFISVMTELLQVYVKFGDIDSARNIFDQLKYKDFIAWSSMIAVYAQSTQPKNAFD  219

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            + R MQL   KPNEF F SLL AC+S+ A+++GE+IH Q+ K G+++NAFL S LIDMYC
Sbjct  220  ILREMQLADQKPNEFTFVSLLMACTSLDAKEIGESIHAQITKDGHSTNAFLTSALIDMYC  279

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K GR  +GK +FDENP KDLICWSSMINGYG+NG G EAL CF +MLS+GI+PNDVVFIS
Sbjct  280  KLGRTSEGKAVFDENPSKDLICWSSMINGYGINGCGEEALHCFSNMLSYGIEPNDVVFIS  339

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +LSACSHCGLEYEGWNWFHAME  Y + PKLAHYACMVDMLSRQGN+EEALEFVN MPIE
Sbjct  340  LLSACSHCGLEYEGWNWFHAMESMYGVKPKLAHYACMVDMLSRQGNIEEALEFVNNMPIE  399

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD+RIWGALLAGCR  HG +EI E+VAK+LISLDP N SYYV+LSNLYADQGRW+EVEKL
Sbjct  400  PDRRIWGALLAGCRNIHGPTEILEIVAKKLISLDPENTSYYVVLSNLYADQGRWEEVEKL  459

Query  902  RQLMDGKKRKKGMGYSVV  955
            R ++D K  KK M YS +
Sbjct  460  RNMIDTKPLKKVMAYSTI  477


 Score = 98.6 bits (244),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 116/242 (48%), Gaps = 3/242 (1%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
             +L+ MY+   N+ES+  +F  +  KDII+W  MI    +++ P  AL +F  +     K
Sbjct  69   NSLMDMYSKCRNLESALQVFRHMENKDIISWRIMIHGSVENEIPEKALLLFLELLACSVK  128

Query  215  -PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKT  391
              +E     +L A S +    + E +H+ V K+G+T+   + + L+ +Y KFG I   + 
Sbjct  129  GVDECIIQDVLGAYSQLDENHIREGLHSLVFKMGFTAFISVMTELLQVYVKFGDIDSARN  188

Query  392  IFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGL  571
            IFD+   KD I WSSMI  Y  +     A +   +M     +PN+  F+S+L AC+    
Sbjct  189  IFDQLKYKDFIAWSSMIAVYAQSTQPKNAFDILREMQLADQKPNEFTFVSLLMACTSLDA  248

Query  572  EYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALL  751
            +  G +  HA   K   +      + ++DM  + G   E     ++ P   D   W +++
Sbjct  249  KEIGES-IHAQITKDGHSTNAFLTSALIDMYCKLGRTSEGKAVFDENP-SKDLICWSSMI  306

Query  752  AG  757
             G
Sbjct  307  NG  308


 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 50/105 (48%), Gaps = 0/105 (0%)
 Frame = +2

Query  134  MISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLG  313
            M+ A   +++   A  + + M L   +PN     S+L AC+ +AA  +G  IH   +K  
Sbjct  1    MVLACVSNEEYLEAFKLVKEMMLFDIQPNHVTISSILPACADLAALKLGREIHGYSIKRP  60

Query  314  YTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMING  448
               +    + L+DMY K   +     +F    +KD+I W  MI+G
Sbjct  61   LYCHTSCQNSLMDMYSKCRNLESALQVFRHMENKDIISWRIMIHG  105



>ref|XP_011092259.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, 
chloroplastic isoform X1 [Sesamum indicum]
 ref|XP_011092267.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, 
chloroplastic isoform X1 [Sesamum indicum]
 ref|XP_011092276.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, 
chloroplastic isoform X1 [Sesamum indicum]
Length=639

 Score =   488 bits (1255),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 222/318 (70%), Positives = 259/318 (81%), Gaps = 0/318 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   I V+T LLQ+Y  FG+I+S+R +FD L  KD IAWS+MI+ YAQS QP NA  
Sbjct  322  KMGFTAFISVMTELLQVYVKFGDIDSARNIFDQLKYKDFIAWSSMIAVYAQSTQPKNAFD  381

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            + R MQL   KPNEF F SLL AC+S+ A+++GE+IH Q+ K G+++NAFL S LIDMYC
Sbjct  382  ILREMQLADQKPNEFTFVSLLMACTSLDAKEIGESIHAQITKDGHSTNAFLTSALIDMYC  441

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K GR  +GK +FDENP KDLICWSSMINGYG+NG G EAL CF +MLS+GI+PNDVVFIS
Sbjct  442  KLGRTSEGKAVFDENPSKDLICWSSMINGYGINGCGEEALHCFSNMLSYGIEPNDVVFIS  501

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +LSACSHCGLEYEGWNWFHAME  Y + PKLAHYACMVDMLSRQGN+EEALEFVN MPIE
Sbjct  502  LLSACSHCGLEYEGWNWFHAMESMYGVKPKLAHYACMVDMLSRQGNIEEALEFVNNMPIE  561

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD+RIWGALLAGCR  HG +EI E+VAK+LISLDP N SYYV+LSNLYADQGRW+EVEKL
Sbjct  562  PDRRIWGALLAGCRNIHGPTEILEIVAKKLISLDPENTSYYVVLSNLYADQGRWEEVEKL  621

Query  902  RQLMDGKKRKKGMGYSVV  955
            R ++D K  KK M YS +
Sbjct  622  RNMIDTKPLKKVMAYSTI  639


 Score = 99.4 bits (246),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 116/241 (48%), Gaps = 3/241 (1%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK-  214
            +L+ MY+   N+ES+  +F  +  KDII+W  MI    +++ P  AL +F  +     K 
Sbjct  232  SLMDMYSKCRNLESALQVFRHMENKDIISWRIMIHGSVENEIPEKALLLFLELLACSVKG  291

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
             +E     +L A S +    + E +H+ V K+G+T+   + + L+ +Y KFG I   + I
Sbjct  292  VDECIIQDVLGAYSQLDENHIREGLHSLVFKMGFTAFISVMTELLQVYVKFGDIDSARNI  351

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            FD+   KD I WSSMI  Y  +     A +   +M     +PN+  F+S+L AC+    +
Sbjct  352  FDQLKYKDFIAWSSMIAVYAQSTQPKNAFDILREMQLADQKPNEFTFVSLLMACTSLDAK  411

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
              G +  HA   K   +      + ++DM  + G   E     ++ P   D   W +++ 
Sbjct  412  EIGES-IHAQITKDGHSTNAFLTSALIDMYCKLGRTSEGKAVFDENP-SKDLICWSSMIN  469

Query  755  G  757
            G
Sbjct  470  G  470


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 75/142 (53%), Gaps = 1/142 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            + +VTAL+ +Y+N+ ++ S+  LF+    KD++  SAM+ A   +++   A  + + M L
Sbjct  127  VSIVTALIGVYSNW-DMGSAWKLFNRTPNKDVVLCSAMVLACVSNEEYLEAFKLVKEMML  185

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
               +PN     S+L AC+ +AA  +G  IH   +K     +    + L+DMY K   +  
Sbjct  186  FDIQPNHVTISSILPACADLAALKLGREIHGYSIKRPLYCHTSCQNSLMDMYSKCRNLES  245

Query  383  GKTIFDENPDKDLICWSSMING  448
               +F    +KD+I W  MI+G
Sbjct  246  ALQVFRHMENKDIISWRIMIHG  267


 Score = 74.7 bits (182),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 104/218 (48%), Gaps = 22/218 (10%)
 Frame = +2

Query  92   FDSLSQKDII-AWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAA  268
            F+  +Q D+  +W++ IS+  +  +P  A+ +F+ M +   +PN     S+++A   + +
Sbjct  47   FEYFNQNDLPKSWTSKISSLVREYRPQEAMGLFKAMLVNEQRPNFVTVLSVIRAVGLLGS  106

Query  269  QDVGETIHTQVMKLGYT-SNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMIN  445
            +++   IH   +K+G   S   + + LI +Y  +  +     +F+  P+KD++  S+M+ 
Sbjct  107  KNLVCGIHGYSIKMGLIDSQVSIVTALIGVYSNWD-MGSAWKLFNRTPNKDVVLCSAMVL  165

Query  446  GYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACS-----HCGLEYEGWNWFHAMEE  610
                N    EA +   +M+   IQPN V   S+L AC+       G E  G         
Sbjct  166  ACVSNEEYLEAFKLVKEMMLFDIQPNHVTISSILPACADLAALKLGREIHG---------  216

Query  611  KYDIT-PKLAHYAC---MVDMLSRQGNVEEALEFVNKM  712
             Y I  P   H +C   ++DM S+  N+E AL+    M
Sbjct  217  -YSIKRPLYCHTSCQNSLMDMYSKCRNLESALQVFRHM  253



>emb|CAN75306.1| hypothetical protein VITISV_040403 [Vitis vinifera]
Length=826

 Score =   458 bits (1178),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 212/319 (66%), Positives = 262/319 (82%), Gaps = 0/319 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G L  + + TALLQMYA FG +ES+ I+FD L++KD I+WSAMIS +A S  P NAL 
Sbjct  318  KNGLLAFVSIGTALLQMYAKFGELESAIIVFDQLNKKDYISWSAMISVHAHSRHPYNALE  377

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             F++MQ    +PNE  F SLLQACS + AQ++GE+I     K GY SNAFL+S LID+YC
Sbjct  378  TFKQMQSTDERPNEITFVSLLQACSLIGAQELGESIQAHATKAGYLSNAFLSSALIDLYC  437

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            KFGRI+QG+ IF+E P KDL+CWSSMINGYG+NG G+EALE F +ML+ G++PN+VVFIS
Sbjct  438  KFGRINQGRAIFNEIPTKDLVCWSSMINGYGLNGCGDEALETFSNMLACGVKPNEVVFIS  497

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VLSACSHCGLE+EGW+ F +ME+KY I PKL HYACMVD++SR+GN+E AL+FVNKMP+E
Sbjct  498  VLSACSHCGLEHEGWSCFSSMEQKYGIIPKLPHYACMVDLISRRGNIEGALQFVNKMPME  557

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PDKRIWGALLAGCR THGS EI+ELVA++LI LDP N SYYVILSNLYA+QGRW +VE+L
Sbjct  558  PDKRIWGALLAGCRSTHGSIEIAELVAERLIGLDPQNTSYYVILSNLYAEQGRWGDVERL  617

Query  902  RQLMDGKKRKKGMGYSVVE  958
            R+L+D K  KK MGYS++E
Sbjct  618  RKLVDEKGLKKEMGYSMIE  636


 Score =   119 bits (299),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/253 (29%), Positives = 124/253 (49%), Gaps = 4/253 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K  F     V  +L+ MYA   N ++S ++FD + +KD+I+W+ +I    ++D P  A  
Sbjct  217  KKMFHPLTNVHNSLVDMYAKCRNFKASMLVFDQILEKDLISWTTIIRGCIENDCPREAFK  276

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             F RMQ      +E     L+ A         G   H  ++K G  +   + + L+ MY 
Sbjct  277  AFSRMQFSCFGADETIVQDLIVAIIQADEHKFGIAFHGFLLKNGLLAFVSIGTALLQMYA  336

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            KFG +     +FD+   KD I WS+MI+ +  + H   ALE F  M S   +PN++ F+S
Sbjct  337  KFGELESAIIVFDQLNKKDYISWSAMISVHAHSRHPYNALETFKQMQSTDERPNEITFVS  396

Query  542  VLSACSHCGLEYEGWN-WFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            +L ACS  G +  G +   HA +  Y     L+  + ++D+  + G + +     N++P 
Sbjct  397  LLQACSLIGAQELGESIQAHATKAGYLSNAFLS--SALIDLYCKFGRINQGRAIFNEIPT  454

Query  719  EPDKRIWGALLAG  757
            + D   W +++ G
Sbjct  455  K-DLVCWSSMING  466


 Score =   106 bits (264),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 113/218 (52%), Gaps = 3/218 (1%)
 Frame = +2

Query  107  QKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGET  286
            + ++I+W++ IS+  + +Q   A+ +F+ M +   +PN     S+++A S +  +D+   
Sbjct  51   KDNVISWTSKISSLVKQNQSELAVGLFKMMLMTEQRPNHVTVLSVIRAISGLGLEDMMRV  110

Query  287  IHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGH  466
            I   V+KLG+ S   +A+ LI  Y  +      K IF++ P KDL+ WS+M++    +G 
Sbjct  111  ICGSVIKLGFESEVSVATALIGFYSDYDMGIVWK-IFNQTPIKDLVLWSAMVSACVKSGQ  169

Query  467  GNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYA  646
              EA E F  M   G++PN V  +S+L AC++ G    G    H    K    P    + 
Sbjct  170  YGEAFEIFRAMQYDGVEPNHVSIVSILPACANVGALLFG-KEIHGFSIKKMFHPLTNVHN  228

Query  647  CMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
             +VDM ++  N + ++   +++ +E D   W  ++ GC
Sbjct  229  SLVDMYAKCRNFKASMLVFDQI-LEKDLISWTTIIRGC  265


 Score = 92.8 bits (229),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 123/251 (49%), Gaps = 3/251 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   + V TAL+  Y+++ ++     +F+    KD++ WSAM+SA  +S Q   A  
Sbjct  117  KLGFESEVSVATALIGFYSDY-DMGIVWKIFNQTPIKDLVLWSAMVSACVKSGQYGEAFE  175

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +FR MQ +  +PN  +  S+L AC+++ A   G+ IH   +K  +     + + L+DMY 
Sbjct  176  IFRAMQYDGVEPNHVSIVSILPACANVGALLFGKEIHGFSIKKMFHPLTNVHNSLVDMYA  235

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K         +FD+  +KDLI W+++I G   N    EA + F  M       ++ +   
Sbjct  236  KCRNFKASMLVFDQILEKDLISWTTIIRGCIENDCPREAFKAFSRMQFSCFGADETIVQD  295

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            ++ A      E++    FH    K  +   ++    ++ M ++ G +E A+   +++  +
Sbjct  296  LIVAIIQAD-EHKFGIAFHGFLLKNGLLAFVSIGTALLQMYAKFGELESAIIVFDQLN-K  353

Query  722  PDKRIWGALLA  754
             D   W A+++
Sbjct  354  KDYISWSAMIS  364



>ref|XP_010661790.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g01580 [Vitis vinifera]
Length=868

 Score =   453 bits (1165),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 210/315 (67%), Positives = 258/315 (82%), Gaps = 0/315 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G L  + + TALLQMYA FG +ES+ I+FD L++KD I+WSAMIS +A S  P NAL 
Sbjct  318  KNGLLAFVSIGTALLQMYAKFGELESAIIVFDQLNKKDYISWSAMISVHAHSRHPYNALE  377

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             F++MQ    +PNE  F SLLQACS + AQ++GE+I     K GY SNAFL+S LID+YC
Sbjct  378  TFKQMQSTDERPNEITFVSLLQACSLIGAQELGESIQAHATKAGYLSNAFLSSALIDLYC  437

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            KFGRI+QG+ IF+E P KDL+CWSSMINGYG+NG G+EALE F +ML+ G++PN+VVFIS
Sbjct  438  KFGRINQGRAIFNEIPTKDLVCWSSMINGYGLNGCGDEALETFSNMLACGVKPNEVVFIS  497

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VLSACSHCGLE+EGW+ F +ME+KY I PKL HYACMVD++SR+GN+E AL+FVNKMP+E
Sbjct  498  VLSACSHCGLEHEGWSCFSSMEQKYGIIPKLPHYACMVDLISRRGNIEGALQFVNKMPME  557

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PDKRIWGALLAGCR THGS EI+ELVA++LI LDP N SYYVILSNLYA+QGRW +VE+L
Sbjct  558  PDKRIWGALLAGCRSTHGSIEIAELVAERLIGLDPQNTSYYVILSNLYAEQGRWGDVERL  617

Query  902  RQLMDGKKRKKGMGY  946
            R+L+D K  KK MGY
Sbjct  618  RKLVDEKGLKKEMGY  632


 Score =   119 bits (299),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/253 (29%), Positives = 124/253 (49%), Gaps = 4/253 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K  F     V  +L+ MYA   N ++S ++FD + +KD+I+W+ +I    ++D P  A  
Sbjct  217  KKMFHPLTNVHNSLVDMYAKCRNFKASMLVFDQILEKDLISWTTIIRGCIENDCPREAFK  276

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             F RMQ      +E     L+ A         G   H  ++K G  +   + + L+ MY 
Sbjct  277  AFSRMQFSCFGADETIVQDLIVAIIQADEHKFGIAFHGFLLKNGLLAFVSIGTALLQMYA  336

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            KFG +     +FD+   KD I WS+MI+ +  + H   ALE F  M S   +PN++ F+S
Sbjct  337  KFGELESAIIVFDQLNKKDYISWSAMISVHAHSRHPYNALETFKQMQSTDERPNEITFVS  396

Query  542  VLSACSHCGLEYEGWN-WFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            +L ACS  G +  G +   HA +  Y     L+  + ++D+  + G + +     N++P 
Sbjct  397  LLQACSLIGAQELGESIQAHATKAGYLSNAFLS--SALIDLYCKFGRINQGRAIFNEIPT  454

Query  719  EPDKRIWGALLAG  757
            + D   W +++ G
Sbjct  455  K-DLVCWSSMING  466


 Score =   106 bits (265),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 115/220 (52%), Gaps = 7/220 (3%)
 Frame = +2

Query  107  QKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGET  286
            + ++I+W++ IS+  + +Q   A+ +F+ M +   +PN     S+++A S +  +D+   
Sbjct  51   KDNVISWTSKISSLVKQNQSELAVGLFKMMLMTEQRPNHVTVLSVIRAISGLGLEDMMRV  110

Query  287  IHTQVMKLGYTSNAFLASGLIDMYCKF--GRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            I   V+KLG+ S   +A+ LI  Y  +  G + +   IF++ P KDL+ WS+M++    +
Sbjct  111  ICGSVIKLGFESEVSVATALIGFYSDYDMGIVWK---IFNQTPIKDLVLWSAMVSACVKS  167

Query  461  GHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAH  640
            G   EA E F  M   G++PN V  +S+L AC++ G    G    H    K    P    
Sbjct  168  GQYGEAFEIFRAMQYDGVEPNHVSIVSILPACANVGALLFG-KEIHGFSIKKMFHPLTNV  226

Query  641  YACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
            +  +VDM ++  N + ++   +++ +E D   W  ++ GC
Sbjct  227  HNSLVDMYAKCRNFKASMLVFDQI-LEKDLISWTTIIRGC  265


 Score = 92.8 bits (229),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 123/251 (49%), Gaps = 3/251 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   + V TAL+  Y+++ ++     +F+    KD++ WSAM+SA  +S Q   A  
Sbjct  117  KLGFESEVSVATALIGFYSDY-DMGIVWKIFNQTPIKDLVLWSAMVSACVKSGQYGEAFE  175

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +FR MQ +  +PN  +  S+L AC+++ A   G+ IH   +K  +     + + L+DMY 
Sbjct  176  IFRAMQYDGVEPNHVSIVSILPACANVGALLFGKEIHGFSIKKMFHPLTNVHNSLVDMYA  235

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K         +FD+  +KDLI W+++I G   N    EA + F  M       ++ +   
Sbjct  236  KCRNFKASMLVFDQILEKDLISWTTIIRGCIENDCPREAFKAFSRMQFSCFGADETIVQD  295

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            ++ A      E++    FH    K  +   ++    ++ M ++ G +E A+   +++  +
Sbjct  296  LIVAIIQAD-EHKFGIAFHGFLLKNGLLAFVSIGTALLQMYAKFGELESAIIVFDQLN-K  353

Query  722  PDKRIWGALLA  754
             D   W A+++
Sbjct  354  KDYISWSAMIS  364



>ref|XP_010670405.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, 
chloroplastic-like [Beta vulgaris subsp. vulgaris]
Length=641

 Score =   437 bits (1124),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 203/316 (64%), Positives = 249/316 (79%), Gaps = 0/316 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            KSG  + + V TALLQMYA FG +  S++LFD L  KD+IAW+AMISAYAQS   S AL 
Sbjct  324  KSGLAESVSVGTALLQMYAKFGEVHPSQLLFDQLHPKDLIAWTAMISAYAQSGYTSEALD  383

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             F+ MQL   KPNE  F SLLQACSS   Q+ GE+IH  V K GY  N+FL S LID+YC
Sbjct  384  TFKHMQLTSEKPNEITFVSLLQACSSSGTQEFGESIHGYVTKAGYLPNSFLISALIDLYC  443

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            KFGRI QG+ +FDE+  KDLI WSSMINGYG+NG  NEALE F +ML+ G++PNDV+F+S
Sbjct  444  KFGRIKQGRALFDEHHIKDLIIWSSMINGYGLNGFANEALEIFSNMLASGVKPNDVIFVS  503

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VLS+CSHCGLE EGW WF+ M++KY I PK+AHYACMVD+LSRQGNVEEA++FV  M +E
Sbjct  504  VLSSCSHCGLEDEGWYWFNCMQDKYGIVPKIAHYACMVDLLSRQGNVEEAVDFVYNMQVE  563

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PDKRIWG+LLAGC+ THGS +++ELV +QLI LDP N SYYV+LSN+YA++GRW++VEK+
Sbjct  564  PDKRIWGSLLAGCKSTHGSIDVAELVVQQLIRLDPKNTSYYVVLSNMYAEEGRWNDVEKV  623

Query  902  RQLMDGKKRKKGMGYS  949
            R+L+D K   K  GYS
Sbjct  624  RKLIDEKGIAKMTGYS  639


 Score =   121 bits (304),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/287 (26%), Positives = 139/287 (48%), Gaps = 3/287 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+ F   I +  +L+ MYA  G    +  +F  +++KD++ W  MI    ++  P  AL 
Sbjct  223  KTSFHYVIYIQNSLIDMYAKCGGFMYAARVFARVARKDVVTWKTMIRGCIETGNPGKALV  282

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M     + +      ++   S       G  +H   +K G   +  + + L+ MY 
Sbjct  283  IFAGMHQSCSEIDCGIICDVIGVTSDSEEFTFGLGLHCYSLKSGLAESVSVGTALLQMYA  342

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            KFG +H  + +FD+   KDLI W++MI+ Y  +G+ +EAL+ F  M     +PN++ F+S
Sbjct  343  KFGEVHPSQLLFDQLHPKDLIAWTAMISAYAQSGYTSEALDTFKHMQLTSEKPNEITFVS  402

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L ACS  G +  G +  H    K    P     + ++D+  + G +++     ++  I+
Sbjct  403  LLQACSSSGTQEFGES-IHGYVTKAGYLPNSFLISALIDLYCKFGRIKQGRALFDEHHIK  461

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLIS-LDPTNASYYVILSN  859
             D  IW +++ G      ++E  E+ +  L S + P +  +  +LS+
Sbjct  462  -DLIIWSSMINGYGLNGFANEALEIFSNMLASGVKPNDVIFVSVLSS  507


 Score = 94.4 bits (233),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 87/339 (26%), Positives = 149/339 (44%), Gaps = 39/339 (12%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   I V+TAL+ +Y N  ++  +  LF  +  KD++ WSAM+S   +S +   A+ 
Sbjct  123  KMGFGSEIRVLTALIGVYGNM-HLPFAWKLFSDMPMKDLVMWSAMVSICVKSGEFMGAIE  181

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            VFR M  E   PN  +  ++L AC+ + +  +G+ +H   +K  +    ++ + LIDMY 
Sbjct  182  VFRNMICEGIVPNFVSIVNVLPACAKLDSLALGKQVHGFALKTSFHYVIYIQNSLIDMYA  241

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G       +F     KD++ W +MI G    G+  +AL  F  M     + +  +   
Sbjct  242  KCGGFMYAARVFARVARKDVVTWKTMIRGCIETGNPGKALVIFAGMHQSCSEIDCGIICD  301

Query  542  VLSACS-----------HC-----GLE------------YEGWNWFHAMEEKYD-ITPK-  631
            V+   S           HC     GL             Y  +   H  +  +D + PK 
Sbjct  302  VIGVTSDSEEFTFGLGLHCYSLKSGLAESVSVGTALLQMYAKFGEVHPSQLLFDQLHPKD  361

Query  632  LAHYACMVDMLSRQGNVEEALEFVNKMPI---EPDKRIWGALLAGCRKTHGSSEISELVA  802
            L  +  M+   ++ G   EAL+    M +   +P++  + +LL  C  + G+ E  E + 
Sbjct  362  LIAWTAMISAYAQSGYTSEALDTFKHMQLTSEKPNEITFVSLLQACSSS-GTQEFGESIH  420

Query  803  KQLISLDPTNASYYV-ILSNLYADQGRWDEVEKLRQLMD  916
              +        S+ +  L +LY   GR   +++ R L D
Sbjct  421  GYVTKAGYLPNSFLISALIDLYCKFGR---IKQGRALFD  456


 Score = 90.9 bits (224),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/222 (26%), Positives = 109/222 (49%), Gaps = 7/222 (3%)
 Frame = +2

Query  110  KDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETI  289
            K+++ W+++IS   + ++P +A+A F+ M L   +PN     ++L++ S++  +     +
Sbjct  58   KEVVYWTSIISGLVKQNRPKDAIAKFKLMLLSEQRPNYVTLVTVLRSISALRFKTPAFVV  117

Query  290  HTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ--GKTIFDENPDKDLICWSSMINGYGMNG  463
            H  ++K+G+ S   + + LI +Y   G +H      +F + P KDL+ WS+M++    +G
Sbjct  118  HGLMIKMGFGSEIRVLTALIGVY---GNMHLPFAWKLFSDMPMKDLVMWSAMVSICVKSG  174

Query  464  HGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHY  643
                A+E F +M+  GI PN V  ++VL AC+       G    H    K      +   
Sbjct  175  EFMGAIEVFRNMICEGIVPNFVSIVNVLPACAKLDSLALG-KQVHGFALKTSFHYVIYIQ  233

Query  644  ACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKT  769
              ++DM ++ G    A     ++    D   W  ++ GC +T
Sbjct  234  NSLIDMYAKCGGFMYAARVFARVA-RKDVVTWKTMIRGCIET  274



>ref|XP_004231185.2| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like 
[Solanum lycopersicum]
Length=612

 Score =   432 bits (1111),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 197/275 (72%), Positives = 231/275 (84%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GFL C+ VVTALL MY  F +IES+R LFD L  KD+IAWS MI+AYAQS+ PSNA  
Sbjct  338  KQGFLGCVSVVTALLHMYGGFADIESARSLFDPLKSKDLIAWSTMIAAYAQSECPSNAFD  397

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++R+MQ  + KPNE  + SL+QACSS+ A+ +GE IH QV+K G TSNAFL + LIDMYC
Sbjct  398  IYRQMQSANEKPNEIIYVSLIQACSSITAEVIGEGIHAQVIKSGNTSNAFLITSLIDMYC  457

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            +FGRI QG+ IF E P++DLICWSSMINGYG+NGHGNEAL+CF DML+ GI+PND+VF+S
Sbjct  458  RFGRISQGEAIFSECPNEDLICWSSMINGYGINGHGNEALQCFSDMLNSGIKPNDIVFVS  517

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VLSACSHCGLEYEGWNWFHAMEE++ +TPKLAHYACMVDM+SRQGN+EEA EFVN MPIE
Sbjct  518  VLSACSHCGLEYEGWNWFHAMEEQFGVTPKLAHYACMVDMISRQGNIEEAFEFVNNMPIE  577

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDP  826
            PDKRIWG LLA CRKT  S EISE V+KQLI+LDP
Sbjct  578  PDKRIWGTLLAVCRKTRVSVEISETVSKQLIALDP  612


 Score =   111 bits (278),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 79/284 (28%), Positives = 139/284 (49%), Gaps = 3/284 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   +PVVTAL+ +Y+ + +++++  +F+    KD+I WSAM SA  +S +   A+ 
Sbjct  137  KMGFEIELPVVTALVGVYSIW-DMDTAWQMFNHTKWKDVILWSAMASACVKSGEYVEAIE  195

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +FR MQ    +PN  +   ++ AC+++ A  +G+ IH   +K+   S+  + + L+DMY 
Sbjct  196  IFREMQFCGVEPNYVSIVGIVPACANLGALSIGKEIHAYSIKVPSISHVNIQNSLVDMYA  255

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +    T+F     KD + W SMI+G   NG  NEAL  F +M     +P++ V   
Sbjct  256  KCGSLKASITVFRGIEKKDPVSWRSMIHGCVENGCFNEALSLFSEMRCCCFEPDEGVIRE  315

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            V+ A S    E +    FH+   K      ++    ++ M     ++E A    + +   
Sbjct  316  VIGALSQLD-EIKIGQCFHSFALKQGFLGCVSVVTALLHMYGGFADIESARSLFDPLK-S  373

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             D   W  ++A   ++   S   ++  +   + +  N   YV L
Sbjct  374  KDLIAWSTMIAAYAQSECPSNAFDIYRQMQSANEKPNEIIYVSL  417


 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 122/245 (50%), Gaps = 2/245 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            + +  +L+ MYA  G++++S  +F  + +KD ++W +MI    ++   + AL++F  M+ 
Sbjct  244  VNIQNSLVDMYAKCGSLKASITVFRGIEKKDPVSWRSMIHGCVENGCFNEALSLFSEMRC  303

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
               +P+E     ++ A S +    +G+  H+  +K G+     + + L+ MY  F  I  
Sbjct  304  CCFEPDEGVIREVIGALSQLDEIKIGQCFHSFALKQGFLGCVSVVTALLHMYGGFADIES  363

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             +++FD    KDLI WS+MI  Y  +   + A + +  M S   +PN+++++S++ ACS 
Sbjct  364  ARSLFDPLKSKDLIAWSTMIAAYAQSECPSNAFDIYRQMQSANEKPNEIIYVSLIQACSS  423

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
               E  G    HA   K   T        ++DM  R G + +     ++ P E D   W 
Sbjct  424  ITAEVIG-EGIHAQVIKSGNTSNAFLITSLIDMYCRFGRISQGEAIFSECPNE-DLICWS  481

Query  743  ALLAG  757
            +++ G
Sbjct  482  SMING  486


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 109/221 (49%), Gaps = 11/221 (5%)
 Frame = +2

Query  107  QKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGET  286
            ++++ AW++ IS+  + +Q   A+ +F+ M  +  KPN     S+++A      Q +   
Sbjct  73   KQNVRAWTSQISSLVRENQSIEAINLFKAMLKDEQKPNYVTVLSVIRAAEKW--QPMVRG  130

Query  287  IHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGH  466
            IH   +K+G+     + + L+ +Y     +     +F+    KD+I WS+M +    +G 
Sbjct  131  IHGFTIKMGFEIELPVVTALVGVY-SIWDMDTAWQMFNHTKWKDVILWSAMASACVKSGE  189

Query  467  GNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYA  646
              EA+E F +M   G++PN V  + ++ AC++ G    G    HA   K    P ++H  
Sbjct  190  YVEAIEIFREMQFCGVEPNYVSIVGIVPACANLGALSIG-KEIHAYSIK---VPSISHVN  245

Query  647  C---MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
                +VDM ++ G+++ ++     +  + D   W +++ GC
Sbjct  246  IQNSLVDMYAKCGSLKASITVFRGIE-KKDPVSWRSMIHGC  285



>gb|EYU32118.1| hypothetical protein MIMGU_mgv1a019324mg, partial [Erythranthe 
guttata]
Length=499

 Score =   420 bits (1079),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 188/309 (61%), Positives = 239/309 (77%), Gaps = 10/309 (3%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQ------  199
            ++L MY+   ++E++  +F  +  KD+++W  MI     +++P  AL +FR ++      
Sbjct  190  SILDMYSKCRDLEAALRVFKHMQNKDMVSWRIMIRGCVVNNKPKKALEIFRELRAYSAEK  249

Query  200  ----LEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKF  367
                +   +PNEF F SLL AC+S+ A ++GE++H+Q+ K GY++N FL S LIDMYCKF
Sbjct  250  LDEYIMQERPNEFTFVSLLLACTSLDAIELGESVHSQITKNGYSTNTFLTSALIDMYCKF  309

Query  368  GRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVL  547
            GR  QGK++FDEN   D +CWSSMINGY +NG GNE LECF DMLSHGI+PNDV+F+SVL
Sbjct  310  GRTRQGKSVFDENTTNDFVCWSSMINGYAINGCGNEVLECFSDMLSHGIEPNDVIFVSVL  369

Query  548  SACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPD  727
            SACSHCGLEYEGW WF AME KY I PKLAHYACMVDMLSRQGNVEEALEFVNKMP+EPD
Sbjct  370  SACSHCGLEYEGWRWFLAMEAKYCIKPKLAHYACMVDMLSRQGNVEEALEFVNKMPMEPD  429

Query  728  KRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQ  907
            KRIWGA+LAGCR ++G +E+ E VAK+LISLDP N +YYV+LSN+YA+QGRW+E EKLR 
Sbjct  430  KRIWGAILAGCRNSYGCNEVLEFVAKKLISLDPENTNYYVVLSNMYAEQGRWEEAEKLRN  489

Query  908  LMDGKKRKK  934
            ++D K  KK
Sbjct  490  MIDTKSLKK  498


 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 70/297 (24%), Positives = 136/297 (46%), Gaps = 15/297 (5%)
 Frame = +2

Query  2    KSGFLKC-IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNAL  178
            K+G +   + +VTAL+ +Y+ + ++ S+  LF+    KD++  SAM+ A   + + S AL
Sbjct  77   KTGLIDSQVAIVTALVGVYSCW-DMRSAWKLFNRARNKDVVMCSAMVFACVSNGEHSEAL  135

Query  179  AVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             +F+ M L    PN     S+L  C+ +   ++G  IH   +K     +  L + ++DMY
Sbjct  136  KLFKEMLLCGILPNHVTLSSILPVCAGLVKPNLGREIHGYSIKRSLYCHTILWNSILDMY  195

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQ-------  517
             K   +     +F    +KD++ W  MI G  +N    +ALE F ++ ++  +       
Sbjct  196  SKCRDLEAALRVFKHMQNKDMVSWRIMIRGCVVNNKPKKALEIFRELRAYSAEKLDEYIM  255

Query  518  ---PNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEE  688
               PN+  F+S+L AC+       G +  H+   K   +      + ++DM  + G   +
Sbjct  256  QERPNEFTFVSLLLACTSLDAIELGES-VHSQITKNGYSTNTFLTSALIDMYCKFGRTRQ  314

Query  689  ALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLI-SLDPTNASYYVILS  856
                 ++     D   W +++ G       +E+ E  +  L   ++P +  +  +LS
Sbjct  315  GKSVFDENTTN-DFVCWSSMINGYAINGCGNEVLECFSDMLSHGIEPNDVIFVSVLS  370


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 106/227 (47%), Gaps = 15/227 (7%)
 Frame = +2

Query  101  LSQKDII-AWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDV  277
              Q DI  +WS  IS+    ++   A+ +F+ M +   +PN     S+++A  S+ ++D+
Sbjct  8    FEQNDIPRSWSFRISSLVSENRSEEAIGLFKAMLVSGDRPNFVTVLSVVKAVGSLGSKDL  67

Query  278  GETIHTQVMKLGYT-SNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYG  454
               IH   +K G   S   + + L+ +Y  +  +     +F+   +KD++  S+M+    
Sbjct  68   ACGIHGYSIKTGLIDSQVAIVTALVGVYSCWD-MRSAWKLFNRARNKDVVMCSAMVFACV  126

Query  455  MNGHGNEALECFLDMLSHGIQPNDVVFISVLSACS-----HCGLEYEGWNWFHAMEEKYD  619
             NG  +EAL+ F +ML  GI PN V   S+L  C+     + G E  G++       K  
Sbjct  127  SNGEHSEALKLFKEMLLCGILPNHVTLSSILPVCAGLVKPNLGREIHGYSI------KRS  180

Query  620  ITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
            +      +  ++DM S+  ++E AL     M    D   W  ++ GC
Sbjct  181  LYCHTILWNSILDMYSKCRDLEAALRVFKHMQ-NKDMVSWRIMIRGC  226


 Score = 64.7 bits (156),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 87/187 (47%), Gaps = 7/187 (4%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G+     + +AL+ MY  FG     + +FD  +  D + WS+MI+ YA +   +  L 
Sbjct  289  KNGYSTNTFLTSALIDMYCKFGRTRQGKSVFDENTTNDFVCWSSMINGYAINGCGNEVLE  348

Query  182  VFRRMQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLA--SGLID  352
             F  M L HG +PN+  F S+L ACS    +  G       M+  Y     LA  + ++D
Sbjct  349  CFSDM-LSHGIEPNDVIFVSVLSACSHCGLEYEGWRWFL-AMEAKYCIKPKLAHYACMVD  406

Query  353  MYCKFGRIHQGKTIFDENP-DKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDV  529
            M  + G + +     ++ P + D   W +++ G   +   NE LE F+      + P + 
Sbjct  407  MLSRQGNVEEALEFVNKMPMEPDKRIWGAILAGCRNSYGCNEVLE-FVAKKLISLDPENT  465

Query  530  VFISVLS  550
             +  VLS
Sbjct  466  NYYVVLS  472



>emb|CDP08816.1| unnamed protein product [Coffea canephora]
Length=612

 Score =   422 bits (1085),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 197/326 (60%), Positives = 251/326 (77%), Gaps = 2/326 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G+++ I ++TA+LQMYANFG I S++ LFD L  KD+IAWSAMI+AY Q++QP +A  
Sbjct  240  KMGYVEDISLMTAILQMYANFGEIGSAKTLFDYLDNKDLIAWSAMIAAYVQNEQPFDAFK  299

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            V+R+MQ    KPNE  F SLLQ+CSS  AQ++GE+IH  ++K GY  NAF+ S LI+MYC
Sbjct  300  VYRKMQSAGEKPNEVTFLSLLQSCSSTTAQEIGESIHAYLLKAGYMLNAFVTSALINMYC  359

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K GR  QG  +FDEN  +DL+CWSSMINGYG+NG G EAL CF +ML  G++PNDVVFIS
Sbjct  360  KVGRTRQGVALFDENHSRDLVCWSSMINGYGINGLGEEALHCFSNMLHCGVKPNDVVFIS  419

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L+ACSHCGLEYEGW+WF+AM EK+ ITPKLAHYACMVDMLSRQGNVEEA EFV KMPI 
Sbjct  420  LLAACSHCGLEYEGWSWFYAMGEKFGITPKLAHYACMVDMLSRQGNVEEAFEFVKKMPIN  479

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PDKRIWGA+LAGCR+T GSSE+SE+ A+QL SLDP NASY+  L +++ D G   +  +L
Sbjct  480  PDKRIWGAILAGCRETCGSSEVSEIAARQLFSLDPENASYHYDLMHIHTDGGDQVQTSEL  539

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMHR  979
             ++      +K   Y ++E  + +H+
Sbjct  540  HRI--HIHYRKPTYYVILECRDQVHQ  563


 Score =   103 bits (258),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 96/186 (52%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K  F   I +  +L+ MYA       S  +  S+  KD+++W +MI     ++ P+  L 
Sbjct  139  KRDFYSHINLQNSLVDMYAKCRLWSYSVQVSSSMQTKDVVSWRSMICRSITNESPARTLI  198

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F +M+    + +      ++ A S +    VG  +H   +K+GY  +  L + ++ MY 
Sbjct  199  LFSQMRSSCVEVDVNTVRVIIVASSQLEEIKVGLGLHGLALKMGYVEDISLMTAILQMYA  258

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
             FG I   KT+FD   +KDLI WS+MI  Y  N    +A + +  M S G +PN+V F+S
Sbjct  259  NFGEIGSAKTLFDYLDNKDLIAWSAMIAAYVQNEQPFDAFKVYRKMQSAGEKPNEVTFLS  318

Query  542  VLSACS  559
            +L +CS
Sbjct  319  LLQSCS  324


 Score = 89.7 bits (221),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 114/245 (47%), Gaps = 2/245 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            +P+VT LL  Y++  +I + RILF     KD+I WSAM+SA  ++++   AL +FR+MQ 
Sbjct  45   LPLVTGLLGAYSSGWDIGAVRILFALTPNKDVILWSAMVSACVKNEEYVEALNIFRKMQS  104

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
               +PN  +  ++L AC+++    +G+ IH   +K  + S+  L + L+DMY K      
Sbjct  105  CGVQPNRVSIVTVLPACANLGTLWLGKEIHGFSIKRDFYSHINLQNSLVDMYAKCRLWSY  164

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
               +      KD++ W SMI     N      L  F  M S  ++  DV  + V+   S 
Sbjct  165  SVQVSSSMQTKDVVSWRSMICRSITNESPARTLILFSQMRSSCVEV-DVNTVRVIIVASS  223

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
               E +     H +  K      ++    ++ M +  G +  A    + +    D   W 
Sbjct  224  QLEEIKVGLGLHGLALKMGYVEDISLMTAILQMYANFGEIGSAKTLFDYLD-NKDLIAWS  282

Query  743  ALLAG  757
            A++A 
Sbjct  283  AMIAA  287


 Score = 80.9 bits (198),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 78/159 (49%), Gaps = 1/159 (1%)
 Frame = +2

Query  194  MQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGR  373
            M +   KPN     S++QA   + ++++   IH   +KLG  S   L +GL+  Y     
Sbjct  1    MLMRDQKPNFVTVLSVIQAIGQLGSKNMASMIHGFAIKLGCDSELPLVTGLLGAYSSGWD  60

Query  374  IHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSA  553
            I   + +F   P+KD+I WS+M++    N    EAL  F  M S G+QPN V  ++VL A
Sbjct  61   IGAVRILFALTPNKDVILWSAMVSACVKNEEYVEALNIFRKMQSCGVQPNRVSIVTVLPA  120

Query  554  CSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSR  670
            C++ G  + G    H    K D    +     +VDM ++
Sbjct  121  CANLGTLWLG-KEIHGFSIKRDFYSHINLQNSLVDMYAK  158



>gb|EPS65170.1| hypothetical protein M569_09608, partial [Genlisea aurea]
Length=579

 Score =   400 bits (1029),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 183/311 (59%), Positives = 231/311 (74%), Gaps = 0/311 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G L  +PV T L+Q++  F +I+ SR +FD +  KDIIAWSAM+S YAQ+D+P  A  
Sbjct  268  KMGLLAFVPVATELMQVHGKFRDIQFSRYVFDQIHPKDIIAWSAMVSTYAQNDRPVEAFD  327

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F+ M L   KPNEF F SLL +C+S  A + G +IH+Q+++ GY  N+ L S LIDMYC
Sbjct  328  IFKAMHLSDQKPNEFTFVSLLFSCTSSDAFETGRSIHSQIIRGGYLVNSHLTSALIDMYC  387

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
             FG+  +G  +F EN  +D ICWSSMINGY +NG G EAL+CF DMLS GI+PNDVVF+S
Sbjct  388  NFGKTREGNAVFIENSCRDFICWSSMINGYAINGFGGEALKCFSDMLSCGIEPNDVVFVS  447

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
             LSACSHCGL+YEGWN FHAME  Y + PKLAHYACMVDMLSRQGN+EEAL+FV++MP+E
Sbjct  448  ALSACSHCGLDYEGWNLFHAMEPVYGVEPKLAHYACMVDMLSRQGNLEEALDFVDRMPVE  507

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD RIWGALL+GCR  H + EI + +A +++   P N SY V LSN +ADQGRW+E EKL
Sbjct  508  PDNRIWGALLSGCRNAHPTPEILKHLADEVMRSYPKNTSYLVALSNQFADQGRWEEAEKL  567

Query  902  RQLMDGKKRKK  934
            R ++D  K  K
Sbjct  568  RDMIDFPKSTK  578


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 99/191 (52%), Gaps = 12/191 (6%)
 Frame = +2

Query  14   LKCIPVV--TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            L C  V+   +LL MY+  G ++++  LF  + +KDI++W  +I   ++++ P  AL  F
Sbjct  165  LLCCHVIPSNSLLDMYSKCGLLKAAIRLFRLMPEKDIVSWRIIIRGCSKNESPLRALEFF  224

Query  188  RRMQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQ------VMKLGYTSNAFLASGL  346
            R M+     + +E     ++ A S +   D G  I  Q      V K+G  +   +A+ L
Sbjct  225  REMRASAAVQVDEHVVKEIIGAFSQL---DDGNGILRQRGVYGLVWKMGLLAFVPVATEL  281

Query  347  IDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPND  526
            + ++ KF  I   + +FD+   KD+I WS+M++ Y  N    EA + F  M     +PN+
Sbjct  282  MQVHGKFRDIQFSRYVFDQIHPKDIIAWSAMVSTYAQNDRPVEAFDIFKAMHLSDQKPNE  341

Query  527  VVFISVLSACS  559
              F+S+L +C+
Sbjct  342  FTFVSLLFSCT  352


 Score = 81.6 bits (200),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 96/189 (51%), Gaps = 3/189 (2%)
 Frame = +2

Query  2    KSGFLKC-IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNAL  178
            K GFL C    VTAL  +Y+++ ++ SS  L+      D++  +AMISA   +   + A 
Sbjct  62   KLGFLHCHASAVTALATVYSSW-DMTSSWKLYHETLHIDLVFCTAMISACIANSDHAGAF  120

Query  179  AVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             + + +     +PN     +LL AC+ +AA ++G+ IH+  ++     +   ++ L+DMY
Sbjct  121  ELLKEILFLGMQPNHITVATLLSACADLAAPELGKQIHSYSIRRLLCCHVIPSNSLLDMY  180

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDM-LSHGIQPNDVVF  535
             K G +     +F   P+KD++ W  +I G   N     ALE F +M  S  +Q ++ V 
Sbjct  181  SKCGLLKAAIRLFRLMPEKDIVSWRIIIRGCSKNESPLRALEFFREMRASAAVQVDEHVV  240

Query  536  ISVLSACSH  562
              ++ A S 
Sbjct  241  KEIIGAFSQ  249


 Score = 74.7 bits (182),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 98/216 (45%), Gaps = 4/216 (2%)
 Frame = +2

Query  122  AWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQV  301
            AW++ IS     D+P  A+ +F+ M  +  +PN        +A   + ++D+   IH   
Sbjct  1    AWTSKISRSIDEDRPGRAIDLFKNMLADEKRPNFVTILCATKAAGLLGSRDLIRGIHGHS  60

Query  302  MKLGYT-SNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEA  478
            MKLG+   +A   + L  +Y  +      K ++ E    DL+  ++MI+    N     A
Sbjct  61   MKLGFLHCHASAVTALATVYSSWDMTSSWK-LYHETLHIDLVFCTAMISACIANSDHAGA  119

Query  479  LECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVD  658
             E   ++L  G+QPN +   ++LSAC+       G    H+   +  +   +     ++D
Sbjct  120  FELLKEILFLGMQPNHITVATLLSACADLAAPELG-KQIHSYSIRRLLCCHVIPSNSLLD  178

Query  659  MLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRK  766
            M S+ G ++ A+     MP E D   W  ++ GC K
Sbjct  179  MYSKCGLLKAAIRLFRLMP-EKDIVSWRIIIRGCSK  213



>ref|XP_010255652.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like 
[Nelumbo nucifera]
Length=559

 Score =   400 bits (1027),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 183/319 (57%), Positives = 242/319 (76%), Gaps = 0/319 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            KSG L  + + T+LL+MYA+FG +  + +LF  L  KD+IAWSAMI+ Y+++     A+ 
Sbjct  239  KSGLLAFVSIGTSLLRMYADFGKVGLAAVLFTHLHHKDLIAWSAMIAIYSRAGYSICAVD  298

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             F++MQL + KPN+    SL+QAC+S+ AQ+ G++IH  V+++GY+SN ++ S LID YC
Sbjct  299  TFKQMQLANMKPNKITLVSLVQACASLGAQEPGKSIHAHVIRVGYSSNGYIMSALIDFYC  358

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            KFG++ +GKT+FD  P KDLICWSSMI+GYG+NG G EAL+ F  ML  G +PND+VFIS
Sbjct  359  KFGKLSEGKTLFDRLPTKDLICWSSMIHGYGINGCGIEALDTFSKMLQCGTKPNDIVFIS  418

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VLSAC+HCGL  EGW WF +MEEKY ITP L HYACMVD+LSR+G +EEAL+FV +MP+E
Sbjct  419  VLSACAHCGLIDEGWGWFSSMEEKYGITPTLPHYACMVDLLSRRGYIEEALQFVYRMPVE  478

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD  IWGALL+GCR + G  E+ E  AK+L+SLDP N SY+VILSNLYA+ GRW + E+L
Sbjct  479  PDANIWGALLSGCRSSQGPIEVVEFAAKRLLSLDPQNTSYHVILSNLYAEHGRWRDAERL  538

Query  902  RQLMDGKKRKKGMGYSVVE  958
              L+  K  KK +GYS+VE
Sbjct  539  WGLVKEKGLKKTVGYSMVE  557


 Score =   122 bits (305),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 111/187 (59%), Gaps = 1/187 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   + +VTALL +Y+   ++  +R LFD +  KD++ WSAM++A +++ Q   A+ 
Sbjct  38   KLGFEIELSIVTALLGLYS-LHDMVIARQLFDPIPVKDLVLWSAMVTACSKNRQFVEAIE  96

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +FR+MQ    +PN  +  S+L AC ++ A  +G+ IH    K  ++S   + + L+DMY 
Sbjct  97   IFRKMQYAGVEPNHVSIVSILPACGNLGALSLGKEIHGYSFKRVFSSLTNVQNSLVDMYA  156

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K   +     IF+    KD++ W+++I G+  NG   +AL  F++M+S  ++PN++   +
Sbjct  157  KCRNLEVSVLIFNRIVHKDIVSWNTIICGFIENGFPRKALNLFINMVSSCVKPNEITVRN  216

Query  542  VLSACSH  562
            VL ACS 
Sbjct  217  VLVACSQ  223


 Score =   116 bits (291),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 122/252 (48%), Gaps = 2/252 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K  F     V  +L+ MYA   N+E S ++F+ +  KDI++W+ +I  + ++  P  AL 
Sbjct  138  KRVFSSLTNVQNSLVDMYAKCRNLEVSVLIFNRIVHKDIVSWNTIICGFIENGFPRKALN  197

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M     KPNE    ++L ACS       G  +H  V+K G  +   + + L+ MY 
Sbjct  198  LFINMVSSCVKPNEITVRNVLVACSQSEQFKFGLGLHCFVLKSGLLAFVSIGTSLLRMYA  257

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
             FG++     +F     KDLI WS+MI  Y   G+   A++ F  M    ++PN +  +S
Sbjct  258  DFGKVGLAAVLFTHLHHKDLIAWSAMIAIYSRAGYSICAVDTFKQMQLANMKPNKITLVS  317

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            ++ AC+  G +  G +  HA   +   +      + ++D   + G + E     +++P +
Sbjct  318  LVQACASLGAQEPGKS-IHAHVIRVGYSSNGYIMSALIDFYCKFGKLSEGKTLFDRLPTK  376

Query  722  PDKRIWGALLAG  757
             D   W +++ G
Sbjct  377  -DLICWSSMIHG  387


 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 91/187 (49%), Gaps = 13/187 (7%)
 Frame = +2

Query  212  KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKT  391
            +PN     SL++A  ++ ++D+   IH  V+KLG+     + + L+ +Y     +   + 
Sbjct  7    RPNYVTVLSLIRAVGTLGSEDMIRGIHGFVIKLGFEIELSIVTALLGLYSLHDMV-IARQ  65

Query  392  IFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGL  571
            +FD  P KDL+ WS+M+     N    EA+E F  M   G++PN V  +S+L AC + G 
Sbjct  66   LFDPIPVKDLVLWSAMVTACSKNRQFVEAIEIFRKMQYAGVEPNHVSIVSILPACGNLGA  125

Query  572  -----EYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
                 E  G+++        ++   L      VDM ++  N+E ++   N++ +  D   
Sbjct  126  LSLGKEIHGYSFKRVFSSLTNVQNSL------VDMYAKCRNLEVSVLIFNRI-VHKDIVS  178

Query  737  WGALLAG  757
            W  ++ G
Sbjct  179  WNTIICG  185



>ref|XP_007051809.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
 gb|EOX95966.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
Length=1279

 Score =   417 bits (1072),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 193/310 (62%), Positives = 250/310 (81%), Gaps = 5/310 (2%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K+GFL  + + TALLQMYA F  + S+R +FD +S KD+IAW+AMISAYAQ+  P NA+ 
Sbjct  967   KTGFLAFVSIATALLQMYAKFSMVASARNVFDHISNKDVIAWNAMISAYAQTGLPFNAIN  1026

Query  182   VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDV----GETIHTQVMKLGYTSNAFLASGLI  349
              FR+M L + KP+EF+  SLLQ CS MA+Q+V    GETIH  V K+GY+ N +L+S LI
Sbjct  1027  TFRQMLLMNEKPSEFSLVSLLQICSLMASQEVSDKVGETIHAFVAKVGYSRNVYLSSALI  1086

Query  350   DMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDV  529
             D YC+FGR+ QGK +FDE P KDLICWSSMINGY +NG+G EALE F +ML  GI+PND+
Sbjct  1087  DFYCRFGRVKQGKALFDEVPTKDLICWSSMINGYVLNGYGIEALETFANMLDCGIKPNDI  1146

Query  530   VFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNK  709
             +F+SVLSACSHCGL+ EGWNWF++M+EKY ITPKLAHYACMVD+LSRQG++E+AL FV K
Sbjct  1147  IFLSVLSACSHCGLKNEGWNWFYSMKEKYGITPKLAHYACMVDLLSRQGHIEQALHFVKK  1206

Query  710   MPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNAS-YYVILSNLYADQGRWD  886
             MP+EPDKRIWGALLAGCR + G  +I E V ++L +LDP N++ YY+ILS+LYA++GR +
Sbjct  1207  MPMEPDKRIWGALLAGCRVSPGPIKIVEFVVERLSTLDPQNSTHYYMILSDLYAEEGRGE  1266

Query  887   EVEKLRQLMD  916
             + ++LR+L+D
Sbjct  1267  DAKRLRRLVD  1276


 Score =   107 bits (266),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 120/247 (49%), Gaps = 5/247 (2%)
 Frame = +2

Query  29    VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQ-LE  205
             V  +L+ MYA   +++++  +F+ + +KD+++W  +I  Y +++    AL  F +MQ L 
Sbjct  874   VQNSLVDMYAKCRSLQTAICVFNGMLKKDLVSWRTLIRGYVENECGIKALDAFSKMQRLS  933

Query  206   HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQG  385
                 +EF    ++ A        +G   H  ++K G+ +   +A+ L+ MY KF  +   
Sbjct  934   FFALDEFVVRDMIMAVLQSGESKIGSAFHCYILKTGFLAFVSIATALLQMYAKFSMVASA  993

Query  386   KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC  565
             + +FD   +KD+I W++MI+ Y   G    A+  F  ML    +P++   +S+L  CS  
Sbjct  994   RNVFDHISNKDVIAWNAMISAYAQTGLPFNAINTFRQMLLMNEKPSEFSLVSLLQICSLM  1053

Query  566   G---LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
                 +  +     HA   K   +  +   + ++D   R G V++     +++P + D   
Sbjct  1054  ASQEVSDKVGETIHAFVAKVGYSRNVYLSSALIDFYCRFGRVKQGKALFDEVPTK-DLIC  1112

Query  737   WGALLAG  757
             W +++ G
Sbjct  1113  WSSMING  1119


 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 115/222 (52%), Gaps = 4/222 (2%)
 Frame = +2

Query  95   DSLSQKD-IIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQ  271
            D  + KD +I+W++++S   +  QP  A+ +F+ M + + +PN     SL++A  ++  +
Sbjct  694  DPYADKDHVISWTSVLSKLVRQGQPEEAIGLFKTMLMSNQRPNYVTILSLVKAFDTLDWE  753

Query  272  DVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGY  451
             +   +H  V+K+G+ S   + + LI  Y  +G +    ++F++ P+KD++  S+M++  
Sbjct  754  ALRMMVHGLVIKMGFESEPSVLTALIGSYSVYG-MGVCWSLFNQIPNKDVVLRSAMVSAC  812

Query  452  GMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPK  631
              NG   EALE F  M   G++ N V  +S+L AC++ G    G    H    +  I   
Sbjct  813  VKNGDYVEALELFRRMQVLGLKANHVSIVSILPACANLGALQLGRE-IHGFIIRRMICYV  871

Query  632  LAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
                  +VDM ++  +++ A+   N M ++ D   W  L+ G
Sbjct  872  NTVQNSLVDMYAKCRSLQTAICVFNGM-LKKDLVSWRTLIRG  912


 Score = 87.8 bits (216),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 88/166 (53%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     V+TAL+  Y+ +G +     LF+ +  KD++  SAM+SA  ++     AL 
Sbjct  765  KMGFESEPSVLTALIGSYSVYG-MGVCWSLFNQIPNKDVVLRSAMVSACVKNGDYVEALE  823

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +FRRMQ+   K N  +  S+L AC+++ A  +G  IH  +++        + + L+DMY 
Sbjct  824  LFRRMQVLGLKANHVSIVSILPACANLGALQLGREIHGFIIRRMICYVNTVQNSLVDMYA  883

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDM  499
            K   +     +F+    KDL+ W ++I GY  N  G +AL+ F  M
Sbjct  884  KCRSLQTAICVFNGMLKKDLVSWRTLIRGYVENECGIKALDAFSKM  929



>ref|XP_002511861.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF50530.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=751

 Score =   393 bits (1010),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 237/308 (77%), Gaps = 1/308 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+GF   + V TALLQMY  F    S+ ++FD L+ KD+IAWSAMIS YA+  +P +AL 
Sbjct  239  KNGFSGYVSVGTALLQMYGKFSKFSSAWLVFDQLNYKDLIAWSAMISVYARGGKPYDALN  298

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++R+MQ  + K NE  F SLLQACS++ AQ++GE+IH  + K G++SNAFL S LID+YC
Sbjct  299  IYRQMQSTNEKANEVTFVSLLQACSALGAQELGESIHGFITKAGHSSNAFLNSALIDLYC  358

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            KFG + +GK +FDE   KDLICWSSMINGY +NG G+EALE F DML+ G +PN+ VF+S
Sbjct  359  KFGSVKKGKAVFDEISTKDLICWSSMINGYALNGCGSEALETFADMLNWGFKPNETVFLS  418

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +LS CS CGLE+EG  WF+ M+EKY + PKL+HYACMVD+LSR G++EEAL FV KMP+ 
Sbjct  419  ILSVCSQCGLEHEGRKWFYYMQEKYRLAPKLSHYACMVDLLSRHGHIEEALMFVKKMPVV  478

Query  722  PDKRIWGALLAGCR-KTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
            PDKRIWGA+LAGCR +  GS E++E V +QL +LDP N SYYV L +LYA+QGRW +VE+
Sbjct  479  PDKRIWGAVLAGCRSRGDGSIEVAEFVVRQLSALDPENTSYYVTLLDLYAEQGRWKDVER  538

Query  899  LRQLMDGK  922
            L +++D K
Sbjct  539  LTKIVDEK  546


 Score =   111 bits (277),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/286 (27%), Positives = 130/286 (45%), Gaps = 3/286 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K  F     V  +L+  YA  G IE+S  +F+ + +KD+I+W  +I    +++ P  AL 
Sbjct  138  KKVFYSFTVVQNSLMDAYAKCGKIEASFYIFNRICEKDLISWRTVIRICVENECPREALD  197

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F +MQ    + +E      + A         G   H  + K G++    + + L+ MY 
Sbjct  198  IFLKMQRSTTEADEIIIRDTIMASIQAKELKFGLGFHAYIEKNGFSGYVSVGTALLQMYG  257

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            KF +      +FD+   KDLI WS+MI+ Y   G   +AL  +  M S   + N+V F+S
Sbjct  258  KFSKFSSAWLVFDQLNYKDLIAWSAMISVYARGGKPYDALNIYRQMQSTNEKANEVTFVS  317

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L ACS  G +  G +  H    K   +      + ++D+  + G+V++     +++  +
Sbjct  318  LLQACSALGAQELGES-IHGFITKAGHSSNAFLNSALIDLYCKFGSVKKGKAVFDEISTK  376

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQL-ISLDPTNASYYVILS  856
             D   W +++ G       SE  E  A  L     P    +  ILS
Sbjct  377  -DLICWSSMINGYALNGCGSEALETFADMLNWGFKPNETVFLSILS  421


 Score = 87.0 bits (214),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 89/184 (48%), Gaps = 1/184 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   +PV TAL++ Y  F + E S  LFD     D++ WSAM+SA  ++ +    + 
Sbjct  38   KLGFELEVPVRTALIRFYTLF-DFEISLKLFDQKLHNDVVLWSAMVSACVKNAKYREGVQ  96

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             FRRM     + N     S+L AC  +      + IH   +K  + S   + + L+D Y 
Sbjct  97   HFRRMLNYGTEANHVTVISILSACGHLGGLCFVKEIHGFCLKKVFYSFTVVQNSLMDAYA  156

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G+I     IF+   +KDLI W ++I     N    EAL+ FL M     + ++++   
Sbjct  157  KCGKIEASFYIFNRICEKDLISWRTVIRICVENECPREALDIFLKMQRSTTEADEIIIRD  216

Query  542  VLSA  553
             + A
Sbjct  217  TIMA  220


 Score = 68.9 bits (167),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 91/210 (43%), Gaps = 15/210 (7%)
 Frame = +2

Query  194  MQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGR  373
            M L   +PN     S+++   +   QD+    H  V+KLG+     + + LI  Y  F  
Sbjct  1    MLLTDQRPNFVTLVSVIRGLGAFHCQDLISAAHGFVIKLGFELEVPVRTALIRFYTLFD-  59

Query  374  IHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSA  553
                  +FD+    D++ WS+M++    N    E ++ F  ML++G + N V  IS+LSA
Sbjct  60   FEISLKLFDQKLHNDVVLWSAMVSACVKNAKYREGVQHFRRMLNYGTEANHVTVISILSA  119

Query  554  CSHCGLEYEGWNWFHAMEEKYDITPKLAHYA------CMVDMLSRQGNVEEALEFVNKMP  715
            C H G           ++E +    K   Y+       ++D  ++ G +E +    N++ 
Sbjct  120  CGHLG-------GLCFVKEIHGFCLKKVFYSFTVVQNSLMDAYAKCGKIEASFYIFNRI-  171

Query  716  IEPDKRIWGALLAGCRKTHGSSEISELVAK  805
             E D   W  ++  C +     E  ++  K
Sbjct  172  CEKDLISWRTVIRICVENECPREALDIFLK  201



>ref|XP_008810412.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like [Phoenix dactylifera]
Length=637

 Score =   354 bits (909),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/318 (51%), Positives = 221/318 (69%), Gaps = 0/318 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G      V TALL+ YA F  +E  + LF+ L  KD IAWSAMISAY+ S  P  AL 
Sbjct  320  KNGLGASTSVGTALLRAYAEFKEVEMVQALFNQLHHKDHIAWSAMISAYSHSGHPDLALE  379

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F++MQL   + NE  F SLLQACS + A ++G++IH  V +L + SN F+ S LID YC
Sbjct  380  MFKQMQLAKEEANEITFVSLLQACSLVGALELGKSIHAHVTRLVFVSNMFVTSALIDFYC  439

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G++ + + +F +   +DL+CWSSMINGYG+NG G EA++ F +ML  G+ PN+V F+S
Sbjct  440  KLGKLREAEILFGKLQKRDLVCWSSMINGYGINGCGEEAIQIFYNMLERGLMPNEVTFVS  499

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +LSACSHCGL  EGW WF +M+EK+ I+  LAHY C+VD+L RQG VEEALEFVN MP+E
Sbjct  500  ILSACSHCGLVDEGWKWFRSMKEKFGISSTLAHYTCIVDLLGRQGRVEEALEFVNTMPME  559

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD  +WG LL+ CR  H   +I+E  A++LI LDP+N S YV LSN+Y+  G W + +++
Sbjct  560  PDITVWGVLLSWCRAAHSDIKIAEFAAERLIQLDPSNTSCYVTLSNMYSKLGLWGDAKRI  619

Query  902  RQLMDGKKRKKGMGYSVV  955
            R LM+    +K  G+S+V
Sbjct  620  RGLMEDNSLRKTAGFSMV  637


 Score =   112 bits (280),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 94/351 (27%), Positives = 163/351 (46%), Gaps = 47/351 (13%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+GF   + + TAL+  Y++   +ES+R LF S   KD+I WSAM+SA  ++ Q   A+ 
Sbjct  118  KNGFESEVAITTALIAFYSSLHELESARRLFYSTPIKDLILWSAMVSACCKNGQFIEAID  177

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             F  M      PN  +  S+L AC++  A   G+ IH   ++  + S   L++ L+DMY 
Sbjct  178  TFGEMLSFGVTPNNVSLLSVLLACANTNALLHGKQIHGYAIRKEFDSEISLSNSLVDMYA  237

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G++     +F+    KD I W ++I G   NG   EA   F DM +  I+P+++   +
Sbjct  238  KCGKLDAAMVVFNGTNWKDDISWKNIIFGCIENGRPREAHRLFYDMRASCIEPDEITIRN  297

Query  542  VLSACS-----------HCGLEYEG--------------WNWFHAMEEKYDITPKLAH--  640
            V+  CS           HC +   G              +  F  +E    +  +L H  
Sbjct  298  VVRTCSQAGYLMFILGLHCYIIKNGLGASTSVGTALLRAYAEFKEVEMVQALFNQLHHKD  357

Query  641  ---YACMVDMLSRQGNVEEALEFVNKMPI---EPDKRIWGALLAGCRKTHGSSEISELVA  802
               ++ M+   S  G+ + ALE   +M +   E ++  + +LL  C    G+ E+ + + 
Sbjct  358  HIAWSAMISAYSHSGHPDLALEMFKQMQLAKEEANEITFVSLLQACSLV-GALELGKSIH  416

Query  803  KQLISLDPTNASYYVILSNLYADQGRWD---EVEKLR--QLMDGKKRKKGM  940
              +  L        V +SN++      D   ++ KLR  +++ GK +K+ +
Sbjct  417  AHVTRL--------VFVSNMFVTSALIDFYCKLGKLREAEILFGKLQKRDL  459


 Score =   100 bits (250),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/245 (25%), Positives = 121/245 (49%), Gaps = 2/245 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            I +  +L+ MYA  G ++++ ++F+  + KD I+W  +I    ++ +P  A  +F  M+ 
Sbjct  226  ISLSNSLVDMYAKCGKLDAAMVVFNGTNWKDDISWKNIIFGCIENGRPREAHRLFYDMRA  285

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
               +P+E    ++++ CS          +H  ++K G  ++  + + L+  Y +F  +  
Sbjct  286  SCIEPDEITIRNVVRTCSQAGYLMFILGLHCYIIKNGLGASTSVGTALLRAYAEFKEVEM  345

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + +F++   KD I WS+MI+ Y  +GH + ALE F  M     + N++ F+S+L ACS 
Sbjct  346  VQALFNQLHHKDHIAWSAMISAYSHSGHPDLALEMFKQMQLAKEEANEITFVSLLQACSL  405

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             G    G +  HA   +      +   + ++D   + G + EA     K+  + D   W 
Sbjct  406  VGALELGKS-IHAHVTRLVFVSNMFVTSALIDFYCKLGKLREAEILFGKLQ-KRDLVCWS  463

Query  743  ALLAG  757
            +++ G
Sbjct  464  SMING  468


 Score = 92.8 bits (229),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 107/231 (46%), Gaps = 2/231 (1%)
 Frame = +2

Query  68   NIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQ  247
            N E  + LFD +  ++ +  ++ I    +S++   A+ +   + L            +++
Sbjct  39   NFEPPQQLFDRIPNRNTVDSNSHIYCPTKSEKEVGAITLPSWVFLGGSNSLRLVVSCIVR  98

Query  248  ACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLIC  427
            A     + D    IH  V+K G+ S   + + LI  Y     +   + +F   P KDLI 
Sbjct  99   AIKVTGSVDTKRGIHAAVIKNGFESEVAITTALIAFYSSLHELESARRLFYSTPIKDLIL  158

Query  428  WSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAME  607
            WS+M++    NG   EA++ F +MLS G+ PN+V  +SVL AC++      G    H   
Sbjct  159  WSAMVSACCKNGQFIEAIDTFGEMLSFGVTPNNVSLLSVLLACANTNALLHG-KQIHGYA  217

Query  608  EKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
             + +   +++    +VDM ++ G ++ A+   N    + D   W  ++ GC
Sbjct  218  IRKEFDSEISLSNSLVDMYAKCGKLDAAMVVFNGTNWKDDIS-WKNIIFGC  267



>ref|XP_010914721.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Elaeis guineensis]
Length=640

 Score =   348 bits (893),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 166/322 (52%), Positives = 224/322 (70%), Gaps = 5/322 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G      V TALL+ YA F  +E ++ LF+ L QKD +AWSAMISAY+ +  P  AL 
Sbjct  320  KNGLGASTSVGTALLRAYAEFKEVEMAQALFNQLHQKDNVAWSAMISAYSHTGHPDLALE  379

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSM----AAQDVGETIHTQVMKLGYTSNAFLASGLI  349
            +F++MQL   + NE  F SLLQACS +     A  +G++IH  V +L   SN F+ S LI
Sbjct  380  MFKQMQLAREEANEITFVSLLQACSLVCSLVGALKLGKSIHAHVTRLVCVSNMFVTSALI  439

Query  350  DMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDV  529
            D YCK GR+ + + +F +   +DL+CWSSMINGYG+NG G EA++ F +ML  G+ PN+V
Sbjct  440  DFYCKLGRLREAEILFGKLQKRDLVCWSSMINGYGINGCGEEAVQIFYNMLEQGLMPNEV  499

Query  530  VFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNK  709
             F+S+LSACSHCGL  EGW WFH+M+E++ I+  LAHY C+VD+L  QG VEEALEFVN 
Sbjct  500  TFVSILSACSHCGLVDEGWKWFHSMKEQFGISSTLAHYTCIVDLLGGQGRVEEALEFVNM  559

Query  710  MPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDE  889
            MP+EPD  +WGALL+ CR  HG   I+E  A++LI LDP+N+S YV LSNLY+  G W++
Sbjct  560  MPMEPDITVWGALLSWCRG-HGDINIAEFAAERLIQLDPSNSSCYVTLSNLYSKLGLWED  618

Query  890  VEKLRQLMDGKKRKKGMGYSVV  955
             +++R LM+    KK  G+S+V
Sbjct  619  AQRIRGLMEDNSLKKTAGFSMV  640


 Score =   111 bits (277),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 100/187 (53%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+GF   + + TAL+  Y++   +ES+R LF S   KD+I WSAM+S   ++ Q   A+ 
Sbjct  118  KNGFECEVAITTALIGFYSSLCELESARRLFYSTPMKDLILWSAMVSTCCKNGQFIEAID  177

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             F  M      PN  +  S+L AC++  A   G+ IH   ++  + S   L + L+DMY 
Sbjct  178  TFGEMLSFGVTPNNVSLVSVLLACANTNALLHGKQIHGYAIRKEFDSETSLCNSLVDMYV  237

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G++     +F+    KD I W ++I G   NG   EAL+ F DM +  I+P+++   +
Sbjct  238  KCGKLDAAMVVFNSTNWKDNISWKNIIFGCIENGLPREALQLFYDMRASSIEPDEITIRN  297

Query  542  VLSACSH  562
            V+  CS 
Sbjct  298  VIGTCSQ  304


 Score =   102 bits (255),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 117/246 (48%), Gaps = 4/246 (2%)
 Frame = +2

Query  26   PVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLE  205
            P   A    Y+   NIE+ R LFD +  ++++  ++ I    +S++   A+ +   M L 
Sbjct  25   PTQAAKSPFYSERRNIETPRQLFDRIPDRNMVDSNSDIYCSTRSEKEVRAIKLPSWMLLG  84

Query  206  HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQG  385
                   A   +++A   M + D    IH  V+K G+     + + LI  Y     +   
Sbjct  85   GSNSLRLAVSCIVRAIKFMGSDDTKRGIHAAVIKNGFECEVAITTALIGFYSSLCELESA  144

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC  565
            + +F   P KDLI WS+M++    NG   EA++ F +MLS G+ PN+V  +SVL AC++ 
Sbjct  145  RRLFYSTPMKDLILWSAMVSTCCKNGQFIEAIDTFGEMLSFGVTPNNVSLVSVLLACANT  204

Query  566  GLEYEGWNWF-HAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
                 G     +A+ +++D    L +   +VDM  + G ++ A+   N    + D   W 
Sbjct  205  NALLHGKQIHGYAIRKEFDSETSLCN--SLVDMYVKCGKLDAAMVVFNSTNWK-DNISWK  261

Query  743  ALLAGC  760
             ++ GC
Sbjct  262  NIIFGC  267


 Score = 99.0 bits (245),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/243 (25%), Positives = 119/243 (49%), Gaps = 4/243 (2%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
            +L+ MY   G ++++ ++F+S + KD I+W  +I    ++  P  AL +F  M+    +P
Sbjct  231  SLVDMYVKCGKLDAAMVVFNSTNWKDNISWKNIIFGCIENGLPREALQLFYDMRASSIEP  290

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            +E    +++  CS ++       +H  ++K G  ++  + + L+  Y +F  +   + +F
Sbjct  291  DEITIRNVIGTCSQVSYLIFILGLHCYIIKNGLGASTSVGTALLRAYAEFKEVEMAQALF  350

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH-CGL-  571
            ++   KD + WS+MI+ Y   GH + ALE F  M     + N++ F+S+L ACS  C L 
Sbjct  351  NQLHQKDNVAWSAMISAYSHTGHPDLALEMFKQMQLAREEANEITFVSLLQACSLVCSLV  410

Query  572  -EYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
               +     HA   +      +   + ++D   + G + EA     K+  + D   W ++
Sbjct  411  GALKLGKSIHAHVTRLVCVSNMFVTSALIDFYCKLGRLREAEILFGKLQ-KRDLVCWSSM  469

Query  749  LAG  757
            + G
Sbjct  470  ING  472



>ref|XP_008439351.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At3g01580 [Cucumis melo]
Length=825

 Score =   313 bits (802),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 146/257 (57%), Positives = 185/257 (72%), Gaps = 0/257 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GFL  I V T LLQMYA FG++  ++++FD L  KDIIAWSAMIS Y+  + P NA+ 
Sbjct  315  KGGFLCFILVGTELLQMYAKFGDLRLAKLVFDELVDKDIIAWSAMISVYSHGEDPLNAIQ  374

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             F+ MQ  + KPNE  F SL+ ACSS+ A+++GE+I    +K GYTSN  L S L+  YC
Sbjct  375  TFKMMQSTNEKPNERTFVSLMDACSSLGAKELGESIQAHTIKCGYTSNTHLMSALVGFYC  434

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
              GRI  G+ +FDE   KDLICW++MI GYG+NG GN+AL  F DMLS+G++PN VVF S
Sbjct  435  TLGRIKLGEHVFDEISTKDLICWNAMIKGYGLNGCGNKALNTFSDMLSYGLKPNGVVFAS  494

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +LSAC+ CGLE E   WF +M +KY ITP  AHYAC+VD+L R+G + EA+EFV  MP+E
Sbjct  495  LLSACAQCGLEKEVRMWFRSMIDKYGITPTEAHYACIVDLLVRKGKIGEAVEFVKXMPVE  554

Query  722  PDKRIWGALLAGCRKTH  772
            PD RIWGALL GC+ TH
Sbjct  555  PDTRIWGALLLGCKLTH  571


 Score = 98.6 bits (244),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/233 (25%), Positives = 119/233 (51%), Gaps = 3/233 (1%)
 Frame = +2

Query  107  QKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGET  286
            ++D+I+W++ I+   ++ QP +A   F+ M     +PN     S+++A  +++   + E 
Sbjct  48   REDVISWTSKITNLVRAGQPESAFGFFKMMFSNGHRPNYVTMLSVIRAIDALSWDSMIEV  107

Query  287  IHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGH  466
            +H   +K+G+ S   +++ L+  Y     I     +F++ P KD++ WS++I+    NG 
Sbjct  108  MHGVTIKMGFESEVAVSTALLGFY-SIRDIETVWKLFNQIPCKDVVFWSAIISACVKNGQ  166

Query  467  GNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYA  646
             +EA +   +M   G+QPN V  +S+L AC+  G+   G    HA   + D    +    
Sbjct  167  YSEAFDLLREMQDQGVQPNQVSIVSILPACADFGVLSLG-KELHAFSMRKDFYSMVDIQN  225

Query  647  CMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAK  805
             ++DM S+    E +++ V K+  + D   W  +   C + +  SE+ ++ ++
Sbjct  226  SLMDMYSKCRMFEASIK-VLKLMRKKDAVSWKIITHACIQNNYPSEVFKIFSR  277


 Score = 96.3 bits (238),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 96/194 (49%), Gaps = 0/194 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            +  F   + +  +L+ MY+     E+S  +   + +KD ++W  +  A  Q++ PS    
Sbjct  214  RKDFYSMVDIQNSLMDMYSKCRMFEASIKVLKLMRKKDAVSWKIITHACIQNNYPSEVFK  273

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F RM+    + +E     ++ A   +    +G  +H   +K G+     + + L+ MY 
Sbjct  274  IFSRMRSLGFELSETMVLDMISAVLLVDELLLGLAVHCYALKGGFLCFILVGTELLQMYA  333

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            KFG +   K +FDE  DKD+I WS+MI+ Y        A++ F  M S   +PN+  F+S
Sbjct  334  KFGDLRLAKLVFDELVDKDIIAWSAMISVYSHGEDPLNAIQTFKMMQSTNEKPNERTFVS  393

Query  542  VLSACSHCGLEYEG  583
            ++ ACS  G +  G
Sbjct  394  LMDACSSLGAKELG  407


 Score = 87.0 bits (214),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 93/184 (51%), Gaps = 1/184 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   + V TALL  Y+   +IE+   LF+ +  KD++ WSA+ISA  ++ Q S A  
Sbjct  114  KMGFESEVAVSTALLGFYS-IRDIETVWKLFNQIPCKDVVFWSAIISACVKNGQYSEAFD  172

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            + R MQ +  +PN+ +  S+L AC+      +G+ +H   M+  + S   + + L+DMY 
Sbjct  173  LLREMQDQGVQPNQVSIVSILPACADFGVLSLGKELHAFSMRKDFYSMVDIQNSLMDMYS  232

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K         +      KD + W  + +    N + +E  + F  M S G + ++ + + 
Sbjct  233  KCRMFEASIKVLKLMRKKDAVSWKIITHACIQNNYPSEVFKIFSRMRSLGFELSETMVLD  292

Query  542  VLSA  553
            ++SA
Sbjct  293  MISA  296



>ref|XP_010660692.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Vitis vinifera]
Length=659

 Score =   303 bits (776),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/345 (40%), Positives = 221/345 (64%), Gaps = 7/345 (2%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF   + V   L+  YA  G +  SR +FD ++++D+I+W+++I+ YAQ+   + ++ 
Sbjct  213   KRGFEGDLGVENTLMDAYAKCGELGVSRRVFDGMAERDVISWNSIIAVYAQNGMSTESME  272

Query  182   VFRRMQLEHGKPN--EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM  355
             +F RM ++ G+ N       ++L AC+   +Q +G+ IH QV+K+G  SN F+ + +IDM
Sbjct  273   IFHRM-VKDGEINYNAVTLSAVLLACAHSGSQRLGKCIHDQVIKMGLESNVFVGTSIIDM  331

Query  356   YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVF  535
             YCK G++   +  FD   +K++  WS+M+ GYGM+GH  EALE F +M   G++PN + F
Sbjct  332   YCKCGKVEMARKAFDRMREKNVKSWSAMVAGYGMHGHAKEALEVFYEMNMAGVKPNYITF  391

Query  536   ISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMP  715
             +SVL+ACSH GL  EGW+WF AM  ++D+ P + HY CMVD+L R G ++EA + +  M 
Sbjct  392   VSVLAACSHAGLLEEGWHWFKAMSHEFDVEPGVEHYGCMVDLLGRAGYLKEAFDLIKGMK  451

Query  716   IEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVE  895
             + PD  +WGALL  CR  H + ++ E+ A++L  LDP N  YYV+LSN+YAD GRW++VE
Sbjct  452   LRPDFVVWGALLGACR-MHKNVDLGEISARKLFELDPKNCGYYVLLSNIYADAGRWEDVE  510

Query  896   KLRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             ++R LM      K  G+S+V++   +H        ++E+ QH ++
Sbjct  511   RMRILMKNSGLVKPPGFSLVDIKGRVHVFLV---GDREHPQHEKI  552


 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 136/259 (53%), Gaps = 11/259 (4%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF   + V +AL+ MY+  G +  +R LFD +S ++I++W++MI+ Y Q+D    AL +F
Sbjct  106  GFEPDLFVSSALVDMYSKCGELRDARTLFDEISHRNIVSWTSMITGYVQNDDAHRALLLF  165

Query  188  RRMQLEHGKP--------NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASG  343
            +   +E            +  A  S+L ACS ++ + + E +H  ++K G+  +  + + 
Sbjct  166  KEFLVEESGSEGDGEVCVDPIAMVSVLSACSRVSEKSITEGVHGFLIKRGFEGDLGVENT  225

Query  344  LIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHG-IQP  520
            L+D Y K G +   + +FD   ++D+I W+S+I  Y  NG   E++E F  M+  G I  
Sbjct  226  LMDAYAKCGELGVSRRVFDGMAERDVISWNSIIAVYAQNGMSTESMEIFHRMVKDGEINY  285

Query  521  NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEF  700
            N V   +VL AC+H G +  G    H    K  +   +     ++DM  + G VE A + 
Sbjct  286  NAVTLSAVLLACAHSGSQRLG-KCIHDQVIKMGLESNVFVGTSIIDMYCKCGKVEMARKA  344

Query  701  VNKMPIEPDKRIWGALLAG  757
             ++M  E + + W A++AG
Sbjct  345  FDRMR-EKNVKSWSAMVAG  362


 Score = 96.7 bits (239),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 95/180 (53%), Gaps = 12/180 (7%)
 Frame = +2

Query  47   QMYANFGNIESSRILFDSLSQK-DIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNE  223
            + Y+N  N+ +   LF+    K ++ +W+++I+  A+S     AL  F  M+    KPN 
Sbjct  20   RRYSNNPNLTT---LFNKYVDKTNVFSWNSVIAELARSGDSVEALRAFSSMRKLSLKPNR  76

Query  224  FAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDE  403
              F   +++CS++     G   H Q +  G+  + F++S L+DMY K G +   +T+FDE
Sbjct  77   STFPCAIKSCSALLDLHSGRQAHQQALIFGFEPDLFVSSALVDMYSKCGELRDARTLFDE  136

Query  404  NPDKDLICWSSMINGYGMNGHGNEALECFLDML-----SHG---IQPNDVVFISVLSACS  559
               ++++ W+SMI GY  N   + AL  F + L     S G   +  + +  +SVLSACS
Sbjct  137  ISHRNIVSWTSMITGYVQNDDAHRALLLFKEFLVEESGSEGDGEVCVDPIAMVSVLSACS  196



>ref|XP_002300144.1| phosphoglycerate/bisphosphoglycerate mutase family protein [Populus 
trichocarpa]
 gb|EEE84949.1| phosphoglycerate/bisphosphoglycerate mutase family protein [Populus 
trichocarpa]
Length=666

 Score =   303 bits (775),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/344 (42%), Positives = 216/344 (63%), Gaps = 5/344 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K G  K + V   LL  YA  G +  SR +FD +++KD+++W++MI+ YAQ+   ++A  
Sbjct  220   KVGLDKVMGVENTLLDAYAKCGEVSLSRKVFDDMAEKDVVSWNSMIAVYAQNGLSTDAFE  279

Query  182   VFRRM-QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VF  M +   GK NE    +LL AC+   A  VG  +H QV+K+GY +N  +A+ +IDMY
Sbjct  280   VFHGMLKAGGGKYNEVTLSTLLLACAHEGALRVGMCLHDQVIKMGYVNNVIMATSIIDMY  339

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK G+    +  FD   +K++  W++MI GYGM+G   EAL+ F  M+  G++PN + FI
Sbjct  340   CKCGQAEMARNAFDGMKEKNVRSWTAMIAGYGMHGFAREALDVFYQMIWAGVKPNYITFI  399

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             SVL+ACSH G   EGW WF+AM  +Y++ P + HY CMVD+L R G ++EA   +  M +
Sbjct  400   SVLAACSHAGFLEEGWRWFNAMSHEYNVEPGVEHYGCMVDLLGRAGYIKEAYNLIKSMKV  459

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
               D  +WG+LLA CR  H   E++E+ A++L  LDP+N  YYV+L+N+YAD GRW +VE+
Sbjct  460   RRDFVLWGSLLAACR-IHKDVELAEISARELFKLDPSNCGYYVLLANIYADAGRWKDVER  518

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             +R L+  +   K  GYS+VE+   +H        ++E+ QH ++
Sbjct  519   MRILVKDRGLVKPPGYSLVELKGRVHVFLV---GDKEHPQHEKI  559


 Score =   130 bits (326),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 86/295 (29%), Positives = 147/295 (50%), Gaps = 15/295 (5%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF   + V +AL+ MY+  G + ++R+LFD + +++I+ W+++I+ Y Q+D    AL VF
Sbjct  112  GFESDLFVSSALIDMYSKCGKLSNARVLFDEIPRRNIVTWTSLITGYVQNDDAHEALMVF  171

Query  188  RRMQLEHGKPN---------EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLAS  340
            +    E  + N           A  S+L ACS ++ + V E +H   +K+G      + +
Sbjct  172  KEFLFEKSEGNGEEVGTSVDSVAMISVLSACSRVSNKAVSEGVHGVAIKVGLDKVMGVEN  231

Query  341  GLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDML-SHGIQ  517
             L+D Y K G +   + +FD+  +KD++ W+SMI  Y  NG   +A E F  ML + G +
Sbjct  232  TLLDAYAKCGEVSLSRKVFDDMAEKDVVSWNSMIAVYAQNGLSTDAFEVFHGMLKAGGGK  291

Query  518  PNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALE  697
             N+V   ++L AC+H G    G    H    K      +     ++DM  + G  E A  
Sbjct  292  YNEVTLSTLLLACAHEGALRVGM-CLHDQVIKMGYVNNVIMATSIIDMYCKCGQAEMARN  350

Query  698  FVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLI--SLDPTNASYYVILS  856
              + M  E + R W A++AG    HG +  +  V  Q+I   + P   ++  +L+
Sbjct  351  AFDGMK-EKNVRSWTAMIAG-YGMHGFAREALDVFYQMIWAGVKPNYITFISVLA  403


 Score =   105 bits (261),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/229 (28%), Positives = 113/229 (49%), Gaps = 15/229 (7%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
              + D+ +W+++I+  A+      +L  F  M+    KPN   F   +++CS++   + G
Sbjct  42   FDRTDVYSWNSLIAELARGGDSCESLRAFSWMRKLDIKPNRSTFPCAIKSCSALFDLNSG  101

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q +  G+ S+ F++S LIDMY K G++   + +FDE P ++++ W+S+I GY  N
Sbjct  102  KQAHQQALVFGFESDLFVSSALIDMYSKCGKLSNARVLFDEIPRRNIVTWTSLITGYVQN  161

Query  461  GHGNEALECFLDMLSH---------GIQPNDVVFISVLSACSHCGLEY--EGWNWFHAME  607
               +EAL  F + L           G   + V  ISVLSACS    +   EG    H + 
Sbjct  162  DDAHEALMVFKEFLFEKSEGNGEEVGTSVDSVAMISVLSACSRVSNKAVSEG---VHGVA  218

Query  608  EKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
             K  +   +     ++D  ++ G V  + +  + M  E D   W +++A
Sbjct  219  IKVGLDKVMGVENTLLDAYAKCGEVSLSRKVFDDMA-EKDVVSWNSMIA  266



>ref|XP_011045805.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Populus euphratica]
 ref|XP_011045806.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Populus euphratica]
Length=666

 Score =   302 bits (773),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/344 (42%), Positives = 216/344 (63%), Gaps = 5/344 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K G  K + V   LL  YA  G +  SR +FD +++KD+++W++MI+ YAQ+   ++A  
Sbjct  220   KVGLDKVMGVENTLLDAYAKCGEVSLSRKVFDDMAEKDVVSWNSMIAVYAQNGLSTDAFE  279

Query  182   VFRRM-QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VF  M +   GK NE    +LL AC+   A  VG  +H QV+K+GY +N  +A+ +IDMY
Sbjct  280   VFHGMLKAGGGKYNEVTLSTLLLACAHEGALRVGMCLHDQVIKMGYVNNVIMATSIIDMY  339

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK G+    +  FD   +K++  W++MI GYGM+G   EAL+ F  M+  G++PN + FI
Sbjct  340   CKCGQAEMARNAFDGMKEKNVRSWTAMIAGYGMHGFAREALDVFYQMIWAGVKPNYITFI  399

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             SVL+ACSH G   EGW WF+AM  +Y++ P + HY CMVD+L R G ++EA   +  M +
Sbjct  400   SVLAACSHAGFLDEGWRWFNAMSHEYNVEPGVEHYGCMVDLLGRAGYIKEAYNLIKSMKV  459

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
               D  +WG+LLA CR  H   E++E+ A++L  LDP+N  YYV+L+N+YAD GRW +VE+
Sbjct  460   RRDFVLWGSLLAACR-IHKDVELAEISARELFKLDPSNCGYYVLLANIYADAGRWKDVER  518

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             +R L+  +   K  GYS+VE+   +H        ++E+ QH ++
Sbjct  519   MRILVKDRGLVKPPGYSLVELKGRVHIFLV---GDKEHPQHEKI  559


 Score =   131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 90/309 (29%), Positives = 153/309 (50%), Gaps = 20/309 (6%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF   + V +AL+ MY+  G + ++R+LFD + +++I+ W+++I+ Y Q+D    AL VF
Sbjct  112  GFESDLFVSSALIDMYSKCGKLSNARVLFDEIPRRNIVTWTSLITGYVQNDDAHEALMVF  171

Query  188  RRMQLEHGKPN---------EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLAS  340
            +    E  + N           A  S+L ACS ++ + V E +H   +K+G      + +
Sbjct  172  KEFLFEKSEGNGEEVGTSVDSVAMISVLSACSRVSNKAVSEGVHGVAIKVGLDKVMGVEN  231

Query  341  GLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDML-SHGIQ  517
             L+D Y K G +   + +FD+  +KD++ W+SMI  Y  NG   +A E F  ML + G +
Sbjct  232  TLLDAYAKCGEVSLSRKVFDDMAEKDVVSWNSMIAVYAQNGLSTDAFEVFHGMLKAGGGK  291

Query  518  PNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALE  697
             N+V   ++L AC+H G    G    H    K      +     ++DM  + G  E A  
Sbjct  292  YNEVTLSTLLLACAHEGALRVGM-CLHDQVIKMGYVNNVIMATSIIDMYCKCGQAEMARN  350

Query  698  FVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLI--SLDPTNASYYVILSNL---  862
              + M  E + R W A++AG    HG +  +  V  Q+I   + P   ++  +L+     
Sbjct  351  AFDGMK-EKNVRSWTAMIAG-YGMHGFAREALDVFYQMIWAGVKPNYITFISVLAACSHA  408

Query  863  -YADQG-RW  883
             + D+G RW
Sbjct  409  GFLDEGWRW  417


 Score =   105 bits (261),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/229 (28%), Positives = 113/229 (49%), Gaps = 15/229 (7%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
              + D+ +W+++I+  A+      +L  F  M+    KPN   F   +++CS++   + G
Sbjct  42   FDRTDVYSWNSLIAELARGGDSCESLRAFSWMRKLDIKPNRSTFPCAIKSCSALFDLNSG  101

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q +  G+ S+ F++S LIDMY K G++   + +FDE P ++++ W+S+I GY  N
Sbjct  102  KQAHQQALVFGFESDLFVSSALIDMYSKCGKLSNARVLFDEIPRRNIVTWTSLITGYVQN  161

Query  461  GHGNEALECFLDMLSH---------GIQPNDVVFISVLSACSHCGLEY--EGWNWFHAME  607
               +EAL  F + L           G   + V  ISVLSACS    +   EG    H + 
Sbjct  162  DDAHEALMVFKEFLFEKSEGNGEEVGTSVDSVAMISVLSACSRVSNKAVSEG---VHGVA  218

Query  608  EKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
             K  +   +     ++D  ++ G V  + +  + M  E D   W +++A
Sbjct  219  IKVGLDKVMGVENTLLDAYAKCGEVSLSRKVFDDMA-EKDVVSWNSMIA  266



>ref|XP_004493063.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial-like [Cicer arietinum]
Length=663

 Score =   301 bits (772),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/344 (40%), Positives = 216/344 (63%), Gaps = 5/344 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF  C+ V   L+  YA  G I  SR +FD + + D+ +W+++I+ YAQ+   + A +
Sbjct  217   KKGFEGCLAVGNTLMDAYAKCGEIGVSRKVFDGMKENDVCSWNSLIAVYAQNGLSAEAFS  276

Query  182   VFRRM-QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             +F  M + +  + N     ++L AC++  A  +G+ IH Q++K+    N F+ + ++DMY
Sbjct  277   IFSDMVKSDEIRYNAVTLSAVLLACANSGALQIGKCIHDQIVKMELEDNVFVGTSIVDMY  336

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK GR+   +  FD    K++  W++M+ GYGM+G   EA+E F +M+  GI+PN + F+
Sbjct  337   CKCGRVEMARKAFDRMKKKNVKSWTAMVAGYGMHGRAKEAMEVFYEMIRSGIKPNYITFV  396

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             SVL+ACSH GL  EGWNWF+ M+ ++D+ P + HY+CMVD+L R G ++EA   + +M +
Sbjct  397   SVLAACSHAGLLKEGWNWFNRMKCEFDVEPGIEHYSCMVDLLGRAGYLKEAYGLIQEMKV  456

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
              PD  +WG+LL  CR  H + E+ E+ A++L  LDP+N  YYV+LSN+YAD GRWD+VE+
Sbjct  457   RPDFIVWGSLLGACR-IHKNVELGEISARKLFELDPSNCGYYVLLSNIYADAGRWDDVER  515

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             +R LM  +   K  GYS+ E    +H        ++E+ QH ++
Sbjct  516   MRILMKNRGLLKTPGYSIAEHKGRIHVFLV---GDKEHPQHEKI  556


 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 150/293 (51%), Gaps = 13/293 (4%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G+   + V +AL+ MY+  G++  +R LFD + ++++++W++MI+ Y Q+D+P  A+++F
Sbjct  111  GYDSNVFVASALIDMYSKCGHLNDARKLFDEIPERNVVSWTSMIAGYVQNDRPCEAVSLF  170

Query  188  RRMQL-------EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGL  346
            + + L       E    +      ++ AC+ +  + V E +H  V K G+     + + L
Sbjct  171  KELLLVEESVYEEGVGVDSVLVGCVVSACARICLKSVTECVHGLVTKKGFEGCLAVGNTL  230

Query  347  IDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDML-SHGIQPN  523
            +D Y K G I   + +FD   + D+  W+S+I  Y  NG   EA   F DM+ S  I+ N
Sbjct  231  MDAYAKCGEIGVSRKVFDGMKENDVCSWNSLIAVYAQNGLSAEAFSIFSDMVKSDEIRYN  290

Query  524  DVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFV  703
             V   +VL AC++ G    G    H    K ++   +     +VDM  + G VE A +  
Sbjct  291  AVTLSAVLLACANSGALQIG-KCIHDQIVKMELEDNVFVGTSIVDMYCKCGRVEMARKAF  349

Query  704  NKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLI--SLDPTNASYYVILS  856
            ++M  + + + W A++AG    HG ++ +  V  ++I   + P   ++  +L+
Sbjct  350  DRMK-KKNVKSWTAMVAG-YGMHGRAKEAMEVFYEMIRSGIKPNYITFVSVLA  400


 Score =   108 bits (271),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 114/225 (51%), Gaps = 9/225 (4%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + +  + +W+A+I+ +A+S +   AL  F  M+     PN   F   +++CSS++    G
Sbjct  41   VDKTSVFSWNAVIADFARSGESLEALNAFSSMRKLSLHPNRSTFPCTIKSCSSLSDLRAG  100

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q    GY SN F+AS LIDMY K G ++  + +FDE P+++++ W+SMI GY  N
Sbjct  101  KQTHQQAFVFGYDSNVFVASALIDMYSKCGHLNDARKLFDEIPERNVVSWTSMIAGYVQN  160

Query  461  GHGNEALECFLDML-------SHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYD  619
                EA+  F ++L         G+  + V+   V+SAC+   L+       H +  K  
Sbjct  161  DRPCEAVSLFKELLLVEESVYEEGVGVDSVLVGCVVSACARICLK-SVTECVHGLVTKKG  219

Query  620  ITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
                LA    ++D  ++ G +  + +  + M  E D   W +L+A
Sbjct  220  FEGCLAVGNTLMDAYAKCGEIGVSRKVFDGMK-ENDVCSWNSLIA  263



>emb|CBI21289.3| unnamed protein product [Vitis vinifera]
Length=581

 Score =   295 bits (756),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/373 (38%), Positives = 219/373 (59%), Gaps = 36/373 (10%)
 Frame = +2

Query  8     GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
             GF   + V +AL+ MY+  G +  +R LFD +S ++I++W++MI+ Y Q+D    AL VF
Sbjct  106   GFEPDLFVSSALVDMYSKCGELRDARTLFDEISHRNIVSWTSMITGYVQNDDAHRALRVF  165

Query  188   -------------------------RRMQLEHG-------KPNEFAFHSLLQACSSMAAQ  271
                                        M++ H          N     ++L AC+   +Q
Sbjct  166   DGMAERDVISWNSIIAVYAQNGMSTESMEIFHRMVKDGEINYNAVTLSAVLLACAHSGSQ  225

Query  272   DVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGY  451
              +G+ IH QV+K+G  SN F+ + +IDMYCK G++   +  FD   +K++  WS+M+ GY
Sbjct  226   RLGKCIHDQVIKMGLESNVFVGTSIIDMYCKCGKVEMARKAFDRMREKNVKSWSAMVAGY  285

Query  452   GMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPK  631
             GM+GH  EALE F +M   G++PN + F+SVL+ACSH GL  EGW+WF AM  ++D+ P 
Sbjct  286   GMHGHAKEALEVFYEMNMAGVKPNYITFVSVLAACSHAGLLEEGWHWFKAMSHEFDVEPG  345

Query  632   LAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQL  811
             + HY CMVD+L R G ++EA + +  M + PD  +WGALL  CR  H + ++ E+ A++L
Sbjct  346   VEHYGCMVDLLGRAGYLKEAFDLIKGMKLRPDFVVWGALLGACR-MHKNVDLGEISARKL  404

Query  812   ISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKKGMGYSVVEVNNSMHRMEF*  991
               LDP N  YYV+LSN+YAD GRW++VE++R LM      K  G+S+V++   +H     
Sbjct  405   FELDPKNCGYYVLLSNIYADAGRWEDVERMRILMKNSGLVKPPGFSLVDIKGRVHVFLV-  463

Query  992   *RSEQEYIQHSRV  1030
                ++E+ QH ++
Sbjct  464   --GDREHPQHEKI  474


 Score =   105 bits (262),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 75/270 (28%), Positives = 126/270 (47%), Gaps = 38/270 (14%)
 Frame = +2

Query  47   QMYANFGNIESSRILFDSLSQK-DIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNE  223
            + Y+N  N+ +   LF+    K ++ +W+++I+  A+S     AL  F  M+    KPN 
Sbjct  20   RRYSNNPNLTT---LFNKYVDKTNVFSWNSVIAELARSGDSVEALRAFSSMRKLSLKPNR  76

Query  224  FAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDE  403
              F   +++CS++     G   H Q +  G+  + F++S L+DMY K G +   +T+FDE
Sbjct  77   STFPCAIKSCSALLDLHSGRQAHQQALIFGFEPDLFVSSALVDMYSKCGELRDARTLFDE  136

Query  404  NPDKDLICWSSMINGY--------------GM-----------------NGHGNEALECF  490
               ++++ W+SMI GY              GM                 NG   E++E F
Sbjct  137  ISHRNIVSWTSMITGYVQNDDAHRALRVFDGMAERDVISWNSIIAVYAQNGMSTESMEIF  196

Query  491  LDMLSHG-IQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLS  667
              M+  G I  N V   +VL AC+H G +  G    H    K  +   +     ++DM  
Sbjct  197  HRMVKDGEINYNAVTLSAVLLACAHSGSQRLG-KCIHDQVIKMGLESNVFVGTSIIDMYC  255

Query  668  RQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            + G VE A +  ++M  E + + W A++AG
Sbjct  256  KCGKVEMARKAFDRMR-EKNVKSWSAMVAG  284


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G    + V T+++ MY   G +E +R  FD + +K++ +WSAM++ Y        AL 
Sbjct  237  KMGLESNVFVGTSIIDMYCKCGKVEMARKAFDRMREKNVKSWSAMVAGYGMHGHAKEALE  296

Query  182  VFRRMQLEHGKPNEFAFHSLLQACS  256
            VF  M +   KPN   F S+L ACS
Sbjct  297  VFYEMNMAGVKPNYITFVSVLAACS  321



>ref|XP_006338732.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial-like isoform X1 [Solanum tuberosum]
Length=645

 Score =   297 bits (761),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/344 (41%), Positives = 214/344 (62%), Gaps = 5/344 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF + + V    +  YA  G ++ SR +FD +  KDII+W++MI+ YAQ    + A+ 
Sbjct  199   KRGFNEDVGVGNTFIDAYAKCGEVDLSRKMFDIMPDKDIISWNSMIAVYAQHGLSAQAME  258

Query  182   VFRRMQLEHGKP-NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             +FR +  +     N     +LL AC+   A   G+ IH QV+K+    N ++++ +IDMY
Sbjct  259   IFRSLAWDREVDYNAVTLSALLLACAHSGALQAGKCIHDQVIKMNLEDNVYVSTSMIDMY  318

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK GR+   +  F+   +K++  WS++I GYGM+G   EAL+ F +M S G++PN + F+
Sbjct  319   CKCGRLRMARNAFNRMKEKNVKSWSALIAGYGMHGRAKEALQVFYEMNSAGVKPNYITFV  378

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             SVL+ACSH GL  EGW WF  ME ++ I P + HYACMVD+L R G + +A   + +M +
Sbjct  379   SVLAACSHAGLLDEGWYWFKVMEPRFCIQPGVEHYACMVDLLGRAGFLTKAYNLLKEMKV  438

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
              PD  IWG+LLA CR  H + E+ E+ A  L  LDPTN+ YYV+LSN+YAD GRW++VEK
Sbjct  439   TPDFVIWGSLLAACR-MHKNVELGEISASNLFELDPTNSGYYVLLSNIYADAGRWEDVEK  497

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             +R LM  +   K  G+S++E+   +H        ++E++QH +V
Sbjct  498   MRILMKNRGLSKPPGFSLLELKGRVHVFLV---GDREHLQHEKV  538


 Score =   131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/248 (31%), Positives = 128/248 (52%), Gaps = 7/248 (3%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V +AL+ MY+  G +  +R LFD + QK++++W++MI+ Y Q+D P  A+ +F+ +    
Sbjct  103  VSSALIDMYSKCGQLADARKLFDQIPQKNVVSWTSMITGYVQNDLPHEAILLFKELLAAQ  162

Query  209  GKPNEF----AFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
                 F    A  S+L ACS ++ + + + +H  V K G+  +  + +  ID Y K G +
Sbjct  163  AGEVVFLDSVAMVSVLSACSRLSRKTLTQGLHGFVTKRGFNEDVGVGNTFIDAYAKCGEV  222

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDML-SHGIQPNDVVFISVLSA  553
               + +FD  PDKD+I W+SMI  Y  +G   +A+E F  +     +  N V   ++L A
Sbjct  223  DLSRKMFDIMPDKDIISWNSMIAVYAQHGLSAQAMEIFRSLAWDREVDYNAVTLSALLLA  282

Query  554  CSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKR  733
            C+H G    G    H    K ++   +     M+DM  + G +  A    N+M  E + +
Sbjct  283  CAHSGALQAG-KCIHDQVIKMNLEDNVYVSTSMIDMYCKCGRLRMARNAFNRMK-EKNVK  340

Query  734  IWGALLAG  757
             W AL+AG
Sbjct  341  SWSALIAG  348


 Score =   112 bits (279),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/224 (30%), Positives = 116/224 (52%), Gaps = 10/224 (4%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            L + D+ +W+++I+  A+S     AL  F  M+    KPN   F   +++CSS++    G
Sbjct  26   LDKSDVFSWNSIIADLARSGDAVEALRAFSSMRKLSLKPNRSTFPCAVKSCSSLSDLTSG  85

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q +  GY ++ F++S LIDMY K G++   + +FD+ P K+++ W+SMI GY  N
Sbjct  86   KQTHQQALIFGYDTDLFVSSALIDMYSKCGQLADARKLFDQIPQKNVVSWTSMITGYVQN  145

Query  461  GHGNEALECFLDMLSHGIQPNDVVF------ISVLSACSHCGLEYEGWNWFHAMEEKYDI  622
               +EA+  F ++L+   Q  +VVF      +SVLSACS    +       H    K   
Sbjct  146  DLPHEAILLFKELLA--AQAGEVVFLDSVAMVSVLSACSRLSRKTLTQG-LHGFVTKRGF  202

Query  623  TPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
               +      +D  ++ G V+ + +  + MP + D   W +++A
Sbjct  203  NEDVGVGNTFIDAYAKCGEVDLSRKMFDIMP-DKDIISWNSMIA  245



>ref|XP_010908711.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Elaeis guineensis]
Length=682

 Score =   298 bits (763),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/326 (41%), Positives = 214/326 (66%), Gaps = 2/326 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G    + V   L+  YA  GN+E  R +FD ++++D+++W++MI+ YAQ+   + AL 
Sbjct  236  KVGLDMDVGVGNTLMDAYAKGGNLEVGRKVFDGMAERDVVSWNSMIALYAQNGLSAEALE  295

Query  182  VFRRMQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
            ++ +M  + G + +     ++L AC+   A  +G+ IH QV+++G   + ++ + ++DMY
Sbjct  296  LYCKMLSDGGVRYSAVTLSAVLLACAHAGALQIGKCIHDQVVRIGLEEDVYVGTSVVDMY  355

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
            CK GR+   +  F+   +++++ WS+M+ GYGM+GHG EALE F +M   G++PN + F+
Sbjct  356  CKCGRVEIARKAFNRMKERNILSWSAMVAGYGMHGHGREALEVFYEMRGSGVKPNHITFV  415

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            SVL+ACSH GL  +G  WFHAM++++ I P + HY C+VD+L R G ++EA   + +M I
Sbjct  416  SVLAACSHAGLVDDGRCWFHAMKKEFGIHPGVEHYGCIVDLLGRAGCLDEAYGLIKEMTI  475

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
            +PD  +WGALL+ CR  H + E+ E+ AK+L  LDP N  YYV+LSN+YAD GRWD+V+K
Sbjct  476  KPDFVVWGALLSACR-IHKNVELGEISAKKLFELDPKNCGYYVLLSNIYADAGRWDDVQK  534

Query  899  LRQLMDGKKRKKGMGYSVVEVNNSMH  976
            +R LM  +   K  GYS+VE+    H
Sbjct  535  MRVLMKNRGLVKPPGYSLVELKGRTH  560


 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/280 (28%), Positives = 133/280 (48%), Gaps = 6/280 (2%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V +AL+ MY+       +R  FD    ++ + W+AMI  Y  +D    AL++F+    + 
Sbjct  142  VASALVDMYSKCREPVDARRAFDETPHRNAVLWTAMIVGYIWNDAAREALSLFKEFLAKE  201

Query  209  G--KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            G    +  A  + L ACS +  +     +H   +K+G   +  + + L+D Y K G +  
Sbjct  202  GALSLDTVAAVAALSACSRILDRKATGGVHGLAVKVGLDMDVGVGNTLMDAYAKGGNLEV  261

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSH-GIQPNDVVFISVLSACS  559
            G+ +FD   ++D++ W+SMI  Y  NG   EALE +  MLS  G++ + V   +VL AC+
Sbjct  262  GRKVFDGMAERDVVSWNSMIALYAQNGLSAEALELYCKMLSDGGVRYSAVTLSAVLLACA  321

Query  560  HCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIW  739
            H G    G    H    +  +   +     +VDM  + G VE A +  N+M  E +   W
Sbjct  322  HAGALQIG-KCIHDQVVRIGLEEDVYVGTSVVDMYCKCGRVEIARKAFNRMK-ERNILSW  379

Query  740  GALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVILS  856
             A++AG     HG   +      +   + P + ++  +L+
Sbjct  380  SAMVAGYGMHGHGREALEVFYEMRGSGVKPNHITFVSVLA  419


 Score = 97.1 bits (240),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/240 (26%), Positives = 117/240 (49%), Gaps = 4/240 (2%)
 Frame = +2

Query  98   SLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDV  277
            ++    + +W++ I+  A++   + ALA F  M+    +P+  +F   L++ +++++   
Sbjct  64   AVEPSSVASWNSAIADLARAGDSAEALAAFASMRRLRLRPDRSSFPCALKSAAALSSLRS  123

Query  278  GETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGM  457
            G  +H    +LG   + F+AS L+DMY K       +  FDE P ++ + W++MI GY  
Sbjct  124  GRQLHLLAFRLGLHPDLFVASALVDMYSKCREPVDARRAFDETPHRNAVLWTAMIVGYIW  183

Query  458  NGHGNEALECFLDMLSH--GIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPK  631
            N    EAL  F + L+    +  + V  ++ LSACS   L+ +     H +  K  +   
Sbjct  184  NDAAREALSLFKEFLAKEGALSLDTVAAVAALSACSRI-LDRKATGGVHGLAVKVGLDMD  242

Query  632  LAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQL  811
            +     ++D  ++ GN+E   +  + M  E D   W +++A   +   S+E  EL  K L
Sbjct  243  VGVGNTLMDAYAKGGNLEVGRKVFDGMA-ERDVVSWNSMIALYAQNGLSAEALELYCKML  301



>ref|XP_008813688.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Phoenix dactylifera]
 ref|XP_008813689.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Phoenix dactylifera]
 ref|XP_008813691.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Phoenix dactylifera]
 ref|XP_008813692.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Phoenix dactylifera]
Length=650

 Score =   296 bits (759),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/326 (41%), Positives = 210/326 (64%), Gaps = 2/326 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G    + V   L+  YA  G++   R +FD ++++D+++W++MI+ YAQ    + AL 
Sbjct  204  KVGLEMDVGVGNTLVDAYAKGGDLGMGRKMFDGMAERDVVSWNSMIALYAQDGLSAEALE  263

Query  182  VFRRMQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
            ++ +M    G + N     ++L AC+   A  +G+ IH QV+++G   + ++ + ++DMY
Sbjct  264  LYCKMLSGGGVRYNAVTLSAVLFACAHAGALQIGKCIHNQVVRIGLEEDVYVGTSVVDMY  323

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
            CK GR+   +  F+    ++++ WS+M+ GYGM+GHG EALE F +M   G++PN + F+
Sbjct  324  CKCGRVEMARKAFNRMKKRNILSWSAMVAGYGMHGHGREALEVFSEMRRSGVKPNHITFV  383

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            SVL+ACSH GL  EG +WFHAM++++ I P + HY C+VD+L R G ++EA   + +M I
Sbjct  384  SVLAACSHAGLVDEGRHWFHAMKKEFGIDPGMEHYGCIVDLLGRAGCLDEAYGLIKEMTI  443

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
            +PD  +WGALL+ CR  H + E+ E+ AK+L  LDP N  YYV+LSN+YAD GRWD VEK
Sbjct  444  KPDFVVWGALLSACR-IHKNVELGEISAKKLFELDPKNCGYYVLLSNIYADAGRWDNVEK  502

Query  899  LRQLMDGKKRKKGMGYSVVEVNNSMH  976
            +R LM  +   K  GYS+VE+    H
Sbjct  503  MRVLMKNRGLVKPPGYSLVELKGRTH  528


 Score =   103 bits (257),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 135/292 (46%), Gaps = 10/292 (3%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V +AL+ MY+       +R  FD    ++ + W+AMI+    +     A ++F+    + 
Sbjct  110  VASALVDMYSKCREPVDARRAFDETPHRNAVLWTAMIAGSVWNGAAREAFSLFKEFLAKE  169

Query  209  G--KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            G    +  A  + L ACS +  +     +H   +K+G   +  + + L+D Y K G +  
Sbjct  170  GALSLDTVAAVAALSACSRVLDRKATGGVHGLAVKVGLEMDVGVGNTLVDAYAKGGDLGM  229

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLS-HGIQPNDVVFISVLSACS  559
            G+ +FD   ++D++ W+SMI  Y  +G   EALE +  MLS  G++ N V   +VL AC+
Sbjct  230  GRKMFDGMAERDVVSWNSMIALYAQDGLSAEALELYCKMLSGGGVRYNAVTLSAVLFACA  289

Query  560  HCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIW  739
            H G    G    H    +  +   +     +VDM  + G VE A +  N+M  + +   W
Sbjct  290  HAGALQIG-KCIHNQVVRIGLEEDVYVGTSVVDMYCKCGRVEMARKAFNRMK-KRNILSW  347

Query  740  GALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVILSNL----YADQGR  880
             A++AG     HG   +      +   + P + ++  +L+        D+GR
Sbjct  348  SAMVAGYGMHGHGREALEVFSEMRRSGVKPNHITFVSVLAACSHAGLVDEGR  399


 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/234 (27%), Positives = 113/234 (48%), Gaps = 4/234 (2%)
 Frame = +2

Query  116  IIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHT  295
            + +W+A I+  A+S   + ALA F  M+    +P+  +F   L+A +++++   G  +H 
Sbjct  38   VASWNAAIADLARSGDSAEALAAFASMRRLRLRPDCSSFPCALKAAAALSSLRSGRQLHL  97

Query  296  QVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNE  475
               +LG   + F+AS L+DMY K       +  FDE P ++ + W++MI G   NG   E
Sbjct  98   LAFRLGLHPDLFVASALVDMYSKCREPVDARRAFDETPHRNAVLWTAMIAGSVWNGAARE  157

Query  476  ALECFLDMLSH--GIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYAC  649
            A   F + L+    +  + V  ++ LSACS   L+ +     H +  K  +   +     
Sbjct  158  AFSLFKEFLAKEGALSLDTVAAVAALSACSRV-LDRKATGGVHGLAVKVGLEMDVGVGNT  216

Query  650  MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQL  811
            +VD  ++ G++    +  + M  E D   W +++A   +   S+E  EL  K L
Sbjct  217  LVDAYAKGGDLGMGRKMFDGMA-ERDVVSWNSMIALYAQDGLSAEALELYCKML  269



>ref|XP_003624481.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|ABD32557.1| Tetratricopeptide-like helical [Medicago truncatula]
 gb|AES80699.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=672

 Score =   296 bits (758),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 216/345 (63%), Gaps = 7/345 (2%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF  C+ V   L+  YA  G I  SR +FD + + D+ +W+++I+ YAQ+     A +
Sbjct  226   KKGFEGCLAVGNTLMDAYAKCGEISVSRKVFDGMEETDVCSWNSLIAVYAQNGLSVEAFS  285

Query  182   VFRRMQLEHG--KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM  355
             +F  M ++ G  + N     ++L AC+   A  +G+ IH QV+K+    N  + + ++DM
Sbjct  286   LFSDM-VKRGEVRYNAVTLSAVLLACAHSGALQIGKCIHDQVVKMELEDNLVVGTSIVDM  344

Query  356   YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVF  535
             YCK GR+   +  FD    K++  W+ M+ GYGM+GHG EA++ F +M+  GI+PN + F
Sbjct  345   YCKCGRVEMARKAFDRLKRKNVKSWTVMVAGYGMHGHGKEAMKVFYEMIRCGIKPNYITF  404

Query  536   ISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMP  715
             +SVL+ACSH GL  EGW+WF+ M+ ++D+ P + HY+CMVD+L R G ++EA   + +M 
Sbjct  405   VSVLAACSHAGLLKEGWHWFNKMKCEFDVEPGIEHYSCMVDLLGRAGYLKEAYGLIQEMK  464

Query  716   IEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVE  895
             ++PD  +WG+LL  CR  H + E+ E+ A++L  LDP+N  YYV+LSN+YAD GRWD+VE
Sbjct  465   VKPDFIVWGSLLGACR-IHKNVELGEISARKLFKLDPSNCGYYVLLSNIYADAGRWDDVE  523

Query  896   KLRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             ++R LM      K  GYS+VE    +H        ++E+ QH ++
Sbjct  524   RMRILMKNHGLLKTPGYSIVEHKGRVHVFLV---GDKEHPQHEKI  565


 Score =   115 bits (288),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/297 (26%), Positives = 142/297 (48%), Gaps = 17/297 (6%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G+   I V +AL+ MY+  G +  +R LFD + ++++++W++MIS Y Q+++   A+ +F
Sbjct  116  GYGSDIFVASALIDMYSKCGYLNDARKLFDEIPERNVVSWTSMISGYVQNERAREAVFLF  175

Query  188  RRMQL-----------EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFL  334
            +   L                +      ++ AC+ +  + V E +H   +K G+     +
Sbjct  176  KEFLLVDETDYDEIVGVGVGVDSVLLGCVISACARVCVKSVTECVHGLAVKKGFEGCLAV  235

Query  335  ASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHG-  511
             + L+D Y K G I   + +FD   + D+  W+S+I  Y  NG   EA   F DM+  G 
Sbjct  236  GNTLMDAYAKCGEISVSRKVFDGMEETDVCSWNSLIAVYAQNGLSVEAFSLFSDMVKRGE  295

Query  512  IQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEA  691
            ++ N V   +VL AC+H G    G    H    K ++   L     +VDM  + G VE A
Sbjct  296  VRYNAVTLSAVLLACAHSGALQIG-KCIHDQVVKMELEDNLVVGTSIVDMYCKCGRVEMA  354

Query  692  LEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLI--SLDPTNASYYVILS  856
             +  +++    + + W  ++AG    HG  + +  V  ++I   + P   ++  +L+
Sbjct  355  RKAFDRLK-RKNVKSWTVMVAG-YGMHGHGKEAMKVFYEMIRCGIKPNYITFVSVLA  409


 Score = 99.0 bits (245),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/229 (28%), Positives = 113/229 (49%), Gaps = 13/229 (6%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + +  + +W+++I+ +A+S     AL  F  M+     PN   F   +++CSS+     G
Sbjct  46   VDKTSVYSWNSIIADFARSGDSLQALYAFSSMRKLSLHPNRSTFPCTIKSCSSLYDLCAG  105

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            + IH Q    GY S+ F+AS LIDMY K G ++  + +FDE P+++++ W+SMI+GY  N
Sbjct  106  KQIHQQAFVFGYGSDIFVASALIDMYSKCGYLNDARKLFDEIPERNVVSWTSMISGYVQN  165

Query  461  GHGNEALECFLDML-----------SHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAME  607
                EA+  F + L             G+  + V+   V+SAC+   ++       H + 
Sbjct  166  ERAREAVFLFKEFLLVDETDYDEIVGVGVGVDSVLLGCVISACARVCVK-SVTECVHGLA  224

Query  608  EKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
             K      LA    ++D  ++ G +  + +  + M  E D   W +L+A
Sbjct  225  VKKGFEGCLAVGNTLMDAYAKCGEISVSRKVFDGME-ETDVCSWNSLIA  272



>ref|XP_010661013.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Vitis vinifera]
Length=503

 Score =   291 bits (746),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 213/328 (65%), Gaps = 1/328 (0%)
 Frame = +2

Query  29    VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
             V  AL+ MYA  G+IE++R++FD ++ +D+++W++MIS YA +   S  L  F  M+   
Sbjct  67    VDAALVDMYAKCGDIEAARLVFDKMAVRDLVSWTSMISGYAHNGYNSETLGFFDLMRSSG  126

Query  209   GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
               PN  +  S+L AC ++ A   GE  H+ V++ G+  +  +A+ ++DMY K G +   +
Sbjct  127   VIPNRVSILSVLLACGNLGALRKGEWFHSYVIQTGFEFDILVATAIMDMYSKCGSLDLAR  186

Query  389   TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
              +FDE   KDL+CWS+MI  YG++GHG +A++ F  M+  G++P+ V F  VLSACSH G
Sbjct  187   CLFDETAGKDLVCWSAMIASYGIHGHGRKAIDLFDQMVKAGVRPSHVTFTCVLSACSHSG  246

Query  569   LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
             L  EG  +F  M E++ I  KL++YACMVD+L R G + EA++ +  MP+EPD  IWG+L
Sbjct  247   LLEEGKMYFQLMTEEFVIARKLSNYACMVDLLGRAGQLSEAVDLIENMPVEPDASIWGSL  306

Query  749   LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
             L  CR  H + +++E +A  L  LDP +A Y+V+LSN+YA + RW+EVEK+R++M  +  
Sbjct  307   LGACR-IHNNLDLAEKIADHLFHLDPVHAGYHVLLSNIYAAKSRWNEVEKVRKMMARRGA  365

Query  929   KKGMGYSVVEVNNSMHRMEF**RSEQEY  1012
              K  G+S+VE +N +H+     RS  ++
Sbjct  366   NKIQGFSLVEYDNQVHKFGVGDRSHPQW  393


 Score =   115 bits (289),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 75/262 (29%), Positives = 138/262 (53%), Gaps = 6/262 (2%)
 Frame = +2

Query  134  MISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLG  313
            MI  +A   +  ++L ++ +M  +  KP++FAF   L++C+ ++    G+ IH  ++  G
Sbjct  1    MIRGFATDGRFLSSLELYSKMMEKGLKPDKFAFPFALKSCAGLSDLQRGKVIHQHLVCCG  60

Query  314  YTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFL  493
             +++ F+ + L+DMY K G I   + +FD+   +DL+ W+SMI+GY  NG+ +E L  F 
Sbjct  61   CSNDLFVDAALVDMYAKCGDIEAARLVFDKMAVRDLVSWTSMISGYAHNGYNSETLGFFD  120

Query  494  DMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQ  673
             M S G+ PN V  +SVL AC + G   +G  WFH+   +      +     ++DM S+ 
Sbjct  121  LMRSSGVIPNRVSILSVLLACGNLGALRKG-EWFHSYVIQTGFEFDILVATAIMDMYSKC  179

Query  674  GNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLI--SLDPTNASYYV  847
            G+++ A    ++     D   W A++A     HG    +  +  Q++   + P++ ++  
Sbjct  180  GSLDLARCLFDETA-GKDLVCWSAMIAS-YGIHGHGRKAIDLFDQMVKAGVRPSHVTFTC  237

Query  848  ILSNLYADQGRWDEVEKLRQLM  913
            +LS   +  G  +E +   QLM
Sbjct  238  VLSAC-SHSGLLEEGKMYFQLM  258


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 80/152 (53%), Gaps = 4/152 (3%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++GF   I V TA++ MY+  G+++ +R LFD  + KD++ WSAMI++Y        A+ 
Sbjct  159  QTGFEFDILVATAIMDMYSKCGSLDLARCLFDETAGKDLVCWSAMIASYGIHGHGRKAID  218

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLA--SGLIDM  355
            +F +M     +P+   F  +L ACS     + G+ ++ Q+M   +     L+  + ++D+
Sbjct  219  LFDQMVKAGVRPSHVTFTCVLSACSHSGLLEEGK-MYFQLMTEEFVIARKLSNYACMVDL  277

Query  356  YCKFGRIHQGKTIFDENP-DKDLICWSSMING  448
              + G++ +   + +  P + D   W S++  
Sbjct  278  LGRAGQLSEAVDLIENMPVEPDASIWGSLLGA  309



>ref|XP_010028951.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Eucalyptus grandis]
 gb|KCW55776.1| hypothetical protein EUGRSUZ_I01606 [Eucalyptus grandis]
Length=659

 Score =   295 bits (756),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 139/327 (43%), Positives = 206/327 (63%), Gaps = 4/327 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   + V  AL+  YA  G + +SR +FD +++KD  +W++MI+ YAQ+     AL 
Sbjct  213  KRGFYGVLGVGNALMDAYAKCGKVATSRKVFDEMTEKDDFSWNSMIAVYAQNGHAVEALQ  272

Query  182  VFRRMQLEHGKP--NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM  355
            +F +M ++ G    N     + L AC+   A  VG+ IH QVMK+    N  + + +IDM
Sbjct  273  LFAQM-IKDGDSDYNAVTLSAALLACACSGALRVGKCIHDQVMKMDLEDNVIVGTSIIDM  331

Query  356  YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVF  535
            YCK GR+   +  FD   DK++  W++MI GYGM+G   EALE F +M+  G++PN V F
Sbjct  332  YCKCGRVEMARRAFDRMRDKNVRTWTTMIAGYGMHGRAREALEVFYEMIRTGVRPNYVTF  391

Query  536  ISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMP  715
            +SVL+ACSH GL  E W+WF +M  +Y+I P + HY C+VD+L R G V +A E +  M 
Sbjct  392  VSVLAACSHAGLVDEAWHWFSSMLREYNIEPGIEHYGCIVDLLGRAGYVNKAYELIKGMK  451

Query  716  IEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVE  895
            ++PD  IWG+LL  CR TH + E++E+ A +L  LDP N  YYV+L N+YAD  RW+++E
Sbjct  452  VKPDFVIWGSLLGACR-THNNVELAEISASKLFELDPDNCGYYVLLCNIYADAERWEDME  510

Query  896  KLRQLMDGKKRKKGMGYSVVEVNNSMH  976
            ++R +M+ +   K  GYS+VE+   +H
Sbjct  511  RIRAIMNSRGLVKTPGYSLVELKGRVH  537


 Score =   128 bits (321),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/296 (28%), Positives = 149/296 (50%), Gaps = 14/296 (5%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G+   + V +AL+ MY+  G++  +R +FD + QK++++W++MI+ Y Q+D+   AL+
Sbjct  104  KFGYEPDLFVSSALIDMYSKCGDLGDARKVFDVIPQKNVVSWTSMIAGYVQNDEGREALS  163

Query  182  VFRRMQLEHGKP--------NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLA  337
            +F+   +E  +         +  A  S+L ACS  + +   + +H  V+K G+     + 
Sbjct  164  LFKDFLVEERERGGDAEVFVDSVAMTSVLSACSHASNEVTTKGVHGFVVKRGFYGVLGVG  223

Query  338  SGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQ  517
            + L+D Y K G++   + +FDE  +KD   W+SMI  Y  NGH  EAL+ F  M+  G  
Sbjct  224  NALMDAYAKCGKVATSRKVFDEMTEKDDFSWNSMIAVYAQNGHAVEALQLFAQMIKDGDS  283

Query  518  P-NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEAL  694
              N V   + L AC+  G    G    H    K D+   +     ++DM  + G VE A 
Sbjct  284  DYNAVTLSAALLACACSGALRVG-KCIHDQVMKMDLEDNVIVGTSIIDMYCKCGRVEMAR  342

Query  695  EFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLI--SLDPTNASYYVILS  856
               ++M  + + R W  ++AG    HG +  +  V  ++I   + P   ++  +L+
Sbjct  343  RAFDRMR-DKNVRTWTTMIAG-YGMHGRAREALEVFYEMIRTGVRPNYVTFVSVLA  396


 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/271 (28%), Positives = 125/271 (46%), Gaps = 14/271 (5%)
 Frame = +2

Query  26   PVVTALLQMYANFGNIESSRILFDS-LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            P        Y+   N+ S   LFD  + + ++ +W+++I+  A+      AL  F  M+ 
Sbjct  13   PSFIFFRSRYSTDANVAS---LFDKYVDRTNVHSWNSVIAELARGGDSVEALRAFASMRR  69

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
               KPN   F   +++CS++     G+  H Q +K GY  + F++S LIDMY K G +  
Sbjct  70   ASLKPNRSTFPCAIKSCSALLDLFSGKQAHQQALKFGYEPDLFVSSALIDMYSKCGDLGD  129

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSH--------GIQPNDVVFI  538
             + +FD  P K+++ W+SMI GY  N  G EAL  F D L           +  + V   
Sbjct  130  ARKVFDVIPQKNVVSWTSMIAGYVQNDEGREALSLFKDFLVEERERGGDAEVFVDSVAMT  189

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            SVLSACSH   E       H    K      L     ++D  ++ G V  + +  ++M  
Sbjct  190  SVLSACSHASNEVTT-KGVHGFVVKRGFYGVLGVGNALMDAYAKCGKVATSRKVFDEMT-  247

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQL  811
            E D   W +++A   +   + E  +L A+ +
Sbjct  248  EKDDFSWNSMIAVYAQNGHAVEALQLFAQMI  278



>ref|XP_008806115.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like 
[Phoenix dactylifera]
Length=649

 Score =   295 bits (755),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/328 (41%), Positives = 210/328 (64%), Gaps = 1/328 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G    + V  AL+ MYA  G +E +R +FD +S++D+++W+ MIS YA+   P  +L 
Sbjct  204  KAGLHSDLFVSAALVDMYARCGLVEDARKVFDKMSKRDMVSWTVMISGYAECGNPDESLV  263

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F +M  E   P++    ++  AC+ + A    + +H  + +  ++ +  L + +IDMY 
Sbjct  264  LFDKMMEEGIVPDKVTMVTVAFACAKLGAMYKAKMVHDYISRRNFSFDVILGTAMIDMYA  323

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            + G +   + IFD   +K++I WSSMI+ YG++GHG  ALE F  ML  GI+PN + F+S
Sbjct  324  RCGSMDAAREIFDRMKEKNVITWSSMISAYGIHGHGRAALELFPQMLESGIRPNRITFVS  383

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +LSACSH GL  EG  +FH+M+  Y I P L HY CMVD+L R G ++EALE  N+M +E
Sbjct  384  ILSACSHAGLVNEGRQFFHSMKRDYSIEPDLKHYTCMVDLLGRAGKLDEALELSNRMNLE  443

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
             D+  WGALL  CR  HG+  ++E  AK L+ L P N+ YY++LSN+YA+ GRW++V K+
Sbjct  444  KDEGFWGALLGACR-IHGNVGLAEKAAKSLLELGPRNSGYYILLSNIYANAGRWEDVAKV  502

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMHRME  985
            R LM  ++ KK  G++ +E++N+ ++  
Sbjct  503  RDLMSSRRLKKTPGWTWIEIDNTAYQFR  530


 Score =   128 bits (321),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/286 (26%), Positives = 144/286 (50%), Gaps = 5/286 (2%)
 Frame = +2

Query  5    SGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAV  184
            +  ++ + V   L+ +YA +  +  +  LF  + ++D ++WS M+  +A+ +   N+L +
Sbjct  104  TSMIENLGVANKLVYIYAQYRALADAHALFCRMKERDNVSWSVMVGGFAKIEDYENSLRI  163

Query  185  FRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK  364
            FR       + + +     L+ C    +  +G  IH  V K G  S+ F+++ L+DMY +
Sbjct  164  FREYIRSGSRVDNYTLPFALRVCRDTMSVQLGTEIHHLVYKAGLHSDLFVSAALVDMYAR  223

Query  365  FGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISV  544
             G +   + +FD+   +D++ W+ MI+GY   G+ +E+L  F  M+  GI P+ V  ++V
Sbjct  224  CGLVEDARKVFDKMSKRDMVSWTVMISGYAECGNPDESLVLFDKMMEEGIVPDKVTMVTV  283

Query  545  LSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEP  724
              AC+  G  Y+     H    + + +  +     M+DM +R G+++ A E  ++M  E 
Sbjct  284  AFACAKLGAMYKA-KMVHDYISRRNFSFDVILGTAMIDMYARCGSMDAAREIFDRMK-EK  341

Query  725  DKRIWGALLAGCRKTHGSSEIS-ELVAKQLIS-LDPTNASYYVILS  856
            +   W ++++     HG    + EL  + L S + P   ++  ILS
Sbjct  342  NVITWSSMISA-YGIHGHGRAALELFPQMLESGIRPNRITFVSILS  386



>ref|XP_010260583.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Nelumbo nucifera]
Length=721

 Score =   296 bits (759),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/344 (41%), Positives = 215/344 (63%), Gaps = 5/344 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF + + V   LL  YA  G++  SR +FD +  KD+I+W++MI+ YAQ+   + AL 
Sbjct  275   KRGFQEDLGVGNTLLDAYAKCGDLGISRKVFDGMKNKDVISWNSMIAVYAQNGLSTEALE  334

Query  182   VFRRM-QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             +F  M +      N     S+L  C+   A  +G+ IH QV+K+G   + F+ + +IDMY
Sbjct  335   IFYEMLKSRDVSYNAVTLSSVLLGCAHSGALQLGKCIHDQVIKMGLEDDVFVGTSVIDMY  394

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK GR+   +  F+   +K++  W++M+ GYGM+G   EALE F +M + G++PN + F+
Sbjct  395   CKCGRVEMARRAFERMKEKNVKSWTAMVAGYGMHGRAKEALEVFYEMQNAGVKPNYITFV  454

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             SVL+ACSH GL  EGW+WF AM ++++I P + HYACMVD+L R G +++A   +  M +
Sbjct  455   SVLAACSHGGLVEEGWHWFKAMTQEFEIEPGVEHYACMVDLLGRAGYLDQAYNLIKGMKM  514

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
              PD  +WGALL  CR  H + E+ E+ A++L  LDP+N  YYV+LSN+YAD GRW++VE+
Sbjct  515   RPDFVVWGALLGACR-IHKNVELGEVSARKLFELDPSNCGYYVLLSNIYADAGRWEDVER  573

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             +R  M  +   K  G+S+VEV   +H        ++E+ QH  +
Sbjct  574   MRVFMKDRGLIKPPGFSLVEVKGRVHVFLV---GDREHPQHDEI  614


 Score =   123 bits (308),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/259 (31%), Positives = 131/259 (51%), Gaps = 11/259 (4%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF   + V +AL+ MY+  G + S+R LFD +  +++++W++MI+   Q+     AL +F
Sbjct  168  GFEFDLFVSSALIDMYSKCGELVSARKLFDEIPHRNVVSWTSMITGCVQNGNAHEALFLF  227

Query  188  RRMQLEHG--------KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASG  343
            +   +E            +  A  S+L ACS ++ + V + +H  ++K G+  +  + + 
Sbjct  228  KEFLMEESDGRGEREVSVDAVALVSVLSACSQVSEKGVTKGVHGFLIKRGFQEDLGVGNT  287

Query  344  LIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDML-SHGIQP  520
            L+D Y K G +   + +FD   +KD+I W+SMI  Y  NG   EALE F +ML S  +  
Sbjct  288  LLDAYAKCGDLGISRKVFDGMKNKDVISWNSMIAVYAQNGLSTEALEIFYEMLKSRDVSY  347

Query  521  NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEF  700
            N V   SVL  C+H G    G    H    K  +   +     ++DM  + G VE A   
Sbjct  348  NAVTLSSVLLGCAHSGALQLG-KCIHDQVIKMGLEDDVFVGTSVIDMYCKCGRVEMARRA  406

Query  701  VNKMPIEPDKRIWGALLAG  757
              +M  E + + W A++AG
Sbjct  407  FERMK-EKNVKSWTAMVAG  424


 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/249 (27%), Positives = 120/249 (48%), Gaps = 10/249 (4%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + +  + +W+++I+  A+S     AL  F  M+     P+   F   +++CS++     G
Sbjct  98   VDRTSVSSWNSVIAELARSGDSVEALRAFLSMRKISLNPDRSTFPCAIKSCSALLDLASG  157

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            + +H Q +  G+  + F++S LIDMY K G +   + +FDE P ++++ W+SMI G   N
Sbjct  158  KQVHQQALVFGFEFDLFVSSALIDMYSKCGELVSARKLFDEIPHRNVVSWTSMITGCVQN  217

Query  461  GHGNEALECFLDML---SHG-----IQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKY  616
            G+ +EAL  F + L   S G     +  + V  +SVLSACS    E       H    K 
Sbjct  218  GNAHEALFLFKEFLMEESDGRGEREVSVDAVALVSVLSACSQVS-EKGVTKGVHGFLIKR  276

Query  617  DITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISEL  796
                 L     ++D  ++ G++  + +  + M    D   W +++A   +   S+E  E+
Sbjct  277  GFQEDLGVGNTLLDAYAKCGDLGISRKVFDGMK-NKDVISWNSMIAVYAQNGLSTEALEI  335

Query  797  VAKQLISLD  823
              + L S D
Sbjct  336  FYEMLKSRD  344



>gb|KHN28625.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=834

 Score =   298 bits (764),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/320 (44%), Positives = 211/320 (66%), Gaps = 2/320 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+    C+PV  AL+ MYA  G++E + ++F  +  KDI++W+ MI  Y+++  P+ AL 
Sbjct  375  KNNMALCLPVSNALMDMYAKCGSMEEAYLVFSQIPVKDIVSWNTMIGGYSKNSLPNEALK  434

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  MQ E  +P+      LL AC S+AA ++G  IH  +++ GY+S   +A+ LIDMY 
Sbjct  435  LFAEMQKE-SRPDGITMACLLPACGSLAALEIGRGIHGCILRNGYSSELHVANALIDMYV  493

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +   + +FD  P+KDLI W+ MI+G GM+G GNEA+  F  M   GI+P+++ F S
Sbjct  494  KCGSLVHARLLFDMIPEKDLITWTVMISGCGMHGLGNEAIATFQKMRIAGIKPDEITFTS  553

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L ACSH GL  EGW +F++M  + ++ PKL HYACMVD+L+R GN+ +A   +  MPI+
Sbjct  554  ILYACSHSGLLNEGWGFFNSMISECNMEPKLEHYACMVDLLARTGNLSKAYNLIETMPIK  613

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD  IWGALL GCR  H   E++E VA+ +  L+P NA YYV+L+N+YA+  +W+EV+KL
Sbjct  614  PDATIWGALLCGCR-IHHDVELAEKVAEHVFELEPDNAGYYVLLANIYAEAEKWEEVKKL  672

Query  902  RQLMDGKKRKKGMGYSVVEV  961
            R+ +  +  KK  G S +EV
Sbjct  673  RERIGKRGLKKSPGCSWIEV  692


 Score =   115 bits (289),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/285 (25%), Positives = 138/285 (48%), Gaps = 4/285 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+ F + +     LL MY+  GN+  +   F+ + QK +++W+++I+AY +     +A+ 
Sbjct  274  KACFSREVMFNNTLLDMYSKCGNLNDAIQAFEKMGQKTVVSWTSLIAAYVREGLYDDAIR  333

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M+ +   P+ ++  S+L AC+   + D G  +H  + K        +++ L+DMY 
Sbjct  334  LFYEMESKGVSPDVYSMTSVLHACACGNSLDKGRDVHNYIRKNNMALCLPVSNALMDMYA  393

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G + +   +F + P KD++ W++MI GY  N   NEAL+ F +M     +P+ +    
Sbjct  394  KCGSMEEAYLVFSQIPVKDIVSWNTMIGGYSKNSLPNEALKLFAEMQKES-RPDGITMAC  452

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L AC       E     H    +   + +L     ++DM  + G++  A    + +P E
Sbjct  453  LLPACGSLA-ALEIGRGIHGCILRNGYSSELHVANALIDMYVKCGSLVHARLLFDMIP-E  510

Query  722  PDKRIWGALLAGC-RKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             D   W  +++GC     G+  I+     ++  + P   ++  IL
Sbjct  511  KDLITWTVMISGCGMHGLGNEAIATFQKMRIAGIKPDEITFTSIL  555


 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 123/251 (49%), Gaps = 4/251 (2%)
 Frame = +2

Query  53   YANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAF  232
            Y   G ++ +  LFD L  +D+++W++MI+    +     AL  F +M L  G       
Sbjct  192  YFKSGEVDRAHKLFDELGDRDVVSWNSMINGCVMNGFSHTALDFFVQM-LIFGVDLATLV  250

Query  233  HSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPD  412
            +SL  AC+++ +   G  +H   +K  ++      + L+DMY K G ++     F++   
Sbjct  251  NSL-AACANVGSLSFGRALHGHGLKACFSREVMFNNTLLDMYSKCGNLNDAIQAFEKMGQ  309

Query  413  KDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNW  592
            K ++ W+S+I  Y   G  ++A+  F +M S G+ P+     SVL AC+ CG   +    
Sbjct  310  KTVVSWTSLIAAYVREGLYDDAIRLFYEMESKGVSPDVYSMTSVLHACA-CGNSLDKGRD  368

Query  593  FHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTH  772
             H    K ++   L     ++DM ++ G++EEA    +++P++ D   W  ++ G  K  
Sbjct  369  VHNYIRKNNMALCLPVSNALMDMYAKCGSMEEAYLVFSQIPVK-DIVSWNTMIGGYSKNS  427

Query  773  GSSEISELVAK  805
              +E  +L A+
Sbjct  428  LPNEALKLFAE  438


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 69/303 (23%), Positives = 119/303 (39%), Gaps = 75/303 (25%)
 Frame = +2

Query  56   ANFGNIESSRILFDSLSQK-------DIIAWSAMISAYAQSDQPS------------NAL  178
            AN+    +  I F   S+K       D+   S  + A+A+ D+ +            NA+
Sbjct  25   ANYAKPRNCFIFFQQPSRKYFLSSYLDVPRSSTRVGAFAKLDENTKICKFCEVGDLRNAV  84

Query  179  AVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             + R  Q      N  A+ S+LQ C+       G+ +H+ +   G      L + L+ MY
Sbjct  85   ELLRMSQKSELDLN--AYSSILQLCAEHKCLQEGKMVHSVISSNGIPIEGVLGAKLVFMY  142

Query  359  CKFGRIHQGKTIFD----------------------------------------------  400
               G + +G+ IFD                                              
Sbjct  143  VSCGALREGRRIFDHILSDNKASVKESMGVFINWALVLIMLLLPLKIAAYFKSGEVDRAH  202

Query  401  ----ENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
                E  D+D++ W+SMING  MNG  + AL+ F+ ML  G+  +    ++ L+AC++ G
Sbjct  203  KLFDELGDRDVVSWNSMINGCVMNGFSHTALDFFVQMLIFGV--DLATLVNSLAACANVG  260

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
                G    H    K   + ++     ++DM S+ GN+ +A++   KM  +     W +L
Sbjct  261  SLSFG-RALHGHGLKACFSREVMFNNTLLDMYSKCGNLNDAIQAFEKMG-QKTVVSWTSL  318

Query  749  LAG  757
            +A 
Sbjct  319  IAA  321



>ref|XP_008231188.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Prunus mume]
Length=653

 Score =   294 bits (752),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/345 (41%), Positives = 215/345 (62%), Gaps = 7/345 (2%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF + + V   L+  YA  G+   SR +FD +SQKD+++W++MI+ YAQS   S AL 
Sbjct  207   KKGFDEDLCVGNTLMDAYAKCGDPSLSRKVFDGMSQKDLVSWNSMIATYAQSGLSSEALQ  266

Query  182   VFRRMQLEHGK--PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM  355
             VF  M +E G    N     +LL AC+      VG++IH QV+K+G   N  +++ +IDM
Sbjct  267   VFNGM-VEDGDFHYNAVTLSALLIACAHSGPLLVGKSIHDQVLKMGLEENVIVSTSIIDM  325

Query  356   YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVF  535
             YCK G++   +  F+   +K++  W++M+ GYGM+G   EALE F +M+  GI+PN + F
Sbjct  326   YCKCGKVDMARKAFEFTKEKNVKTWTAMVAGYGMHGRAKEALELFYNMIRDGIKPNYITF  385

Query  536   ISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMP  715
             +S+L+ACSH GL  EGW WF+ M  K+ + P + HY CMVD+L R G++ +A + +  M 
Sbjct  386   VSLLNACSHAGLLKEGWYWFNTMNHKFGVEPGIEHYGCMVDLLGRSGDLNKAYDLIKGMR  445

Query  716   IEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVE  895
             + PD  +WG+ L  CR  H +   +E+ A++L  LDP N  YY++LSN+YAD GRW++VE
Sbjct  446   VRPDCVVWGSFLGACR-IHKNVMFAEISARKLFELDPNNCGYYILLSNIYADAGRWEDVE  504

Query  896   KLRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             ++R LM  +   K  G+S+VE+   +H        ++E+ QH R+
Sbjct  505   RMRVLMKNRGLVKPPGFSLVELKGEVHLFLV---GDREHPQHKRI  546


 Score =   115 bits (288),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 132/259 (51%), Gaps = 14/259 (5%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF   + V +AL+ MY+  G +  +  LFD +  +++++W++MI+   Q+D    AL++F
Sbjct  103  GFESDLFVSSALIDMYSRCGLLPDAWTLFDLIPHRNVVSWTSMITGCVQNDHAHQALSLF  162

Query  188  RRMQLEHGKPNEFAFH-----SLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
            + + +E     + +       S+L ACS +  +++ + +H  V+K G+  +  + + L+D
Sbjct  163  KDLLIEEIDNEDVSLDPVVVVSVLSACSRVPRKELTQCVHGLVVKKGFDEDLCVGNTLMD  222

Query  353  MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHG-IQPNDV  529
             Y K G     + +FD    KDL+ W+SMI  Y  +G  +EAL+ F  M+  G    N V
Sbjct  223  AYAKCGDPSLSRKVFDGMSQKDLVSWNSMIATYAQSGLSSEALQVFNGMVEDGDFHYNAV  282

Query  530  VFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVE---EALEF  700
               ++L AC+H G    G +  H    K  +   +     ++DM  + G V+   +A EF
Sbjct  283  TLSALLIACAHSGPLLVGKS-IHDQVLKMGLEENVIVSTSIIDMYCKCGKVDMARKAFEF  341

Query  701  VNKMPIEPDKRIWGALLAG  757
                  E + + W A++AG
Sbjct  342  TK----EKNVKTWTAMVAG  356


 Score =   102 bits (253),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 117/233 (50%), Gaps = 7/233 (3%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + + D+ +W+++I+  A+S     AL  F  M+    +P   +F   +++CS++     G
Sbjct  33   VDKNDVSSWNSVIADLARSGDSVEALRAFSSMRKLSLRPTRSSFPCAIKSCSALLDLHSG  92

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q +  G+ S+ F++S LIDMY + G +    T+FD  P ++++ W+SMI G   N
Sbjct  93   KQAHQQALVFGFESDLFVSSALIDMYSRCGLLPDAWTLFDLIPHRNVVSWTSMITGCVQN  152

Query  461  GHGNEALECFLDMLSHGIQPND-----VVFISVLSACSHCGLEYEGWNWFHAMEEKYDIT  625
             H ++AL  F D+L   I   D     VV +SVLSACS    + E     H +  K    
Sbjct  153  DHAHQALSLFKDLLIEEIDNEDVSLDPVVVVSVLSACSRVPRK-ELTQCVHGLVVKKGFD  211

Query  626  PKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSE  784
              L     ++D  ++ G+   + +  + M  + D   W +++A   ++  SSE
Sbjct  212  EDLCVGNTLMDAYAKCGDPSLSRKVFDGMS-QKDLVSWNSMIATYAQSGLSSE  263



>ref|XP_010538669.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Tarenaya hassleriana]
Length=599

 Score =   292 bits (748),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/325 (40%), Positives = 215/325 (66%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            +SGF   I    +LL +YAN G++ S+  +FD +S++D++AW+++I+ +A + +P+ A+ 
Sbjct  154  RSGFDSLIFAQNSLLHLYANCGDVASAYKMFDKMSERDLVAWNSLINGFALNGKPTEAME  213

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++R MQ+E  +P+ F   SLL AC+ + A  +G  +H  ++K+G+  N+   + L+D Y 
Sbjct  214  IYRGMQMEGIEPDGFTIVSLLSACAELGALALGRRVHVYMIKVGWRGNSHANNALLDFYA  273

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K GR+ + +T+F E  +K+ I W+S+I G  +NG G E+LE F DM   G+ PN+V F+ 
Sbjct  274  KCGRVREAQTLFHEMGNKNSISWNSLIVGLAVNGFGKESLELFKDMEKKGLPPNEVTFVG  333

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L ACSHCG+  EG+ +F  M E+++I P++ HY CMVD+LSR G ++EA +++  MP++
Sbjct  334  ILYACSHCGMVTEGFEYFRRMVEEFNIVPRIEHYGCMVDLLSRAGKIKEAYDYIQNMPMQ  393

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            P+  IW  LL  C   HG+S ++E    QL+ L+P  +  YV+LSNLYA + RW +V+++
Sbjct  394  PNSVIWRTLLGAC-SVHGNSALAEYATDQLLQLEPNYSGDYVLLSNLYASEERWLDVQRV  452

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R+ M     +K  G+S+VEV N +H
Sbjct  453  RRKMVNDGVRKFPGHSLVEVGNQVH  477


 Score =   117 bits (293),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 117/226 (52%), Gaps = 3/226 (1%)
 Frame = +2

Query  83   RILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH-GKPNEFAFHSLLQACSS  259
            RI     +  ++  W+ +I  YA++  PS A+A+FR M++    +P+   +  LL+A + 
Sbjct  79   RIFSKIQNPNNVFTWNTLIRGYAENGDPSPAVALFREMRVSGLAEPDTHTYPFLLKAVAK  138

Query  260  MAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSM  439
            MA   +GETIH+ V++ G+ S  F  + L+ +Y   G +     +FD+  ++DL+ W+S+
Sbjct  139  MADVRLGETIHSIVIRSGFDSLIFAQNSLLHLYANCGDVASAYKMFDKMSERDLVAWNSL  198

Query  440  INGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYD  619
            ING+ +NG   EA+E +  M   GI+P+    +S+LSAC+  G    G    H    K  
Sbjct  199  INGFALNGKPTEAMEIYRGMQMEGIEPDGFTIVSLLSACAELGALALG-RRVHVYMIKVG  257

Query  620  ITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
                      ++D  ++ G V EA    ++M    +   W +L+ G
Sbjct  258  WRGNSHANNALLDFYAKCGRVREAQTLFHEMG-NKNSISWNSLIVG  302



>ref|XP_006597484.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like [Glycine max]
Length=873

 Score =   298 bits (764),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 142/320 (44%), Positives = 211/320 (66%), Gaps = 2/320 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+    C+PV  AL+ MYA  G++E + ++F  +  KDI++W+ MI  Y+++  P+ AL 
Sbjct  429  KNNMALCLPVSNALMDMYAKCGSMEEAYLVFSQIPVKDIVSWNTMIGGYSKNSLPNEALK  488

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  MQ E  +P+      LL AC S+AA ++G  IH  +++ GY+S   +A+ LIDMY 
Sbjct  489  LFAEMQKE-SRPDGITMACLLPACGSLAALEIGRGIHGCILRNGYSSELHVANALIDMYV  547

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +   + +FD  P+KDLI W+ MI+G GM+G GNEA+  F  M   GI+P+++ F S
Sbjct  548  KCGSLVHARLLFDMIPEKDLITWTVMISGCGMHGLGNEAIATFQKMRIAGIKPDEITFTS  607

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L ACSH GL  EGW +F++M  + ++ PKL HYACMVD+L+R GN+ +A   +  MPI+
Sbjct  608  ILYACSHSGLLNEGWGFFNSMISECNMEPKLEHYACMVDLLARTGNLSKAYNLIETMPIK  667

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD  IWGALL GCR  H   E++E VA+ +  L+P NA YYV+L+N+YA+  +W+EV+KL
Sbjct  668  PDATIWGALLCGCR-IHHDVELAEKVAEHVFELEPDNAGYYVLLANIYAEAEKWEEVKKL  726

Query  902  RQLMDGKKRKKGMGYSVVEV  961
            R+ +  +  KK  G S +EV
Sbjct  727  RERIGKRGLKKSPGCSWIEV  746


 Score =   115 bits (288),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/285 (25%), Positives = 138/285 (48%), Gaps = 4/285 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+ F + +     LL MY+  GN+  +   F+ + QK +++W+++I+AY +     +A+ 
Sbjct  328  KACFSREVMFNNTLLDMYSKCGNLNDAIQAFEKMGQKTVVSWTSLIAAYVREGLYDDAIR  387

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M+ +   P+ ++  S+L AC+   + D G  +H  + K        +++ L+DMY 
Sbjct  388  LFYEMESKGVSPDVYSMTSVLHACACGNSLDKGRDVHNYIRKNNMALCLPVSNALMDMYA  447

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G + +   +F + P KD++ W++MI GY  N   NEAL+ F +M     +P+ +    
Sbjct  448  KCGSMEEAYLVFSQIPVKDIVSWNTMIGGYSKNSLPNEALKLFAEMQKES-RPDGITMAC  506

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L AC       E     H    +   + +L     ++DM  + G++  A    + +P E
Sbjct  507  LLPACGSLA-ALEIGRGIHGCILRNGYSSELHVANALIDMYVKCGSLVHARLLFDMIP-E  564

Query  722  PDKRIWGALLAGC-RKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             D   W  +++GC     G+  I+     ++  + P   ++  IL
Sbjct  565  KDLITWTVMISGCGMHGLGNEAIATFQKMRIAGIKPDEITFTSIL  609


 Score =   111 bits (278),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 134/268 (50%), Gaps = 2/268 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     VV +L+  Y   G ++S+  LFD L  +D+++W++MIS    +    +AL 
Sbjct  227  KLGFGSYNTVVNSLIATYFKSGEVDSAHKLFDELGDRDVVSWNSMISGCVMNGFSHSALE  286

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             F +M +     +     + + AC+++ +  +G  +H Q +K  ++      + L+DMY 
Sbjct  287  FFVQMLILRVGVDLATLVNSVAACANVGSLSLGRALHGQGVKACFSREVMFNNTLLDMYS  346

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G ++     F++   K ++ W+S+I  Y   G  ++A+  F +M S G+ P+     S
Sbjct  347  KCGNLNDAIQAFEKMGQKTVVSWTSLIAAYVREGLYDDAIRLFYEMESKGVSPDVYSMTS  406

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL AC+ CG   +     H    K ++   L     ++DM ++ G++EEA    +++P++
Sbjct  407  VLHACA-CGNSLDKGRDVHNYIRKNNMALCLPVSNALMDMYAKCGSMEEAYLVFSQIPVK  465

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAK  805
             D   W  ++ G  K    +E  +L A+
Sbjct  466  -DIVSWNTMIGGYSKNSLPNEALKLFAE  492


 Score =   104 bits (259),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 121/240 (50%), Gaps = 3/240 (1%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDS-LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
            L+ MY + G +   R +FD  LS   +  W+ M+S YA+      ++ +F++MQ      
Sbjct  138  LVFMYVSCGALREGRRIFDHILSDNKVFLWNLMMSEYAKIGDYRESIYLFKKMQKLGITG  197

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            N + F  +L+  +++      + IH  V KLG+ S   + + LI  Y K G +     +F
Sbjct  198  NSYTFSCILKCFATLGRVGECKRIHGCVYKLGFGSYNTVVNSLIATYFKSGEVDSAHKLF  257

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEY  577
            DE  D+D++ W+SMI+G  MNG  + ALE F+ ML   +  +    ++ ++AC++ G   
Sbjct  258  DELGDRDVVSWNSMISGCVMNGFSHSALEFFVQMLILRVGVDLATLVNSVAACANVGSLS  317

Query  578  EGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
             G    H    K   + ++     ++DM S+ GN+ +A++   KM  +     W +L+A 
Sbjct  318  LG-RALHGQGVKACFSREVMFNNTLLDMYSKCGNLNDAIQAFEKMG-QKTVVSWTSLIAA  375


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 61/273 (22%), Positives = 106/273 (39%), Gaps = 24/273 (9%)
 Frame = +2

Query  56   ANFGNIESSRILFDSLSQK-------DIIAWSAMISAYAQSDQPS------------NAL  178
            AN+    +  I F   S+K       D+   S  + A+A+ D+ +            NA+
Sbjct  25   ANYAKPRNCFIFFQQPSRKYFLSSYLDVPRSSTRVGAFAKLDENTKICKFCEVGDLRNAV  84

Query  179  AVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             + R  Q      N  A+ S+LQ C+       G+ +H+ +   G      L + L+ MY
Sbjct  85   ELLRMSQKSELDLN--AYSSILQLCAEHKCLQEGKMVHSVISSNGIPIEGVLGAKLVFMY  142

Query  359  CKFGRIHQGKTIFDEN-PDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVF  535
               G + +G+ IFD    D  +  W+ M++ Y   G   E++  F  M   GI  N   F
Sbjct  143  VSCGALREGRRIFDHILSDNKVFLWNLMMSEYAKIGDYRESIYLFKKMQKLGITGNSYTF  202

Query  536  ISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMP  715
              +L   +  G   E     H    K            ++    + G V+ A +  +++ 
Sbjct  203  SCILKCFATLGRVGE-CKRIHGCVYKLGFGSYNTVVNSLIATYFKSGEVDSAHKLFDELG  261

Query  716  IEPDKRIWGALLAGCRKTHGSSEISELVAKQLI  814
             + D   W ++++GC     S    E   + LI
Sbjct  262  -DRDVVSWNSMISGCVMNGFSHSALEFFVQMLI  293



>ref|XP_007161642.1| hypothetical protein PHAVU_001G086300g [Phaseolus vulgaris]
 gb|ESW33636.1| hypothetical protein PHAVU_001G086300g [Phaseolus vulgaris]
Length=669

 Score =   293 bits (751),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 137/345 (40%), Positives = 217/345 (63%), Gaps = 7/345 (2%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF  C+ V   L+  YAN G +  +R +FD + + D+  W+++IS YAQ+   + A  
Sbjct  223   KRGFEGCVGVGNTLMDAYANCGEMGVARKVFDGMHESDVCTWNSIISKYAQNGLSAEAFC  282

Query  182   VFRRMQLEHGKP--NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM  355
             VF  M ++ GK   NE    ++L AC++  A  +G+ IH QV+K+    +  + + ++DM
Sbjct  283   VFADM-VKSGKVRYNEVTLSAVLLACANSGALQLGKCIHDQVIKMDLEDSVVVGTSIVDM  341

Query  356   YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVF  535
             YCK GR+   +  FD    K++  W++M+ GYGM+G   EA+E F +M+  G +PN + F
Sbjct  342   YCKCGRVEMARKAFDRMKVKNVKSWTAMVAGYGMHGRAKEAMEVFYEMIRSGDKPNYITF  401

Query  536   ISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMP  715
             +SVL+ACSH GL  EGW+WF+ M+ ++++ P + HY+CMVD+L R G + EA   + +M 
Sbjct  402   VSVLAACSHAGLLKEGWHWFNRMKGEFNVVPGIEHYSCMVDLLGRAGYLNEAYGLIQEMN  461

Query  716   IEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVE  895
             ++PD  IWG+LL  CR  H + E+ E+ A++L  LDP++  YYV+LSN+YAD GRWDEVE
Sbjct  462   VKPDFIIWGSLLGACR-IHKNVELGEISARKLFQLDPSSCGYYVLLSNIYADAGRWDEVE  520

Query  896   KLRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             ++R LM  +   K  G+S+VE+   +H        ++E+ QH ++
Sbjct  521   RMRILMKNRGLLKTPGFSIVELKGRIHVFLV---GDKEHPQHKKI  562


 Score =   126 bits (317),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 86/297 (29%), Positives = 150/297 (51%), Gaps = 14/297 (5%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF + I V  AL+ MY+  G  + +R+LFD +  ++ ++W++MI+ Y Q+D+P +A+ +F
Sbjct  115  GFGRDIFVSAALVNMYSKCGCPDHARLLFDEIPARNAVSWTSMIAGYVQNDRPHDAVCLF  174

Query  188  RRMQLEHG---KPNEFAF------HSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLAS  340
            + + +E     +  + AF        +L ACS +  +   E +H  V+K G+     + +
Sbjct  175  KELLVEQSGYVESEDDAFVDSMLVGCVLSACSRVGRRSTTEGVHGLVVKRGFEGCVGVGN  234

Query  341  GLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHG-IQ  517
             L+D Y   G +   + +FD   + D+  W+S+I+ Y  NG   EA   F DM+  G ++
Sbjct  235  TLMDAYANCGEMGVARKVFDGMHESDVCTWNSIISKYAQNGLSAEAFCVFADMVKSGKVR  294

Query  518  PNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALE  697
             N+V   +VL AC++ G    G    H    K D+   +     +VDM  + G VE A +
Sbjct  295  YNEVTLSAVLLACANSGALQLG-KCIHDQVIKMDLEDSVVVGTSIVDMYCKCGRVEMARK  353

Query  698  FVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYA  868
              ++M ++  K  W A++AG      + E  E+  + + S D  N  Y   +S L A
Sbjct  354  AFDRMKVKNVKS-WTAMVAGYGMHGRAKEAMEVFYEMIRSGDKPN--YITFVSVLAA  407


 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 84/165 (51%), Gaps = 9/165 (5%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + +  + +W+ +I+  A+S     AL+ F  M+     PN   F   ++AC++++    G
Sbjct  45   VDKTSVSSWNTVIADLARSGDSVEALSAFSSMRKLSLHPNRSTFPCAIKACAALSDLRAG  104

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
               H Q    G+  + F+++ L++MY K G     + +FDE P ++ + W+SMI GY  N
Sbjct  105  AQTHQQAFVFGFGRDIFVSAALVNMYSKCGCPDHARLLFDEIPARNAVSWTSMIAGYVQN  164

Query  461  GHGNEALECFLDML---SHGIQPNDVVFIS------VLSACSHCG  568
               ++A+  F ++L   S  ++  D  F+       VLSACS  G
Sbjct  165  DRPHDAVCLFKELLVEQSGYVESEDDAFVDSMLVGCVLSACSRVG  209



>ref|XP_009599644.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Nicotiana tomentosiformis]
Length=653

 Score =   293 bits (749),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/344 (41%), Positives = 212/344 (62%), Gaps = 5/344 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF +   V   L+  YA  G ++ SR +FD +  KDII+W++MI+ YAQ    S AL 
Sbjct  207   KRGFDEDPGVGNTLIDAYAKCGEVDLSRKMFDVMPDKDIISWNSMIAVYAQHGLSSQALE  266

Query  182   VFRRMQLEHGKP-NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             +FR +  +     N     ++L AC+   A   G+ IH QV+K+    N ++A+ +IDMY
Sbjct  267   IFRSLAWDREVDYNAVTLSAVLLACAHSGALQAGKCIHDQVIKMNLEDNVYVATSMIDMY  326

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK GR+   +  F+   +K++  WS++I GYGM+G   EAL+ F +M   G++PN + F+
Sbjct  327   CKCGRLRTARNAFNRMKEKNVKSWSALIAGYGMHGRAMEALQVFYEMNLAGVKPNYITFV  386

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             SVL+ACSH GL  EGW WF AME +Y I P + HYACMVD+L R G + +A   + +M +
Sbjct  387   SVLAACSHAGLLDEGWYWFKAMEPRYCIQPGVEHYACMVDLLGRAGFLAKAYNLIEEMKV  446

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
              PD  +WG+LLA CR  H + E+ E+ A+ L  LD TN  YYV+LSN+YAD GRW++V+K
Sbjct  447   TPDFVVWGSLLAACR-MHKNVELGEIAARNLFELDSTNCGYYVLLSNIYADAGRWEDVDK  505

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             +R LM  +   K  G+S++E+   +H        ++E+ QH ++
Sbjct  506   MRILMKNRGLSKPPGFSLLELKGRVHVFLV---GDREHPQHEKI  546


 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 138/257 (54%), Gaps = 11/257 (4%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G+   + V +AL+ MY+  G +  +R LFD + QK++++W++MI+ Y Q+DQP  AL++F
Sbjct  104  GYETDLFVSSALIDMYSKCGQLADARKLFDQIPQKNVVSWTSMITGYVQNDQPHEALSLF  163

Query  188  RRMQLEHGKPNEF------AFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLI  349
            +  +L  G+  E       +  S+L ACS ++ + + + +H  V K G+  +  + + LI
Sbjct  164  K--ELLAGQAEELVSLDSVSMVSVLSACSRVSGKTLTQGLHGFVTKRGFDEDPGVGNTLI  221

Query  350  DMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDML-SHGIQPND  526
            D Y K G +   + +FD  PDKD+I W+SMI  Y  +G  ++ALE F  +     +  N 
Sbjct  222  DAYAKCGEVDLSRKMFDVMPDKDIISWNSMIAVYAQHGLSSQALEIFRSLAWDREVDYNA  281

Query  527  VVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVN  706
            V   +VL AC+H G    G    H    K ++   +     M+DM  + G +  A    N
Sbjct  282  VTLSAVLLACAHSGALQAG-KCIHDQVIKMNLEDNVYVATSMIDMYCKCGRLRTARNAFN  340

Query  707  KMPIEPDKRIWGALLAG  757
            +M  E + + W AL+AG
Sbjct  341  RMK-EKNVKSWSALIAG  356


 Score =   107 bits (267),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/224 (30%), Positives = 122/224 (54%), Gaps = 10/224 (4%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            L + D+ +W+++I+  A+S     AL  F  M+    KPN   F   +++CSS++    G
Sbjct  34   LDKSDVFSWNSIIADLARSGDSVEALRAFSSMRKLSLKPNRSTFPCAIKSCSSLSNLSSG  93

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q +  GY ++ F++S LIDMY K G++   + +FD+ P K+++ W+SMI GY  N
Sbjct  94   KQTHQQALIFGYETDLFVSSALIDMYSKCGQLADARKLFDQIPQKNVVSWTSMITGYVQN  153

Query  461  GHGNEALECFLDMLS----HGIQPNDVVFISVLSACSHCGLE--YEGWNWFHAMEEKYDI  622
               +EAL  F ++L+      +  + V  +SVLSACS    +   +G + F   +  +D 
Sbjct  154  DQPHEALSLFKELLAGQAEELVSLDSVSMVSVLSACSRVSGKTLTQGLHGF-VTKRGFDE  212

Query  623  TPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
             P + +   ++D  ++ G V+ + +  + MP + D   W +++A
Sbjct  213  DPGVGN--TLIDAYAKCGEVDLSRKMFDVMP-DKDIISWNSMIA  253



>gb|KGN58242.1| hypothetical protein Csa_3G598390 [Cucumis sativus]
Length=659

 Score =   293 bits (749),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/326 (43%), Positives = 202/326 (62%), Gaps = 2/326 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   I V   L+  YA  G    S+ +FD + +KD I+W++MI+ YAQS     AL 
Sbjct  213  KKGFDGSIGVGNTLMDAYAKCGQPLVSKKVFDWMEEKDDISWNSMIAVYAQSGLSGEALE  272

Query  182  VFRRMQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
            VF  M    G + N     ++L AC+   A   G+ IH QV+K+    N  + + +IDMY
Sbjct  273  VFHGMVRHVGVRYNAVTLSAVLLACAHAGALRAGKCIHDQVIKMDLEYNVCVGTSIIDMY  332

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
            CK GR+   K  FD   +K++  W++M+ GYGM+G   EAL+ F  M+  G++PN + F+
Sbjct  333  CKCGRVEMAKKTFDRMKEKNVKSWTAMVAGYGMHGRAKEALDIFYKMVRAGVKPNYITFV  392

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            SVL+ACSH GL  EGW+WF+AM+ KYDI P + HY CMVD+  R G + EA   + +M +
Sbjct  393  SVLAACSHAGLVEEGWHWFNAMKHKYDIEPGIEHYGCMVDLFGRAGCLNEAYNLIKRMKM  452

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
            +PD  +WG+LL  CR  H + ++ E+ A++L  LDP N  YYV+LSNLYAD GRW +VE+
Sbjct  453  KPDFVVWGSLLGACR-IHKNVDLGEIAAQKLFELDPDNCGYYVLLSNLYADAGRWADVER  511

Query  899  LRQLMDGKKRKKGMGYSVVEVNNSMH  976
            +R LM  ++  K  G+S+VE+   +H
Sbjct  512  MRMLMKNRQLVKPPGFSLVELKGRVH  537


 Score =   135 bits (339),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 140/259 (54%), Gaps = 11/259 (4%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF   + V +AL+ MY+  G ++ +R LFD +  +++++W++MI+ Y Q++Q  NAL +F
Sbjct  106  GFETDLFVSSALIDMYSKCGQLKDARALFDEIPLRNVVSWTSMITGYVQNEQADNALLLF  165

Query  188  R-----RMQLEHGKP---NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASG  343
            +       ++E G     +     S+L ACS ++ + + E +H  V+K G+  +  + + 
Sbjct  166  KDFLEEETEVEDGNNVPLDSVVMVSVLSACSRVSGKGITEGVHGFVVKKGFDGSIGVGNT  225

Query  344  LIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSH-GIQP  520
            L+D Y K G+    K +FD   +KD I W+SMI  Y  +G   EALE F  M+ H G++ 
Sbjct  226  LMDAYAKCGQPLVSKKVFDWMEEKDDISWNSMIAVYAQSGLSGEALEVFHGMVRHVGVRY  285

Query  521  NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEF  700
            N V   +VL AC+H G    G    H    K D+   +     ++DM  + G VE A + 
Sbjct  286  NAVTLSAVLLACAHAGALRAG-KCIHDQVIKMDLEYNVCVGTSIIDMYCKCGRVEMAKKT  344

Query  701  VNKMPIEPDKRIWGALLAG  757
             ++M  E + + W A++AG
Sbjct  345  FDRMK-EKNVKSWTAMVAG  362


 Score = 99.0 bits (245),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 83/344 (24%), Positives = 142/344 (41%), Gaps = 57/344 (17%)
 Frame = +2

Query  89   LFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAA  268
             +  + + ++ +W+++I+  A+      AL  F  ++     P   +F   +++CS++  
Sbjct  32   FYKYVDKSNVHSWNSVIADLARGGDSVEALRAFSSLRKLGLIPTRSSFPCTIKSCSALCD  91

Query  269  QDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMING  448
               G   H Q    G+ ++ F++S LIDMY K G++   + +FDE P ++++ W+SMI G
Sbjct  92   LVSGRMSHQQAFVFGFETDLFVSSALIDMYSKCGQLKDARALFDEIPLRNVVSWTSMITG  151

Query  449  YGMNGHGNEALECFLDMLSHGIQPND--------VVFISVLSACSH--------------  562
            Y  N   + AL  F D L    +  D        VV +SVLSACS               
Sbjct  152  YVQNEQADNALLLFKDFLEEETEVEDGNNVPLDSVVMVSVLSACSRVSGKGITEGVHGFV  211

Query  563  ---------------------CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGN  679
                                 CG        F  MEEK DI+     +  M+ + ++ G 
Sbjct  212  VKKGFDGSIGVGNTLMDAYAKCGQPLVSKKVFDWMEEKDDIS-----WNSMIAVYAQSGL  266

Query  680  VEEALE----FVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLD-PTNASYY  844
              EALE     V  + +  +     A+L  C    G+    + +  Q+I +D   N    
Sbjct  267  SGEALEVFHGMVRHVGVRYNAVTLSAVLLACAHA-GALRAGKCIHDQVIKMDLEYNVCVG  325

Query  845  VILSNLYADQGRWDEVEKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
              + ++Y   GR   VE  ++  D  K K    ++ +     MH
Sbjct  326  TSIIDMYCKCGR---VEMAKKTFDRMKEKNVKSWTAMVAGYGMH  366



>ref|XP_009415688.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820-like 
[Musa acuminata subsp. malaccensis]
Length=655

 Score =   293 bits (749),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/314 (45%), Positives = 201/314 (64%), Gaps = 1/314 (0%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
            TA++  YA  G I  +R +FD ++ KD++ WSAMIS YA+SDQP+ AL +F  M L   K
Sbjct  221  TAMVFGYAKLGKIAVARSIFDQMTDKDLVCWSAMISGYAESDQPNEALKLFNEMHLLGVK  280

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
            P++    S++ AC++M A+D  + +H  V K G+     + + LIDMY K G +   +TI
Sbjct  281  PDQITMLSVISACANMGARDQAKWVHIFVDKNGFHQILSIRNALIDMYSKCGSLVDARTI  340

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            FDE   KD+I W+SMI G+ M+G+G  AL  F  M+S G++PN V FIS+L ACSH GL 
Sbjct  341  FDETAFKDVITWTSMITGFAMHGNGRSALAVFDHMISEGVKPNGVTFISLLYACSHAGLV  400

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
             EG   F +M + Y + PK  HY CMVD+L R   ++EALEF+  MP  P+  +WG+LL 
Sbjct  401  DEGRRIFESMIQDYRLEPKHEHYGCMVDLLGRARLLQEALEFIESMPFAPNVVVWGSLLG  460

Query  755  GCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKK  934
             CR  HG  ++ ELVA++L+ LDP +   YV+LSN+YA   RW++V ++R LM  K   K
Sbjct  461  ACR-IHGDVKLGELVARRLLELDPNHDGAYVLLSNIYAKASRWEDVREVRNLMKNKGVIK  519

Query  935  GMGYSVVEVNNSMH  976
              G+S +E+N  +H
Sbjct  520  EAGFSWIELNGHVH  533


 Score =   103 bits (257),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/296 (26%), Positives = 137/296 (46%), Gaps = 46/296 (16%)
 Frame = +2

Query  113  DIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIH  292
            D  ++  ++ A A+S   + AL +F  M+     P+     ++L AC+       G  +H
Sbjct  115  DRFSFPTVLRAAARSGCYNEALQLFDEMKSSGVIPDRVILATILSACARTRNLTSGGAVH  174

Query  293  TQVMKLGYTSNAFLASGLIDMY-------------------------------CKFGRIH  379
            + +++   + +A L S LI +Y                                K G+I 
Sbjct  175  SYIVESNLSIDAHLQSALISLYSSCGSMDTAQRLYDDTSPKNLVASTAMVFGYAKLGKIA  234

Query  380  QGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACS  559
              ++IFD+  DKDL+CWS+MI+GY  +   NEAL+ F +M   G++P+ +  +SV+SAC+
Sbjct  235  VARSIFDQMTDKDLVCWSAMISGYAESDQPNEALKLFNEMHLLGVKPDQITMLSVISACA  294

Query  560  HCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIW  739
            + G   +   W H   +K      L+    ++DM S+ G++ +A    ++   + D   W
Sbjct  295  NMGARDQA-KWVHIFVDKNGFHQILSIRNALIDMYSKCGSLVDARTIFDETAFK-DVITW  352

Query  740  GALLAGCRKTHGSSEISELVAKQLIS--LDPTNASYYVILSNLYA-------DQGR  880
             +++ G    HG+   +  V   +IS  + P   ++   +S LYA       D+GR
Sbjct  353  TSMITGF-AMHGNGRSALAVFDHMISEGVKPNGVTF---ISLLYACSHAGLVDEGR  404


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+GF + + +  AL+ MY+  G++  +R +FD  + KD+I W++MI+ +A      +ALA
Sbjct  311  KNGFHQILSIRNALIDMYSKCGSLVDARTIFDETAFKDVITWTSMITGFAMHGNGRSALA  370

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMK  307
            VF  M  E  KPN   F SLL ACS     D G  I   +++
Sbjct  371  VFDHMISEGVKPNGVTFISLLYACSHAGLVDEGRRIFESMIQ  412



>ref|XP_009800271.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Nicotiana sylvestris]
Length=653

 Score =   292 bits (748),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/344 (41%), Positives = 212/344 (62%), Gaps = 5/344 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF + + V   L+  YA  G ++ SR +FD +  KDII+W++MI+ YAQ    S AL 
Sbjct  207   KRGFDEDLGVGNTLIDAYAKCGEVDLSRKMFDVMPAKDIISWNSMIAVYAQHGLSSQALE  266

Query  182   VFRRMQLEHGKP-NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             +FR +  +     N     ++L AC+   A   G+ IH QV+K+    N ++A+ +IDMY
Sbjct  267   IFRSLAWDREVDYNAVTLSAVLLACAHSGALQAGKCIHDQVIKMNLEDNVYVATSMIDMY  326

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK GR+   +  F+   +K++  WS++I GYGM+G   EAL+ F +M   G++PN + F+
Sbjct  327   CKCGRLRMARNAFNRMKEKNVKSWSALIAGYGMHGRAREALQVFYEMNLAGVKPNYITFV  386

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             SVL+ACSH GL  EGW WF AME +Y I P + HYACMVD+L R G + +A   + +M +
Sbjct  387   SVLAACSHAGLLDEGWYWFKAMEPRYCIQPGVEHYACMVDLLGRAGFLAKAYNLIEEMKV  446

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
              PD  +WG+LLA CR  H + ++ E+ A+ L  LD TN  YYV+LSN+YAD GRW +V+K
Sbjct  447   TPDFVVWGSLLAACR-MHKNVDLGEIAARNLFELDSTNCGYYVLLSNIYADAGRWGDVDK  505

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             +R LM  +   K  G+S++E+   +H        ++E+ QH ++
Sbjct  506   MRILMKNRGLSKPPGFSLLELKGRVHAFLV---GDREHPQHEKI  546


 Score =   135 bits (341),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 134/250 (54%), Gaps = 11/250 (4%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V +AL+ MY+  G +  +R LFD + QK++++W++MI+ Y Q+DQP  AL++F+  +L  
Sbjct  111  VSSALIDMYSKCGQLADARKLFDQIPQKNVVSWTSMITGYVQNDQPHEALSLFK--ELLA  168

Query  209  GKPNEF------AFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFG  370
            G+  E       +  S+L ACS ++ + + + +H  V K G+  +  + + LID Y K G
Sbjct  169  GQAEELVSLDSVSMVSVLSACSRVSGKTLTQGLHGFVTKRGFDEDLGVGNTLIDAYAKCG  228

Query  371  RIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDML-SHGIQPNDVVFISVL  547
             +   + +FD  P KD+I W+SMI  Y  +G  ++ALE F  +     +  N V   +VL
Sbjct  229  EVDLSRKMFDVMPAKDIISWNSMIAVYAQHGLSSQALEIFRSLAWDREVDYNAVTLSAVL  288

Query  548  SACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPD  727
             AC+H G    G    H    K ++   +     M+DM  + G +  A    N+M  E +
Sbjct  289  LACAHSGALQAG-KCIHDQVIKMNLEDNVYVATSMIDMYCKCGRLRMARNAFNRMK-EKN  346

Query  728  KRIWGALLAG  757
             + W AL+AG
Sbjct  347  VKSWSALIAG  356


 Score =   112 bits (280),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 114/222 (51%), Gaps = 6/222 (3%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            L + D+ +W+ +I+  A+S     AL  F  M+    KPN   F   +++CSS++    G
Sbjct  34   LDKSDVFSWNFIIADLARSGDSVEALRAFSSMRKLSLKPNRSTFPCAVKSCSSLSDLTSG  93

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q +  GY ++ F++S LIDMY K G++   + +FD+ P K+++ W+SMI GY  N
Sbjct  94   KQTHQQALIFGYETDLFVSSALIDMYSKCGQLADARKLFDQIPQKNVVSWTSMITGYVQN  153

Query  461  GHGNEALECFLDMLS----HGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITP  628
               +EAL  F ++L+      +  + V  +SVLSACS    +       H    K     
Sbjct  154  DQPHEALSLFKELLAGQAEELVSLDSVSMVSVLSACSRVSGKTLTQG-LHGFVTKRGFDE  212

Query  629  KLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
             L     ++D  ++ G V+ + +  + MP + D   W +++A
Sbjct  213  DLGVGNTLIDAYAKCGEVDLSRKMFDVMPAK-DIISWNSMIA  253



>ref|XP_004233581.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial isoform X1 [Solanum lycopersicum]
Length=642

 Score =   292 bits (747),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/344 (41%), Positives = 211/344 (61%), Gaps = 5/344 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF + + V    +  YA  G ++ SR +FD +  KDII+W++MI+ YAQ    + A+ 
Sbjct  196   KRGFNEDMGVGNTFIDAYAKCGQVDLSRKMFDIMPYKDIISWNSMIAVYAQHGLSAQAME  255

Query  182   VFRRMQLEHGKP-NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             +FR +  +     N     +LL AC+   A   G+ IH QV+K+    N ++ + +IDMY
Sbjct  256   IFRSLSWDREVDYNAVTLSALLLACAHSGALQAGKCIHDQVIKMNLEDNVYVGTSMIDMY  315

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK GR+   +  F+   +K++  WS++I GYGM+G   EAL+ F +M S G++P+ + F+
Sbjct  316   CKCGRLRMARNAFNRMKEKNVKSWSALIAGYGMHGRAREALQVFYEMNSAGVKPSYITFV  375

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             SVL+ACSH GL  EGW WF AME ++ I P + HYACMVD+L R G +  A + + +M +
Sbjct  376   SVLAACSHGGLLDEGWYWFKAMEPRFCIQPGVEHYACMVDLLGRAGFLTRAYDLLKEMKV  435

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
              PD  IWG+LLA CR  H + E+ E+ A  L  LDPTN  YYV+LSN+YAD GRW +VEK
Sbjct  436   TPDFVIWGSLLAACR-IHKNVELGEISASNLFELDPTNCGYYVLLSNIYADAGRWGDVEK  494

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             +R LM  +   K  G+S++E+   +H        ++E+ QH +V
Sbjct  495   MRILMKNRGLSKPPGFSLLELKGRVHVFVV---GDREHPQHEKV  535


 Score =   123 bits (309),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 74/245 (30%), Positives = 129/245 (53%), Gaps = 4/245 (2%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL-E  205
            V +AL+ MY+  G +  +R LFD + QK++++W++MI+ Y Q+D+P  A+ +F+ +   E
Sbjct  103  VSSALIDMYSKCGQLADARKLFDQIPQKNVVSWTSMITGYVQNDRPHEAIWLFKELLAGE  162

Query  206  HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQG  385
                +  A  S+L A S ++ + + + +H  V K G+  +  + +  ID Y K G++   
Sbjct  163  VVFLDSVAMVSVLSASSRLSGKTLTQGLHGFVTKRGFNEDMGVGNTFIDAYAKCGQVDLS  222

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDM-LSHGIQPNDVVFISVLSACSH  562
            + +FD  P KD+I W+SMI  Y  +G   +A+E F  +     +  N V   ++L AC+H
Sbjct  223  RKMFDIMPYKDIISWNSMIAVYAQHGLSAQAMEIFRSLSWDREVDYNAVTLSALLLACAH  282

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             G    G    H    K ++   +     M+DM  + G +  A    N+M  E + + W 
Sbjct  283  SGALQAG-KCIHDQVIKMNLEDNVYVGTSMIDMYCKCGRLRMARNAFNRMK-EKNVKSWS  340

Query  743  ALLAG  757
            AL+AG
Sbjct  341  ALIAG  345


 Score =   107 bits (267),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 113/219 (52%), Gaps = 3/219 (1%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            L + D+ +W+++I+  A+S     AL  F  M+    KPN   F   +++CSS++    G
Sbjct  26   LDKSDVFSWNSIIADLARSGDAVEALRAFSSMRKLSLKPNRSTFPCAVKSCSSLSDLTSG  85

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q +  GY ++ F++S LIDMY K G++   + +FD+ P K+++ W+SMI GY  N
Sbjct  86   KQTHQQALIFGYDTDLFVSSALIDMYSKCGQLADARKLFDQIPQKNVVSWTSMITGYVQN  145

Query  461  GHGNEALECFLDMLSHGIQPND-VVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLA  637
               +EA+  F ++L+  +   D V  +SVLSA S    +       H    K      + 
Sbjct  146  DRPHEAIWLFKELLAGEVVFLDSVAMVSVLSASSRLSGKTLTQG-LHGFVTKRGFNEDMG  204

Query  638  HYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
                 +D  ++ G V+ + +  + MP + D   W +++A
Sbjct  205  VGNTFIDAYAKCGQVDLSRKMFDIMPYK-DIISWNSMIA  242



>ref|XP_009387668.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820-like 
[Musa acuminata subsp. malaccensis]
Length=653

 Score =   292 bits (748),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/314 (45%), Positives = 201/314 (64%), Gaps = 1/314 (0%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
            TA++  YA  G I  +R +FD ++ KD++ WSAMIS YA+SDQP+ AL +F  M L   K
Sbjct  219  TAMVFGYAKLGKIAVARSIFDQMTDKDLVCWSAMISGYAESDQPNEALKLFNEMHLLGVK  278

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
            P++    S++ AC++M A+D  + +H  V K G+     + + LIDMY K G +   +TI
Sbjct  279  PDQITMLSVISACANMGARDQAKWVHIFVDKNGFHQILSIRNALIDMYSKCGSLVDARTI  338

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            FDE   KD+I W+SMI G+ M+G+G  AL  F  M+S G++PN V FIS+L ACSH GL 
Sbjct  339  FDETAFKDVITWTSMITGFAMHGNGRSALAVFDHMISEGVKPNGVTFISLLYACSHAGLV  398

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
             EG   F +M + Y + PK  HY CMVD+L R   ++EALEF+  MP  P+  +WG+LL 
Sbjct  399  DEGRRIFESMIQDYRLEPKHEHYGCMVDLLGRARLLQEALEFIESMPFAPNVVVWGSLLG  458

Query  755  GCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKK  934
             CR  HG  ++ ELVA++L+ LDP +   YV+LSN+YA   RW++V ++R LM  K   K
Sbjct  459  ACR-IHGDVKLGELVARRLLELDPNHDGAYVLLSNIYAKASRWEDVREVRNLMKNKGVIK  517

Query  935  GMGYSVVEVNNSMH  976
              G+S +E+N  +H
Sbjct  518  EAGFSWIELNGHVH  531


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/313 (25%), Positives = 140/313 (45%), Gaps = 54/313 (17%)
 Frame = +2

Query  62   FGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSL  241
            +G +  + +  D  S   ++        Y QS   + AL +F  M+     P+     ++
Sbjct  104  YGRLRRAGLALDRFSFPTVL--------YCQSGCYNEALQLFDEMKSSGVIPDRVILATI  155

Query  242  LQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY---------------------  358
            L AC+       G  +H+ +++   + +A L S LI MY                     
Sbjct  156  LSACARTRNLTSGGAVHSYIVESNLSIDAHLQSALISMYSNCGSMDTAQRLYDDTSAKNL  215

Query  359  ----------CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSH  508
                       K G+I   ++IFD+  DKDL+CWS+MI+GY  +   NEAL+ F +M   
Sbjct  216  VASTAMVFGYAKLGKIAVARSIFDQMTDKDLVCWSAMISGYAESDQPNEALKLFNEMHLL  275

Query  509  GIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEE  688
            G++P+ +  +SV+SAC++ G   +   W H   +K      L+    ++DM S+ G++ +
Sbjct  276  GVKPDQITMLSVISACANMGARDQA-KWVHIFVDKNGFHQILSIRNALIDMYSKCGSLVD  334

Query  689  ALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLIS--LDPTNASYYVILSNL  862
            A    ++   + D   W +++ G    HG+   +  V   +IS  + P   ++   +S L
Sbjct  335  ARTIFDETAFK-DVITWTSMITGF-AMHGNGRSALAVFDHMISEGVKPNGVTF---ISLL  389

Query  863  YA-------DQGR  880
            YA       D+GR
Sbjct  390  YACSHAGLVDEGR  402


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+GF + + +  AL+ MY+  G++  +R +FD  + KD+I W++MI+ +A      +ALA
Sbjct  309  KNGFHQILSIRNALIDMYSKCGSLVDARTIFDETAFKDVITWTSMITGFAMHGNGRSALA  368

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMK  307
            VF  M  E  KPN   F SLL ACS     D G  I   +++
Sbjct  369  VFDHMISEGVKPNGVTFISLLYACSHAGLVDEGRRIFESMIQ  410



>ref|XP_010273754.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g11460 [Nelumbo nucifera]
Length=513

 Score =   288 bits (738),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/317 (43%), Positives = 199/317 (63%), Gaps = 1/317 (0%)
 Frame = +2

Query  26   PVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLE  205
            P+V +L+ +Y    N++ +R LFD +  +++++W+AMI AY Q+    +A+ +FRRM+ E
Sbjct  188  PLVNSLISLYGKCRNVDIARSLFDQMVARNLVSWNAMIGAYEQNGASRDAIKLFRRMRNE  247

Query  206  HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQG  385
              + +     SL+ AC+SM A + G+  H  V   G   N  + + LIDMY K G I   
Sbjct  248  KVEFDYITTVSLISACASMGALNTGKWAHELVTSKGLEINVSITNALIDMYAKCGSIESA  307

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC  565
            + +FD+ P + ++ W++MI  Y  +G+G +AL+ F  M   GIQPN   F +VL+AC H 
Sbjct  308  RDVFDKLPKRSVVSWTAMIGAYAAHGYGEDALKLFSKMQEEGIQPNSFTFTAVLTACRHS  367

Query  566  GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGA  745
            GL  EG   F +M   Y I P L   ACMVD+L R G + EA EF+  +P+EPD  +WGA
Sbjct  368  GLVEEGRKHFESMTRDYLIAPGLEQCACMVDLLGRAGRLTEAYEFIKGIPVEPDAGVWGA  427

Query  746  LLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKK  925
            LL  CR  HG+ E++ELVA+ LI LDP   +YYV+LSN+YA+ GRW++V +LR+LM  ++
Sbjct  428  LLGACR-IHGNVELAELVAEHLIQLDPQTVTYYVLLSNIYAEAGRWEDVARLRELMKERE  486

Query  926  RKKGMGYSVVEVNNSMH  976
             KK  G S+VE+N   H
Sbjct  487  LKKIPGRSLVEINRRFH  503


 Score =   138 bits (348),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 154/287 (54%), Gaps = 5/287 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+GF   + V ++L+ MY+  G  + S  +FD +  ++I++W+AMIS Y Q+      L+
Sbjct  79   KNGFDSDVFVQSSLVSMYSQSGETKDSESIFDEMIVRNIVSWTAMISGYVQNGFYKEGLS  138

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            VFRRM     +PN     S+L AC  +   ++G+ IH   +KLG  S+  L + LI +Y 
Sbjct  139  VFRRMVASGTQPNAVTLVSILPACGGLEVLNLGKLIHGYGVKLGVDSDTPLVNSLISLYG  198

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K   +   +++FD+   ++L+ W++MI  Y  NG   +A++ F  M +  ++ + +  +S
Sbjct  199  KCRNVDIARSLFDQMVARNLVSWNAMIGAYEQNGASRDAIKLFRRMRNEKVEFDYITTVS  258

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            ++SAC+  G    G  W H +     +   ++    ++DM ++ G++E A +  +K+P +
Sbjct  259  LISACASMGALNTG-KWAHELVTSKGLEINVSITNALIDMYAKCGSIESARDVFDKLP-K  316

Query  722  PDKRIWGALLAGCRKTHGSSEIS-ELVAK-QLISLDPTNASYYVILS  856
                 W A++ G    HG  E + +L +K Q   + P + ++  +L+
Sbjct  317  RSVVSWTAMI-GAYAAHGYGEDALKLFSKMQEEGIQPNSFTFTAVLT  362


 Score =   119 bits (299),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/239 (28%), Positives = 121/239 (51%), Gaps = 5/239 (2%)
 Frame = +2

Query  71   IESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQA  250
            ++ +R LFD + Q+D   W+ +I  YA          ++R M L    P+ + F  ++++
Sbjct  1    MDYARKLFDRVPQRDAFLWNTLIRGYADMGPCEEVFVLYRNMHLSGLLPDNYTFPFVVRS  60

Query  251  CSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICW  430
            C+ ++A   G+ +H  ++K G+ S+ F+ S L+ MY + G     ++IFDE   ++++ W
Sbjct  61   CAVLSALREGKEVHCNIIKNGFDSDVFVQSSLVSMYSQSGETKDSESIFDEMIVRNIVSW  120

Query  431  SSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGW-NWFHAME  607
            ++MI+GY  NG   E L  F  M++ G QPN V  +S+L AC   GLE        H   
Sbjct  121  TAMISGYVQNGFYKEGLSVFRRMVASGTQPNAVTLVSILPACG--GLEVLNLGKLIHGYG  178

Query  608  EKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSE  784
             K  +         ++ +  +  NV+ A    ++M +  +   W A++ G  + +G+S 
Sbjct  179  VKLGVDSDTPLVNSLISLYGKCRNVDIARSLFDQM-VARNLVSWNAMI-GAYEQNGASR  235


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 90/183 (49%), Gaps = 14/183 (8%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            + +  AL+ MYA  G+IES+R +FD L ++ +++W+AMI AYA      +AL +F +MQ 
Sbjct  288  VSITNALIDMYAKCGSIESARDVFDKLPKRSVVSWTAMIGAYAAHGYGEDALKLFSKMQE  347

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGL------IDMYCK  364
            E  +PN F F ++L AC      + G   H + M    T +  +A GL      +D+  +
Sbjct  348  EGIQPNSFTFTAVLTACRHSGLVEEGRK-HFESM----TRDYLIAPGLEQCACMVDLLGR  402

Query  365  FGRIHQGKTIFDENP-DKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
             GR+ +        P + D   W +++    +  HGN  L   +      + P  V +  
Sbjct  403  AGRLTEAYEFIKGIPVEPDAGVWGALLGACRI--HGNVELAELVAEHLIQLDPQTVTYYV  460

Query  542  VLS  550
            +LS
Sbjct  461  LLS  463



>ref|XP_004306318.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial-like [Fragaria vesca subsp. vesca]
Length=747

 Score =   295 bits (754),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/344 (41%), Positives = 214/344 (62%), Gaps = 5/344 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF   I V   L+  YA  G +  SR +FD ++Q+D+++W++MI+  AQS   + AL 
Sbjct  301   KRGFDGDIGVGNTLMDAYAKCGELGLSRKVFDGMAQRDLVSWNSMIAICAQSGLSNEALQ  360

Query  182   VFRRMQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VF  M  E G   N     ++L AC+   A  VG+ IH QV+K+G   N  +++ +IDMY
Sbjct  361   VFYEMVKEGGFLYNAVTLSAVLLACAHAGALLVGQCIHDQVVKMGMEENVIVSTSIIDMY  420

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK GR+   +  FD   +K++  WS+M+ GYGM+G   EALE F  M+SHGI+PN + F+
Sbjct  421   CKCGRVDMARKAFDCMKEKNVKTWSAMVAGYGMHGRAKEALEVFYKMISHGIKPNYITFV  480

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             S+L+ACSH GL  EGW WF+ M  ++ + P + HY CMVD+L R G++ +A   +  M +
Sbjct  481   SLLNACSHAGLLEEGWYWFNTMNHEFGVKPGIEHYGCMVDLLGRAGDLTKAYNLIKGMTM  540

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
             + D  +WG+ L  CR  H + +++E+ A++L  LDP N  YY++LSN+YAD GRW++VEK
Sbjct  541   KADSVVWGSFLGACR-IHKNVKLAEISARKLFELDPNNCGYYILLSNIYADAGRWEDVEK  599

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             +R LM  +   K  G+SVVE+   +H        ++E+ QH ++
Sbjct  600   MRVLMKNRGLAKLPGFSVVELKGMVHLFLV---GDREHPQHKKI  640


 Score =   115 bits (287),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 84/302 (28%), Positives = 150/302 (50%), Gaps = 12/302 (4%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF   + V +AL+ MY   G +  +  LFD +  +++++W++MI+    +D    AL +F
Sbjct  197  GFESDLFVSSALIDMYCRCGLLRDAWKLFDEIPHRNVVSWTSMITGCLLNDHTRQALLLF  256

Query  188  RRMQL-----EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
            + + +     E    +     S+L ACS ++++ + + +H  VMK G+  +  + + L+D
Sbjct  257  KELLVDEFDNEDVDLDPVVLVSVLSACSRVSSKGLTQCVHGLVMKRGFDGDIGVGNTLMD  316

Query  353  MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSH-GIQPNDV  529
             Y K G +   + +FD    +DL+ W+SMI     +G  NEAL+ F +M+   G   N V
Sbjct  317  AYAKCGELGLSRKVFDGMAQRDLVSWNSMIAICAQSGLSNEALQVFYEMVKEGGFLYNAV  376

Query  530  VFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNK  709
               +VL AC+H G    G    H    K  +   +     ++DM  + G V+ A +  + 
Sbjct  377  TLSAVLLACAHAGALLVG-QCIHDQVVKMGMEENVIVSTSIIDMYCKCGRVDMARKAFDC  435

Query  710  MPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLIS--LDPTNASYYVILSNLYADQGRW  883
            M  E + + W A++AG    HG ++ +  V  ++IS  + P N   +V L N  +  G  
Sbjct  436  MK-EKNVKTWSAMVAG-YGMHGRAKEALEVFYKMISHGIKP-NYITFVSLLNACSHAGLL  492

Query  884  DE  889
            +E
Sbjct  493  EE  494


 Score =   105 bits (262),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 121/234 (52%), Gaps = 9/234 (4%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + + D+ +W+++I+  A+S     AL  F  M+    +PN  +F   +++CS++     G
Sbjct  127  VDKTDVSSWNSVIADLARSGNSVEALGAFSSMRKLSLRPNRSSFPCAIKSCSALLDVHSG  186

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
               H Q +  G+ S+ F++S LIDMYC+ G +     +FDE P ++++ W+SMI G  +N
Sbjct  187  RQAHQQALVFGFESDLFVSSALIDMYCRCGLLRDAWKLFDEIPHRNVVSWTSMITGCLLN  246

Query  461  GHGNEALECFLDML-----SHGIQPNDVVFISVLSACSHCGLEYEGWN-WFHAMEEKYDI  622
             H  +AL  F ++L     +  +  + VV +SVLSACS   +  +G     H +  K   
Sbjct  247  DHTRQALLLFKELLVDEFDNEDVDLDPVVLVSVLSACSR--VSSKGLTQCVHGLVMKRGF  304

Query  623  TPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSE  784
               +     ++D  ++ G +  + +  + M  + D   W +++A C ++  S+E
Sbjct  305  DGDIGVGNTLMDAYAKCGELGLSRKVFDGMA-QRDLVSWNSMIAICAQSGLSNE  357



>ref|XP_004304909.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g56570-like [Fragaria vesca subsp. vesca]
Length=608

 Score =   291 bits (744),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/325 (43%), Positives = 202/325 (62%), Gaps = 2/325 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K  F   +PV+ ++L MY  F  +  ++  FD +SQKD+I W+ +IS Y +SD P  +L+
Sbjct  240  KYAFDSHLPVMNSILDMYCKFCCLPEAKQYFDEMSQKDLITWNTLISGYEKSD-PRESLS  298

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F RM+ E   PN F   S+  AC++MAA + GE +H  +++ G+  N  LA+ LIDMY 
Sbjct  299  IFSRMESEGFSPNSFTLTSVTAACANMAALNCGEQVHGTIIRRGFNKNLALANTLIDMYA  358

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G I     IF +  D++L+ W+SM+ GYG +GHG EA+E F +M+  GI+P+ +VF++
Sbjct  359  KCGSITDAHKIFSDMSDRNLVSWTSMMLGYGDHGHGKEAVELFDEMVMSGIRPDRIVFMA  418

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VLSACSH GL  EG  +F  M   Y +TP    Y+C+VD+L R G ++EA E +  MP +
Sbjct  419  VLSACSHTGLVTEGLRYFKCMVNDYKVTPDKDIYSCVVDLLCRAGRIKEAYELIESMPFK  478

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD+  WGALL  CR  H    +S L A++LI L P  A  YV+LSN YA +G+W E   +
Sbjct  479  PDESFWGALLGACR-AHKLPHLSRLAAQRLIDLRPNMAGTYVMLSNFYAAEGKWGEYANM  537

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R LM G   KK  G S +EV N ++
Sbjct  538  RMLMRGTGNKKEAGQSWIEVRNQVY  562


 Score =   129 bits (323),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 85/294 (29%), Positives = 148/294 (50%), Gaps = 19/294 (6%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMY-ANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNAL  178
            K G    I V  AL+ MY A   +++ +  +F  L +K+ ++W+++I+ Y         L
Sbjct  138  KYGMKGSIYVENALMDMYGACCVSMDDACKVFSELHEKNAVSWTSLITGYTHRGDGYGGL  197

Query  179  AVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VFR+M LE  +PN F+F   ++AC+S+ +Q  G  +H+ V+K  + S+  + + ++DMY
Sbjct  198  QVFRQMLLEGVEPNPFSFSIAVKACASVGSQTFGRQLHSAVIKYAFDSHLPVMNSILDMY  257

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
            CKF  + + K  FDE   KDLI W+++I+GY       E+L  F  M S G  PN     
Sbjct  258  CKFCCLPEAKQYFDEMSQKDLITWNTLISGYE-KSDPRESLSIFSRMESEGFSPNSFTLT  316

Query  539  SVLSACS-----HCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFV  703
            SV +AC+     +CG +       H    +      LA    ++DM ++ G++ +A +  
Sbjct  317  SVTAACANMAALNCGEQ------VHGTIIRRGFNKNLALANTLIDMYAKCGSITDAHKIF  370

Query  704  NKMPIEPDKRI--WGALLAGCRKTHGSSEISELVAKQLIS-LDPTNASYYVILS  856
            + M    D+ +  W +++ G        E  EL  + ++S + P    +  +LS
Sbjct  371  SDM---SDRNLVSWTSMMLGYGDHGHGKEAVELFDEMVMSGIRPDRIVFMAVLS  421


 Score =   126 bits (316),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 74/256 (29%), Positives = 128/256 (50%), Gaps = 5/256 (2%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            + T L++ Y   G+++ +R +FD +S++D++ W+AMI+ Y      S+A  VF  M    
Sbjct  46   LATDLIKSYFQKGSLKEARKVFDEMSERDVVTWTAMIAGYTSCSHHSSAWGVFCEMFRSD  105

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY--CKFGRIHQ  382
             +PN F F S+L+AC  M +   G  +H   +K G   + ++ + L+DMY  C    +  
Sbjct  106  MEPNAFTFSSVLKACKGMVSLLCGALVHGSTVKYGMKGSIYVENALMDMYGACCVS-MDD  164

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
               +F E  +K+ + W+S+I GY   G G   L+ F  ML  G++PN   F   + AC+ 
Sbjct  165  ACKVFSELHEKNAVSWTSLITGYTHRGDGYGGLQVFRQMLLEGVEPNPFSFSIAVKACAS  224

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             G +  G    H+   KY     L     ++DM  +   + EA ++ ++M  + D   W 
Sbjct  225  VGSQTFG-RQLHSAVIKYAFDSHLPVMNSILDMYCKFCCLPEAKQYFDEMS-QKDLITWN  282

Query  743  ALLAGCRKTHGSSEIS  790
             L++G  K+     +S
Sbjct  283  TLISGYEKSDPRESLS  298



>ref|NP_001078415.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 gb|AEE84395.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=462

 Score =   286 bits (732),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/326 (40%), Positives = 215/326 (66%), Gaps = 2/326 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            +SGF   I V  +LL +YAN G++ S+  +FD + +KD++AW+++I+ +A++ +P  ALA
Sbjct  16   RSGFGSLIYVQNSLLHLYANCGDVASAYKVFDKMPEKDLVAWNSVINGFAENGKPEEALA  75

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++  M  +  KP+ F   SLL AC+ + A  +G+ +H  ++K+G T N   ++ L+D+Y 
Sbjct  76   LYTEMNSKGIKPDGFTIVSLLSACAKIGALTLGKRVHVYMIKVGLTRNLHSSNVLLDLYA  135

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLS-HGIQPNDVVFI  538
            + GR+ + KT+FDE  DK+ + W+S+I G  +NG G EA+E F  M S  G+ P ++ F+
Sbjct  136  RCGRVEEAKTLFDEMVDKNSVSWTSLIVGLAVNGFGKEAIELFKYMESTEGLLPCEITFV  195

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             +L ACSHCG+  EG+ +F  M E+Y I P++ H+ CMVD+L+R G V++A E++  MP+
Sbjct  196  GILYACSHCGMVKEGFEYFRRMREEYKIEPRIEHFGCMVDLLARAGQVKKAYEYIKSMPM  255

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
            +P+  IW  LL  C   HG S+++E    Q++ L+P ++  YV+LSN+YA + RW +V+K
Sbjct  256  QPNVVIWRTLLGAC-TVHGDSDLAEFARIQILQLEPNHSGDYVLLSNMYASEQRWSDVQK  314

Query  899  LRQLMDGKKRKKGMGYSVVEVNNSMH  976
            +R+ M     KK  G+S+VEV N +H
Sbjct  315  IRKQMLRDGVKKVPGHSLVEVGNRVH  340


 Score =   103 bits (258),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 93/166 (56%), Gaps = 2/166 (1%)
 Frame = +2

Query  260  MAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSM  439
            MA   +GETIH+ V++ G+ S  ++ + L+ +Y   G +     +FD+ P+KDL+ W+S+
Sbjct  1    MADVRLGETIHSVVIRSGFGSLIYVQNSLLHLYANCGDVASAYKVFDKMPEKDLVAWNSV  60

Query  440  INGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYD  619
            ING+  NG   EAL  + +M S GI+P+    +S+LSAC+  G    G    H    K  
Sbjct  61   INGFAENGKPEEALALYTEMNSKGIKPDGFTIVSLLSACAKIGALTLG-KRVHVYMIKVG  119

Query  620  ITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            +T  L     ++D+ +R G VEEA    ++M ++ +   W +L+ G
Sbjct  120  LTRNLHSSNVLLDLYARCGRVEEAKTLFDEM-VDKNSVSWTSLIVG  164



>ref|XP_007214267.1| hypothetical protein PRUPE_ppa025121mg [Prunus persica]
 gb|EMJ15466.1| hypothetical protein PRUPE_ppa025121mg [Prunus persica]
Length=796

 Score =   295 bits (754),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 210/316 (66%), Gaps = 2/316 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V   L+ MYA  G++E +  +F S+  KDI++W+ MI  Y+++  P+ AL +F  MQ + 
Sbjct  361  VCNTLMDMYAKCGSMEDAHSVFSSMPVKDIVSWNTMIGGYSKNCLPNEALKLFSEMQ-QK  419

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KP+     S+L AC+S+AA + G+ IH  +++ GY S+ ++A+ L+DMY K G +   +
Sbjct  420  SKPDGMTIASVLPACASLAALNRGQEIHGHILRNGYFSDRYVANALVDMYVKCGVLVLAR  479

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD  P KDLI W+ ++ GYGM+G G+EA+  F +M   GI+P+ + FIS+L ACSH G
Sbjct  480  LLFDIIPIKDLISWTVIVAGYGMHGFGSEAITAFNEMRKSGIKPDSISFISILYACSHSG  539

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  E W +F +M   Y I PKL HYACMVD+L+R GN+ +A +F+NKMPIEPD  IWG+L
Sbjct  540  LLDEAWRFFDSMRNDYSIVPKLEHYACMVDLLARTGNLTKAYKFINKMPIEPDATIWGSL  599

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L GCR  H   +++E VA+++  L+P N  YYV+L+N+YA+  +W+EV+KLR+ +  +  
Sbjct  600  LCGCR-IHHDVKLAEKVAERVFELEPENTGYYVLLANIYAEAEKWEEVKKLRERIGRQGL  658

Query  929  KKGMGYSVVEVNNSMH  976
            KK  G S +E+   + 
Sbjct  659  KKNPGCSWIEIKGKVQ  674


 Score =   124 bits (312),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 83/281 (30%), Positives = 140/281 (50%), Gaps = 4/281 (1%)
 Frame = +2

Query  26   PVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLE  205
            P+   L+ M+   G++  +R +FD LS   +  W+ MI+ YA+       + +FR+MQ  
Sbjct  57   PLGAKLVFMFVKCGDLREARRVFDKLSNGKVFLWNLMINEYAKVRNFREGIHLFRKMQEL  116

Query  206  HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQG  385
              + N + F  +L+  SS+     GE +H  + KLG+ S+  + + L+  Y K   I   
Sbjct  117  GIQANSYTFSCILKCFSSLGYVREGEWVHGYLYKLGFGSDNTVGNSLMAFYFKNRIIESA  176

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC  565
            + +FDE  D+D+I W+SMI+ Y  NG   + +E F  MLS G+  +    I+VL ACS  
Sbjct  177  RKVFDELSDRDVISWNSMISAYVANGLAEKGVEIFRQMLSLGVDVDLATVINVLMACSDG  236

Query  566  GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGA  745
            G    G    H+   K  +   +  Y  ++DM S+ G++  A +   KM  +     W +
Sbjct  237  GNLSLG-RALHSYAIKTCLDMDIMFYNNVLDMYSKCGDLSSATQVFGKMG-QRSVVSWTS  294

Query  746  LLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYA  868
            ++AG  +   S E  EL ++  +  +  +   Y I S L+A
Sbjct  295  MIAGYVREGLSDEAIELFSE--MERNDVSPDVYTITSILHA  333


 Score =   115 bits (289),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/277 (28%), Positives = 135/277 (49%), Gaps = 14/277 (5%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            +L MY+  G++ S+  +F  + Q+ +++W++MI+ Y +      A+ +F  M+     P+
Sbjct  264  VLDMYSKCGDLSSATQVFGKMGQRSVVSWTSMIAGYVREGLSDEAIELFSEMERNDVSPD  323

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
             +   S+L AC+   +   G  IH  + + G  S+ F+ + L+DMY K G +    ++F 
Sbjct  324  VYTITSILHACACNGSLKKGRDIHKYIREHGMDSSLFVCNTLMDMYAKCGSMEDAHSVFS  383

Query  401  ENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC-----  565
              P KD++ W++MI GY  N   NEAL+ F +M     +P+ +   SVL AC+       
Sbjct  384  SMPVKDIVSWNTMIGGYSKNCLPNEALKLFSEMQQKS-KPDGMTIASVLPACASLAALNR  442

Query  566  GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGA  745
            G E  G    H +   Y     +A+   +VDM  + G +  A    + +PI+ D   W  
Sbjct  443  GQEIHG----HILRNGYFSDRYVAN--ALVDMYVKCGVLVLARLLFDIIPIK-DLISWTV  495

Query  746  LLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
            ++AG      GS  I+     +   + P + S+  IL
Sbjct  496  IVAGYGMHGFGSEAITAFNEMRKSGIKPDSISFISIL  532


 Score =   112 bits (280),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 73/256 (29%), Positives = 129/256 (50%), Gaps = 4/256 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     V  +L+  Y     IES+R +FD LS +D+I+W++MISAY  +      + 
Sbjct  150  KLGFGSDNTVGNSLMAFYFKNRIIESARKVFDELSDRDVISWNSMISAYVANGLAEKGVE  209

Query  182  VFRRMQLEHGKPNEFA-FHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
            +FR+M L  G   + A   ++L ACS      +G  +H+  +K     +    + ++DMY
Sbjct  210  IFRQM-LSLGVDVDLATVINVLMACSDGGNLSLGRALHSYAIKTCLDMDIMFYNNVLDMY  268

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             K G +     +F +   + ++ W+SMI GY   G  +EA+E F +M  + + P+     
Sbjct  269  SKCGDLSSATQVFGKMGQRSVVSWTSMIAGYVREGLSDEAIELFSEMERNDVSPDVYTIT  328

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            S+L AC+  G   +G +  H    ++ +   L     ++DM ++ G++E+A    + MP+
Sbjct  329  SILHACACNGSLKKGRD-IHKYIREHGMDSSLFVCNTLMDMYAKCGSMEDAHSVFSSMPV  387

Query  719  EPDKRIWGALLAGCRK  766
            + D   W  ++ G  K
Sbjct  388  K-DIVSWNTMIGGYSK  402


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 72/152 (47%), Gaps = 4/152 (3%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++G+     V  AL+ MY   G +  +R+LFD +  KD+I+W+ +++ Y      S A+ 
Sbjct  452  RNGYFSDRYVANALVDMYVKCGVLVLARLLFDIIPIKDLISWTVIVAGYGMHGFGSEAIT  511

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLA--SGLIDM  355
             F  M+    KP+  +F S+L ACS     D         M+  Y+    L   + ++D+
Sbjct  512  AFNEMRKSGIKPDSISFISILYACSHSGLLDEAWRFFDS-MRNDYSIVPKLEHYACMVDL  570

Query  356  YCKFGRIHQGKTIFDENP-DKDLICWSSMING  448
              + G + +     ++ P + D   W S++ G
Sbjct  571  LARTGNLTKAYKFINKMPIEPDATIWGSLLCG  602


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 58/125 (46%), Gaps = 1/125 (1%)
 Frame = +2

Query  227  AFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDEN  406
             + S+L+ C+ + +   G+ +H+ +   G   +  L + L+ M+ K G + + + +FD+ 
Sbjct  23   GYCSVLELCAGLKSLQDGKRVHSVICNNGAEVDGPLGAKLVFMFVKCGDLREARRVFDKL  82

Query  407  PDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGW  586
             +  +  W+ MIN Y    +  E +  F  M   GIQ N   F  +L   S  G   EG 
Sbjct  83   SNGKVFLWNLMINEYAKVRNFREGIHLFRKMQELGIQANSYTFSCILKCFSSLGYVREG-  141

Query  587  NWFHA  601
             W H 
Sbjct  142  EWVHG  146



>ref|XP_006436291.1| hypothetical protein CICLE_v10033724mg, partial [Citrus clementina]
 gb|ESR49531.1| hypothetical protein CICLE_v10033724mg, partial [Citrus clementina]
Length=580

 Score =   289 bits (739),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 136/329 (41%), Positives = 210/329 (64%), Gaps = 2/329 (1%)
 Frame = +2

Query  23    IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
             + V  AL+ MYA  GN+E +R++FD +S +D+++W++MIS YAQ+   S  L+ F  M+ 
Sbjct  143   VFVNAALVNMYAKCGNVEDARVVFDKMSVRDLVSWTSMISGYAQNGYNSETLSFFYLMRD  202

Query  203   EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
                KPN  +  S L AC ++ A   GE  H+ V+  G+ S+  +A+ ++DMY K G +  
Sbjct  203   LGVKPNRVSVLSALLACGNLGASRKGEWFHSYVIHTGFESDVLVATAVMDMYAKCGSLDL  262

Query  383   GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
                +FD+   KD++CWS+MI  YG +G G  A++ F +M+  G+ PND+ F  +LSACSH
Sbjct  263   AHKLFDQTEGKDVVCWSAMIASYGFHGQGRTAIDLFDNMVKAGVGPNDITFTCILSACSH  322

Query  563   CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
              GL  EG  +F AM + + I PKL +Y+CMVD+L R G V EA + +  MP+EPD  +WG
Sbjct  323   SGLLEEGKRYFEAM-KGFGIVPKLNNYSCMVDLLGRAGQVSEAEKLIENMPMEPDASLWG  381

Query  743   ALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGK  922
             +LL  CR  +G+ +++E +A ++  LDP N+ Y+V+LSN+YA + RW EVEK+R +M  +
Sbjct  382   SLLGACR-IYGNLDLAEKIADRIFQLDPFNSGYHVLLSNIYAAKSRWKEVEKVRLMMGRR  440

Query  923   KRKKGMGYSVVEVNNSMHRMEF**RSEQE  1009
                K  G+S++E NN +++     RS  E
Sbjct  441   GATKEQGFSLIEFNNVVYKFGVGDRSHSE  469


 Score =   132 bits (331),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 151/299 (51%), Gaps = 6/299 (2%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            ++  +   Y  F  ++++R++F+ +S      W+ +I  YA       +LA++ +M    
Sbjct  44   ILNQIAIFYVQFKKLDTARLVFEYISNPSSYLWNILIREYATQGNFRQSLALYAKMMQNG  103

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KP++FAF   L++C+ +A   +G+ +H  ++  G   + F+ + L++MY K G +   +
Sbjct  104  FKPDKFAFPFALKSCAGLANLQIGKLVHQHLVCCGCDYDVFVNAALVNMYAKCGNVEDAR  163

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD+   +DL+ W+SMI+GY  NG+ +E L  F  M   G++PN V  +S L AC + G
Sbjct  164  VVFDKMSVRDLVSWTSMISGYAQNGYNSETLSFFYLMRDLGVKPNRVSVLSALLACGNLG  223

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
               +G  WFH+          +     ++DM ++ G+++ A +  ++     D   W A+
Sbjct  224  ASRKG-EWFHSYVIHTGFESDVLVATAVMDMYAKCGSLDLAHKLFDQTE-GKDVVCWSAM  281

Query  749  LAGCRKTHGSSEISELVAKQLI--SLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDG  919
            +A     HG    +  +   ++   + P + ++  ILS   +  G  +E ++  + M G
Sbjct  282  IAS-YGFHGQGRTAIDLFDNMVKAGVGPNDITFTCILSAC-SHSGLLEEGKRYFEAMKG  338


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 75/155 (48%), Gaps = 1/155 (1%)
 Frame = +2

Query  5    SGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAV  184
            +GF   + V TA++ MYA  G+++ +  LFD    KD++ WSAMI++Y    Q   A+ +
Sbjct  238  TGFESDVLVATAVMDMYAKCGSLDLAHKLFDQTEGKDVVCWSAMIASYGFHGQGRTAIDL  297

Query  185  FRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK  364
            F  M      PN+  F  +L ACS     + G+     +   G        S ++D+  +
Sbjct  298  FDNMVKAGVGPNDITFTCILSACSHSGLLEEGKRYFEAMKGFGIVPKLNNYSCMVDLLGR  357

Query  365  FGRIHQGKTIFDENP-DKDLICWSSMINGYGMNGH  466
             G++ + + + +  P + D   W S++    + G+
Sbjct  358  AGQVSEAEKLIENMPMEPDASLWGSLLGACRIYGN  392



>ref|XP_010943831.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At4g21065-like [Elaeis guineensis]
Length=803

 Score =   294 bits (752),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 133/328 (41%), Positives = 206/328 (63%), Gaps = 1/328 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G    + V  AL+ MYA   +++ +R +FD +S++D+++W+ MIS Y +   P  +L 
Sbjct  188  KAGLHSDLFVSAALVDMYARCAHVDDARKVFDKMSKRDMVSWTVMISGYTECGNPEESLV  247

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F +M  E   P++    +++ AC+ + A    + +H  + +  ++ +  L + +IDMY 
Sbjct  248  LFDKMMEEGIVPDKVTMVTVVFACAKLGAMHKAKMVHDYISRRNFSFDVILGTAMIDMYA  307

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +   + IFD   +K++I WSSMI+ YG++GHG  ALE F  ML  GI PN + F+S
Sbjct  308  KCGSVDAARDIFDRMKEKNVITWSSMISAYGIHGHGRTALELFPQMLESGILPNRITFVS  367

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +LSACSH GL  EG  +FH+M+  Y I P + HY CMVD+L R G ++EALE  N+M +E
Sbjct  368  ILSACSHAGLVNEGRQFFHSMKRDYSIEPDVKHYTCMVDLLGRAGKLDEALELSNRMKLE  427

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
             D+  WGALL  CR  HG+  ++E  A  L+ L P N+ YYV+LSN+YA+ GRW++V K+
Sbjct  428  KDEGFWGALLGACR-IHGNVGLAEKAATSLLELGPQNSGYYVLLSNIYANAGRWEDVAKV  486

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMHRME  985
            R LM  ++ KK  G + +E+NN  H+  
Sbjct  487  RDLMSSRRLKKTPGGTWIEINNKTHQFR  514


 Score =   117 bits (293),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 141/286 (49%), Gaps = 5/286 (2%)
 Frame = +2

Query  5    SGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAV  184
            +  ++ + V   L+ +YA    ++ +  LF  + ++D ++WS M+   A+     N+L +
Sbjct  88   TSMIENLGVANKLVYIYAEHRALDDAHALFCRMKERDNVSWSVMVGGLAKIGDYENSLRI  147

Query  185  FRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK  364
            FR       + + +     L+ C    +  +G  IH  V K G  S+ F+++ L+DMY +
Sbjct  148  FREYIRSGSRIDNYTLPFALRVCRDTMSVQLGTEIHQLVYKAGLHSDLFVSAALVDMYAR  207

Query  365  FGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISV  544
               +   + +FD+   +D++ W+ MI+GY   G+  E+L  F  M+  GI P+ V  ++V
Sbjct  208  CAHVDDARKVFDKMSKRDMVSWTVMISGYTECGNPEESLVLFDKMMEEGIVPDKVTMVTV  267

Query  545  LSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEP  724
            + AC+  G  ++     H    + + +  +     M+DM ++ G+V+ A +  ++M  E 
Sbjct  268  VFACAKLGAMHKA-KMVHDYISRRNFSFDVILGTAMIDMYAKCGSVDAARDIFDRMK-EK  325

Query  725  DKRIWGALLAGCRKTHGSSEIS-ELVAKQLIS-LDPTNASYYVILS  856
            +   W ++++     HG    + EL  + L S + P   ++  ILS
Sbjct  326  NVITWSSMISA-YGIHGHGRTALELFPQMLESGILPNRITFVSILS  370



>ref|XP_003629790.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AET04266.1| PPR containing plant protein [Medicago truncatula]
Length=908

 Score =   296 bits (757),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 139/320 (43%), Positives = 211/320 (66%), Gaps = 2/320 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G    +PV  AL+ MYA  G++E +R++F  +  KDI++W+ MI  Y+Q+  P+ AL 
Sbjct  425  KNGMGSNLPVTNALINMYAKCGSVEEARLVFSKIPVKDIVSWNTMIGGYSQNLLPNEALE  484

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  MQ +  KP++     +L AC+ +AA D G  IH  +++ GY S+  +A  L+DMY 
Sbjct  485  LFLDMQ-KQFKPDDITMACVLPACAGLAALDKGREIHGHILRRGYFSDLHVACALVDMYA  543

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +   + +FD  P KDLI W+ MI GYGM+G GNEA+  F +M   GI+P++  F +
Sbjct  544  KCGLLVLAQLLFDMIPKKDLISWTVMIAGYGMHGFGNEAISTFNEMRIAGIEPDESSFSA  603

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L+ACSH GL  EGW +F++M  +  + PKL HYAC+VD+L+R GN+ +A +F+  MPI+
Sbjct  604  ILNACSHSGLLNEGWKFFNSMRNECGVEPKLEHYACVVDLLARMGNLSKAYKFIESMPIK  663

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD  IWG LL+GCR  H   +++E VA+ +  L+P N  YYV+L+N+YA+  +W+EV+KL
Sbjct  664  PDTTIWGVLLSGCR-IHHDVKLAEKVAEHIFELEPDNTRYYVVLANVYAEAEKWEEVKKL  722

Query  902  RQLMDGKKRKKGMGYSVVEV  961
            R+ M  +  K+  G S +EV
Sbjct  723  RKRMQKRGFKQNPGCSWIEV  742


 Score =   136 bits (342),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 88/294 (30%), Positives = 153/294 (52%), Gaps = 20/294 (7%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+ F + +     LL MY+  GN+  +  +F  +    I++W+++I+AY +    S+A+ 
Sbjct  324  KACFSEEVVFSNTLLDMYSKCGNLNGATEVFVKMGDTTIVSWTSIIAAYVREGLYSDAIG  383

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  MQ +  +P+ +   S++ AC+  ++ D G  +H+ V+K G  SN  + + LI+MY 
Sbjct  384  LFDEMQSKGVRPDIYTVTSIVHACACSSSLDKGRDVHSYVIKNGMGSNLPVTNALINMYA  443

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G + + + +F + P KD++ W++MI GY  N   NEALE FLDM     +P+D+    
Sbjct  444  KCGSVEEARLVFSKIPVKDIVSWNTMIGGYSQNLLPNEALELFLDMQKQ-FKPDDITMAC  502

Query  542  VLSACSHC-----GLEYEGWNWFHAMEEKY--DITPKLAHYAC-MVDMLSRQGNVEEALE  697
            VL AC+       G E  G    H +   Y  D+     H AC +VDM ++ G +  A  
Sbjct  503  VLPACAGLAALDKGREIHG----HILRRGYFSDL-----HVACALVDMYAKCGLLVLAQL  553

Query  698  FVNKMPIEPDKRIWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVILS  856
              + +P + D   W  ++AG      G+  IS     ++  ++P  +S+  IL+
Sbjct  554  LFDMIP-KKDLISWTVMIAGYGMHGFGNEAISTFNEMRIAGIEPDESSFSAILN  606


 Score =   118 bits (296),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/224 (30%), Positives = 116/224 (52%), Gaps = 1/224 (0%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            L+ MY N G++   R +FD +    +  W+ ++S YA+      ++++F++MQ      N
Sbjct  135  LVFMYVNCGDLVQGRKIFDKIMNDKVFLWNLLMSEYAKIGNFRESVSLFKKMQKLGVVGN  194

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
             + F  +L+  +++      + +H  V+KLG+ SN  + + LI  Y KFG +     +FD
Sbjct  195  CYTFTCVLKCFAALGKVKECKRVHGYVLKLGFGSNTAVVNSLIAAYFKFGGVESAHNLFD  254

Query  401  ENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYE  580
            E  + D++ W+SMING  +NG     LE F+ ML  G++ +    +SVL AC++ G    
Sbjct  255  ELSEPDVVSWNSMINGCVVNGFSGNGLEIFIQMLILGVEVDLTTLVSVLVACANIGNLSL  314

Query  581  GWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
            G    H    K   + ++     ++DM S+ GN+  A E   KM
Sbjct  315  G-RALHGFGVKACFSEEVVFSNTLLDMYSKCGNLNGATEVFVKM  357


 Score =   118 bits (296),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 148/297 (50%), Gaps = 6/297 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     VV +L+  Y  FG +ES+  LFD LS+ D+++W++MI+    +    N L 
Sbjct  223  KLGFGSNTAVVNSLIAAYFKFGGVESAHNLFDELSEPDVVSWNSMINGCVVNGFSGNGLE  282

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F +M +   + +     S+L AC+++    +G  +H   +K  ++     ++ L+DMY 
Sbjct  283  IFIQMLILGVEVDLTTLVSVLVACANIGNLSLGRALHGFGVKACFSEEVVFSNTLLDMYS  342

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G ++    +F +  D  ++ W+S+I  Y   G  ++A+  F +M S G++P+     S
Sbjct  343  KCGNLNGATEVFVKMGDTTIVSWTSIIAAYVREGLYSDAIGLFDEMQSKGVRPDIYTVTS  402

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            ++ AC+ C    +     H+   K  +   L     +++M ++ G+VEEA    +K+P++
Sbjct  403  IVHACA-CSSSLDKGRDVHSYVIKNGMGSNLPVTNALINMYAKCGSVEEARLVFSKIPVK  461

Query  722  PDKRIWGALLAGCRKTHGSSEISEL---VAKQLISLDPTNASYYVILSNLYA-DQGR  880
             D   W  ++ G  +    +E  EL   + KQ    D T A      + L A D+GR
Sbjct  462  -DIVSWNTMIGGYSQNLLPNEALELFLDMQKQFKPDDITMACVLPACAGLAALDKGR  517


 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 100/229 (44%), Gaps = 4/229 (2%)
 Frame = +2

Query  128  SAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMK  307
            +A I+ + +     NA+ +  + +      N +   S+LQ C+   + + G+ +H+ ++ 
Sbjct  65   NAKINKFCEMGDLRNAIELLTKSKSYELGLNSYC--SVLQLCAEKKSLEDGKRVHSVIIS  122

Query  308  LGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALEC  487
             G + +  L + L+ MY   G + QG+ IFD+  +  +  W+ +++ Y   G+  E++  
Sbjct  123  NGISVDEALGAKLVFMYVNCGDLVQGRKIFDKIMNDKVFLWNLLMSEYAKIGNFRESVSL  182

Query  488  FLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLS  667
            F  M   G+  N   F  VL   +  G + +     H    K       A    ++    
Sbjct  183  FKKMQKLGVVGNCYTFTCVLKCFAALG-KVKECKRVHGYVLKLGFGSNTAVVNSLIAAYF  241

Query  668  RQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLI  814
            + G VE A    +++  EPD   W +++ GC     S    E+  + LI
Sbjct  242  KFGGVESAHNLFDELS-EPDVVSWNSMINGCVVNGFSGNGLEIFIQMLI  289



>ref|XP_006485864.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial-like [Citrus sinensis]
Length=583

 Score =   288 bits (738),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 136/329 (41%), Positives = 210/329 (64%), Gaps = 2/329 (1%)
 Frame = +2

Query  23    IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
             + V  AL+ MYA  GN+E +R++FD +S +D+++W++MIS YAQ+   S  L+ F  M+ 
Sbjct  146   VFVNAALVNMYAKCGNVEDARVVFDKMSVRDLVSWTSMISGYAQNGYNSETLSFFYLMRD  205

Query  203   EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
                KPN  +  S L AC ++ A   GE  H+ V+  G+ S+  +A+ ++DMY K G +  
Sbjct  206   LGVKPNRVSVLSALLACGNLGASRKGEWFHSYVIHTGFESDVLVATAVMDMYAKCGSLDL  265

Query  383   GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
                +FD+   KD++CWS+MI  YG +G G  A++ F +M+  G+ PND+ F  +LSACSH
Sbjct  266   AHKLFDQTEGKDVVCWSAMIASYGFHGQGRTAIDLFDNMVKAGVGPNDITFTCILSACSH  325

Query  563   CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
              GL  EG  +F AM + + I PKL +Y+CMVD+L R G V EA + +  MP+EPD  +WG
Sbjct  326   SGLLEEGKRYFEAM-KGFGIVPKLNNYSCMVDLLGRAGQVSEAEKLIENMPMEPDASLWG  384

Query  743   ALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGK  922
             +LL  CR  +G+ +++E +A ++  LDP N+ Y+V+LSN+YA + RW EVEK+R +M  +
Sbjct  385   SLLGACR-IYGNLDLAEKIADRIFQLDPFNSGYHVLLSNIYAAKSRWKEVEKVRLMMGRR  443

Query  923   KRKKGMGYSVVEVNNSMHRMEF**RSEQE  1009
                K  G+S++E NN +++     RS  E
Sbjct  444   GATKEQGFSLIEFNNVVYKFGVGDRSHSE  472


 Score =   132 bits (331),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 151/299 (51%), Gaps = 6/299 (2%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            ++  +   Y  F  ++++R++F+ +S      W+ +I  YA       +LA++ +M    
Sbjct  47   ILNQIAIFYVQFKKLDTARLVFEYISNPSSYLWNILIREYATQGNFRQSLALYAKMMQNG  106

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KP++FAF   L++C+ +A   +G+ +H  ++  G   + F+ + L++MY K G +   +
Sbjct  107  FKPDKFAFPFALKSCAGLANLQIGKLVHQHLVCCGCDYDVFVNAALVNMYAKCGNVEDAR  166

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD+   +DL+ W+SMI+GY  NG+ +E L  F  M   G++PN V  +S L AC + G
Sbjct  167  VVFDKMSVRDLVSWTSMISGYAQNGYNSETLSFFYLMRDLGVKPNRVSVLSALLACGNLG  226

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
               +G  WFH+          +     ++DM ++ G+++ A +  ++     D   W A+
Sbjct  227  ASRKG-EWFHSYVIHTGFESDVLVATAVMDMYAKCGSLDLAHKLFDQTE-GKDVVCWSAM  284

Query  749  LAGCRKTHGSSEISELVAKQLI--SLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDG  919
            +A     HG    +  +   ++   + P + ++  ILS   +  G  +E ++  + M G
Sbjct  285  IAS-YGFHGQGRTAIDLFDNMVKAGVGPNDITFTCILSAC-SHSGLLEEGKRYFEAMKG  341


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 75/155 (48%), Gaps = 1/155 (1%)
 Frame = +2

Query  5    SGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAV  184
            +GF   + V TA++ MYA  G+++ +  LFD    KD++ WSAMI++Y    Q   A+ +
Sbjct  241  TGFESDVLVATAVMDMYAKCGSLDLAHKLFDQTEGKDVVCWSAMIASYGFHGQGRTAIDL  300

Query  185  FRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK  364
            F  M      PN+  F  +L ACS     + G+     +   G        S ++D+  +
Sbjct  301  FDNMVKAGVGPNDITFTCILSACSHSGLLEEGKRYFEAMKGFGIVPKLNNYSCMVDLLGR  360

Query  365  FGRIHQGKTIFDENP-DKDLICWSSMINGYGMNGH  466
             G++ + + + +  P + D   W S++    + G+
Sbjct  361  AGQVSEAEKLIENMPMEPDASLWGSLLGACRIYGN  395



>ref|XP_009419424.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Musa acuminata subsp. malaccensis]
Length=629

 Score =   289 bits (740),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/327 (41%), Positives = 202/327 (62%), Gaps = 1/327 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G    + V  +L+ MYA  G+++ +R +FD + ++ ++ W+ M+S YA+   P  +LA
Sbjct  183  KAGLQSDLSVSASLVDMYARCGDVDDARKVFDRMPKRHMVTWTVMMSGYAECGNPEESLA  242

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F RM+ E   P++ A  ++  AC+ +      + IH  +    ++ N  L + LIDMY 
Sbjct  243  LFDRMRGEGVVPDKIATVTVAFACAKLGVMHKAKMIHDYISSWNFSLNVILGTALIDMYA  302

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G     + IFD   D+++I W+SMI+ YG++G G EAL+ F  ML  GI+PN + F+S
Sbjct  303  KCGSADDARVIFDRMKDRNVISWNSMISAYGIHGRGREALDLFPLMLQSGIRPNRITFVS  362

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +LSACSH GL  EG  +FH ME  Y I P + HY CMVD+L R G + EALE   KM +E
Sbjct  363  ILSACSHAGLVDEGRQFFHLMERDYSIEPDVKHYTCMVDLLGRAGKLYEALELSEKMTLE  422

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
             D+  WGALL  CR  HG + ++E  AK L+ L P N+ YYV+LSN+YA+ GRW++V ++
Sbjct  423  KDEGFWGALLGACR-IHGDAVLAEKAAKSLLELRPRNSGYYVLLSNIYANAGRWEDVAEV  481

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMHRM  982
            R LM  +  +K  G++ +E+N   HR 
Sbjct  482  RDLMASRSLRKKPGWTWIEINKETHRF  508


 Score =   109 bits (272),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/292 (23%), Positives = 138/292 (47%), Gaps = 8/292 (3%)
 Frame = +2

Query  50   MYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFA  229
            +YA  G +  +  LF  + ++D ++WS ++  + +    +N L  FR       + + F 
Sbjct  98   IYAQHGALADAYALFSRMKERDNVSWSVIVGGFVKVGYYANCLQTFRDFVRSGLRIDNFT  157

Query  230  FHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENP  409
               +L+AC    +  +G  IH  V K G  S+  +++ L+DMY + G +   + +FD  P
Sbjct  158  LPFVLRACRDTVSLRLGVEIHHLVFKAGLQSDLSVSASLVDMYARCGDVDDARKVFDRMP  217

Query  410  DKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWN  589
             + ++ W+ M++GY   G+  E+L  F  M   G+ P+ +  ++V  AC+  G+ ++   
Sbjct  218  KRHMVTWTVMMSGYAECGNPEESLALFDRMRGEGVVPDKIATVTVAFACAKLGVMHKA-K  276

Query  590  WFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI--WGALLAGCR  763
              H     ++ +  +     ++DM ++ G+ ++A    ++M    D+ +  W ++++   
Sbjct  277  MIHDYISSWNFSLNVILGTALIDMYAKCGSADDARVIFDRM---KDRNVISWNSMISAYG  333

Query  764  KTHGSSEISELVAKQLIS-LDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
                  E  +L    L S + P   ++  ILS   +  G  DE  +   LM+
Sbjct  334  IHGRGREALDLFPLMLQSGIRPNRITFVSILSAC-SHAGLVDEGRQFFHLME  384



>ref|XP_002869909.1| binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46168.1| binding protein [Arabidopsis lyrata subsp. lyrata]
Length=595

 Score =   288 bits (738),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/326 (40%), Positives = 218/326 (67%), Gaps = 2/326 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            +SGF   I V  +LL +YAN G++ S+  +FD + +KD++AW+++I+ +A++ +P  ALA
Sbjct  149  RSGFGSLIYVQNSLLHLYANCGDVASAYKVFDKMPEKDLVAWNSVINGFAENGKPEEALA  208

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++  M L+  KP+ F   SLL AC+ + A  +G+  H  ++K+G T N   ++ L+D+Y 
Sbjct  209  LYTEMDLKGIKPDGFTIVSLLSACAKIGALTLGKRFHVYMIKVGLTRNLHSSNVLLDLYA  268

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLS-HGIQPNDVVFI  538
            + GR+ + KT+FDE  DK+ + W+S+I G  +NG G EA+E F +M S  G+ P ++ F+
Sbjct  269  RCGRVEEAKTLFDEMVDKNSVSWTSLIVGLAVNGLGKEAIELFKNMESKEGLLPCEITFV  328

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             +L ACSHCG+  EG+ +F  M E+Y I P++ H+ CMVD+L+R G V++A E++ KMP+
Sbjct  329  GILYACSHCGMVKEGFEYFRRMSEEYKIEPRIEHFGCMVDLLARAGQVKKAYEYILKMPM  388

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
            +P+  IW  LL  C   HG S+++EL   +++ L+P ++  YV+LSN+YA + RW +V+K
Sbjct  389  QPNVVIWRTLLGAC-TVHGDSDLAELARMKILQLEPNHSGDYVLLSNMYASEQRWSDVQK  447

Query  899  LRQLMDGKKRKKGMGYSVVEVNNSMH  976
            +R+ M     +K  G+S+VEV N +H
Sbjct  448  IRKQMLRDGVRKVPGHSLVEVGNRVH  473


 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 119/216 (55%), Gaps = 3/216 (1%)
 Frame = +2

Query  113  DIIAWSAMISAYAQSDQPSNALAVFRRMQLE-HGKPNEFAFHSLLQACSSMAAQDVGETI  289
            ++  W+ +I  YA+     +A++++R M+     +P+   +  LL+A   MA   +GETI
Sbjct  84   NVFIWNTLIRGYAEIGNSVSAVSLYREMRASGFVEPDTHTYPFLLKAVGKMADVRLGETI  143

Query  290  HTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHG  469
            H+ V++ G+ S  ++ + L+ +Y   G +     +FD+ P+KDL+ W+S+ING+  NG  
Sbjct  144  HSVVIRSGFGSLIYVQNSLLHLYANCGDVASAYKVFDKMPEKDLVAWNSVINGFAENGKP  203

Query  470  NEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYAC  649
             EAL  + +M   GI+P+    +S+LSAC+  G    G   FH    K  +T  L     
Sbjct  204  EEALALYTEMDLKGIKPDGFTIVSLLSACAKIGALTLG-KRFHVYMIKVGLTRNLHSSNV  262

Query  650  MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            ++D+ +R G VEEA    ++M ++ +   W +L+ G
Sbjct  263  LLDLYARCGRVEEAKTLFDEM-VDKNSVSWTSLIVG  297



>ref|XP_008450012.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Cucumis melo]
 ref|XP_008450013.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Cucumis melo]
 ref|XP_008450014.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Cucumis melo]
 ref|XP_008450015.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Cucumis melo]
Length=659

 Score =   290 bits (742),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/326 (43%), Positives = 201/326 (62%), Gaps = 2/326 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   I V   L+  YA  G    S+ +FD + +KD I+W++MI+ YAQS     AL 
Sbjct  213  KKGFDGSIGVGNTLMDAYAKCGQPLVSKKVFDWMEEKDDISWNSMIAVYAQSGLSGEALE  272

Query  182  VFRRMQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
            VF  M    G + N     ++L AC+   A   G+ IH QV+K+    N  + + +IDMY
Sbjct  273  VFHGMVRHVGVRYNAVTLSAVLLACAHAGALRAGKCIHDQVIKMDLEDNVCVGTSIIDMY  332

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
            CK GR+   K  FD   +K++  W++M+ GYGM+G   EAL+ F  M+  G++PN + F+
Sbjct  333  CKCGRVEMAKKTFDRMKEKNVKSWTAMVAGYGMHGRAKEALDIFYKMVRAGVKPNYITFV  392

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            SVL+ACSH GL  EGW+WF+AM+ KYDI P + HY CMVD+  R G + +A   +  M +
Sbjct  393  SVLAACSHAGLVEEGWHWFNAMKHKYDIEPGIEHYGCMVDLFGRAGCLNKAYNLIKGMKM  452

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
            +PD  +WG+LL  CR  H + ++ E+ A++L  LDP N  YYV+LSNLYAD GRW +VE+
Sbjct  453  KPDFVVWGSLLGACR-IHKNVDLGEVAAQKLFELDPDNCGYYVLLSNLYADAGRWADVER  511

Query  899  LRQLMDGKKRKKGMGYSVVEVNNSMH  976
            +R LM  ++  K  G+S+VE+   +H
Sbjct  512  MRMLMKSRQLVKPPGFSLVELKGRVH  537


 Score =   136 bits (342),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 141/259 (54%), Gaps = 11/259 (4%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF   + V +AL+ MY+  G ++ +R LFD +  +++++W++MI+ Y Q++Q  NAL +F
Sbjct  106  GFDTDLFVSSALIDMYSKCGQLQDARALFDEIPLRNVVSWTSMITGYVQNEQADNALLLF  165

Query  188  RRM-----QLEHGKP---NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASG  343
            + +     ++E G     +     S+L ACS ++ + + E +H  V+K G+  +  + + 
Sbjct  166  KDLLEEETEVEDGNNVPLDSVVMVSVLSACSRVSGKGITEGVHGFVVKKGFDGSIGVGNT  225

Query  344  LIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSH-GIQP  520
            L+D Y K G+    K +FD   +KD I W+SMI  Y  +G   EALE F  M+ H G++ 
Sbjct  226  LMDAYAKCGQPLVSKKVFDWMEEKDDISWNSMIAVYAQSGLSGEALEVFHGMVRHVGVRY  285

Query  521  NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEF  700
            N V   +VL AC+H G    G    H    K D+   +     ++DM  + G VE A + 
Sbjct  286  NAVTLSAVLLACAHAGALRAG-KCIHDQVIKMDLEDNVCVGTSIIDMYCKCGRVEMAKKT  344

Query  701  VNKMPIEPDKRIWGALLAG  757
             ++M  E + + W A++AG
Sbjct  345  FDRMK-EKNVKSWTAMVAG  362


 Score =   100 bits (248),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 83/336 (25%), Positives = 140/336 (42%), Gaps = 57/336 (17%)
 Frame = +2

Query  113  DIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIH  292
            ++ +W+++I+  A+      AL  F  ++     P   +F   +++CS++     G   H
Sbjct  40   NVHSWNSVIADLARGGDSVEALRAFSSLRKLGLTPTRSSFPCTIKSCSALCDLVSGRMSH  99

Query  293  TQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGN  472
             Q    G+ ++ F++S LIDMY K G++   + +FDE P ++++ W+SMI GY  N   +
Sbjct  100  QQAFVFGFDTDLFVSSALIDMYSKCGQLQDARALFDEIPLRNVVSWTSMITGYVQNEQAD  159

Query  473  EALECFLDMLSHGIQPND--------VVFISVLSACSH----------------------  562
             AL  F D+L    +  D        VV +SVLSACS                       
Sbjct  160  NALLLFKDLLEEETEVEDGNNVPLDSVVMVSVLSACSRVSGKGITEGVHGFVVKKGFDGS  219

Query  563  -------------CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALE--  697
                         CG        F  MEEK DI+     +  M+ + ++ G   EALE  
Sbjct  220  IGVGNTLMDAYAKCGQPLVSKKVFDWMEEKDDIS-----WNSMIAVYAQSGLSGEALEVF  274

Query  698  --FVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLD-PTNASYYVILSNLYA  868
               V  + +  +     A+L  C    G+    + +  Q+I +D   N      + ++Y 
Sbjct  275  HGMVRHVGVRYNAVTLSAVLLACAHA-GALRAGKCIHDQVIKMDLEDNVCVGTSIIDMYC  333

Query  869  DQGRWDEVEKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
              GR   VE  ++  D  K K    ++ +     MH
Sbjct  334  KCGR---VEMAKKTFDRMKEKNVKSWTAMVAGYGMH  366



>ref|XP_010439529.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Camelina sativa]
Length=598

 Score =   288 bits (737),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/326 (40%), Positives = 215/326 (66%), Gaps = 2/326 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            +SGF   I    +LL +YAN G++  +  +FD + +KD++AW+++I+ +A++ +P+ ALA
Sbjct  152  RSGFGSLIFAQNSLLHLYANCGDLSGAYKVFDKMPEKDLVAWNSVINGFAENGKPNEALA  211

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++  M  +  KP+ F   SLL AC+ + A  +G+ IH  ++K+G T N    + L+D+Y 
Sbjct  212  LYTEMNSKGIKPDGFTIVSLLSACAKIGALTLGKRIHVYMIKMGLTRNLHSRNVLLDLYA  271

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLS-HGIQPNDVVFI  538
            + GR+ + K +FDE  DK+ + W+S+I G  +NG G EA+E F DM S  G+ P ++ F+
Sbjct  272  RCGRVKEAKRLFDEMVDKNSVSWTSLIVGLAVNGFGKEAIELFRDMESKEGLVPCEITFV  331

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             +L ACSHCG+  EG+ +F  M E+Y I P++ H+ CMVD+L+R G V+EA E++ KMP+
Sbjct  332  GILYACSHCGMVKEGFEYFRRMREEYKIEPRIEHFGCMVDLLARAGQVKEAYEYIMKMPL  391

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
            +P+  IW  LL GC   HG +E++E    Q++ L+P ++  YV+LSN+YA + RW +V+K
Sbjct  392  QPNVVIWRTLLGGC-TVHGDAELAEYARLQILQLEPNHSGDYVLLSNMYASEQRWSDVQK  450

Query  899  LRQLMDGKKRKKGMGYSVVEVNNSMH  976
            +R+ M     +K  G+S+VEV N +H
Sbjct  451  IRKQMLRDGVRKVPGHSLVEVGNRVH  476


 Score =   122 bits (307),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/219 (32%), Positives = 121/219 (55%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  DIIAWSAMISAYAQSDQ---PSNALAVFRRMQLEH-GKPNEFAFHSLLQACSSMAAQDVG  280
            +I  W+ +I  YA+        +A++++R M++    +P+   +  LL+A + MA   +G
Sbjct  84   NIFVWNTLIRGYAECSSNYASVSAVSLYREMKVSGLVEPDTHTYPFLLKAVAKMADVRLG  143

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            ETIH+ V++ G+ S  F  + L+ +Y   G +     +FD+ P+KDL+ W+S+ING+  N
Sbjct  144  ETIHSVVIRSGFGSLIFAQNSLLHLYANCGDLSGAYKVFDKMPEKDLVAWNSVINGFAEN  203

Query  461  GHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAH  640
            G  NEAL  + +M S GI+P+    +S+LSAC+  G    G    H    K  +T  L  
Sbjct  204  GKPNEALALYTEMNSKGIKPDGFTIVSLLSACAKIGALTLG-KRIHVYMIKMGLTRNLHS  262

Query  641  YACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
               ++D+ +R G V+EA    ++M ++ +   W +L+ G
Sbjct  263  RNVLLDLYARCGRVKEAKRLFDEM-VDKNSVSWTSLIVG  300



>ref|XP_010248645.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33760-like 
[Nelumbo nucifera]
Length=621

 Score =   288 bits (738),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/318 (41%), Positives = 207/318 (65%), Gaps = 1/318 (0%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V  AL+ MY+  G++E++R++FD ++ +D+++W++MIS YA +      L  F  M+   
Sbjct  185  VDAALVDMYSKCGDVEAARLVFDKMAVRDLVSWTSMISGYAHNGYNGETLQFFDLMRYSD  244

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KPN  +  S+L AC+++ A   GE  H+ V++ G+ S+  +A+ ++DMY K G +   +
Sbjct  245  VKPNRVSLLSVLLACANLGALRKGEWFHSYVIQTGFGSDILVATAVMDMYAKCGSLELSR  304

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD+   KD++CWS+MI  +GM+GHG +A++ F  M+   ++PN V F  VLSACSH  
Sbjct  305  HLFDQTLGKDVVCWSAMIASHGMHGHGRKAIDLFGQMVEQDVKPNHVTFTCVLSACSHSR  364

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  EG  +F +M  ++ I PKL HYAC+VD+L R G + EA   +  MPIEPD  IWG+L
Sbjct  365  LLEEGQRYFKSMSNEFGIVPKLNHYACLVDLLGRAGKLLEAETLIESMPIEPDTSIWGSL  424

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L  CR  +G+ ++ E VA ++  LDPT A Y+V+LSN+YA + RW +VE++R+LM G+  
Sbjct  425  LGACR-IYGNLDLGERVADKIFHLDPTQAGYHVLLSNIYAAKSRWVDVERVRELMAGRGA  483

Query  929  KKGMGYSVVEVNNSMHRM  982
             K  G+S++E NN + + 
Sbjct  484  NKIQGFSLIEFNNQVFKF  501


 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/271 (28%), Positives = 142/271 (52%), Gaps = 5/271 (2%)
 Frame = +2

Query  50   MYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFA  229
            +Y  F  I+S+ +LF  +       W+ ++  YA   +   AL ++ +M     KP++FA
Sbjct  91   LYVTFHCIDSANLLFRKILDPCTYLWNILLRGYATEGRFLQALKLYNKMIGARVKPDKFA  150

Query  230  FHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENP  409
            F   L++C+ ++A   G+ IH  ++  G +++ F+ + L+DMY K G +   + +FD+  
Sbjct  151  FPFALKSCAGLSALQTGKQIHQHLICCGCSNDLFVDAALVDMYSKCGDVEAARLVFDKMA  210

Query  410  DKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWN  589
             +DL+ W+SMI+GY  NG+  E L+ F  M    ++PN V  +SVL AC++ G   +G  
Sbjct  211  VRDLVSWTSMISGYAHNGYNGETLQFFDLMRYSDVKPNRVSLLSVLLACANLGALRKG-E  269

Query  590  WFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKT  769
            WFH+   +      +     ++DM ++ G++E +    ++  +  D   W A++A     
Sbjct  270  WFHSYVIQTGFGSDILVATAVMDMYAKCGSLELSRHLFDQT-LGKDVVCWSAMIAS-HGM  327

Query  770  HGSSEISELVAKQLISLD--PTNASYYVILS  856
            HG    +  +  Q++  D  P + ++  +LS
Sbjct  328  HGHGRKAIDLFGQMVEQDVKPNHVTFTCVLS  358


 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 79/156 (51%), Gaps = 2/156 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++GF   I V TA++ MYA  G++E SR LFD    KD++ WSAMI+++        A+ 
Sbjct  277  QTGFGSDILVATAVMDMYAKCGSLELSRHLFDQTLGKDVVCWSAMIASHGMHGHGRKAID  336

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGET-IHTQVMKLGYTSNAFLASGLIDMY  358
            +F +M  +  KPN   F  +L ACS     + G+    +   + G        + L+D+ 
Sbjct  337  LFGQMVEQDVKPNHVTFTCVLSACSHSRLLEEGQRYFKSMSNEFGIVPKLNHYACLVDLL  396

Query  359  CKFGRIHQGKTIFDENP-DKDLICWSSMINGYGMNG  463
             + G++ + +T+ +  P + D   W S++    + G
Sbjct  397  GRAGKLLEAETLIESMPIEPDTSIWGSLLGACRIYG  432



>gb|KCW54802.1| hypothetical protein EUGRSUZ_I00741 [Eucalyptus grandis]
Length=495

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/320 (42%), Positives = 197/320 (62%), Gaps = 1/320 (0%)
 Frame = +2

Query  17   KCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM  196
            K +  +TA++  YA  G ++ +R++FD + ++D++ W+ MI  YAQ  +P  AL +FR+M
Sbjct  70   KSLVSLTAMITCYAKHGELKEARVVFDEILERDVVCWNVMIDGYAQHGKPDEALVLFRQM  129

Query  197  QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
                 +PNE    S+L AC  + A +VG  IH+ +   G   NA + + L+DMY K G +
Sbjct  130  LSAGVRPNEVTVLSVLSACGQLGALEVGRWIHSHIQNNGIQMNAHVGTALVDMYSKCGSL  189

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
                 +F+    KD++ W+SMI GY ++G    AL  F  M   G+ PND+ FI++L+AC
Sbjct  190  EDALLVFESMNHKDVVAWNSMILGYAIHGSSQCALGTFNTMCRSGVNPNDITFIAILTAC  249

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
            SH GL  EGW++F++M++KY I PK+ HY CMV++LSR GN+EEA + V +M IEPD  I
Sbjct  250  SHTGLIKEGWDFFNSMKDKYGIQPKIEHYGCMVNLLSRAGNLEEAYQLVKEMEIEPDAVI  309

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            WG LL  CR  H  + ++E +A+ L+  D  N   Y +LSN+YA  G W+ V K+R LM 
Sbjct  310  WGTLLGACR-LHAKTALAEKIAEFLVGKDLANCGTYTLLSNIYAASGDWEGVAKVRTLMK  368

Query  917  GKKRKKGMGYSVVEVNNSMH  976
                 K  G S +EVNN +H
Sbjct  369  SSGVVKEKGCSSIEVNNRVH  388


 Score =   113 bits (282),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 120/248 (48%), Gaps = 40/248 (16%)
 Frame = +2

Query  212  KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKT  391
            +PN F F S+L++C      + G+ +H   +KLG+ S+ ++ +GL+D+Y + G I   + 
Sbjct  7    EPNAFTFSSVLKSCP----LESGKALHCLAVKLGFCSDPYVRTGLVDVYARGGEIVSARR  62

Query  392  IFDENPDK-------------------------------DLICWSSMINGYGMNGHGNEA  478
            +FD  P+K                               D++CW+ MI+GY  +G  +EA
Sbjct  63   LFDSMPEKSLVSLTAMITCYAKHGELKEARVVFDEILERDVVCWNVMIDGYAQHGKPDEA  122

Query  479  LECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVD  658
            L  F  MLS G++PN+V  +SVLSAC   G   E   W H+  +   I         +VD
Sbjct  123  LVLFRQMLSAGVRPNEVTVLSVLSACGQLG-ALEVGRWIHSHIQNNGIQMNAHVGTALVD  181

Query  659  MLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLI--SLDPTN  832
            M S+ G++E+AL     M    D   W +++ G    HGSS+ +      +    ++P +
Sbjct  182  MYSKCGSLEDALLVFESMN-HKDVVAWNSMILG-YAIHGSSQCALGTFNTMCRSGVNPND  239

Query  833  ASYYVILS  856
             ++  IL+
Sbjct  240  ITFIAILT  247



>ref|XP_004504288.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like isoform X1 [Cicer arietinum]
 ref|XP_004504289.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like isoform X2 [Cicer arietinum]
Length=879

 Score =   294 bits (752),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/320 (43%), Positives = 208/320 (65%), Gaps = 2/320 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+  +  +PV  AL+ MYA  G++E +R++F  +  KDI++W+ MI  Y+++  P+ AL 
Sbjct  435  KNSMVSNLPVANALMNMYAKCGSMEEARLVFSQIPAKDIVSWNTMIGGYSKNSLPNGALE  494

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M +E  KP++     +L AC+ +AA D G  IH  +++ GY S+  +A  L+DMY 
Sbjct  495  LFSDM-VEQLKPDDITMACVLPACAGLAALDKGREIHGHILRRGYFSDLHVACALVDMYA  553

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +   + +FD  P KDLI W+ MI GYGM+G GNEA+  F  M   GI+P++  F +
Sbjct  554  KCGLLVLAQILFDMIPKKDLISWTVMIAGYGMHGFGNEAISTFNKMRIAGIEPDESSFTA  613

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L+ACSH GL  EGW +F++M  +  I PKL HYACMVD+L R GN+ +A +F+  MPI+
Sbjct  614  ILNACSHSGLLNEGWRFFNSMRNECSIEPKLEHYACMVDLLGRAGNLSKAYKFIESMPIK  673

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            P+  IWGALL+GCR  H   +++E VA  +  L+P N  YYV+L+N+YA+  +W+E +KL
Sbjct  674  PNATIWGALLSGCR-IHHDVKLAEKVADHVFELEPDNTRYYVVLANVYAEAEKWEEAKKL  732

Query  902  RQLMDGKKRKKGMGYSVVEV  961
            R+ M  +  K+  G S +EV
Sbjct  733  RERMQRRGFKQNPGCSWIEV  752


 Score =   130 bits (327),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 82/282 (29%), Positives = 147/282 (52%), Gaps = 20/282 (7%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
             LL MY+  GN+  +  +F  + +  I++W+++I+AY +     +A+ +F  MQ +  +P
Sbjct  346  TLLDMYSKCGNLNGATEVFVKMGETTIVSWTSIIAAYVREGLYDDAIGLFDEMQSKGVRP  405

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            + +   S++ AC+   + D G  +H+ V+K    SN  +A+ L++MY K G + + + +F
Sbjct  406  DIYTVTSIVHACACSNSLDKGRDVHSYVIKNSMVSNLPVANALMNMYAKCGSMEEARLVF  465

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC----  565
             + P KD++ W++MI GY  N   N ALE F DM+   ++P+D+    VL AC+      
Sbjct  466  SQIPAKDIVSWNTMIGGYSKNSLPNGALELFSDMVEQ-LKPDDITMACVLPACAGLAALD  524

Query  566  -GLEYEGWNWFHAMEEKY--DITPKLAHYAC-MVDMLSRQGNVEEALEFVNKMPIEPDKR  733
             G E  G    H +   Y  D+     H AC +VDM ++ G +  A    + +P + D  
Sbjct  525  KGREIHG----HILRRGYFSDL-----HVACALVDMYAKCGLLVLAQILFDMIP-KKDLI  574

Query  734  IWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVILS  856
             W  ++AG      G+  IS     ++  ++P  +S+  IL+
Sbjct  575  SWTVMIAGYGMHGFGNEAISTFNKMRIAGIEPDESSFTAILN  616


 Score =   122 bits (306),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 126/251 (50%), Gaps = 6/251 (2%)
 Frame = +2

Query  17   KCIPVVTAL----LQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAV  184
            K IP+  AL    + MY N G++   R +FD +    +  W+ M+S YA+      +L +
Sbjct  133  KGIPIKGALGAKLVFMYVNCGDLVKGREIFDEILNDKVFLWNLMMSEYAKIGNYRESLGL  192

Query  185  FRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK  364
            F +MQ      + + F  +L+  +++      + +H  V+KLG+ S+  + + LI  Y K
Sbjct  193  FNKMQKLGIAGDSYTFTCVLKCFTALGKVKECKRVHGYVLKLGFGSSTAVVNSLIAAYFK  252

Query  365  FGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISV  544
            FG +     +FDE  D+D++ W+SMING  +NG     LE F+ ML  G+  +    +SV
Sbjct  253  FGGVESAHNLFDELSDRDVVSWNSMINGCVVNGFSRNGLEIFIQMLILGVGVDLTTLVSV  312

Query  545  LSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEP  724
            L AC++ G    G    HA   K   + ++     ++DM S+ GN+  A E   KM  E 
Sbjct  313  LVACANIGNLSLG-RALHAFGVKAPFSGEVVFSNTLLDMYSKCGNLNGATEVFVKMG-ET  370

Query  725  DKRIWGALLAG  757
                W +++A 
Sbjct  371  TIVSWTSIIAA  381


 Score =   115 bits (288),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 151/306 (49%), Gaps = 6/306 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     VV +L+  Y  FG +ES+  LFD LS +D+++W++MI+    +    N L 
Sbjct  233  KLGFGSSTAVVNSLIAAYFKFGGVESAHNLFDELSDRDVVSWNSMINGCVVNGFSRNGLE  292

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F +M +     +     S+L AC+++    +G  +H   +K  ++     ++ L+DMY 
Sbjct  293  IFIQMLILGVGVDLTTLVSVLVACANIGNLSLGRALHAFGVKAPFSGEVVFSNTLLDMYS  352

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G ++    +F +  +  ++ W+S+I  Y   G  ++A+  F +M S G++P+     S
Sbjct  353  KCGNLNGATEVFVKMGETTIVSWTSIIAAYVREGLYDDAIGLFDEMQSKGVRPDIYTVTS  412

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            ++ AC+ C    +     H+   K  +   L     +++M ++ G++EEA    +++P +
Sbjct  413  IVHACA-CSNSLDKGRDVHSYVIKNSMVSNLPVANALMNMYAKCGSMEEARLVFSQIPAK  471

Query  722  PDKRIWGALLAGCRKT---HGSSEISELVAKQLISLDPTNASYYVILSNLYA-DQGRWDE  889
             D   W  ++ G  K    +G+ E+   + +QL   D T A      + L A D+GR   
Sbjct  472  -DIVSWNTMIGGYSKNSLPNGALELFSDMVEQLKPDDITMACVLPACAGLAALDKGREIH  530

Query  890  VEKLRQ  907
               LR+
Sbjct  531  GHILRR  536



>ref|XP_010101198.1| hypothetical protein L484_015002 [Morus notabilis]
 gb|EXB87872.1| hypothetical protein L484_015002 [Morus notabilis]
Length=483

 Score =   284 bits (726),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/318 (42%), Positives = 204/318 (64%), Gaps = 1/318 (0%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V  AL+  YA  G+IES+R++FD +  +D+++W++MIS YA +      L  F  M    
Sbjct  47   VSAALVDTYAKCGDIESARLVFDKMPVRDLVSWTSMISGYAHNGCNGETLVFFDSMCDSG  106

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             +PN     S+L AC ++ A   GE +H+ V++ G+  +  +A+ ++DMY K G +   +
Sbjct  107  IRPNRVGILSVLLACGNLGALRKGEWLHSYVIQTGFEFDVLVATAVMDMYTKCGSLDLAR  166

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD  P KD++CWS+MI  YG++G G ++L+ F DML   + PN V F  VLSACSH G
Sbjct  167  RLFDGTPGKDVVCWSAMIASYGIHGQGRKSLDLFDDMLRVKVMPNHVTFTCVLSACSHSG  226

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  EG   F +M +++ I P+L +YACMVD+LSR G + EA + +  MP+EPD  IWG+L
Sbjct  227  LLEEGKRCFESMVKEFGIVPQLNNYACMVDLLSRSGQLSEAEKLIESMPVEPDASIWGSL  286

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L  CR  +G+ +++E +A ++  LDP +A Y+V+LSN+YA + RW EVEK+R+LM  +  
Sbjct  287  LGACR-IYGNLDLAERIADRIFELDPFHAGYHVLLSNIYAAKSRWKEVEKVRKLMVKRGA  345

Query  929  KKGMGYSVVEVNNSMHRM  982
             K  G+S++E  N +H+ 
Sbjct  346  NKVQGFSLIEFKNVVHKF  363


 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 62/217 (29%), Positives = 110/217 (51%), Gaps = 5/217 (2%)
 Frame = +2

Query  212  KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKT  391
            +P+++ F   L++C+ ++   +G  +H   +  G   + F+++ L+D Y K G I   + 
Sbjct  7    RPDKYTFPFALKSCAGLSDLKLGRLVHQHSVCCGCQHDVFVSAALVDTYAKCGDIESARL  66

Query  392  IFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGL  571
            +FD+ P +DL+ W+SMI+GY  NG   E L  F  M   GI+PN V  +SVL AC + G 
Sbjct  67   VFDKMPVRDLVSWTSMISGYAHNGCNGETLVFFDSMCDSGIRPNRVGILSVLLACGNLGA  126

Query  572  EYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALL  751
              +G  W H+   +      +     ++DM ++ G+++ A    +  P   D   W A++
Sbjct  127  LRKG-EWLHSYVIQTGFEFDVLVATAVMDMYTKCGSLDLARRLFDGTP-GKDVVCWSAMI  184

Query  752  AGCRKTHGSSEIS-ELVAKQL-ISLDPTNASYYVILS  856
            A     HG    S +L    L + + P + ++  +LS
Sbjct  185  AS-YGIHGQGRKSLDLFDDMLRVKVMPNHVTFTCVLS  220


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 77/157 (49%), Gaps = 2/157 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++GF   + V TA++ MY   G+++ +R LFD    KD++ WSAMI++Y    Q   +L 
Sbjct  139  QTGFEFDVLVATAVMDMYTKCGSLDLARRLFDGTPGKDVVCWSAMIASYGIHGQGRKSLD  198

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGE-TIHTQVMKLGYTSNAFLASGLIDMY  358
            +F  M      PN   F  +L ACS     + G+    + V + G        + ++D+ 
Sbjct  199  LFDDMLRVKVMPNHVTFTCVLSACSHSGLLEEGKRCFESMVKEFGIVPQLNNYACMVDLL  258

Query  359  CKFGRIHQGKTIFDENP-DKDLICWSSMINGYGMNGH  466
             + G++ + + + +  P + D   W S++    + G+
Sbjct  259  SRSGQLSEAEKLIESMPVEPDASIWGSLLGACRIYGN  295



>ref|XP_010246449.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic [Nelumbo nucifera]
Length=873

 Score =   293 bits (751),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 137/316 (43%), Positives = 210/316 (66%), Gaps = 2/316 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V  A++ MYA  G++E +R +FD +  +D ++W+ MI  Y+++  P++AL +F +MQ E 
Sbjct  440  VANAIMDMYAKCGSMEDARSVFDQMPVRDTVSWNTMIGGYSRNCLPNDALGLFIQMQNEL  499

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KPN      +L AC+S++A   G+ IH+ VM+ G+ S+ ++A+ L+DMY K G +   +
Sbjct  500  -KPNVVTMACVLPACASLSALKRGQEIHSHVMRNGFFSDLYVANALVDMYVKCGALVHAR  558

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD  P KDLI W+ MI+GYGM+G G E +  F +M   G++PN + FIS+L ACSH G
Sbjct  559  RLFDRMPTKDLISWTVMISGYGMHGCGREVISVFNEMRRTGVEPNGLSFISILYACSHSG  618

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  EGW +F+ M+    I PKL HYACMVD+L+R G++ +A +F+  MPI+PD  +WGAL
Sbjct  619  LIDEGWRFFNIMKNDCKIEPKLDHYACMVDLLARAGHLTKAYKFIQMMPIKPDSTVWGAL  678

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L GCR  H   +++E VA+Q+  L+P N  YYV+LSN+YA+  +W+EV+KLR+ +D +  
Sbjct  679  LFGCR-IHHDVKLAERVAEQIFELEPENTRYYVLLSNIYAEAEKWEEVKKLRERIDRRSF  737

Query  929  KKGMGYSVVEVNNSMH  976
            +K    S +E+    H
Sbjct  738  RKKPECSWIEIKKRYH  753


 Score =   124 bits (312),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/274 (27%), Positives = 138/274 (50%), Gaps = 6/274 (2%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
             LL +Y+  G+++++  +F  + ++ +++W++M++ Y +  Q   A+ +F+ M+ E  KP
Sbjct  342  TLLDLYSKCGDLDAATRVFVKMDKRSVVSWTSMMAGYTREGQYDRAINLFKEMEEEGIKP  401

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            + F   S+L AC+   + + G+ +H  V       + F+A+ ++DMY K G +   +++F
Sbjct  402  DIFTITSILHACACNGSLESGKDVHNYVRSSNLQFHVFVANAIMDMYAKCGSMEDARSVF  461

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEY  577
            D+ P +D + W++MI GY  N   N+AL  F+ M  + ++PN V    VL AC+      
Sbjct  462  DQMPVRDTVSWNTMIGGYSRNCLPNDALGLFIQM-QNELKPNVVTMACVLPACASLSALK  520

Query  578  EGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
             G    H+   +      L     +VDM  + G +  A    ++MP + D   W  +++G
Sbjct  521  RGQE-IHSHVMRNGFFSDLYVANALVDMYVKCGALVHARRLFDRMPTK-DLISWTVMISG  578

Query  758  CRKTHGSSE--ISELVAKQLISLDPTNASYYVIL  853
                HG     IS     +   ++P   S+  IL
Sbjct  579  -YGMHGCGREVISVFNEMRRTGVEPNGLSFISIL  611


 Score =   112 bits (279),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/252 (27%), Positives = 122/252 (48%), Gaps = 2/252 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            KSGF     V  +L+  Y+    I+S+R +FD LS +D I+W++MIS Y  +      L 
Sbjct  229  KSGFDSYSAVGNSLIAFYSKCKKIQSAREVFDELSDRDTISWNSMISGYVSNGLAEEGLK  288

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F +M L     +     S+L AC+ + +  +   +H   +K  + S     + L+D+Y 
Sbjct  289  LFIQMPLSGVDLDLTTMISILPACAEIGSLYLCRALHGYGIKAHFDSEVTFNNTLLDLYS  348

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +     +F +   + ++ W+SM+ GY   G  + A+  F +M   GI+P+     S
Sbjct  349  KCGDLDAATRVFVKMDKRSVVSWTSMMAGYTREGQYDRAINLFKEMEEEGIKPDIFTITS  408

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L AC+ C    E     H      ++   +     ++DM ++ G++E+A    ++MP+ 
Sbjct  409  ILHACA-CNGSLESGKDVHNYVRSSNLQFHVFVANAIMDMYAKCGSMEDARSVFDQMPVR  467

Query  722  PDKRIWGALLAG  757
             D   W  ++ G
Sbjct  468  -DTVSWNTMIGG  478


 Score =   109 bits (272),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/245 (28%), Positives = 125/245 (51%), Gaps = 10/245 (4%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHG-  211
            + L+ MYA  G++   R +FD + ++ +  W+ +++ YA+      ++ +F++M LE G 
Sbjct  139  SKLVFMYATCGDLGEGRRVFDGIQKEKVFLWNLLMNEYAKIGNFRESIRLFKQM-LELGI  197

Query  212  KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKT  391
              N +    + +  +++ +   GE +H  ++K G+ S + + + LI  Y K  +I   + 
Sbjct  198  DANSYTMSCVFKCFAALGSVVEGEQVHGYLLKSGFDSYSAVGNSLIAFYSKCKKIQSARE  257

Query  392  IFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGL  571
            +FDE  D+D I W+SMI+GY  NG   E L+ F+ M   G+  +    IS+L AC+  G 
Sbjct  258  VFDELSDRDTISWNSMISGYVSNGLAEEGLKLFIQMPLSGVDLDLTTMISILPACAEIGS  317

Query  572  EYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKR---IWG  742
             Y      H    K     ++     ++D+ S+ G+++ A     KM    DKR    W 
Sbjct  318  LYL-CRALHGYGIKAHFDSEVTFNNTLLDLYSKCGDLDAATRVFVKM----DKRSVVSWT  372

Query  743  ALLAG  757
            +++AG
Sbjct  373  SMMAG  377


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 105/244 (43%), Gaps = 39/244 (16%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++GF   + V  AL+ MY   G +  +R LFD +  KD+I+W+ MIS Y         ++
Sbjct  531  RNGFFSDLYVANALVDMYVKCGALVHARRLFDRMPTKDLISWTVMISGYGMHGCGREVIS  590

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            VF  M+    +PN  +F S+L ACS                           SGLID   
Sbjct  591  VFNEMRRTGVEPNGLSFISILYACSH--------------------------SGLIDEGW  624

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            +F  I +     +   D     ++ M++     GH  +A + F+ M+   I+P+  V+ +
Sbjct  625  RFFNIMKNDCKIEPKLDH----YACMVDLLARAGHLTKAYK-FIQMMP--IKPDSTVWGA  677

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L  C    + ++        E+ +++ P+   Y  ++  +  +    E  E V K+   
Sbjct  678  LLFGCR---IHHDVKLAERVAEQIFELEPENTRYYVLLSNIYAEA---EKWEEVKKLRER  731

Query  722  PDKR  733
             D+R
Sbjct  732  IDRR  735


 Score = 58.5 bits (140),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/177 (23%), Positives = 78/177 (44%), Gaps = 2/177 (1%)
 Frame = +2

Query  227  AFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDEN  406
             + S+LQ C+ + + + G  +H+ +   G   ++ L S L+ MY   G + +G+ +FD  
Sbjct  102  TYCSILQLCADLKSLNDGRKVHSIISSSGVEIDSLLGSKLVFMYATCGDLGEGRRVFDGI  161

Query  407  PDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGW  586
              + +  W+ ++N Y   G+  E++  F  ML  GI  N      V    +  G   EG 
Sbjct  162  QKEKVFLWNLLMNEYAKIGNFRESIRLFKQMLELGIDANSYTMSCVFKCFAALGSVVEG-  220

Query  587  NWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
               H    K       A    ++   S+   ++ A E  +++  + D   W ++++G
Sbjct  221  EQVHGYLLKSGFDSYSAVGNSLIAFYSKCKKIQSAREVFDELS-DRDTISWNSMISG  276



>ref|XP_008790066.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic [Phoenix dactylifera]
Length=877

 Score =   293 bits (751),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/320 (41%), Positives = 212/320 (66%), Gaps = 2/320 (1%)
 Frame = +2

Query  17   KCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM  196
            K + V  AL+ MY+  G++E +R +FD+ + K+II+W+ +I  Y+++  P+ AL++F  M
Sbjct  438  KNLFVANALMDMYSKCGSMEDARSVFDNTTSKNIISWNTLIGGYSKNHFPNEALSLFSEM  497

Query  197  QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
            Q+ H +PN      +L A +S+++ + G  IH  +++ G+ S+ ++A+ L+DMY K G +
Sbjct  498  QV-HMRPNSVTMACILPAAASLSSLEKGREIHGHILRSGHFSDGYVANALVDMYAKCGAL  556

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
               + +FD    KDLI W+ MI GYGM+GHG  A+  F +M   G++P++V F  +L AC
Sbjct  557  LLARILFDRMSKKDLISWTVMIAGYGMHGHGKNAIAVFKEMSGSGVEPDEVSFTVILYAC  616

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
            SH GL YEGW +++ M  +Y I P+L HYACMVD+LSR G++ +A EF+  MP++PD  +
Sbjct  617  SHSGLIYEGWEFYNIMRNEYKIEPRLEHYACMVDLLSRAGHLAKAYEFIKSMPVKPDSTV  676

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            WGALL GCR  H + +++E VA+ +  L+P N  YYV+L+N+YA+   W+ V KLR+ + 
Sbjct  677  WGALLCGCR-IHRNVKLAERVAEHVFELEPENTGYYVLLANIYAEAEEWEAVRKLRKKIS  735

Query  917  GKKRKKGMGYSVVEVNNSMH  976
            G+  +K  G S +E+ + +H
Sbjct  736  GRGLRKNPGCSWIEIKSKIH  755


 Score =   124 bits (310),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 81/290 (28%), Positives = 147/290 (51%), Gaps = 14/290 (5%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+ + K + V  +L+ MY+   ++E +  +F+ + Q+ +++W++MI A  ++     A+A
Sbjct  332  KAAYSKEVTVSNSLVDMYSKCWSLEGASRIFERMVQRSVVSWTSMIQASTRAGLFDEAIA  391

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M+    +P+ FA  S L AC+   + D G+ IH  +++     N F+A+ L+DMY 
Sbjct  392  LFGEMESLGVRPDLFAVTSALHACACSGSLDQGKNIHDYIVRNRVEKNLFVANALMDMYS  451

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +   +++FD    K++I W+++I GY  N   NEAL  F +M  H ++PN V    
Sbjct  452  KCGSMEDARSVFDNTTSKNIISWNTLIGGYSKNHFPNEALSLFSEMQVH-MRPNSVTMAC  510

Query  542  VLSACSHC-----GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVN  706
            +L A +       G E  G    H +   +     +A+   +VDM ++ G +  A    +
Sbjct  511  ILPAAASLSSLEKGREIHG----HILRSGHFSDGYVAN--ALVDMYAKCGALLLARILFD  564

Query  707  KMPIEPDKRIWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
            +M  + D   W  ++AG     HG + I+         ++P   S+ VIL
Sbjct  565  RMS-KKDLISWTVMIAGYGMHGHGKNAIAVFKEMSGSGVEPDEVSFTVIL  613


 Score =   110 bits (276),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 113/227 (50%), Gaps = 2/227 (1%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKD-IIAWSAMISAYAQSDQPSNALAVFRRMQLEHG  211
            + L+ MY   G++   R +FD  + KD I  W+ +++ YA+      ++ +FR MQ    
Sbjct  140  SKLVFMYVKCGDLREGRRVFDWSAAKDHIFPWNLLLNEYAKVGDFDESIDLFREMQYSSV  199

Query  212  KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKT  391
            KP+ + F   L+  ++      GE +H  ++KLG+ +   + + LI  Y K  RI     
Sbjct  200  KPDSYTFSLTLKCFATSGGVSEGEQVHGSLIKLGFGAYNAVGNALIAFYSKCNRITSAID  259

Query  392  IFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGL  571
            +FDE PD+D+I W+S+ING   N    + ++ F +M   G+  +    ++VL AC+  G+
Sbjct  260  VFDEMPDRDVISWNSLINGCVFNSLPRKGVDLFTEMWFLGMDIDSATLVTVLPACAELGI  319

Query  572  EYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
               G    H    K   + ++     +VDM S+  ++E A     +M
Sbjct  320  LTLG-KAVHGYSIKAAYSKEVTVSNSLVDMYSKCWSLEGASRIFERM  365


 Score =   104 bits (259),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/286 (25%), Positives = 131/286 (46%), Gaps = 6/286 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     V  AL+  Y+    I S+  +FD +  +D+I+W+++I+    +  P   + 
Sbjct  231  KLGFGAYNAVGNALIAFYSKCNRITSAIDVFDEMPDRDVISWNSLINGCVFNSLPRKGVD  290

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M       +     ++L AC+ +    +G+ +H   +K  Y+    +++ L+DMY 
Sbjct  291  LFTEMWFLGMDIDSATLVTVLPACAELGILTLGKAVHGYSIKAAYSKEVTVSNSLVDMYS  350

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K   +     IF+    + ++ W+SMI      G  +EA+  F +M S G++P+     S
Sbjct  351  KCWSLEGASRIFERMVQRSVVSWTSMIQASTRAGLFDEAIALFGEMESLGVRPDLFAVTS  410

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
             L AC+  G   +G N  H    +  +   L     ++DM S+ G++E+A    +     
Sbjct  411  ALHACACSGSLDQGKN-IHDYIVRNRVEKNLFVANALMDMYSKCGSMEDARSVFDNT---  466

Query  722  PDKRI--WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
              K I  W  L+ G  K H  +E   L ++  + + P + +   IL
Sbjct  467  TSKNIISWNTLIGGYSKNHFPNEALSLFSEMQVHMRPNSVTMACIL  512


 Score = 71.6 bits (174),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 75/152 (49%), Gaps = 4/152 (3%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            +SG      V  AL+ MYA  G +  +RILFD +S+KD+I+W+ MI+ Y       NA+A
Sbjct  533  RSGHFSDGYVANALVDMYAKCGALLLARILFDRMSKKDLISWTVMIAGYGMHGHGKNAIA  592

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLA--SGLIDM  355
            VF+ M     +P+E +F  +L ACS       G   +  +M+  Y     L   + ++D+
Sbjct  593  VFKEMSGSGVEPDEVSFTVILYACSHSGLIYEGWEFY-NIMRNEYKIEPRLEHYACMVDL  651

Query  356  YCKFGRIHQGKTIFDENPDK-DLICWSSMING  448
              + G + +        P K D   W +++ G
Sbjct  652  LSRAGHLAKAYEFIKSMPVKPDSTVWGALLCG  683


 Score = 69.3 bits (168),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/233 (24%), Positives = 101/233 (43%), Gaps = 6/233 (3%)
 Frame = +2

Query  74   ESSRILF---DSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLL  244
            +S RI+     S+ +K  I  +  I  + Q       + +      E    N   F S+L
Sbjct  49   DSRRIITRASTSVYEKQRIDLNVKIRKFCQKGDLKEVMRLISDSDSEDRCINSETFCSVL  108

Query  245  QACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKD-L  421
            Q C+ + +   G  +H+ +   G   +  L S L+ MY K G + +G+ +FD +  KD +
Sbjct  109  QLCAELGSLADGRKVHSILSSSGIQIHTLLGSKLVFMYVKCGDLREGRRVFDWSAAKDHI  168

Query  422  ICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHA  601
              W+ ++N Y   G  +E+++ F +M    ++P+   F   L   +  G   EG    H 
Sbjct  169  FPWNLLLNEYAKVGDFDESIDLFREMQYSSVKPDSYTFSLTLKCFATSGGVSEG-EQVHG  227

Query  602  MEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
               K       A    ++   S+   +  A++  ++MP + D   W +L+ GC
Sbjct  228  SLIKLGFGAYNAVGNALIAFYSKCNRITSAIDVFDEMP-DRDVISWNSLINGC  279



>ref|XP_007148025.1| hypothetical protein PHAVU_006G174200g [Phaseolus vulgaris]
 gb|ESW20019.1| hypothetical protein PHAVU_006G174200g [Phaseolus vulgaris]
Length=871

 Score =   293 bits (750),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 207/313 (66%), Gaps = 3/313 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            +PV  AL+ MYA  G++E + ++F  +  KDI++W+ MI  Y+++  P+ AL +F  MQ 
Sbjct  435  LPVSNALMNMYAKCGSMEEAYLVFSQIPVKDIVSWNIMIGGYSKNTLPNEALKLFSEMQ-  493

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            E  +P+      +L AC S+AA D+G  IH  +++ GY S+ ++ + LIDMY K G +  
Sbjct  494  EESRPDGITMACVLPACGSLAALDIGRGIHGCILRNGYLSDLYVVNALIDMYVKCGSLVH  553

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + +FD   +KDLI W+ MI GYGM+G GNEA+  F  M + GI+P+++ F S+L ACSH
Sbjct  554  AQFLFDMISEKDLISWTVMITGYGMHGFGNEAIATFQKMRTVGIKPDEITFTSILYACSH  613

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             GL  EGW  F+++ E  +I PKL HYACMVD+L+R GN+ +A  F+  MPI+PD  +WG
Sbjct  614  SGLLNEGWEIFNSISE-CNIEPKLDHYACMVDLLARTGNLSKAYNFIETMPIKPDATVWG  672

Query  743  ALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGK  922
            ALL GCR  H   E+++ VA+ +  L+P N  YYV+L+N+YA+  +W+EV+KLR+ +  +
Sbjct  673  ALLCGCR-IHHDVELAKTVAEHVFELEPDNTGYYVLLANIYAEAEKWEEVKKLRERISKR  731

Query  923  KRKKGMGYSVVEV  961
              KK  G S +EV
Sbjct  732  GLKKSPGCSWIEV  744


 Score =   108 bits (269),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 134/285 (47%), Gaps = 4/285 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+ F + +     LL MY+  GN+  +  +F  + Q  +++W+++ISAY +     +A+ 
Sbjct  327  KACFGREVRFNNTLLDMYSKCGNLNDAIQVFGKMGQTTVVSWTSLISAYVREGLYDDAIR  386

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M+ +   P+ ++  S+L AC+   + D G  +H    K   T +  +++ L++MY 
Sbjct  387  LFYEMECKGVSPDVYSMTSVLHACAHSNSLDKGRDLHNYFRKNNVTLSLPVSNALMNMYA  446

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G + +   +F + P KD++ W+ MI GY  N   NEAL+ F +M     +P+ +    
Sbjct  447  KCGSMEEAYLVFSQIPVKDIVSWNIMIGGYSKNTLPNEALKLFSEMQEES-RPDGITMAC  505

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL AC        G    H    +      L     ++DM  + G++  A +F+  M  E
Sbjct  506  VLPACGSLAALDIG-RGIHGCILRNGYLSDLYVVNALIDMYVKCGSLVHA-QFLFDMISE  563

Query  722  PDKRIWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             D   W  ++ G      G+  I+     + + + P   ++  IL
Sbjct  564  KDLISWTVMITGYGMHGFGNEAIATFQKMRTVGIKPDEITFTSIL  608


 Score =   107 bits (267),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 115/225 (51%), Gaps = 2/225 (1%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFD-SLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
            L+ MY + G++   R +FD +LS   +  W+ M+S YA+      ++ +FR+MQ      
Sbjct  137  LVFMYVSCGDLREGRRIFDHTLSDNKVFLWNLMMSEYAKIGDYRESIYLFRKMQKLGIAG  196

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            N + F  +L    ++      ++IH  + KLG+ S   + + LI  Y K G +     +F
Sbjct  197  NSYTFSCILNCLRTLGRVGDCKSIHGYIYKLGFGSYNTVVNSLIATYFKSGGVDNAHKLF  256

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEY  577
            DE  D+D++ W+SMI+G  MNG  + AL+ F+ ML   +  +    ++VL AC++ G   
Sbjct  257  DELGDRDVVSWNSMISGCVMNGFSHTALDFFIQMLILRVGVDLATLVNVLVACANVGSLS  316

Query  578  EGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
             G    H    K     ++     ++DM S+ GN+ +A++   KM
Sbjct  317  FG-RAVHGHGVKACFGREVRFNNTLLDMYSKCGNLNDAIQVFGKM  360


 Score =   106 bits (265),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 132/268 (49%), Gaps = 2/268 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     VV +L+  Y   G ++++  LFD L  +D+++W++MIS    +     AL 
Sbjct  226  KLGFGSYNTVVNSLIATYFKSGGVDNAHKLFDELGDRDVVSWNSMISGCVMNGFSHTALD  285

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             F +M +     +     ++L AC+++ +   G  +H   +K  +       + L+DMY 
Sbjct  286  FFIQMLILRVGVDLATLVNVLVACANVGSLSFGRAVHGHGVKACFGREVRFNNTLLDMYS  345

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G ++    +F +     ++ W+S+I+ Y   G  ++A+  F +M   G+ P+     S
Sbjct  346  KCGNLNDAIQVFGKMGQTTVVSWTSLISAYVREGLYDDAIRLFYEMECKGVSPDVYSMTS  405

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL AC+H     +G +  H    K ++T  L     +++M ++ G++EEA    +++P++
Sbjct  406  VLHACAHSNSLDKGRD-LHNYFRKNNVTLSLPVSNALMNMYAKCGSMEEAYLVFSQIPVK  464

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAK  805
             D   W  ++ G  K    +E  +L ++
Sbjct  465  -DIVSWNIMIGGYSKNTLPNEALKLFSE  491


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 85/212 (40%), Gaps = 5/212 (2%)
 Frame = +2

Query  128  SAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMK  307
            +A IS + +     NA+ + R  Q      N FA  S+LQ C+       G+ +H+ +  
Sbjct  67   NAKISKFCEVGDLRNAVELLRMSQKSELDLNTFA--SILQLCAESKRLQEGKIVHSIISS  124

Query  308  LGYTSNAFLASGLIDMYCKFGRIHQGKTIFDEN-PDKDLICWSSMINGYGMNGHGNEALE  484
             G      L   L+ MY   G + +G+ IFD    D  +  W+ M++ Y   G   E++ 
Sbjct  125  NGIPIEGLLGPKLVFMYVSCGDLREGRRIFDHTLSDNKVFLWNLMMSEYAKIGDYRESIY  184

Query  485  CFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDML  664
             F  M   GI  N   F  +L+     G         H    K            ++   
Sbjct  185  LFRKMQKLGIAGNSYTFSCILNCLRTLG-RVGDCKSIHGYIYKLGFGSYNTVVNSLIATY  243

Query  665  SRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
             + G V+ A +  +++  + D   W ++++GC
Sbjct  244  FKSGGVDNAHKLFDELG-DRDVVSWNSMISGC  274



>ref|XP_010096042.1| hypothetical protein L484_008698 [Morus notabilis]
 gb|EXB62848.1| hypothetical protein L484_008698 [Morus notabilis]
Length=671

 Score =   288 bits (738),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 140/344 (41%), Positives = 210/344 (61%), Gaps = 5/344 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             KSGF   + V   L+  YA  G     R +FD + +KD+++W++MI+ YAQS   + AL 
Sbjct  225   KSGFGGDLGVANTLMDAYAKCGETALCRKVFDEMVEKDVVSWNSMIAVYAQSGLSTKALE  284

Query  182   VFRRMQLEHGKP-NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VF  M    G   N     +LL AC+      +G+ IH QV+++G   N  + + +IDMY
Sbjct  285   VFYGMVKVGGVSYNAVTLSALLLACAHSGTLRIGKCIHNQVLRMGLEENVVVNTAMIDMY  344

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
              K GR+   +  FD   +K++  W++M+ GYGM+G   EALE F  M+  G +PN + F+
Sbjct  345   SKCGRVDIARKAFDCMKEKNVKSWTAMVAGYGMHGRAREALEVFHKMVRVGAKPNYITFV  404

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             SVLSACSH GL  EGW+WF++M  K+ I P + HY CMVD+L+R G + +A   + +M I
Sbjct  405   SVLSACSHAGLLKEGWHWFNSMRHKFGIEPGVEHYGCMVDLLARAGYLNKAYNLIKEMKI  464

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
              PD  +WG+LL  CR  H + E++E+ A++L  LDP+N  YYV+LS++YAD GRW++VE+
Sbjct  465   SPDFIVWGSLLGACR-IHKNVELAEISARKLFELDPSNCGYYVLLSHIYADAGRWEDVER  523

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             +R LM      K  G+S+VE+   +H        ++E+ QH R+
Sbjct  524   MRGLMKNHGIVKPPGFSLVELKGRVHVFMV---GDREHPQHERI  564


 Score =   124 bits (311),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 84/285 (29%), Positives = 146/285 (51%), Gaps = 9/285 (3%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRR-MQ  199
            I V +AL+ MY    ++  +R LFD + Q+++++W+AMI  Y QS   + AL++F+  + 
Sbjct  126  IFVSSALIDMYCKCDDLRDARQLFDFMPQRNVVSWTAMIVGYVQSGSANVALSLFKEFLS  185

Query  200  LEHG----KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKF  367
             E G      +     S+L ACS ++   V +++H  V+K G+  +  +A+ L+D Y K 
Sbjct  186  DESGDGGCSVDPVVMVSVLSACSRVSDMGVTDSVHGVVVKSGFGGDLGVANTLMDAYAKC  245

Query  368  GRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLS-HGIQPNDVVFISV  544
            G     + +FDE  +KD++ W+SMI  Y  +G   +ALE F  M+   G+  N V   ++
Sbjct  246  GETALCRKVFDEMVEKDVVSWNSMIAVYAQSGLSTKALEVFYGMVKVGGVSYNAVTLSAL  305

Query  545  LSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEP  724
            L AC+H G    G    H    +  +   +     M+DM S+ G V+ A +  + M  E 
Sbjct  306  LLACAHSGTLRIG-KCIHNQVLRMGLEENVVVNTAMIDMYSKCGRVDIARKAFDCMK-EK  363

Query  725  DKRIWGALLAGCRKTHGSSEISELVAKQL-ISLDPTNASYYVILS  856
            + + W A++AG      + E  E+  K + +   P   ++  +LS
Sbjct  364  NVKSWTAMVAGYGMHGRAREALEVFHKMVRVGAKPNYITFVSVLS  408


 Score = 97.4 bits (241),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/215 (28%), Positives = 106/215 (49%), Gaps = 7/215 (3%)
 Frame = +2

Query  125  WSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVM  304
            W+++I+  A+S     AL  F  M+    +P    F  ++++CS+++    G+  H Q +
Sbjct  59   WNSVIADLARSGFSVEALLAFSSMRKLSLRPTRSTFPCVIKSCSALSDLRSGKQTHQQAL  118

Query  305  KLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALE  484
                 S+ F++S LIDMYCK   +   + +FD  P ++++ W++MI GY  +G  N AL 
Sbjct  119  LFALESDIFVSSALIDMYCKCDDLRDARQLFDFMPQRNVVSWTAMIVGYVQSGSANVALS  178

Query  485  CFLDMLSH-----GIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYAC  649
             F + LS      G   + VV +SVLSACS    +    +  H +  K      L     
Sbjct  179  LFKEFLSDESGDGGCSVDPVVMVSVLSACSRVS-DMGVTDSVHGVVVKSGFGGDLGVANT  237

Query  650  MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
            ++D  ++ G      +  ++M +E D   W +++A
Sbjct  238  LMDAYAKCGETALCRKVFDEM-VEKDVVSWNSMIA  271



>ref|XP_007031998.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOY02924.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=659

 Score =   288 bits (737),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 137/343 (40%), Positives = 216/343 (63%), Gaps = 5/343 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF   + V   LL  YA   ++  SR +FD++  KD ++W++MI+ YAQ+   + AL 
Sbjct  213   KKGFDGEVSVGNTLLDAYAKSEDVGLSRKVFDAMVDKDEVSWNSMIAVYAQNGLSNEALE  272

Query  182   VFRRM-QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VF  M + ++   N     ++L AC+   A   G+ IH QV+K+G   +  + + +IDMY
Sbjct  273   VFHGMVRDDNVNYNAVTLSAVLLACAHSGALQAGKCIHDQVIKMGLEDDVIVGTSIIDMY  332

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK GR+   +  F    +K++  W+++I GYGM+GH  EALE F +M+  G++PN + F+
Sbjct  333   CKCGRVEMARKAFSCIKEKNVRSWTALIAGYGMHGHAKEALEVFYNMIRTGVRPNYITFV  392

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             SVL++CSH GL  EGW+WF+AM++++++ P + HY CMVD+L R G + +A + + +M +
Sbjct  393   SVLASCSHAGLVQEGWHWFNAMKDEFNVEPGVEHYGCMVDLLGRAGYLSQAYKLIKQMKV  452

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
              PD  IWG+LLA CR  H + E++E+ A +L  LD  N  YYV+LSN+YAD GRW++VE+
Sbjct  453   TPDIVIWGSLLAACR-IHKNVELAEISANKLFELDSNNCGYYVLLSNIYADAGRWEDVER  511

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSR  1027
             +R LM  +   K  G+S+VE+   +H        +QE+ QH +
Sbjct  512   MRLLMKDRGLIKPPGFSLVELKGKVHVFLV---GDQEHPQHEK  551


 Score =   125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 128/255 (50%), Gaps = 14/255 (5%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V +AL+ MY+  G +  +RILFD + Q++I++W++MI+ Y Q++    AL +F+ + ++ 
Sbjct  110  VSSALIDMYSKCGQLRDARILFDQIPQRNIVSWTSMITGYVQNNSADQALLLFKELLIQK  169

Query  209  GKP-----------NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM  355
             +            +  A  S+L ACS +  +     +H  ++K G+     + + L+D 
Sbjct  170  SENGGNDAIGQVLIDPVAIVSVLSACSRVPIKGASGGVHGMIIKKGFDGEVSVGNTLLDA  229

Query  356  YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDML-SHGIQPNDVV  532
            Y K   +   + +FD   DKD + W+SMI  Y  NG  NEALE F  M+    +  N V 
Sbjct  230  YAKSEDVGLSRKVFDAMVDKDEVSWNSMIAVYAQNGLSNEALEVFHGMVRDDNVNYNAVT  289

Query  533  FISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
              +VL AC+H G    G    H    K  +   +     ++DM  + G VE A +  + +
Sbjct  290  LSAVLLACAHSGALQAG-KCIHDQVIKMGLEDDVIVGTSIIDMYCKCGRVEMARKAFSCI  348

Query  713  PIEPDKRIWGALLAG  757
              E + R W AL+AG
Sbjct  349  K-EKNVRSWTALIAG  362


 Score =   102 bits (254),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 118/229 (52%), Gaps = 13/229 (6%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + +  + +W+++I+  A++   + AL  F  M+    KPN   F   +++CS++   + G
Sbjct  33   VDKSSVWSWNSIIAELARAGDSAEALRAFSSMRKLSLKPNRSTFPCAIKSCSALLDLNSG  92

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q +  GY S+ F++S LIDMY K G++   + +FD+ P ++++ W+SMI GY  N
Sbjct  93   KQTHQQALIFGYGSDLFVSSALIDMYSKCGQLRDARILFDQIPQRNIVSWTSMITGYVQN  152

Query  461  GHGNEALECFLDMLSHG-----------IQPNDVVFISVLSACSHCGLEYEGWNWFHAME  607
               ++AL  F ++L              +  + V  +SVLSACS   ++       H M 
Sbjct  153  NSADQALLLFKELLIQKSENGGNDAIGQVLIDPVAIVSVLSACSRVPIKGAS-GGVHGMI  211

Query  608  EKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
             K     +++    ++D  ++  +V  + +  + M ++ D+  W +++A
Sbjct  212  IKKGFDGEVSVGNTLLDAYAKSEDVGLSRKVFDAM-VDKDEVSWNSMIA  259



>ref|NP_001078414.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|A8MQA3.2|PP330_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g21065 
[Arabidopsis thaliana]
 gb|AEE84394.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=595

 Score =   286 bits (732),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 131/326 (40%), Positives = 215/326 (66%), Gaps = 2/326 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            +SGF   I V  +LL +YAN G++ S+  +FD + +KD++AW+++I+ +A++ +P  ALA
Sbjct  149  RSGFGSLIYVQNSLLHLYANCGDVASAYKVFDKMPEKDLVAWNSVINGFAENGKPEEALA  208

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++  M  +  KP+ F   SLL AC+ + A  +G+ +H  ++K+G T N   ++ L+D+Y 
Sbjct  209  LYTEMNSKGIKPDGFTIVSLLSACAKIGALTLGKRVHVYMIKVGLTRNLHSSNVLLDLYA  268

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLS-HGIQPNDVVFI  538
            + GR+ + KT+FDE  DK+ + W+S+I G  +NG G EA+E F  M S  G+ P ++ F+
Sbjct  269  RCGRVEEAKTLFDEMVDKNSVSWTSLIVGLAVNGFGKEAIELFKYMESTEGLLPCEITFV  328

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             +L ACSHCG+  EG+ +F  M E+Y I P++ H+ CMVD+L+R G V++A E++  MP+
Sbjct  329  GILYACSHCGMVKEGFEYFRRMREEYKIEPRIEHFGCMVDLLARAGQVKKAYEYIKSMPM  388

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
            +P+  IW  LL  C   HG S+++E    Q++ L+P ++  YV+LSN+YA + RW +V+K
Sbjct  389  QPNVVIWRTLLGAC-TVHGDSDLAEFARIQILQLEPNHSGDYVLLSNMYASEQRWSDVQK  447

Query  899  LRQLMDGKKRKKGMGYSVVEVNNSMH  976
            +R+ M     KK  G+S+VEV N +H
Sbjct  448  IRKQMLRDGVKKVPGHSLVEVGNRVH  473


 Score =   125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/216 (31%), Positives = 121/216 (56%), Gaps = 3/216 (1%)
 Frame = +2

Query  113  DIIAWSAMISAYAQSDQPSNALAVFRRMQLEH-GKPNEFAFHSLLQACSSMAAQDVGETI  289
            ++  W+ +I  YA+     +A +++R M++    +P+   +  L++A ++MA   +GETI
Sbjct  84   NVFIWNTLIRGYAEIGNSISAFSLYREMRVSGLVEPDTHTYPFLIKAVTTMADVRLGETI  143

Query  290  HTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHG  469
            H+ V++ G+ S  ++ + L+ +Y   G +     +FD+ P+KDL+ W+S+ING+  NG  
Sbjct  144  HSVVIRSGFGSLIYVQNSLLHLYANCGDVASAYKVFDKMPEKDLVAWNSVINGFAENGKP  203

Query  470  NEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYAC  649
             EAL  + +M S GI+P+    +S+LSAC+  G    G    H    K  +T  L     
Sbjct  204  EEALALYTEMNSKGIKPDGFTIVSLLSACAKIGALTLG-KRVHVYMIKVGLTRNLHSSNV  262

Query  650  MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            ++D+ +R G VEEA    ++M ++ +   W +L+ G
Sbjct  263  LLDLYARCGRVEEAKTLFDEM-VDKNSVSWTSLIVG  297



>ref|XP_008225340.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic [Prunus mume]
Length=878

 Score =   293 bits (749),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 137/316 (43%), Positives = 209/316 (66%), Gaps = 2/316 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V   L+ MYA  G++E +  +F ++  KDI++W+ MI  Y+++  P+ AL +F  MQ + 
Sbjct  443  VCNTLMDMYAKCGSMEDAHSVFSNMPVKDIVSWNTMIGGYSKNCLPNEALKLFSEMQ-QK  501

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KP+     S+L AC+S+AA + G+ IH  +++ GY S+ ++A+ L+DMY K G +   +
Sbjct  502  SKPDGMTIASVLPACASLAALNRGQEIHGHILRNGYFSDRYVANALVDMYVKCGVLVLAR  561

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD  P KDLI W+ ++ GYGM+G G EA+  F +M   GI+P+ + FIS+L ACSH G
Sbjct  562  LLFDIIPMKDLISWTVIVAGYGMHGLGREAITAFNEMRKSGIKPDSISFISILYACSHSG  621

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  E W +F +M   Y I PKL HYACMVD+L+R GN+ +A +F+NKMPIEPD  IWG+L
Sbjct  622  LLDEAWRFFDSMRNDYSIVPKLEHYACMVDLLARTGNLTKAYKFINKMPIEPDATIWGSL  681

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L GCR  H   +++E VA+++  L+P N  YYV+L+N+YA+  +W+EV+KLR+ +  +  
Sbjct  682  LCGCR-IHHDVKLAEKVAERVFELEPENTGYYVLLANIYAEAEKWEEVKKLRERIGRQGL  740

Query  929  KKGMGYSVVEVNNSMH  976
            KK  G S +E+   + 
Sbjct  741  KKNPGCSWIEIKGKVQ  756


 Score =   130 bits (326),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 85/281 (30%), Positives = 143/281 (51%), Gaps = 4/281 (1%)
 Frame = +2

Query  26   PVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLE  205
            P+   L+ M+   G++  +R++FD LS   I  W+ MI+ YA+       + +FR+MQ  
Sbjct  139  PLGAKLVFMFVKCGDLREARLIFDKLSNGKIFLWNLMINEYAKVRNFREGIHLFRKMQEL  198

Query  206  HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQG  385
              + N + F  +L+  SS+     GE +H  + KLG+ S+  + + L+  Y K  RI   
Sbjct  199  DIQANSYTFSCILKCFSSLGYVREGEWVHGYLYKLGFGSDNTVGNSLMAFYFKNRRIESA  258

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC  565
            + +FDE  D+D+I W+SMI+ Y  NG  ++ ++ F  MLS GI  +    I+VL ACS  
Sbjct  259  RKVFDELSDRDVISWNSMISAYVSNGLADKGVDIFRQMLSLGIDVDLATIINVLMACSDG  318

Query  566  GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGA  745
            G    G    H+   K  +   +  Y  ++DM S+ G++  A +   KM  +     W +
Sbjct  319  GNLSLG-RALHSYAIKTCLDMDIIFYNNVLDMYSKCGDLSSATQVFGKMG-QRSVVSWTS  376

Query  746  LLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYA  868
            ++AG  +   S E  EL ++  +  +  +   Y I S L+A
Sbjct  377  MIAGYVREGLSDEAIELFSE--MERNGVSPDVYTITSILHA  415


 Score =   115 bits (289),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/256 (29%), Positives = 130/256 (51%), Gaps = 4/256 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     V  +L+  Y     IES+R +FD LS +D+I+W++MISAY  +      + 
Sbjct  232  KLGFGSDNTVGNSLMAFYFKNRRIESARKVFDELSDRDVISWNSMISAYVSNGLADKGVD  291

Query  182  VFRRMQLEHGKPNEFA-FHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
            +FR+M L  G   + A   ++L ACS      +G  +H+  +K     +    + ++DMY
Sbjct  292  IFRQM-LSLGIDVDLATIINVLMACSDGGNLSLGRALHSYAIKTCLDMDIIFYNNVLDMY  350

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             K G +     +F +   + ++ W+SMI GY   G  +EA+E F +M  +G+ P+     
Sbjct  351  SKCGDLSSATQVFGKMGQRSVVSWTSMIAGYVREGLSDEAIELFSEMERNGVSPDVYTIT  410

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            S+L AC+  G   +G +  H    ++ +   L     ++DM ++ G++E+A    + MP+
Sbjct  411  SILHACACNGSLKKGRD-IHKYIREHGMDSGLFVCNTLMDMYAKCGSMEDAHSVFSNMPV  469

Query  719  EPDKRIWGALLAGCRK  766
            + D   W  ++ G  K
Sbjct  470  K-DIVSWNTMIGGYSK  484


 Score =   112 bits (280),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 122/244 (50%), Gaps = 13/244 (5%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            +L MY+  G++ S+  +F  + Q+ +++W++MI+ Y +      A+ +F  M+     P+
Sbjct  346  VLDMYSKCGDLSSATQVFGKMGQRSVVSWTSMIAGYVREGLSDEAIELFSEMERNGVSPD  405

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
             +   S+L AC+   +   G  IH  + + G  S  F+ + L+DMY K G +    ++F 
Sbjct  406  VYTITSILHACACNGSLKKGRDIHKYIREHGMDSGLFVCNTLMDMYAKCGSMEDAHSVFS  465

Query  401  ENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC-----  565
              P KD++ W++MI GY  N   NEAL+ F +M     +P+ +   SVL AC+       
Sbjct  466  NMPVKDIVSWNTMIGGYSKNCLPNEALKLFSEMQQKS-KPDGMTIASVLPACASLAALNR  524

Query  566  GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGA  745
            G E  G    H +   Y     +A+   +VDM  + G +  A    + +P++ D   W  
Sbjct  525  GQEIHG----HILRNGYFSDRYVAN--ALVDMYVKCGVLVLARLLFDIIPMK-DLISWTV  577

Query  746  LLAG  757
            ++AG
Sbjct  578  IVAG  581


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 71/152 (47%), Gaps = 4/152 (3%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++G+     V  AL+ MY   G +  +R+LFD +  KD+I+W+ +++ Y        A+ 
Sbjct  534  RNGYFSDRYVANALVDMYVKCGVLVLARLLFDIIPMKDLISWTVIVAGYGMHGLGREAIT  593

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLA--SGLIDM  355
             F  M+    KP+  +F S+L ACS     D         M+  Y+    L   + ++D+
Sbjct  594  AFNEMRKSGIKPDSISFISILYACSHSGLLDEAWRFFDS-MRNDYSIVPKLEHYACMVDL  652

Query  356  YCKFGRIHQGKTIFDENP-DKDLICWSSMING  448
              + G + +     ++ P + D   W S++ G
Sbjct  653  LARTGNLTKAYKFINKMPIEPDATIWGSLLCG  684


 Score = 58.9 bits (141),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 75/169 (44%), Gaps = 9/169 (5%)
 Frame = +2

Query  104  SQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEF---AFHSLLQACSSMAAQD  274
            +  ++I  +A IS Y +     NA+ +     +   K +E     + S+L+ C+ + +  
Sbjct  66   TNSEVIDKNAKISKYCEMGNLKNAVEL-----VCGSKKSELDLEGYCSVLELCAGLKSLQ  120

Query  275  VGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYG  454
             G+ +H+ +   G   +  L + L+ M+ K G + + + IFD+  +  +  W+ MIN Y 
Sbjct  121  DGKRVHSVICSNGAEVDGPLGAKLVFMFVKCGDLREARLIFDKLSNGKIFLWNLMINEYA  180

Query  455  MNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHA  601
               +  E +  F  M    IQ N   F  +L   S  G   EG  W H 
Sbjct  181  KVRNFREGIHLFRKMQELDIQANSYTFSCILKCFSSLGYVREG-EWVHG  228



>ref|XP_010904754.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic-like [Elaeis guineensis]
Length=486

 Score =   283 bits (724),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 135/317 (43%), Positives = 200/317 (63%), Gaps = 5/317 (2%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            + V TALL +YA  G  E +R +FD++ +KD+IAW+AMI+ YAQ+ +P+ A+ +FR MQ 
Sbjct  44   VSVSTALLNLYAKVGRTEEAREVFDAIPEKDLIAWNAMITGYAQNQRPAEAIELFRLMQK  103

Query  203  EHG----KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFG  370
                   +P+     SL+ +CS M A  +GE ++  + K    ++  L + ++DMY K G
Sbjct  104  SRNGVKIRPDSVTMISLINSCSQMGALSLGEWVYAYIRKNRIETDTVLMTAIVDMYAKCG  163

Query  371  RIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLS  550
             + + + +F E P+KDL  W++MI G G++G GNEALE    M   GI PND  F+ +L+
Sbjct  164  DLDRARCLFAEMPEKDLASWNAMIKGLGIHGRGNEALEMLYLMEKDGIVPNDATFVGLLN  223

Query  551  ACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDK  730
            ACSH GL  +G   F  M+ +Y I P + HY C++D+L R G + EA E V  MP+EPDK
Sbjct  224  ACSHGGLVGKGLELFELMQSRYSIAPCIEHYGCVIDLLGRAGELVEAYELVKSMPLEPDK  283

Query  731  RIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQL  910
             IWGALL  CR +H + E++E+ A++L+ LDP +   YV+LSN+YA  G+W  VEK+R  
Sbjct  284  VIWGALLGACR-SHQNLELAEVAAQRLVELDPGHDGNYVLLSNVYASMGKWGNVEKVRAQ  342

Query  911  MDGKKRKKGMGYSVVEV  961
            M  ++  K  G S VE+
Sbjct  343  MRARQVHKVPGCSTVEL  359



>ref|XP_009378030.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Pyrus x bretschneideri]
Length=653

 Score =   287 bits (735),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/344 (40%), Positives = 208/344 (60%), Gaps = 5/344 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF   + V   L+  YA  G ++  R +FD +SQKD+++W++MI+ YAQS   S A  
Sbjct  207   KRGFDGDLWVGNTLMDAYAKCGELDLVRKVFDGMSQKDLVSWNSMIATYAQSGLSSEAWQ  266

Query  182   VFRRMQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VF  M  +     N     +LL AC+      VG++IH QV+K G   N  +++ +IDMY
Sbjct  267   VFYGMARDGDVHYNAVTLSTLLLACAHAGPLLVGKSIHDQVLKKGLEENVIVSTSIIDMY  326

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK GR+   +  FD   +K++  W++M+ GYGM+G   EALE F  M+  G+ PN + F+
Sbjct  327   CKRGRVDLARKAFDCMKEKNVRTWTAMVAGYGMHGRAKEALEVFYKMIRDGVTPNYITFV  386

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             S+L+ACSH GL  +GW WF+AM  ++ + P + HY CMVD+L R G + +A + +  M I
Sbjct  387   SLLNACSHAGLFEQGWYWFNAMSREFSVEPGIEHYGCMVDLLGRSGELNKAYDLIKGMRI  446

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
              PD  +WG+ L  CR  H +   +E+ A++L  LDP N  YY++LSN+YAD GRW++VE+
Sbjct  447   RPDCVVWGSFLGACR-VHKNVRFAEISARKLFELDPHNCGYYILLSNVYADAGRWEDVER  505

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             +R LM  +   K  G+S+VE+   +H        E+EY QH ++
Sbjct  506   MRVLMKNRGLVKPPGFSLVELRGIVHLFLV---GEREYPQHEKI  546


 Score =   127 bits (318),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 82/293 (28%), Positives = 152/293 (52%), Gaps = 10/293 (3%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF   + V +AL+ MY+  G +  +  LFD++  ++++ W++MI+   Q+D    AL++F
Sbjct  103  GFESDLFVSSALIDMYSRCGRLTDAWKLFDTIPHRNVVTWTSMITGCVQNDDACQALSLF  162

Query  188  RRMQLEHGKPNEFAFH-----SLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
            + + +E     + +       S+L ACS ++++ + +T+H  V+K G+  + ++ + L+D
Sbjct  163  KELLIEEIDNEDVSLDPVVLVSVLSACSRVSSKGLAQTVHGLVVKRGFDGDLWVGNTLMD  222

Query  353  MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHG-IQPNDV  529
             Y K G +   + +FD    KDL+ W+SMI  Y  +G  +EA + F  M   G +  N V
Sbjct  223  AYAKCGELDLVRKVFDGMSQKDLVSWNSMIATYAQSGLSSEAWQVFYGMARDGDVHYNAV  282

Query  530  VFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNK  709
               ++L AC+H G    G +  H    K  +   +     ++DM  ++G V+ A +  + 
Sbjct  283  TLSTLLLACAHAGPLLVGKS-IHDQVLKKGLEENVIVSTSIIDMYCKRGRVDLARKAFDC  341

Query  710  MPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYA  868
            M  E + R W A++AG    HG ++ +  V  ++I  D    +Y   +S L A
Sbjct  342  MK-EKNVRTWTAMVAG-YGMHGRAKEALEVFYKMIR-DGVTPNYITFVSLLNA  391


 Score =   100 bits (248),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 87/158 (55%), Gaps = 5/158 (3%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + + D+ +W+++I+  A+S     AL  F  M+    +PN  +F   +++CS++     G
Sbjct  33   VDKDDVASWNSVIADLARSGDSLEALRAFSSMRKLSLRPNRSSFPCAIKSCSALLDLHSG  92

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q +  G+ S+ F++S LIDMY + GR+     +FD  P ++++ W+SMI G   N
Sbjct  93   KQAHQQALVFGFESDLFVSSALIDMYSRCGRLTDAWKLFDTIPHRNVVTWTSMITGCVQN  152

Query  461  GHGNEALECFLDMLSHGIQPND-----VVFISVLSACS  559
                +AL  F ++L   I   D     VV +SVLSACS
Sbjct  153  DDACQALSLFKELLIEEIDNEDVSLDPVVLVSVLSACS  190



>ref|XP_010682981.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Beta vulgaris subsp. vulgaris]
Length=669

 Score =   288 bits (736),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/344 (40%), Positives = 214/344 (62%), Gaps = 5/344 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K G    + V   L+  YA  G +  S+ +FD + +KD+I+W+ M++ +AQ+   + A+ 
Sbjct  223   KRGLEVFLGVGNTLVDAYAKCGELGMSKKVFDGMIEKDVISWNTMVAVFAQNGLSTEAIE  282

Query  182   VFRRMQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VFR +  +   + N     ++L ACS   A  +G+ IH QV+++G   N F+ + +IDMY
Sbjct  283   VFRTLVNDSDIRYNAVTLSAVLLACSHAGALQLGKCIHDQVVRMGLEQNVFVGTSIIDMY  342

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK GR+   +  F+   +K++  WS+MI GYGM+G+  EALE F DM   GI+PN +  I
Sbjct  343   CKCGRVEMARKAFERMKEKNVKSWSAMIAGYGMHGYAKEALEVFYDMKRIGIKPNYITCI  402

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             SVL+ACSH GL  EGW+ F +M+  + + P + HY CMVD+L R G + +A + +  M +
Sbjct  403   SVLAACSHAGLVEEGWDCFTSMKRNFGVEPGVEHYGCMVDLLGRAGLLGKAYDLIKGMKV  462

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
             +PD  +WGALLAGCR  H + E++E+ A++L  LD +N  YYV+LSN+YAD GRW +VE+
Sbjct  463   KPDSVVWGALLAGCR-MHKNLELAEISARKLFELDSSNCGYYVLLSNMYADAGRWADVER  521

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             +R LM G    K  G+S++EV   +H        ++E+ QH ++
Sbjct  522   IRVLMKGNGLVKPPGFSLLEVKGKVHVFLV---GDKEHPQHEKI  562


 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/252 (29%), Positives = 127/252 (50%), Gaps = 11/252 (4%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM----  196
            V ++L+ MY+  G I  +R +FD +  +++++W++MI+   Q+D+P  AL +F       
Sbjct  123  VGSSLIDMYSKCGQIWDARKVFDEIPMRNVVSWTSMITGCVQNDEPHEALLLFNEFLAEE  182

Query  197  ----QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK  364
                  E    +  A  S+L AC+ ++ + V E +H   +K G      + + L+D Y K
Sbjct  183  NEIEGEEGFSVDSIALVSVLSACARVSNKIVTEGVHGFSIKRGLEVFLGVGNTLVDAYAK  242

Query  365  FGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHG-IQPNDVVFIS  541
             G +   K +FD   +KD+I W++M+  +  NG   EA+E F  +++   I+ N V   +
Sbjct  243  CGELGMSKKVFDGMIEKDVISWNTMVAVFAQNGLSTEAIEVFRTLVNDSDIRYNAVTLSA  302

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL ACSH G    G    H    +  +   +     ++DM  + G VE A +   +M  E
Sbjct  303  VLLACSHAGALQLG-KCIHDQVVRMGLEQNVFVGTSIIDMYCKCGRVEMARKAFERMK-E  360

Query  722  PDKRIWGALLAG  757
             + + W A++AG
Sbjct  361  KNVKSWSAMIAG  372


 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 113/238 (47%), Gaps = 14/238 (6%)
 Frame = +2

Query  113  DIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIH  292
            ++ +W+++I+  A+S     A+  F  M+     PN   F   +++CSS+   + G   H
Sbjct  50   NVYSWNSVIAELARSGDSIEAIRAFASMRKLSLLPNRNTFPCTIKSCSSLFDVNSGRQAH  109

Query  293  TQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGN  472
             Q    GY  + F+ S LIDMY K G+I   + +FDE P ++++ W+SMI G   N   +
Sbjct  110  QQAFVFGYDYDLFVGSSLIDMYSKCGQIWDARKVFDEIPMRNVVSWTSMITGCVQNDEPH  169

Query  473  EALECFLDMLS--------HGIQPNDVVFISVLSACSHCG--LEYEGWNWFHAMEEKYDI  622
            EAL  F + L+         G   + +  +SVLSAC+     +  EG    H    K  +
Sbjct  170  EALLLFNEFLAEENEIEGEEGFSVDSIALVSVLSACARVSNKIVTEG---VHGFSIKRGL  226

Query  623  TPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISEL  796
               L     +VD  ++ G +  + +  + M IE D   W  ++A   +   S+E  E+
Sbjct  227  EVFLGVGNTLVDAYAKCGELGMSKKVFDGM-IEKDVISWNTMVAVFAQNGLSTEAIEV  283



>gb|KHM99224.1| Pentatricopeptide repeat-containing protein, mitochondrial, partial 
[Glycine soja]
Length=534

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 214/345 (62%), Gaps = 7/345 (2%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF   + V   L+  YA  G +  +R +FD + + D  +W++MI+ YAQ+   + A  
Sbjct  88    KRGFEGSVGVGNTLMDAYAKCGEMGVARKVFDGMDESDDYSWNSMIAEYAQNGLSAEAFC  147

Query  182   VFRRMQLEHGKP--NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM  355
             VF  M ++ GK   N     ++L AC+S  A  +G+ IH QV+K+    + F+ + ++DM
Sbjct  148   VFGEM-VKSGKVRYNAVTLSAVLLACASSGALQLGKCIHDQVIKMDLEDSVFVGTSIVDM  206

Query  356   YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVF  535
             YCK GR+   +  FD    K++  W++MI GYGM+G   EA+E F  M+  G++PN + F
Sbjct  207   YCKCGRVEMARKAFDRMKVKNVKSWTAMIAGYGMHGCAKEAMEIFYKMIRSGVKPNYITF  266

Query  536   ISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMP  715
             +SVL+ACSH G+  EGW+WF+ M+ ++++ P + HY+CMVD+L R G + EA   + +M 
Sbjct  267   VSVLAACSHAGMLKEGWHWFNRMKCEFNVEPGIEHYSCMVDLLGRAGCLNEAYGLIQEMN  326

Query  716   IEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVE  895
             ++PD  IWG+LL  CR  H + E+ E+ A++L  LDP+N  YYV+LSN+YAD GRW +VE
Sbjct  327   VKPDFIIWGSLLGACR-IHKNVELGEISARKLFELDPSNCGYYVLLSNIYADAGRWADVE  385

Query  896   KLRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             ++R LM  +   K  G+S+VE+   +H        ++E+ QH ++
Sbjct  386   RMRILMKSRGLLKTPGFSIVELKGRIHVFLV---GDKEHPQHEKI  427


 Score =   108 bits (271),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 73/273 (27%), Positives = 133/273 (49%), Gaps = 13/273 (5%)
 Frame = +2

Query  71   IESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNE---------  223
            ++ SR LFD +  + +++W+++I+ Y Q+D+  +A+ +F+ + +E     E         
Sbjct  1    VKDSRHLFDEIPDRSVVSWTSIIAGYVQNDRARDAVRIFKELLVEESGSLESEDGVFVDS  60

Query  224  FAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDE  403
                 ++ ACS +  + V E +H  V+K G+  +  + + L+D Y K G +   + +FD 
Sbjct  61   VLLGCVVSACSKVGRRSVTEGVHGWVIKRGFEGSVGVGNTLMDAYAKCGEMGVARKVFDG  120

Query  404  NPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHG-IQPNDVVFISVLSACSHCGLEYE  580
              + D   W+SMI  Y  NG   EA   F +M+  G ++ N V   +VL AC+  G    
Sbjct  121  MDESDDYSWNSMIAEYAQNGLSAEAFCVFGEMVKSGKVRYNAVTLSAVLLACASSGALQL  180

Query  581  GWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
            G    H    K D+   +     +VDM  + G VE A +  ++M ++  K  W A++AG 
Sbjct  181  G-KCIHDQVIKMDLEDSVFVGTSIVDMYCKCGRVEMARKAFDRMKVKNVKS-WTAMIAGY  238

Query  761  RKTHGSSEISELVAKQLIS-LDPTNASYYVILS  856
                 + E  E+  K + S + P   ++  +L+
Sbjct  239  GMHGCAKEAMEIFYKMIRSGVKPNYITFVSVLA  271



>ref|XP_003608008.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES90205.1| PPR containing plant protein [Medicago truncatula]
Length=1183

 Score =   296 bits (757),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/320 (43%), Positives = 210/320 (66%), Gaps = 2/320 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K+G    +PV  AL+ MYA  G++E +R++F  +  KDI++W+ MI  Y+Q+  P+ AL 
Sbjct  700   KNGMGSNLPVTNALINMYAKCGSVEEARLVFSKIPVKDIVSWNTMIGGYSQNSLPNEALE  759

Query  182   VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             +F  MQ +  KP++     +L AC+ +AA D G  IH  +++ GY S+  +A  L+DMY 
Sbjct  760   LFLDMQ-KQFKPDDITMACVLPACAGLAALDKGREIHGHILRRGYFSDLHVACALVDMYA  818

Query  362   KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
             K G +   + +FD  P KDLI W+ MI GYGM+G GNEA+  F +M   GI+P++  F  
Sbjct  819   KCGLLVLAQLLFDMIPKKDLISWTVMIAGYGMHGFGNEAISTFNEMRIAGIEPDESSFSV  878

Query  542   VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
             +L+ACSH GL  EGW +F++M  +  + PKL HYAC+VD+L+R GN+ +A +F+  MPI+
Sbjct  879   ILNACSHSGLLNEGWKFFNSMRNECGVEPKLEHYACVVDLLARMGNLSKAYKFIESMPIK  938

Query  722   PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
             PD  IWG LL+GCR  H   +++E VA+ +  L+P N  YYV+L+N+YA+  +W+EV+KL
Sbjct  939   PDTTIWGVLLSGCR-IHHDVKLAEKVAEHIFELEPDNTRYYVVLANVYAEAEKWEEVKKL  997

Query  902   RQLMDGKKRKKGMGYSVVEV  961
             R+ M  +  K+  G S +EV
Sbjct  998   RKRMQKRGFKQNPGCSWIEV  1017


 Score =   138 bits (347),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 89/294 (30%), Positives = 153/294 (52%), Gaps = 20/294 (7%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+ F + +     LL MY+  GN+  +  +F  +    I++W++ I+AY +    S+A+ 
Sbjct  599  KACFSEEVVFSNTLLDMYSKCGNLNGATEVFVKMGDTTIVSWTSTIAAYVREGLYSDAIG  658

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  MQ +  +P+ +   S++ AC+  ++ D G  +H+ V+K G  SN  + + LI+MY 
Sbjct  659  LFDEMQSKGVRPDIYTVTSIVHACACSSSLDKGRDVHSYVIKNGMGSNLPVTNALINMYA  718

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G + + + +F + P KD++ W++MI GY  N   NEALE FLDM     +P+D+    
Sbjct  719  KCGSVEEARLVFSKIPVKDIVSWNTMIGGYSQNSLPNEALELFLDMQKQ-FKPDDITMAC  777

Query  542  VLSACSHC-----GLEYEGWNWFHAMEEKY--DITPKLAHYAC-MVDMLSRQGNVEEALE  697
            VL AC+       G E  G    H +   Y  D+     H AC +VDM ++ G +  A  
Sbjct  778  VLPACAGLAALDKGREIHG----HILRRGYFSDL-----HVACALVDMYAKCGLLVLAQL  828

Query  698  FVNKMPIEPDKRIWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVILS  856
              + +P + D   W  ++AG      G+  IS     ++  ++P  +S+ VIL+
Sbjct  829  LFDMIP-KKDLISWTVMIAGYGMHGFGNEAISTFNEMRIAGIEPDESSFSVILN  881


 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 115/224 (51%), Gaps = 1/224 (0%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            L+ MY N G++   R +FD +    +  W+ ++S YA+      ++++F++MQ      N
Sbjct  410  LVFMYVNCGDLVQGRKIFDKIMNDKVFLWNLLMSEYAKIGNFRESVSLFKKMQKLGVVGN  469

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
             + F  +L+  +++      + +H  V+KLG+ SN  + + LI  Y KFG +     +FD
Sbjct  470  CYTFTCVLKCFAALGKVKECKRVHGYVLKLGFGSNTAVVNSLIAAYFKFGGVESAHNLFD  529

Query  401  ENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYE  580
            E  + D++ W+SMING  +NG     LE F+ ML  G++ +    +SVL A ++ G    
Sbjct  530  ELSEPDVVSWNSMINGCVVNGFSGNGLEIFIQMLILGVEVDLTTLVSVLVAWANIGNLSL  589

Query  581  GWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
            G    H    K   + ++     ++DM S+ GN+  A E   KM
Sbjct  590  G-RALHGFGVKACFSEEVVFSNTLLDMYSKCGNLNGATEVFVKM  632


 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 80/297 (27%), Positives = 146/297 (49%), Gaps = 6/297 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     VV +L+  Y  FG +ES+  LFD LS+ D+++W++MI+    +    N L 
Sbjct  498  KLGFGSNTAVVNSLIAAYFKFGGVESAHNLFDELSEPDVVSWNSMINGCVVNGFSGNGLE  557

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F +M +   + +     S+L A +++    +G  +H   +K  ++     ++ L+DMY 
Sbjct  558  IFIQMLILGVEVDLTTLVSVLVAWANIGNLSLGRALHGFGVKACFSEEVVFSNTLLDMYS  617

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G ++    +F +  D  ++ W+S I  Y   G  ++A+  F +M S G++P+     S
Sbjct  618  KCGNLNGATEVFVKMGDTTIVSWTSTIAAYVREGLYSDAIGLFDEMQSKGVRPDIYTVTS  677

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            ++ AC+ C    +     H+   K  +   L     +++M ++ G+VEEA    +K+P++
Sbjct  678  IVHACA-CSSSLDKGRDVHSYVIKNGMGSNLPVTNALINMYAKCGSVEEARLVFSKIPVK  736

Query  722  PDKRIWGALLAGCRKTHGSSEISEL---VAKQLISLDPTNASYYVILSNLYA-DQGR  880
             D   W  ++ G  +    +E  EL   + KQ    D T A      + L A D+GR
Sbjct  737  -DIVSWNTMIGGYSQNSLPNEALELFLDMQKQFKPDDITMACVLPACAGLAALDKGR  792


 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 100/229 (44%), Gaps = 4/229 (2%)
 Frame = +2

Query  128  SAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMK  307
            +A I+ + +     NA+ +  + +      N +   S+LQ C+   + + G+ +H+ ++ 
Sbjct  340  NAKINKFCEMGDLRNAIELLTKSKSYELGLNSYC--SVLQLCAEKKSLEDGKRVHSVIIS  397

Query  308  LGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALEC  487
             G + +  L + L+ MY   G + QG+ IFD+  +  +  W+ +++ Y   G+  E++  
Sbjct  398  NGISIDEALGAKLVFMYVNCGDLVQGRKIFDKIMNDKVFLWNLLMSEYAKIGNFRESVSL  457

Query  488  FLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLS  667
            F  M   G+  N   F  VL   +  G + +     H    K       A    ++    
Sbjct  458  FKKMQKLGVVGNCYTFTCVLKCFAALG-KVKECKRVHGYVLKLGFGSNTAVVNSLIAAYF  516

Query  668  RQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLI  814
            + G VE A    +++  EPD   W +++ GC     S    E+  + LI
Sbjct  517  KFGGVESAHNLFDELS-EPDVVSWNSMINGCVVNGFSGNGLEIFIQMLI  564



>gb|ABR17838.1| unknown [Picea sitchensis]
Length=795

 Score =   290 bits (742),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/324 (42%), Positives = 207/324 (64%), Gaps = 1/324 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            +SGF     V  AL+ MYA  GN+ S+  LF+ + +K+++AW+A+IS Y+Q   P  ALA
Sbjct  350  RSGFESNDVVGNALVNMYAKCGNVNSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEALA  409

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  MQ +  KP+ FA  S+L AC+   A + G+ IH   ++ G+ SN  + +GL+D+Y 
Sbjct  410  LFIEMQAQGIKPDSFAIVSVLPACAHFLALEQGKQIHGYTIRSGFESNVVVGTGLVDIYA  469

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G ++  + +F+  P++D++ W++MI  YG++GHG +AL  F  M   G + + + F +
Sbjct  470  KCGNVNTAQKLFERMPEQDVVSWTTMILAYGIHGHGEDALALFSKMQETGTKLDHIAFTA  529

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L+ACSH GL  +G  +F  M+  Y + PKL HYAC+VD+L R G+++EA   +  M +E
Sbjct  530  ILTACSHAGLVDQGLQYFQCMKSDYGLAPKLEHYACLVDLLGRAGHLDEANGIIKNMSLE  589

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD  +WGALL  CR  H + E+ E  AK L  LDP NA YYV+LSN+YA+  RW++V KL
Sbjct  590  PDANVWGALLGACR-IHCNIELGEQAAKHLFELDPDNAGYYVLLSNIYAEAQRWEDVAKL  648

Query  902  RQLMDGKKRKKGMGYSVVEVNNSM  973
            R++M  K  KK  G SVV V+  +
Sbjct  649  RKMMKEKGVKKQPGCSVVAVHRDV  672


 Score =   161 bits (407),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 139/250 (56%), Gaps = 2/250 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            +SG    + VV  L+ MYA  GN+ ++  LF+ +  +D+ +W+A+I  Y+ + Q   ALA
Sbjct  249  RSGIESDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIGGYSLNSQHHEALA  308

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             F RMQ+   KPN     S+L AC+ + A + G+ IH   ++ G+ SN  + + L++MY 
Sbjct  309  FFNRMQVRGIKPNSITMVSVLPACAHLFALEQGQQIHGYAIRSGFESNDVVGNALVNMYA  368

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G ++    +F+  P K+++ W+++I+GY  +GH +EAL  F++M + GI+P+    +S
Sbjct  369  KCGNVNSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVS  428

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL AC+H  L  E     H    +      +     +VD+ ++ GNV  A +   +MP E
Sbjct  429  VLPACAHF-LALEQGKQIHGYTIRSGFESNVVVGTGLVDIYAKCGNVNTAQKLFERMP-E  486

Query  722  PDKRIWGALL  751
             D   W  ++
Sbjct  487  QDVVSWTTMI  496


 Score =   159 bits (403),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 85/284 (30%), Positives = 157/284 (55%), Gaps = 5/284 (2%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF   + V TAL  MY   G++E++R +FD + ++D+++W+A+I+ Y+Q+ QP  ALA+F
Sbjct  150  GFESDVIVGTALASMYTKCGSLENARQVFDRMPKRDVVSWNAIIAGYSQNGQPYEALALF  209

Query  188  RRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKF  367
              MQ+   KPN     S++  C+ + A + G+ IH   ++ G  S+  + +GL++MY K 
Sbjct  210  SEMQVNGIKPNSSTLVSVMPVCAHLLALEQGKQIHCYAIRSGIESDVLVVNGLVNMYAKC  269

Query  368  GRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVL  547
            G ++    +F+  P +D+  W+++I GY +N   +EAL  F  M   GI+PN +  +SVL
Sbjct  270  GNVNTAHKLFERMPIRDVASWNAIIGGYSLNSQHHEALAFFNRMQVRGIKPNSITMVSVL  329

Query  548  SACSHC-GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEP  724
             AC+H   LE       +A+   ++    + +   +V+M ++ GNV  A +   +MP + 
Sbjct  330  PACAHLFALEQGQQIHGYAIRSGFESNDVVGN--ALVNMYAKCGNVNSAYKLFERMP-KK  386

Query  725  DKRIWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
            +   W A+++G  +  H    ++  +  Q   + P + +   +L
Sbjct  387  NVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVL  430


 Score =   122 bits (307),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/254 (28%), Positives = 124/254 (49%), Gaps = 13/254 (5%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILF-----DSLSQKDI----IAWSAMISAYAQSDQPSNA  175
            +P  T + Q+  N   ++++R +         +Q DI    + W   I  Y ++   + A
Sbjct  47   LPTSTVVAQLRRN--KVKTTREVSACANQTQFTQTDIRNNAVVWKETIIGYVKNGFWNKA  104

Query  176  LAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM  355
            L ++ +MQ     P++  F S+++AC S +    G  +H  ++  G+ S+  + + L  M
Sbjct  105  LRLYYQMQRTGINPDKLVFLSVIKACGSQSDLQAGRKVHEDIIARGFESDVIVGTALASM  164

Query  356  YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVF  535
            Y K G +   + +FD  P +D++ W+++I GY  NG   EAL  F +M  +GI+PN    
Sbjct  165  YTKCGSLENARQVFDRMPKRDVVSWNAIIAGYSQNGQPYEALALFSEMQVNGIKPNSSTL  224

Query  536  ISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMP  715
            +SV+  C+H  L  E     H    +  I   +     +V+M ++ GNV  A +   +MP
Sbjct  225  VSVMPVCAHL-LALEQGKQIHCYAIRSGIESDVLVVNGLVNMYAKCGNVNTAHKLFERMP  283

Query  716  IEPDKRIWGALLAG  757
            I  D   W A++ G
Sbjct  284  IR-DVASWNAIIGG  296



>ref|XP_002278128.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290 
[Vitis vinifera]
Length=597

 Score =   285 bits (730),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/318 (41%), Positives = 204/318 (64%), Gaps = 1/318 (0%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            + +  AL+ +Y   GN+E++R LFD +  +++++W+AMI+AY Q++  +NA+ +FRRMQ 
Sbjct  264  VSLTNALIALYGKCGNVETARSLFDGMVVQNLVSWNAMIAAYEQNNAGANAVKLFRRMQA  323

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            E    +     S++ AC+S+ A + G  +H  V + G   N  + + LIDMY K G I  
Sbjct  324  EKVDFDYITMVSVISACASLGALNTGRWMHELVKRKGLEINVSITNALIDMYAKCGNIDL  383

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + +F+  P + ++ W+SMI     +GHG +AL+ F  M   G++PN   F +V +AC H
Sbjct  384  AREVFERLPCRSVVSWTSMIGACASHGHGEDALKLFSRMKDEGVKPNSFTFAAVFTACRH  443

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             GL  EG   F +M   Y I P + H ACMVD+L R G++ EA EF++KMP+EPD  +WG
Sbjct  444  SGLVEEGRKHFESMMRDYSIMPGVEHCACMVDLLGRAGSLMEAYEFIDKMPVEPDVSVWG  503

Query  743  ALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGK  922
            ALL  CR  H + E++ELVA++L  LDP   ++YV++SN+YA+ GRW++  +LR+LM+ +
Sbjct  504  ALLGSCR-IHSNLELAELVAEKLFLLDPQTVTFYVLMSNIYAEAGRWEDAARLRKLMEER  562

Query  923  KRKKGMGYSVVEVNNSMH  976
            + KK  G+S+VEVN   H
Sbjct  563  ELKKIPGHSLVEVNRRFH  580


 Score =   128 bits (322),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/261 (27%), Positives = 134/261 (51%), Gaps = 3/261 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   + V ++L+ MY+  G      ++F  +  ++I++W+A+I+ Y Q+      L 
Sbjct  156  KHGFDSDVFVQSSLVAMYSQSGETLGMELVFGEMVVRNIVSWTAVIAGYVQNRYFKEGLG  215

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            VFR M     +PN     S+L AC+ +   ++G+ IH   +KLG   +  L + LI +Y 
Sbjct  216  VFREMVGSGTQPNAVTLVSVLPACAGLEFLNLGKLIHGYGIKLGVDPDVSLTNALIALYG  275

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +   +++FD    ++L+ W++MI  Y  N  G  A++ F  M +  +  + +  +S
Sbjct  276  KCGNVETARSLFDGMVVQNLVSWNAMIAAYEQNNAGANAVKLFRRMQAEKVDFDYITMVS  335

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            V+SAC+  G    G  W H + ++  +   ++    ++DM ++ GN++ A E   ++P  
Sbjct  336  VISACASLGALNTG-RWMHELVKRKGLEINVSITNALIDMYAKCGNIDLAREVFERLPCR  394

Query  722  PDKRIWGALLAGCRKTHGSSE  784
                 W +++  C  +HG  E
Sbjct  395  SVVS-WTSMIGAC-ASHGHGE  413


 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 141/280 (50%), Gaps = 13/280 (5%)
 Frame = +2

Query  68   NIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQ  247
             ++ +R +FD + ++D+  W+ +I  YA +     ALA++  M      P+ + F  +++
Sbjct  77   TMDYARKMFDQMPKRDVFLWNTLIRGYADAGPCEEALALYSNMHGAGLFPDNYTFPFVVR  136

Query  248  ACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLIC  427
            +C+ ++A   G+ +H  ++K G+ S+ F+ S L+ MY + G     + +F E   ++++ 
Sbjct  137  SCAVLSALREGKEVHCNIVKHGFDSDVFVQSSLVAMYSQSGETLGMELVFGEMVVRNIVS  196

Query  428  WSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGW-NWFHAM  604
            W+++I GY  N +  E L  F +M+  G QPN V  +SVL AC+  GLE+       H  
Sbjct  197  WTAVIAGYVQNRYFKEGLGVFREMVGSGTQPNAVTLVSVLPACA--GLEFLNLGKLIHGY  254

Query  605  EEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSE  784
              K  + P ++    ++ +  + GNVE A    + M ++ +   W A++A   + +  + 
Sbjct  255  GIKLGVDPDVSLTNALIALYGKCGNVETARSLFDGMVVQ-NLVSWNAMIAAYEQNNAGAN  313

Query  785  ISELVAKQLISLDPTNASYYVILSNLYA-------DQGRW  883
              +L  +  +  +  +  Y  ++S + A       + GRW
Sbjct  314  AVKLFRR--MQAEKVDFDYITMVSVISACASLGALNTGRW  351


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 82/178 (46%), Gaps = 6/178 (3%)
 Frame = +2

Query  227  AFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFG-RIHQGKTIFDE  403
            +F+ LL  CSS+   D+   IH  V+  G   N  L++ LI   C     +   + +FD+
Sbjct  31   SFNYLLNCCSSLP--DLSR-IHALVVTNGCGQNLLLSTKLIITACCLAPTMDYARKMFDQ  87

Query  404  NPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEG  583
             P +D+  W+++I GY   G   EAL  + +M   G+ P++  F  V+ +C+      EG
Sbjct  88   MPKRDVFLWNTLIRGYADAGPCEEALALYSNMHGAGLFPDNYTFPFVVRSCAVLSALREG  147

Query  584  WNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
                H    K+     +   + +V M S+ G     +E V    +  +   W A++AG
Sbjct  148  -KEVHCNIVKHGFDSDVFVQSSLVAMYSQSGET-LGMELVFGEMVVRNIVSWTAVIAG  203



>ref|XP_010502622.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial-like [Camelina sativa]
Length=663

 Score =   287 bits (734),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/346 (39%), Positives = 215/346 (62%), Gaps = 7/346 (2%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFG--NIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNA  175
             K GF + + V   LL  YA  G   +  +R +FD +  KD +++++++  YAQS  P+ A
Sbjct  215   KRGFDRGVSVGNTLLDAYAKGGEGGVAVARNIFDQIVDKDRVSYNSIMGVYAQSGMPNEA  274

Query  176   LAVFRRMQLEHGKP-NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
               VFRR+  +     N     ++L A S   A  +G+ IH QV+++G   +  + + LID
Sbjct  275   FEVFRRLVEDKVVTFNSITLSTVLLAVSHSGALRIGKCIHDQVIRMGLEDDVIIGTSLID  334

Query  353   MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVV  532
             MYCK GR+   + +FD    K++  W++MI GYGM+GH  +ALE F  M+  G++PN + 
Sbjct  335   MYCKCGRVETARKVFDRMKYKNVRSWTAMIAGYGMHGHAAKALELFPAMIDSGVRPNYIT  394

Query  533   FISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
             F+SVL+ACSH GL  EGW WF+AM+ ++D+ P L HY CMVD+L R G +++A + +  M
Sbjct  395   FVSVLAACSHAGLHVEGWRWFNAMKGRFDVEPGLEHYGCMVDLLGRAGFLQKAYDLIQTM  454

Query  713   PIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEV  892
              ++PD  IW +LLAGCR  H + E++E+   +L  LD +N  YY++LS++YAD GRW +V
Sbjct  455   KMKPDSIIWSSLLAGCR-IHKNVELAEISVARLFELDSSNCGYYMLLSHIYADAGRWKDV  513

Query  893   EKLRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             E++R +M  +   K  G+S++E+N  +H        ++E+ +H ++
Sbjct  514   ERVRMIMKNRGLVKPPGFSLLELNGEVHVFLI---GDEEHPEHEKI  556


 Score =   111 bits (277),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 154/318 (48%), Gaps = 21/318 (7%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G+   I V +AL+ MY+  G ++ +R +FD +  + I++W++MI  Y  +    +A+++F
Sbjct  106  GYQSDIFVSSALIVMYSTCGQLKDARKVFDEIPSRKIVSWTSMIRGYDLNGNAIDAVSLF  165

Query  188  RRMQLEHGKP----------NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLA  337
            + + +E              +     S++ ACS +AA+ + E+IH+ V+K G+     + 
Sbjct  166  KDLLVEENDGDHEGDDAMFLDSMGMVSVISACSRVAAKGLTESIHSFVIKRGFDRGVSVG  225

Query  338  SGLIDMYCKFGR--IHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHG  511
            + L+D Y K G   +   + IFD+  DKD + ++S++  Y  +G  NEA E F  ++   
Sbjct  226  NTLLDAYAKGGEGGVAVARNIFDQIVDKDRVSYNSIMGVYAQSGMPNEAFEVFRRLVEDK  285

Query  512  IQP-NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEE  688
            +   N +   +VL A SH G    G    H    +  +   +     ++DM  + G VE 
Sbjct  286  VVTFNSITLSTVLLAVSHSGALRIG-KCIHDQVIRMGLEDDVIIGTSLIDMYCKCGRVET  344

Query  689  ALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLIS-LDPTNASYYVIL----  853
            A +  ++M  + + R W A++AG      +++  EL    + S + P   ++  +L    
Sbjct  345  ARKVFDRMKYK-NVRSWTAMIAGYGMHGHAAKALELFPAMIDSGVRPNYITFVSVLAACS  403

Query  854  -SNLYADQGRWDEVEKLR  904
             + L+ +  RW    K R
Sbjct  404  HAGLHVEGWRWFNAMKGR  421


 Score = 99.0 bits (245),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 89/163 (55%), Gaps = 10/163 (6%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + + D+ +W+++I+  A+S   + AL  F  M+     P   +F   ++ACSS+     G
Sbjct  36   VDKTDVFSWNSVIADLARSGDSAEALRAFSSMRKLSLYPTRSSFPCTIKACSSLLDIFSG  95

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q    GY S+ F++S LI MY   G++   + +FDE P + ++ W+SMI GY +N
Sbjct  96   KQTHQQAFVFGYQSDIFVSSALIVMYSTCGQLKDARKVFDEIPSRKIVSWTSMIRGYDLN  155

Query  461  GHGNEALECFLDMLSH----GIQPNDVVF------ISVLSACS  559
            G+  +A+  F D+L        + +D +F      +SV+SACS
Sbjct  156  GNAIDAVSLFKDLLVEENDGDHEGDDAMFLDSMGMVSVISACS  198



>ref|XP_007047423.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOX91580.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=633

 Score =   286 bits (731),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/320 (42%), Positives = 195/320 (61%), Gaps = 1/320 (0%)
 Frame = +2

Query  17   KCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM  196
            K +   T +L  YA  G +E +R+LFD + +KD++ W+ MI  YAQ   P+ AL +FRRM
Sbjct  193  KSLVSFTTMLTCYAKHGELEEARLLFDGMVKKDVVCWNVMIDGYAQHGMPNEALVLFRRM  252

Query  197  QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
                 +PNE    ++L AC+ + A + G  +HT +       N  +A+ LIDMY K G +
Sbjct  253  LAAKARPNEITILAVLSACAQLGALESGRWLHTYIDNNNIQVNVRVATALIDMYSKCGSL  312

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
               + +FD  PDKD++ W+SMI GY ++G   EALE F  M    ++P D+ FI VL AC
Sbjct  313  EDARLVFDRIPDKDVVAWNSMIIGYALHGFSQEALELFHGMCRTRLRPTDITFIGVLGAC  372

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
             H GL  EGW+ F+AM+++Y I PK+ HY CMV++L R G +EEA E    M IEPD  +
Sbjct  373  GHAGLVNEGWSLFYAMKDEYGIEPKIEHYGCMVNLLGRAGRLEEAYELAKNMKIEPDPIL  432

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            WGALL  CR  HG+ ++ E + + L+  +  N+  Y++LSN+YA +G W+ V ++R LM 
Sbjct  433  WGALLGACR-LHGNIDLGEKIVEFLVGHNVANSGTYILLSNMYAAKGNWEGVARIRTLMK  491

Query  917  GKKRKKGMGYSVVEVNNSMH  976
                +K  G S +EVN+ +H
Sbjct  492  DSGVQKEPGCSSIEVNSKVH  511


 Score =   139 bits (349),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/309 (28%), Positives = 154/309 (50%), Gaps = 39/309 (13%)
 Frame = +2

Query  26   PVVTALLQM-YANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            P++   LQ  Y++ G ++ S  LF+     +I  ++++I+A+A       AL ++ RM  
Sbjct  67   PILNFKLQRSYSSLGRLDYSLALFNRTLNPNIFFYTSIINAHALHGLSQEALFIYTRMLF  126

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM---------  355
            E  +PNEF F S+L++CS     + G+ +H+Q +K G+ S+ ++ +GL+D+         
Sbjct  127  EGVQPNEFTFSSILKSCSF----EHGKMLHSQAIKFGFDSDLYVKTGLVDVYARGGDIGS  182

Query  356  ----------------------YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHG  469
                                  Y K G + + + +FD    KD++CW+ MI+GY  +G  
Sbjct  183  ARLVFERMLEKSLVSFTTMLTCYAKHGELEEARLLFDGMVKKDVVCWNVMIDGYAQHGMP  242

Query  470  NEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYAC  649
            NEAL  F  ML+   +PN++  ++VLSAC+  G   E   W H   +  +I   +     
Sbjct  243  NEALVLFRRMLAAKARPNEITILAVLSACAQLG-ALESGRWLHTYIDNNNIQVNVRVATA  301

Query  650  MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQL-ISLDP  826
            ++DM S+ G++E+A    +++P + D   W +++ G      S E  EL        L P
Sbjct  302  LIDMYSKCGSLEDARLVFDRIP-DKDVVAWNSMIIGYALHGFSQEALELFHGMCRTRLRP  360

Query  827  TNASYYVIL  853
            T+ ++  +L
Sbjct  361  TDITFIGVL  369


 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/215 (25%), Positives = 98/215 (46%), Gaps = 11/215 (5%)
 Frame = +2

Query  287  IHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGH  466
            IH  +++ G   +  L   L   Y   GR+     +F+   + ++  ++S+IN + ++G 
Sbjct  54   IHATLLRRGLHDHPILNFKLQRSYSSLGRLDYSLALFNRTLNPNIFFYTSIINAHALHGL  113

Query  467  GNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYA  646
              EAL  +  ML  G+QPN+  F S+L +CS     +E     H+   K+     L    
Sbjct  114  SQEALFIYTRMLFEGVQPNEFTFSSILKSCS-----FEHGKMLHSQAIKFGFDSDLYVKT  168

Query  647  CMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDP  826
             +VD+ +R G++  A     +M +E     +  +L  C   HG  E + L+   ++  D 
Sbjct  169  GLVDVYARGGDIGSARLVFERM-LEKSLVSFTTMLT-CYAKHGELEEARLLFDGMVKKD-  225

Query  827  TNASYYVILSNLYADQGRWDEVEKL-RQLMDGKKR  928
                 + ++ + YA  G  +E   L R+++  K R
Sbjct  226  --VVCWNVMIDGYAQHGMPNEALVLFRRMLAAKAR  258



>ref|XP_010449130.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
isoform X2 [Camelina sativa]
Length=599

 Score =   285 bits (728),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/326 (40%), Positives = 215/326 (66%), Gaps = 2/326 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            +SGF   I    +LL +YAN G++ S+  +FD + +KD++AW+++I+ +A++ +P+ ALA
Sbjct  153  RSGFGSLIFAQNSLLHLYANCGDLSSAYKVFDEMPEKDLVAWNSVINGFAENGKPNEALA  212

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++  M  +  KP+ F   SLL AC+ + A  +G+ IH  ++K+G T N    + L+D+Y 
Sbjct  213  LYNEMDSKGIKPDGFTIVSLLSACAKIGALTLGKRIHVYMIKVGLTRNLHSRNVLLDLYG  272

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLS-HGIQPNDVVFI  538
            + GR+ + KT+F E  DK+ + W+S+I G  +NG G EA+E F DM S  G+ P ++ F+
Sbjct  273  RCGRVEEAKTLFYEMVDKNSVSWTSLIVGLAVNGFGKEAIELFRDMESKEGLVPCEITFV  332

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             +L ACSHCG+  EG+ +F  M E+Y I P++ H+ CMVD+L+R G V+EA E++ KMP+
Sbjct  333  GILYACSHCGMVKEGFEYFRRMREEYKIEPRIEHFGCMVDLLARAGQVKEAYEYIMKMPM  392

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
            +P+  IW  LL  C   HG +E++E    Q++ L+P ++  YV+LSN+YA + RW +V+K
Sbjct  393  QPNVVIWRTLLGAC-TVHGDAELAEYARLQILQLEPNHSGDYVLLSNMYASEQRWSDVQK  451

Query  899  LRQLMDGKKRKKGMGYSVVEVNNSMH  976
            +R+ M     +K  G+S+VEV N +H
Sbjct  452  IRKQMLRDGVRKVPGHSLVEVGNRVH  477


 Score =   121 bits (303),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/219 (32%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  DIIAWSAMISAYAQSDQ---PSNALAVFRRMQLEH-GKPNEFAFHSLLQACSSMAAQDVG  280
            +I  W+ +I  YA+        +A++++R M++    +P+   +  LL+A +  A   +G
Sbjct  85   NIFVWNTLIRGYAECSSNYASVSAISLYREMKVSGLVEPDTHTYPFLLKAVAKTADVRLG  144

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            ETIH+ V++ G+ S  F  + L+ +Y   G +     +FDE P+KDL+ W+S+ING+  N
Sbjct  145  ETIHSVVIRSGFGSLIFAQNSLLHLYANCGDLSSAYKVFDEMPEKDLVAWNSVINGFAEN  204

Query  461  GHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAH  640
            G  NEAL  + +M S GI+P+    +S+LSAC+  G    G    H    K  +T  L  
Sbjct  205  GKPNEALALYNEMDSKGIKPDGFTIVSLLSACAKIGALTLG-KRIHVYMIKVGLTRNLHS  263

Query  641  YACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
               ++D+  R G VEEA     +M ++ +   W +L+ G
Sbjct  264  RNVLLDLYGRCGRVEEAKTLFYEM-VDKNSVSWTSLIVG  301



>gb|KGN56518.1| hypothetical protein Csa_3G122420 [Cucumis sativus]
Length=551

 Score =   283 bits (724),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 171/236 (72%), Gaps = 0/236 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GFL  I V T LLQMYA FG++  ++++FD L  KDIIAWSAMISAY+  + P NA+ 
Sbjct  315  KGGFLCFILVGTELLQMYAKFGDLRLAKLVFDGLVDKDIIAWSAMISAYSHGEDPLNAIQ  374

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             F+ MQ  + KPNE  F SL+ ACSS+ A+++GETI    +K GYTSN  L S L+  YC
Sbjct  375  TFKMMQSTNEKPNERTFVSLMDACSSLGAKELGETIQAHTIKCGYTSNTHLMSALVGFYC  434

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K GRI  G+ +FDE   KD+ICW+++I GYG+NG GN+AL  F DMLS+G++PN VVF S
Sbjct  435  KLGRIKLGEHVFDEISRKDVICWNALIKGYGLNGCGNKALNTFSDMLSYGLKPNGVVFAS  494

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNK  709
            +LSAC+ CGLE E   WF +M ++Y ITP +AHYAC+VD+L RQG + EA+EFV K
Sbjct  495  LLSACAQCGLEKEVRMWFRSMNDEYGITPTMAHYACIVDLLVRQGKIREAVEFVKK  550


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 119/233 (51%), Gaps = 3/233 (1%)
 Frame = +2

Query  107  QKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGET  286
            ++D+I+W++ I+   ++ QP +A   F+ M     +PN     S+++A  +++   + E 
Sbjct  48   REDVISWTSKITNLVRTGQPESAFGFFKMMFSNGHRPNYVTMLSVIRAIDALSWDSMIEV  107

Query  287  IHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGH  466
            +H  V+K+G+ S   +++ L+  Y     I     +F++ P KD++ WS++I+    NG 
Sbjct  108  MHGVVIKMGFESEVAVSTALLGFY-SIRDIETVWKLFNQIPSKDVVLWSAIISVCVKNGQ  166

Query  467  GNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYA  646
             NEA +   +M   G+QPN V  +S+L AC+  G+   G    HA   + D    +    
Sbjct  167  YNEAFDLLREMQDQGVQPNQVTIVSILPACADFGVLSLG-KELHAFSMRRDFYSMVDLQN  225

Query  647  CMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAK  805
             ++DM S+    E ++  V K+  + D   W  +   C + +  S++ ++ ++
Sbjct  226  SLMDMYSKCRKFEASIR-VLKLMRKKDAVSWKIITHACIQNNCPSKVFKIFSR  277


 Score = 94.7 bits (234),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 114/252 (45%), Gaps = 2/252 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            +  F   + +  +L+ MY+     E+S  +   + +KD ++W  +  A  Q++ PS    
Sbjct  214  RRDFYSMVDLQNSLMDMYSKCRKFEASIRVLKLMRKKDAVSWKIITHACIQNNCPSKVFK  273

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F RM+    + +E     ++ A   +    +G  +H   +K G+     + + L+ MY 
Sbjct  274  IFSRMRSFGFELSETMMLDMISAVLLLDELLLGLAVHCYALKGGFLCFILVGTELLQMYA  333

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            KFG +   K +FD   DKD+I WS+MI+ Y        A++ F  M S   +PN+  F+S
Sbjct  334  KFGDLRLAKLVFDGLVDKDIIAWSAMISAYSHGEDPLNAIQTFKMMQSTNEKPNERTFVS  393

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            ++ ACS  G +  G     A   K   T      + +V    + G ++      +++   
Sbjct  394  LMDACSSLGAKELG-ETIQAHTIKCGYTSNTHLMSALVGFYCKLGRIKLGEHVFDEIS-R  451

Query  722  PDKRIWGALLAG  757
             D   W AL+ G
Sbjct  452  KDVICWNALIKG  463


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 91/184 (49%), Gaps = 1/184 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   + V TALL  Y+   +IE+   LF+ +  KD++ WSA+IS   ++ Q + A  
Sbjct  114  KMGFESEVAVSTALLGFYS-IRDIETVWKLFNQIPSKDVVLWSAIISVCVKNGQYNEAFD  172

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            + R MQ +  +PN+    S+L AC+      +G+ +H   M+  + S   L + L+DMY 
Sbjct  173  LLREMQDQGVQPNQVTIVSILPACADFGVLSLGKELHAFSMRRDFYSMVDLQNSLMDMYS  232

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K  +      +      KD + W  + +    N   ++  + F  M S G + ++ + + 
Sbjct  233  KCRKFEASIRVLKLMRKKDAVSWKIITHACIQNNCPSKVFKIFSRMRSFGFELSETMMLD  292

Query  542  VLSA  553
            ++SA
Sbjct  293  MISA  296



>ref|XP_007212650.1| hypothetical protein PRUPE_ppa018206mg, partial [Prunus persica]
 gb|EMJ13849.1| hypothetical protein PRUPE_ppa018206mg, partial [Prunus persica]
Length=604

 Score =   285 bits (728),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/336 (38%), Positives = 212/336 (63%), Gaps = 1/336 (0%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             ++GF   + V   LL MYA  G++ES+  +F+S+S++D++AW+++I+ +A + +P+ AL 
Sbjct  159   RNGFESLVFVKNTLLHMYACCGHVESAHRVFESISERDLVAWNSVINGFALNGRPNEALT  218

Query  182   VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             VFR M LE  +P+ F   SLL AC+ +    +G  IH  ++K+G T N+   + L+D+Y 
Sbjct  219   VFRDMSLEGVQPDGFTMVSLLSACAELGTLALGRRIHVYMLKVGLTGNSHATNALLDLYA  278

Query  362   KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
             K G I + + +F    ++ ++ W++++ G  +NG GNEALE F ++   G+ P ++ F+ 
Sbjct  279   KCGNIREAQKVFKTMDERSVVSWTALVVGLAVNGFGNEALEHFQELRREGLVPTEITFVG  338

Query  542   VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
             VL ACSHCG+  EG+N+F  M+E+Y I P++ HY CM+D+L R G V+EA E++N MP++
Sbjct  339   VLYACSHCGMVDEGFNYFRMMKEEYGIVPRIEHYGCMIDLLGRAGLVKEAYEYINNMPMQ  398

Query  722   PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
             P+  IW  LL  C   HG   + E     +  L+P ++  YV+LSNLYA + RW +V+K+
Sbjct  399   PNAVIWRTLLGAC-TIHGHLALGETARAHIRELEPGHSGDYVLLSNLYASERRWSDVQKV  457

Query  902   RQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQE  1009
             R+ M     +K  GYS+VE+ N ++      RS  +
Sbjct  458   RRTMLSDGVRKTPGYSIVELRNCIYEFTMGDRSHPQ  493


 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 117/226 (52%), Gaps = 8/226 (4%)
 Frame = +2

Query  89   LFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAA  268
            +F  +   ++  W+ MI  YA+S+ P+  L ++ +M +   +P+   +  LL+A + +  
Sbjct  87   IFSQIRSPNVFTWNTMIRGYAESENPTPVLQLYHQMHVNSVEPDTHTYPFLLKAVAKLTN  146

Query  269  QDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMING  448
               GE IH+  ++ G+ S  F+ + L+ MY   G +     +F+   ++DL+ W+S+ING
Sbjct  147  VREGEKIHSIALRNGFESLVFVKNTLLHMYACCGHVESAHRVFESISERDLVAWNSVING  206

Query  449  YGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITP  628
            + +NG  NEAL  F DM   G+QP+    +S+LSAC+  G    G    H    K  +T 
Sbjct  207  FALNGRPNEALTVFRDMSLEGVQPDGFTMVSLLSACAELGTLALG-RRIHVYMLKVGLTG  265

Query  629  KLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKR---IWGALLAG  757
                   ++D+ ++ GN+ EA +    M    D+R    W AL+ G
Sbjct  266  NSHATNALLDLYAKCGNIREAQKVFKTM----DERSVVSWTALVVG  307



>ref|XP_002305733.2| hypothetical protein POPTR_0004s05810g, partial [Populus trichocarpa]
 gb|EEE86244.2| hypothetical protein POPTR_0004s05810g, partial [Populus trichocarpa]
Length=778

 Score =   289 bits (739),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/318 (44%), Positives = 210/318 (66%), Gaps = 2/318 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            I V  AL+ MYA  G++E +  +F  +  KDII+W+ MI  Y+++  P+ AL++F  M L
Sbjct  341  IFVCNALMDMYAKCGSMEDANSVFLEMPVKDIISWNTMIGGYSKNSLPNEALSLFGDMVL  400

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            E  KP+      +L AC+S+A+ D G+ +H  +++ G+ S+  +A+ L+DMY K G    
Sbjct  401  EM-KPDGTTLACILPACASLASLDRGKEVHGHILRNGFFSDQQVANALVDMYVKCGVPVL  459

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + +FD  P KDLI W+ MI GYGM+G GN A+  F +M   GI+P++V FIS+L ACSH
Sbjct  460  ARLLFDMIPTKDLITWTVMIAGYGMHGFGNNAITTFNEMRQAGIEPDEVSFISILYACSH  519

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             GL  EGW +F+ M+++ ++ PKL HYAC+VD+L+R G +  A +F+  MPIEPD  IWG
Sbjct  520  SGLLDEGWRFFNVMQDECNVKPKLEHYACIVDLLARSGKLAMAYKFIKSMPIEPDATIWG  579

Query  743  ALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGK  922
            ALL+GCR  H   +++E VA+ +  L+P N  YYV+L+N YA+  +W+EV+KLRQ +  +
Sbjct  580  ALLSGCR-IHHDVKLAEKVAEHVFELEPENTGYYVLLANTYAEAEKWEEVKKLRQKIGRR  638

Query  923  KRKKGMGYSVVEVNNSMH  976
              KK  G S +EV + +H
Sbjct  639  GLKKNPGCSWIEVKSKVH  656


 Score =   122 bits (305),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/293 (28%), Positives = 142/293 (48%), Gaps = 18/293 (6%)
 Frame = +2

Query  5    SGFLKCI----PVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSN  172
            SG   C+         LL MYA  G ++ + ++FD +S + ++ W+++I+AYA+      
Sbjct  230  SGVKACVHWKTTFCNTLLDMYAKCGVLDGAILVFDLMSVRTVVTWTSLIAAYAREGLSDE  289

Query  173  ALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
            A+ +F  M  E   P+ F   ++L AC+   + + G+ +H  + +    SN F+ + L+D
Sbjct  290  AIRLFHEMDREGVSPDIFTITTVLHACACNGSLENGKDVHNYIRENDMQSNIFVCNALMD  349

Query  353  MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVV  532
            MY K G +    ++F E P KD+I W++MI GY  N   NEAL  F DM+   ++P+   
Sbjct  350  MYAKCGSMEDANSVFLEMPVKDIISWNTMIGGYSKNSLPNEALSLFGDMVLE-MKPDGTT  408

Query  533  FISVLSACSHC-----GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALE  697
               +L AC+       G E  G    H +   +    ++A+   +VDM  + G    A  
Sbjct  409  LACILPACASLASLDRGKEVHG----HILRNGFFSDQQVAN--ALVDMYVKCGVPVLARL  462

Query  698  FVNKMPIEPDKRIWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
              + +P + D   W  ++AG      G++ I+     +   ++P   S+  IL
Sbjct  463  LFDMIPTK-DLITWTVMIAGYGMHGFGNNAITTFNEMRQAGIEPDEVSFISIL  514


 Score =   115 bits (288),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 128/275 (47%), Gaps = 2/275 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            VV +L+  Y     ++ +R LFD LS +D+I+W++MIS Y  +      + +F++M    
Sbjct  141  VVNSLIAFYLKIRRVDVARKLFDELSNRDVISWNSMISGYVANGFSEKGVELFKKMLYLG  200

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
               +     S+LQAC++     +G  +H   +K          + L+DMY K G +    
Sbjct  201  VDMDLATMVSILQACANCGDVSLGRAVHGSGVKACVHWKTTFCNTLLDMYAKCGVLDGAI  260

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD    + ++ W+S+I  Y   G  +EA+  F +M   G+ P+     +VL AC+ C 
Sbjct  261  LVFDLMSVRTVVTWTSLIAAYAREGLSDEAIRLFHEMDREGVSPDIFTITTVLHACA-CN  319

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
               E     H    + D+   +     ++DM ++ G++E+A     +MP++ D   W  +
Sbjct  320  GSLENGKDVHNYIRENDMQSNIFVCNALMDMYAKCGSMEDANSVFLEMPVK-DIISWNTM  378

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
            + G  K    +E   L    ++ + P   +   IL
Sbjct  379  IGGYSKNSLPNEALSLFGDMVLEMKPDGTTLACIL  413


 Score =   106 bits (264),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 65/254 (26%), Positives = 125/254 (49%), Gaps = 2/254 (1%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
            + L+ MY   G++   R++FD +  + +  W+ M++ Y +      ++++FR+M     +
Sbjct  42   SKLVFMYVTCGDLREGRLIFDKIRNEKVFLWNLMMNGYTKIGDFKESVSLFRQMLDLGVE  101

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
             N      +L+  +++ +   G+ +H  ++KLG  S   + + LI  Y K  R+   + +
Sbjct  102  VNSHTVSCVLKCFAALGSVKEGKWVHGFLLKLGLGSYNAVVNSLIAFYLKIRRVDVARKL  161

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            FDE  ++D+I W+SMI+GY  NG   + +E F  ML  G+  +    +S+L AC++CG  
Sbjct  162  FDELSNRDVISWNSMISGYVANGFSEKGVELFKKMLYLGVDMDLATMVSILQACANCGDV  221

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
              G    H    K  +  K      ++DM ++ G ++ A+   + M +      W +L+A
Sbjct  222  SLG-RAVHGSGVKACVHWKTTFCNTLLDMYAKCGVLDGAILVFDLMSVRT-VVTWTSLIA  279

Query  755  GCRKTHGSSEISEL  796
               +   S E   L
Sbjct  280  AYAREGLSDEAIRL  293


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/152 (28%), Positives = 71/152 (47%), Gaps = 4/152 (3%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++GF     V  AL+ MY   G    +R+LFD +  KD+I W+ MI+ Y      +NA+ 
Sbjct  434  RNGFFSDQQVANALVDMYVKCGVPVLARLLFDMIPTKDLITWTVMIAGYGMHGFGNNAIT  493

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLA--SGLIDM  355
             F  M+    +P+E +F S+L ACS     D G      VM+        L   + ++D+
Sbjct  494  TFNEMRQAGIEPDEVSFISILYACSHSGLLDEGWRFF-NVMQDECNVKPKLEHYACIVDL  552

Query  356  YCKFGRIHQGKTIFDENP-DKDLICWSSMING  448
              + G++          P + D   W ++++G
Sbjct  553  LARSGKLAMAYKFIKSMPIEPDATIWGALLSG  584


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/207 (25%), Positives = 94/207 (45%), Gaps = 3/207 (1%)
 Frame = +2

Query  236  SLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDK  415
            S+LQ  + + +   G+ +H+ +   G + ++ L S L+ MY   G + +G+ IFD+  ++
Sbjct  8    SILQLSAELKSLQDGKKVHSFICSSGISIDSVLGSKLVFMYVTCGDLREGRLIFDKIRNE  67

Query  416  DLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWF  595
             +  W+ M+NGY   G   E++  F  ML  G++ N      VL   +  G   EG  W 
Sbjct  68   KVFLWNLMMNGYTKIGDFKESVSLFRQMLDLGVEVNSHTVSCVLKCFAALGSVKEG-KWV  126

Query  596  HAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHG  775
            H    K  +    A    ++    +   V+ A +  +++    D   W ++++G      
Sbjct  127  HGFLLKLGLGSYNAVVNSLIAFYLKIRRVDVARKLFDELS-NRDVISWNSMISGYVANGF  185

Query  776  SSEISELVAKQL-ISLDPTNASYYVIL  853
            S +  EL  K L + +D   A+   IL
Sbjct  186  SEKGVELFKKMLYLGVDMDLATMVSIL  212



>ref|XP_010248175.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540 
[Nelumbo nucifera]
Length=629

 Score =   285 bits (730),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/314 (42%), Positives = 205/314 (65%), Gaps = 1/314 (0%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
            T+++  Y   G++ES+R LFD + +++++ WS MI+ Y ++   + A+ +F+ +Q E  +
Sbjct  195  TSMIAGYNKCGDVESARRLFDKMPERNLVTWSIMINGYVRNHHFNKAIELFQVLQSEGVQ  254

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
             NE    S++ AC+ + A + GE  H  V++     N  L + L+DMY + G I +   +
Sbjct  255  ANETVMVSVIAACAHLGALEQGEKAHNYVLRHKLNVNLILGTALVDMYARCGSIQKAIRV  314

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            F+E P++D + W+++I G  M+GH ++ALE F +ML  GI P D+ F +VLSACSH GL 
Sbjct  315  FEELPERDTLSWTAVIAGLAMHGHADKALEYFSEMLKTGITPRDITFTAVLSACSHGGLV  374

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
              G+  F +ME +Y+I P+L HY CMVD+L R G +EEA +FV KMP++P+  IWGALL 
Sbjct  375  DRGFQIFESMEREYEIEPRLEHYGCMVDILGRVGKLEEAEDFVRKMPMQPNAPIWGALLG  434

Query  755  GCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKK  934
             CR  H ++EI E V K LI L P ++ YYV+LSN+YA   +WD V +LRQ+M  +  KK
Sbjct  435  ACR-IHRNTEIGERVGKILIQLQPCHSGYYVLLSNIYARANQWDNVTQLRQIMKERGIKK  493

Query  935  GMGYSVVEVNNSMH  976
              GYS++E+ ++++
Sbjct  494  PPGYSLIEIGDTVY  507


 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/295 (25%), Positives = 140/295 (47%), Gaps = 36/295 (12%)
 Frame = +2

Query  71   IESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQA  250
            ++ ++ +F  +   ++  ++AM+  Y+ S  P  +   +R++Q E   P+   F  L+++
Sbjct  75   LDYAQRIFSQIQNPNLFIYNAMVRVYSGSKNPQQSFQFYRKLQQEGLLPDNLTFPYLVKS  134

Query  251  CSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICW  430
            C+      +G     Q++K G+ S+ ++ + L+ MY   G I     IF      D++ W
Sbjct  135  CAEFGCVGMGIQALGQIIKHGFESDVYVQNSLVHMYATCGDIGTANRIFRGIYHLDVVSW  194

Query  431  SS-------------------------------MINGYGMNGHGNEALECFLDMLSHGIQ  517
            +S                               MINGY  N H N+A+E F  + S G+Q
Sbjct  195  TSMIAGYNKCGDVESARRLFDKMPERNLVTWSIMINGYVRNHHFNKAIELFQVLQSEGVQ  254

Query  518  PNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALE  697
             N+ V +SV++AC+H G   +G    H    ++ +   L     +VDM +R G++++A+ 
Sbjct  255  ANETVMVSVIAACAHLGALEQGEKA-HNYVLRHKLNVNLILGTALVDMYARCGSIQKAIR  313

Query  698  FVNKMPIEPDKRIWGALLAGCRKTHGSSEIS-ELVAKQL-ISLDPTNASYYVILS  856
               ++P E D   W A++AG    HG ++ + E  ++ L   + P + ++  +LS
Sbjct  314  VFEELP-ERDTLSWTAVIAGL-AMHGHADKALEYFSEMLKTGITPRDITFTAVLS  366



>ref|XP_010918777.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Elaeis guineensis]
Length=790

 Score =   289 bits (739),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/325 (43%), Positives = 201/325 (62%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++GF   + + TAL+ MY   G++ S+R LFDS+++KDI+ W+AMIS YA       A  
Sbjct  345  RNGFKMSVVLATALVDMYCKCGDMRSARALFDSMNEKDILTWTAMISGYAWVKHIEEAFD  404

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F +M+    KPNE    +LL  C+   A D G  +H  + K G  S+  LA+ L+DMY 
Sbjct  405  LFGQMKDADIKPNEVTMVNLLSLCAEAGALDHGRWVHACIEKEGIESDVVLATALVDMYA  464

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G I     +F    +KD+  W++M+NG  +NGHG+EA++ F  +   GI+PNDV FI 
Sbjct  465  KCGDIDAAYMVFHGATNKDVCMWNAMLNGLAINGHGDEAIKLFSQLEKEGIKPNDVTFIG  524

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L ACSH GL  EG  +F+ M+  Y + PK+ HY CMVD+L R G ++EA E +N MPI+
Sbjct  525  ILHACSHAGLVAEGKQFFNRMDHDYGLVPKIEHYGCMVDLLGRAGKLDEAHELINGMPIK  584

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            P+  IWGALLA C K H +  + E+ A  ++ L+P N+ Y ++LSN+YA   RWDEV ++
Sbjct  585  PNVVIWGALLAAC-KVHKNPSLGEVAANNVLKLEPHNSGYRILLSNIYAMNHRWDEVAQV  643

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R  M     KK  G S +EVN S+H
Sbjct  644  RTTMKDTGIKKTPGISSIEVNGSVH  668


 Score =   152 bits (385),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/278 (31%), Positives = 143/278 (51%), Gaps = 3/278 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            +  +TAL+ MY   G++  +R +FD ++ K I +WSAMI+          A+ +F +M+ 
Sbjct  251  VNAITALIDMYVKCGSVSVARRVFDGMTAKSIASWSAMIAGCIHCGDLEAAVQLFGKMRQ  310

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            E+  PNE    SL+  C    A ++G+ +H  +++ G+  +  LA+ L+DMYCK G +  
Sbjct  311  ENVSPNEITMLSLVTECGQTEALELGKWLHAYMLRNGFKMSVVLATALVDMYCKCGDMRS  370

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + +FD   +KD++ W++MI+GY    H  EA + F  M    I+PN+V  +++LS C+ 
Sbjct  371  ARALFDSMNEKDILTWTAMISGYAWVKHIEEAFDLFGQMKDADIKPNEVTMVNLLSLCAE  430

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             G    G  W HA  EK  I   +     +VDM ++ G+++ A   V       D  +W 
Sbjct  431  AGALDHG-RWVHACIEKEGIESDVVLATALVDMYAKCGDIDAAY-MVFHGATNKDVCMWN  488

Query  743  ALLAGCR-KTHGSSEISELVAKQLISLDPTNASYYVIL  853
            A+L G     HG   I      +   + P + ++  IL
Sbjct  489  AMLNGLAINGHGDEAIKLFSQLEKEGIKPNDVTFIGIL  526


 Score =   114 bits (285),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/290 (28%), Positives = 140/290 (48%), Gaps = 11/290 (4%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
            +L+QMY+    I+S+  +FD + ++D+++WS MI  +A+S   + A+ + R M L + KP
Sbjct  153  SLMQMYSECERIDSAIRIFDEMPERDVVSWSTMIKTFARSKFFNEAIDLVREMFLLNMKP  212

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLG--YTSNAFLASGLIDMYCKFGRIHQGKT  391
            ++    S+L   + +A    G  +HT ++K G   ++N    + LIDMY K G +   + 
Sbjct  213  SDITMISMLNLFADIADLKKGRPLHTYLIKNGDAGSANVNAITALIDMYVKCGSVSVARR  272

Query  392  IFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC-G  568
            +FD    K +  WS+MI G    G    A++ F  M    + PN++  +S+++ C     
Sbjct  273  VFDGMTAKSIASWSAMIAGCIHCGDLEAAVQLFGKMRQENVSPNEITMLSLVTECGQTEA  332

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            LE   W   + +   + ++  LA    +VDM  + G++  A    + M  E D   W A+
Sbjct  333  LELGKWLHAYMLRNGFKMSVVLA--TALVDMYCKCGDMRSARALFDSMN-EKDILTWTAM  389

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYA-----DQGRW  883
            ++G        E  +L  +   +    N    V L +L A     D GRW
Sbjct  390  ISGYAWVKHIEEAFDLFGQMKDADIKPNEVTMVNLLSLCAEAGALDHGRW  439


 Score = 90.1 bits (222),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/210 (26%), Positives = 107/210 (51%), Gaps = 2/210 (1%)
 Frame = +2

Query  134  MISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLG  313
            +I++Y ++ +P+ AL ++  M+      + F   S+L+AC+ +++   G  IH   +K G
Sbjct  84   LITSYIKNSRPAAALRLYAYMRKTGTGLDNFTVPSVLKACAQLSSIRQGMEIHGFALKAG  143

Query  314  YTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFL  493
               + F+ + L+ MY +  RI     IFDE P++D++ WS+MI  +  +   NEA++   
Sbjct  144  LDWDVFIHNSLMQMYSECERIDSAIRIFDEMPERDVVSWSTMIKTFARSKFFNEAIDLVR  203

Query  494  DMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDI-TPKLAHYACMVDMLSR  670
            +M    ++P+D+  IS+L+  +      +G      + +  D  +  +     ++DM  +
Sbjct  204  EMFLLNMKPSDITMISMLNLFADIADLKKGRPLHTYLIKNGDAGSANVNAITALIDMYVK  263

Query  671  QGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
             G+V  A    + M  +     W A++AGC
Sbjct  264  CGSVSVARRVFDGMTAKSIAS-WSAMIAGC  292



>ref|XP_009392630.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01510, 
mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=608

 Score =   285 bits (728),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 198/317 (62%), Gaps = 1/317 (0%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V  AL+ MY+  G++  +R  FD ++ +D++ W++MIS YA +      L  FR MQL  
Sbjct  172  VAAALVDMYSKCGDVFCARQTFDKMANRDLVCWTSMISGYAHNGLTMETLEFFRLMQLSS  231

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KPN  +  S L AC  + A   GE  H   +K  +  +  +A+ ++DMY K G +   +
Sbjct  232  VKPNRVSLLSALLACGRLGALRGGECFHCLAIKTRFEHDVLVATAVVDMYVKCGNLELAR  291

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD    KD++CWS+M+ G+G +G   EA+  F +M+  G+ PN   F S+LSACSH G
Sbjct  292  LMFDRIDSKDVVCWSTMVAGFGYHGLAGEAISTFDNMVDDGVMPNATTFTSLLSACSHSG  351

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  EG  +F +M  KY I PK+ HYACMVD+L R G ++EA EF+ +MP+EPD  IW +L
Sbjct  352  LSEEGRRFFDSMNLKYGIEPKMNHYACMVDILGRAGKLQEAEEFIKQMPMEPDTSIWVSL  411

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L  CR  HG  ++ E +A ++++ D  +A Y+V+LSN+YA + RW +VE++R+LM G++ 
Sbjct  412  LGACR-IHGDLDLGEKIADKIMNRDHNHAGYFVLLSNVYAAKSRWTDVERVRKLMVGRRV  470

Query  929  KKGMGYSVVEVNNSMHR  979
             K  G S++E NN +H+
Sbjct  471  NKDQGISLIEFNNQVHK  487


 Score =   114 bits (286),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 74/251 (29%), Positives = 127/251 (51%), Gaps = 3/251 (1%)
 Frame = +2

Query  8    GFLKCIP-VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAV  184
            G  + IP +++A    Y + G ++S+  LF S+       ++  I A A   +   AL++
Sbjct  63   GLHRRIPTLLSAATLGYLSLGLLDSALPLFRSVPSPSPFLFNMAIRACAAGGRFHVALSL  122

Query  185  FRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK  364
            +  +     +P++F F   L++C++++   VG+ +H   +  G  S+ F+A+ L+DMY K
Sbjct  123  YSTLLSSGLRPDKFTFPFALRSCAALSDLWVGKLLHQHSLCFGCASDLFVAAALVDMYSK  182

Query  365  FGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISV  544
             G +   +  FD+  ++DL+CW+SMI+GY  NG   E LE F  M    ++PN V  +S 
Sbjct  183  CGDVFCARQTFDKMANRDLVCWTSMISGYAHNGLTMETLEFFRLMQLSSVKPNRVSLLSA  242

Query  545  LSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEP  724
            L AC   G    G   FH +  K      +     +VDM  + GN+E A    +++    
Sbjct  243  LLACGRLG-ALRGGECFHCLAIKTRFEHDVLVATAVVDMYVKCGNLELARLMFDRID-SK  300

Query  725  DKRIWGALLAG  757
            D   W  ++AG
Sbjct  301  DVVCWSTMVAG  311


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 75/156 (48%), Gaps = 2/156 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+ F   + V TA++ MY   GN+E +R++FD +  KD++ WS M++ +        A++
Sbjct  264  KTRFEHDVLVATAVVDMYVKCGNLELARLMFDRIDSKDVVCWSTMVAGFGYHGLAGEAIS  323

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQV-MKLGYTSNAFLASGLIDMY  358
             F  M  +   PN   F SLL ACS     + G      + +K G        + ++D+ 
Sbjct  324  TFDNMVDDGVMPNATTFTSLLSACSHSGLSEEGRRFFDSMNLKYGIEPKMNHYACMVDIL  383

Query  359  CKFGRIHQGKTIFDENP-DKDLICWSSMINGYGMNG  463
             + G++ + +    + P + D   W S++    ++G
Sbjct  384  GRAGKLQEAEEFIKQMPMEPDTSIWVSLLGACRIHG  419



>ref|XP_010449129.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
isoform X1 [Camelina sativa]
Length=619

 Score =   285 bits (728),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/326 (40%), Positives = 215/326 (66%), Gaps = 2/326 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            +SGF   I    +LL +YAN G++ S+  +FD + +KD++AW+++I+ +A++ +P+ ALA
Sbjct  173  RSGFGSLIFAQNSLLHLYANCGDLSSAYKVFDEMPEKDLVAWNSVINGFAENGKPNEALA  232

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++  M  +  KP+ F   SLL AC+ + A  +G+ IH  ++K+G T N    + L+D+Y 
Sbjct  233  LYNEMDSKGIKPDGFTIVSLLSACAKIGALTLGKRIHVYMIKVGLTRNLHSRNVLLDLYG  292

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLS-HGIQPNDVVFI  538
            + GR+ + KT+F E  DK+ + W+S+I G  +NG G EA+E F DM S  G+ P ++ F+
Sbjct  293  RCGRVEEAKTLFYEMVDKNSVSWTSLIVGLAVNGFGKEAIELFRDMESKEGLVPCEITFV  352

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             +L ACSHCG+  EG+ +F  M E+Y I P++ H+ CMVD+L+R G V+EA E++ KMP+
Sbjct  353  GILYACSHCGMVKEGFEYFRRMREEYKIEPRIEHFGCMVDLLARAGQVKEAYEYIMKMPM  412

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
            +P+  IW  LL  C   HG +E++E    Q++ L+P ++  YV+LSN+YA + RW +V+K
Sbjct  413  QPNVVIWRTLLGAC-TVHGDAELAEYARLQILQLEPNHSGDYVLLSNMYASEQRWSDVQK  471

Query  899  LRQLMDGKKRKKGMGYSVVEVNNSMH  976
            +R+ M     +K  G+S+VEV N +H
Sbjct  472  IRKQMLRDGVRKVPGHSLVEVGNRVH  497


 Score =   121 bits (304),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/219 (32%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  DIIAWSAMISAYAQSDQ---PSNALAVFRRMQLEH-GKPNEFAFHSLLQACSSMAAQDVG  280
            +I  W+ +I  YA+        +A++++R M++    +P+   +  LL+A +  A   +G
Sbjct  105  NIFVWNTLIRGYAECSSNYASVSAISLYREMKVSGLVEPDTHTYPFLLKAVAKTADVRLG  164

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            ETIH+ V++ G+ S  F  + L+ +Y   G +     +FDE P+KDL+ W+S+ING+  N
Sbjct  165  ETIHSVVIRSGFGSLIFAQNSLLHLYANCGDLSSAYKVFDEMPEKDLVAWNSVINGFAEN  224

Query  461  GHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAH  640
            G  NEAL  + +M S GI+P+    +S+LSAC+  G    G    H    K  +T  L  
Sbjct  225  GKPNEALALYNEMDSKGIKPDGFTIVSLLSACAKIGALTLG-KRIHVYMIKVGLTRNLHS  283

Query  641  YACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
               ++D+  R G VEEA     +M ++ +   W +L+ G
Sbjct  284  RNVLLDLYGRCGRVEEAKTLFYEM-VDKNSVSWTSLIVG  321



>ref|XP_008225544.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Prunus mume]
Length=623

 Score =   285 bits (728),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/336 (38%), Positives = 212/336 (63%), Gaps = 1/336 (0%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             ++GF   + V   LL MYA  G++ES+  +F+S+S++D++AW+++I+ +A + +P+ AL 
Sbjct  178   RNGFESLVFVKNTLLHMYACCGHVESAHRVFESMSERDLVAWNSVINGFALNGRPNEALT  237

Query  182   VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             +FR M LE  +P+ F   SLL AC+ +    +G  IH  ++K+G T N+   + L+D+Y 
Sbjct  238   IFRDMSLEGVQPDGFTMVSLLSACAELGTLALGRRIHVYMLKVGLTGNSHATNALLDLYA  297

Query  362   KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
             K G I + + +F    ++ ++ W++++ G  +NG GNEALE F ++   G+ P ++ F+ 
Sbjct  298   KCGSIREAQKVFTTMDERSVVSWTALVVGLAVNGFGNEALELFKELRREGLVPTEITFVG  357

Query  542   VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
             VL ACSHCG+  EG+N+F  M+E+Y I P++ HY CM+D+L R G V+EA E++N MP++
Sbjct  358   VLYACSHCGMVDEGFNYFRMMKEEYGIVPRIEHYGCMIDLLGRAGLVKEAYEYINNMPMQ  417

Query  722   PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
             P+  IW  LL  C   HG   + E     +  L+P ++  YV+LSNLYA + RW +V+K+
Sbjct  418   PNAVIWRTLLGAC-TIHGHLALGETARAHIRELEPGHSGDYVLLSNLYASERRWSDVQKV  476

Query  902   RQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQE  1009
             R+ M     +K  GYS+VE+ N ++      RS  +
Sbjct  477   RRTMLSDGVRKTPGYSIVELRNCIYEFTMGDRSHPQ  512


 Score =   126 bits (316),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 130/259 (50%), Gaps = 9/259 (3%)
 Frame = +2

Query  89   LFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAA  268
            +F  +   ++  W+ MI  YA+S+ P+  L ++ +M +   +P+   +  LL+A + +  
Sbjct  106  IFSQIRSPNVFTWNTMIRGYAESENPTPVLQLYHQMHVNSVEPDTHTYPFLLKAVAKLTN  165

Query  269  QDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMING  448
               GE IH+  ++ G+ S  F+ + L+ MY   G +     +F+   ++DL+ W+S+ING
Sbjct  166  VRDGEKIHSIALRNGFESLVFVKNTLLHMYACCGHVESAHRVFESMSERDLVAWNSVING  225

Query  449  YGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITP  628
            + +NG  NEAL  F DM   G+QP+    +S+LSAC+  G    G    H    K  +T 
Sbjct  226  FALNGRPNEALTIFRDMSLEGVQPDGFTMVSLLSACAELGTLALG-RRIHVYMLKVGLTG  284

Query  629  KLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKR---IWGALLAGCRKTHGSSEISELV  799
                   ++D+ ++ G++ EA +    M    D+R    W AL+ G       +E  EL 
Sbjct  285  NSHATNALLDLYAKCGSIREAQKVFTTM----DERSVVSWTALVVGLAVNGFGNEALELF  340

Query  800  AK-QLISLDPTNASYYVIL  853
             + +   L PT  ++  +L
Sbjct  341  KELRREGLVPTEITFVGVL  359



>ref|XP_008776306.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Phoenix dactylifera]
Length=622

 Score =   285 bits (728),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/317 (40%), Positives = 208/317 (66%), Gaps = 1/317 (0%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V TA+L+MY   G ++ +R  FD + ++D++ WS+MI+ YAQ+ +P+ AL +F RM+ E+
Sbjct  265  VQTAVLEMYVKCGAVDEARHEFDRMERRDVVGWSSMIAGYAQNGRPNEALELFERMKAEN  324

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KPNE    S+L AC+ + + +VGE I   V + G+  + +  S L+DMY K G I + +
Sbjct  325  CKPNEVTLVSVLSACAQLGSVEVGERIGNYVERQGFALDVYAGSALVDMYSKCGNIKRAR  384

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             IF+    KD++ W+SMI G   NG   +A+E +  M+   ++PND+ F+++L+AC+H G
Sbjct  385  WIFNRMHQKDVVTWNSMIGGLAFNGFAKDAIELYQTMIGENLKPNDITFVALLTACTHAG  444

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  +G  +FH M+  ++I PK+ H AC+VD+L R G +E+A +F+ +M +EP+  IWG L
Sbjct  445  LVDQGLMFFHGMKPNHNIVPKVEHCACIVDLLCRSGRLEDAYKFICEMEVEPNVIIWGTL  504

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L+ CR  H +  ++EL  ++L+ L+P N++ YV+LSN+YA+ GRW+E  K+R LM  K  
Sbjct  505  LSACR-AHSNVWLAELSVEKLLVLEPHNSANYVLLSNIYANAGRWEEARKVRDLMKNKNV  563

Query  929  KKGMGYSVVEVNNSMHR  979
            +K   YS +E+   +H+
Sbjct  564  QKLAAYSWIELEGMVHK  580


 Score =   141 bits (355),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 142/284 (50%), Gaps = 8/284 (3%)
 Frame = +2

Query  23   IPV-----VTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            IPV     +  L+  Y+  GN+ ++R LFD + Q+   +W++MI+ YA     + AL +F
Sbjct  157  IPVKDPVPINCLISGYSKSGNVLAARQLFDGMIQRTSSSWNSMITCYAHHGDFAEALRLF  216

Query  188  RRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKF  367
             RMQ E+ +PNE    ++L  C+ +     G  +   +       N  + + +++MY K 
Sbjct  217  ERMQTENARPNEITLVTVLSICAKLGDLKTGLKVKNLIENNDLRRNLIVQTAVLEMYVKC  276

Query  368  GRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVL  547
            G + + +  FD    +D++ WSSMI GY  NG  NEALE F  M +   +PN+V  +SVL
Sbjct  277  GAVDEARHEFDRMERRDVVGWSSMIAGYAQNGRPNEALELFERMKAENCKPNEVTLVSVL  336

Query  548  SACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPD  727
            SAC+  G   E         E+      +   + +VDM S+ GN++ A    N+M  + D
Sbjct  337  SACAQLG-SVEVGERIGNYVERQGFALDVYAGSALVDMYSKCGNIKRARWIFNRMH-QKD  394

Query  728  KRIWGALLAGCRKTHGSSEISELVAKQL-ISLDPTNASYYVILS  856
               W +++ G      + +  EL    +  +L P + ++  +L+
Sbjct  395  VVTWNSMIGGLAFNGFAKDAIELYQTMIGENLKPNDITFVALLT  438


 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 140/300 (47%), Gaps = 40/300 (13%)
 Frame = +2

Query  11   FLKCIPVVTAL-LQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
             +K  P +T L L +  N  N+  ++  FD++ Q D    +++I +Y++       L +F
Sbjct  25   IVKSNPDLTPLFLGVLLNRSNMGYAQRAFDAIPQPDPGLSNSIIFSYSKLSMHKEVLKIF  84

Query  188  RRMQLEHGKPNEFAFHSL---LQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
              +   H K  +  FHS+   L++C+++AA + G+ +HT ++  G++S+ F+ + LID Y
Sbjct  85   FSV---HRKKTQILFHSIPSVLKSCAALAASNEGKQVHTYILIHGFSSSVFIQTSLIDFY  141

Query  359  CKFGRIHQGKTIFDENPDKDLI-------------------------------CWSSMIN  445
             K G ++  + +F+E P KD +                                W+SMI 
Sbjct  142  SKNGDLNSARRVFNEIPVKDPVPINCLISGYSKSGNVLAARQLFDGMIQRTSSSWNSMIT  201

Query  446  GYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDIT  625
             Y  +G   EAL  F  M +   +PN++  ++VLS C+  G    G    + +E   D+ 
Sbjct  202  CYAHHGDFAEALRLFERMQTENARPNEITLVTVLSICAKLGDLKTGLKVKNLIENN-DLR  260

Query  626  PKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAK  805
              L     +++M  + G V+EA    ++M    D   W +++AG  +    +E  EL  +
Sbjct  261  RNLIVQTAVLEMYVKCGAVDEARHEFDRME-RRDVVGWSSMIAGYAQNGRPNEALELFER  319


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 83/157 (53%), Gaps = 14/157 (9%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            + GF   +   +AL+ MY+  GNI+ +R +F+ + QKD++ W++MI   A +    +A+ 
Sbjct  357  RQGFALDVYAGSALVDMYSKCGNIKRARWIFNRMHQKDVVTWNSMIGGLAFNGFAKDAIE  416

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG-------ETIHTQVMKLGYTSNAFLAS  340
            +++ M  E+ KPN+  F +LL AC+     D G       +  H  V K+ +       +
Sbjct  417  LYQTMIGENLKPNDITFVALLTACTHAGLVDQGLMFFHGMKPNHNIVPKVEH------CA  470

Query  341  GLIDMYCKFGRIHQG-KTIFDENPDKDLICWSSMING  448
             ++D+ C+ GR+    K I +   + ++I W ++++ 
Sbjct  471  CIVDLLCRSGRLEDAYKFICEMEVEPNVIIWGTLLSA  507



>ref|XP_002303975.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE78954.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=543

 Score =   282 bits (721),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/314 (43%), Positives = 207/314 (66%), Gaps = 2/314 (1%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
            A+L  YA  G++ ++R LF+ + Q+++I+W+A+I+ YAQ+++P +A+A+FRRMQLE+ +P
Sbjct  188  AMLNGYAKHGDLCNARDLFERMPQRNVISWTALITGYAQANRPHDAIALFRRMQLENVEP  247

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGY-TSNAFLASGLIDMYCKFGRIHQGKTI  394
            +E A    L AC+ + A ++GE I   + +LG  T+N  L + LIDMY K G I     +
Sbjct  248  DEIAMLVALTACARLGALELGEWIRHYIDRLGLLTTNIPLNNALIDMYAKSGDIKSALQV  307

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            F+    K +I W++MI G  ++G G EALE F  M    ++PND+ FI++LSACSH GL 
Sbjct  308  FENMNHKTIITWTTMIAGLALHGLGTEALEMFSRMERARVKPNDITFIAILSACSHVGLV  367

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
              G  +F+ M  +Y I PK+ HY CM+D+L R G+++EA   + +MP EP+  IWG+LLA
Sbjct  368  QTGRWYFNRMISRYGIEPKIEHYGCMIDLLGRAGHLKEAQTLLAQMPFEPNAVIWGSLLA  427

Query  755  GCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKK  934
             C  THG  E+ EL  + L+ L+P N+  Y +LSN+YA +GRW+E   +R++M     KK
Sbjct  428  AC-NTHGDPELGELALQHLLELEPDNSGNYALLSNIYASRGRWNESRVVRKVMWDAGVKK  486

Query  935  GMGYSVVEVNNSMH  976
              G S++EVNN +H
Sbjct  487  MPGGSLIEVNNRVH  500


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/308 (20%), Positives = 133/308 (43%), Gaps = 45/308 (15%)
 Frame = +2

Query  89   LFDSLSQ-KDIIAWSAMISAYAQS-DQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSM  262
            LF S++   DI  ++ +I A + S   P  ++ ++  +QL   +P+ ++F   L+A +  
Sbjct  67   LFTSITHAPDIYLYNNIIKALSSSPTHPKASIFLYNNIQLAGLRPDSYSFPFALKAVTRF  126

Query  263  AAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGR-----------------------  373
            ++   G  +H+Q ++ G  S+  + +  + MY  FG                        
Sbjct  127  SSIQTGRQLHSQSIRFGLHSDLHVLTAFVQMYSSFGSGCICDARKMFDGMSMSTGDVALW  186

Query  374  ------------IHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQ  517
                        +   + +F+  P +++I W+++I GY      ++A+  F  M    ++
Sbjct  187  NAMLNGYAKHGDLCNARDLFERMPQRNVISWTALITGYAQANRPHDAIALFRRMQLENVE  246

Query  518  PNDVVFISVLSACSHCG-LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEAL  694
            P+++  +  L+AC+  G LE   W   H ++    +T  +     ++DM ++ G+++ AL
Sbjct  247  PDEIAMLVALTACARLGALELGEW-IRHYIDRLGLLTTNIPLNNALIDMYAKSGDIKSAL  305

Query  695  EFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAK-QLISLDPTNASYYVILSNL---  862
            +    M        W  ++AG       +E  E+ ++ +   + P + ++  ILS     
Sbjct  306  QVFENMN-HKTIITWTTMIAGLALHGLGTEALEMFSRMERARVKPNDITFIAILSACSHV  364

Query  863  -YADQGRW  883
                 GRW
Sbjct  365  GLVQTGRW  372


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 85/164 (52%), Gaps = 5/164 (3%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            IP+  AL+ MYA  G+I+S+  +F++++ K II W+ MI+  A     + AL +F RM+ 
Sbjct  285  IPLNNALIDMYAKSGDIKSALQVFENMNHKTIITWTTMIAGLALHGLGTEALEMFSRMER  344

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGE-TIHTQVMKLGYTSNAFLASGLIDMYCKFGRIH  379
               KPN+  F ++L ACS +     G    +  + + G          +ID+  + G + 
Sbjct  345  ARVKPNDITFIAILSACSHVGLVQTGRWYFNRMISRYGIEPKIEHYGCMIDLLGRAGHLK  404

Query  380  QGKTIFDENP-DKDLICWSSMI---NGYGMNGHGNEALECFLDM  499
            + +T+  + P + + + W S++   N +G    G  AL+  L++
Sbjct  405  EAQTLLAQMPFEPNAVIWGSLLAACNTHGDPELGELALQHLLEL  448



>ref|XP_010937492.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, 
mitochondrial [Elaeis guineensis]
Length=791

 Score =   288 bits (737),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 141/313 (45%), Positives = 200/313 (64%), Gaps = 3/313 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            + V  AL+ MYA  G ++ +R +FD  + +D++ W+A+I+AYAQ    S+AL++F RM  
Sbjct  481  VSVANALIGMYARCGKLDLARTIFDH-TTRDVVTWNALIAAYAQLGHSSDALSLFDRMLF  539

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            E  KPN     S+L ACS MA    G  IH  + K+G  S+  + + L+DMY K G++  
Sbjct  540  EDVKPNSATLVSILSACSHMAVLHHGRWIHNYIKKMGLESDVSICTALVDMYAKCGQLEI  599

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + IFD  P++D++ W+ MI+GYG++G+  EALE F +M    ++PN V F++VLS CSH
Sbjct  600  SRAIFDSMPERDVVSWNVMISGYGIHGYAKEALEVFREMEKTSLRPNGVTFLAVLSTCSH  659

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             GL  EG   F  M  KY +TP L HYAC+VD+L R GN+ EA   V  MP+EPD  IWG
Sbjct  660  AGLVKEGKELFCGM-GKYSVTPTLKHYACIVDLLGRSGNLCEAEAMVLNMPMEPDSGIWG  718

Query  743  ALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGK  922
            ALL  CR  H + E+ E +A++ +  DP N  YY++LSN+Y+  GRW+EVEKLR  M+ K
Sbjct  719  ALLGACR-MHNNVEMGERIARRALESDPENEGYYILLSNMYSCAGRWEEVEKLRGTMNNK  777

Query  923  KRKKGMGYSVVEV  961
               K  G+S VE+
Sbjct  778  GVSKRAGWSAVEL  790


 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/298 (25%), Positives = 137/298 (46%), Gaps = 11/298 (4%)
 Frame = +2

Query  14   LKCIPVV-TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFR  190
            + C P V ++LL MY+   ++E + I+F  LS++D+++W+A++  YA+       L +F+
Sbjct  273  MGCYPSVNSSLLSMYSKCESLEEATIVFQELSERDVVSWTAIVGVYARKGFIFECLELFQ  332

Query  191  RMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFG  370
             +Q    +P+      +L   ++      G+  H  +++  +  N  + + L  MYCKF 
Sbjct  333  MLQNSGVEPDGVFISCMLTGFANSGNVSGGKAFHGVMLRRNFVLNTLVGNALQSMYCKFE  392

Query  371  RIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECF--LDMLSHGIQPNDVVFISV  544
             +   +  FD   ++D   W+ M+ GYG  G   + L+ +  L  L  G   +    +SV
Sbjct  393  LLEYARKAFDVVGERDTESWNLMVFGYGKMGLDVKCLDLYRELQFLRLGYSSDLNCLVSV  452

Query  545  LSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEP  724
            + +CS  G  + G +  H    KY +   ++    ++ M +R G ++ A    +      
Sbjct  453  IYSCSQLGALHLGQS-MHCYMIKYAVDEDVSVANALIGMYARCGKLDLARTIFDH--TTR  509

Query  725  DKRIWGALLAGCRKTHGSSEISELVAKQLIS-LDPTNASYYVILSNL----YADQGRW  883
            D   W AL+A   +   SS+   L  + L   + P +A+   ILS          GRW
Sbjct  510  DVVTWNALIAAYAQLGHSSDALSLFDRMLFEDVKPNSATLVSILSACSHMAVLHHGRW  567


 Score = 90.1 bits (222),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/200 (26%), Positives = 98/200 (49%), Gaps = 5/200 (3%)
 Frame = +2

Query  17   KCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM  196
            K   V ++L+ MY+  G I  +  +FD +  +D++AW+A+I    ++ +    L   ++M
Sbjct  170  KSTAVGSSLVYMYSKCGVIGDAYRMFDEMPARDVVAWTAVIIGCVRNGEFEEGLVCLKKM  229

Query  197  QL----EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK  364
                    G+PN       LQAC ++ A   G+ +H  ++K G      + S L+ MY K
Sbjct  230  HRVGGDGGGRPNSRTMEGGLQACGNLGALPEGKCLHGFLLKAGMGCYPSVNSSLLSMYSK  289

Query  365  FGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISV  544
               + +   +F E  ++D++ W++++  Y   G   E LE F  + + G++P+ V    +
Sbjct  290  CESLEEATIVFQELSERDVVSWTAIVGVYARKGFIFECLELFQMLQNSGVEPDGVFISCM  349

Query  545  LSACSHCGLEYEGWNWFHAM  604
            L+  ++ G    G   FH +
Sbjct  350  LTGFANSG-NVSGGKAFHGV  368


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 109/253 (43%), Gaps = 12/253 (5%)
 Frame = +2

Query  26   PVVTA-LLQMYANFGNIESSRILFDSL---SQKDIIAWSAMISAYAQSDQPSNALAVFRR  193
            P + A L+ +YA     + S  +F +    +  D   W+++I A+  +     AL  + +
Sbjct  66   PFLAAKLISLYAALCRPDLSACVFSAAIPSNSGDTFLWNSIIQAHFSNVDFPLALRFYSQ  125

Query  194  MQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASG--LIDMYCKF  367
            M      PNEF    +  A + +    +G +IH   MK G  +    A G  L+ MY K 
Sbjct  126  MLSSGASPNEFTIPMVASASAELLDLGLGSSIHGNAMKFGLFNGKSTAVGSSLVYMYSKC  185

Query  368  GRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDML----SHGIQPNDVVF  535
            G I     +FDE P +D++ W+++I G   NG   E L C   M       G +PN    
Sbjct  186  GVIGDAYRMFDEMPARDVVAWTAVIIGCVRNGEFEEGLVCLKKMHRVGGDGGGRPNSRTM  245

Query  536  ISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMP  715
               L AC + G   EG    H    K  +    +  + ++ M S+  ++EEA     ++ 
Sbjct  246  EGGLQACGNLGALPEG-KCLHGFLLKAGMGCYPSVNSSLLSMYSKCESLEEATIVFQELS  304

Query  716  IEPDKRIWGALLA  754
             E D   W A++ 
Sbjct  305  -ERDVVSWTAIVG  316


 Score = 75.5 bits (184),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 75/154 (49%), Gaps = 1/154 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G    + + TAL+ MYA  G +E SR +FDS+ ++D+++W+ MIS Y        AL 
Sbjct  574  KMGLESDVSICTALVDMYAKCGQLEISRAIFDSMPERDVVSWNVMISGYGIHGYAKEALE  633

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            VFR M+    +PN   F ++L  CS       G+ +   + K   T      + ++D+  
Sbjct  634  VFREMEKTSLRPNGVTFLAVLSTCSHAGLVKEGKELFCGMGKYSVTPTLKHYACIVDLLG  693

Query  362  KFGRIHQGKTIFDENP-DKDLICWSSMINGYGMN  460
            + G + + + +    P + D   W +++    M+
Sbjct  694  RSGNLCEAEAMVLNMPMEPDSGIWGALLGACRMH  727



>ref|XP_010028149.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, 
chloroplastic [Eucalyptus grandis]
Length=638

 Score =   284 bits (727),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 133/320 (42%), Positives = 197/320 (62%), Gaps = 1/320 (0%)
 Frame = +2

Query  17   KCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM  196
            K +  +TA++  YA  G ++ +R++FD + ++D++ W+ MI  YAQ  +P  AL +FR+M
Sbjct  198  KSLVSLTAMITCYAKHGELKEARVVFDEILERDVVCWNVMIDGYAQHGKPDEALVLFRQM  257

Query  197  QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
                 +PNE    S+L AC  + A +VG  IH+ +   G   NA + + L+DMY K G +
Sbjct  258  LSAGVRPNEVTVLSVLSACGQLGALEVGRWIHSHIQNNGIQMNAHVGTALVDMYSKCGSL  317

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
                 +F+    KD++ W+SMI GY ++G    AL  F  M   G+ PND+ FI++L+AC
Sbjct  318  EDALLVFESMNHKDVVAWNSMILGYAIHGSSQCALGTFNTMCRSGVNPNDITFIAILTAC  377

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
            SH GL  EGW++F++M++KY I PK+ HY CMV++LSR GN+EEA + V +M IEPD  I
Sbjct  378  SHTGLIKEGWDFFNSMKDKYGIQPKIEHYGCMVNLLSRAGNLEEAYQLVKEMEIEPDAVI  437

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            WG LL  CR  H  + ++E +A+ L+  D  N   Y +LSN+YA  G W+ V K+R LM 
Sbjct  438  WGTLLGACR-LHAKTALAEKIAEFLVGKDLANCGTYTLLSNIYAASGDWEGVAKVRTLMK  496

Query  917  GKKRKKGMGYSVVEVNNSMH  976
                 K  G S +EVNN +H
Sbjct  497  SSGVVKEKGCSSIEVNNRVH  516


 Score =   136 bits (342),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 90/311 (29%), Positives = 152/311 (49%), Gaps = 41/311 (13%)
 Frame = +2

Query  26   PVVTALLQM-YANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            P+++  LQ  Y++ G + SS  LF+  S+  +  W+A+I  +A       AL  F +M  
Sbjct  72   PILSFKLQRSYSSRGRLRSSVALFNCSSEPTVYQWTALIHDHAHLGLHQQALLYFVQMMG  131

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            +  +PN F F S+L++C      + G+ +H   +KLG+ S+ ++ +GL+D+Y + G I  
Sbjct  132  DGIEPNAFTFSSVLKSC----PLESGKALHCLAVKLGFCSDPYVRTGLVDVYARGGEIVS  187

Query  383  GKTIFDENPDK-------------------------------DLICWSSMINGYGMNGHG  469
             + +FD  P+K                               D++CW+ MI+GY  +G  
Sbjct  188  ARRLFDSMPEKSLVSLTAMITCYAKHGELKEARVVFDEILERDVVCWNVMIDGYAQHGKP  247

Query  470  NEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYAC  649
            +EAL  F  MLS G++PN+V  +SVLSAC   G   E   W H+  +   I         
Sbjct  248  DEALVLFRQMLSAGVRPNEVTVLSVLSACGQLG-ALEVGRWIHSHIQNNGIQMNAHVGTA  306

Query  650  MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLI--SLD  823
            +VDM S+ G++E+AL     M    D   W +++ G    HGSS+ +      +    ++
Sbjct  307  LVDMYSKCGSLEDALLVFESMN-HKDVVAWNSMILG-YAIHGSSQCALGTFNTMCRSGVN  364

Query  824  PTNASYYVILS  856
            P + ++  IL+
Sbjct  365  PNDITFIAILT  375


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/215 (24%), Positives = 93/215 (43%), Gaps = 11/215 (5%)
 Frame = +2

Query  287  IHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGH  466
            IH  +++ G   +  L+  L   Y   GR+     +F+ + +  +  W+++I+ +   G 
Sbjct  59   IHAALLRRGLHHHPILSFKLQRSYSSRGRLRSSVALFNCSSEPTVYQWTALIHDHAHLGL  118

Query  467  GNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYA  646
              +AL  F+ M+  GI+PN   F SVL +C       E     H +  K           
Sbjct  119  HQQALLYFVQMMGDGIEPNAFTFSSVLKSCP-----LESGKALHCLAVKLGFCSDPYVRT  173

Query  647  CMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDP  826
             +VD+ +R G +  A    + MP E       A++  C   HG  + + +V  +++  D 
Sbjct  174  GLVDVYARGGEIVSARRLFDSMP-EKSLVSLTAMIT-CYAKHGELKEARVVFDEILERDV  231

Query  827  TNASYYVILSNLYADQGRWDEVEKL-RQLMDGKKR  928
                 + ++ + YA  G+ DE   L RQ++    R
Sbjct  232  V---CWNVMIDGYAQHGKPDEALVLFRQMLSAGVR  263



>ref|XP_006599001.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial-like [Glycine max]
Length=653

 Score =   284 bits (727),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 214/345 (62%), Gaps = 7/345 (2%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF   + V   L+  YA  G +  +R +FD + + D  +W++MI+ YAQ+   + A  
Sbjct  207   KRGFEGSVGVGNTLMDAYAKCGEMGVARKVFDGMDESDDYSWNSMIAEYAQNGLSAEAFC  266

Query  182   VFRRMQLEHGKP--NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM  355
             VF  M ++ GK   N     ++L AC+S  A  +G+ IH QV+K+    + F+ + ++DM
Sbjct  267   VFGEM-VKSGKVRYNAVTLSAVLLACASSGALQLGKCIHDQVIKMDLEDSVFVGTSIVDM  325

Query  356   YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVF  535
             YCK GR+   +  FD    K++  W++MI GYGM+G   EA+E F  M+  G++PN + F
Sbjct  326   YCKCGRVEMARKAFDRMKVKNVKSWTAMIAGYGMHGCAKEAMEIFYKMIRSGVKPNYITF  385

Query  536   ISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMP  715
             +SVL+ACSH G+  EGW+WF+ M+ ++++ P + HY+CMVD+L R G + EA   + +M 
Sbjct  386   VSVLAACSHAGMLKEGWHWFNRMKCEFNVEPGIEHYSCMVDLLGRAGCLNEAYGLIQEMN  445

Query  716   IEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVE  895
             ++PD  IWG+LL  CR  H + E+ E+ A++L  LDP+N  YYV+LSN+YAD GRW +VE
Sbjct  446   VKPDFIIWGSLLGACR-IHKNVELGEISARKLFELDPSNCGYYVLLSNIYADAGRWADVE  504

Query  896   KLRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             ++R LM  +   K  G+S+VE+   +H        ++E+ QH ++
Sbjct  505   RMRILMKSRGLLKTPGFSIVELKGRIHVFLV---GDKEHPQHEKI  546


 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 79/294 (27%), Positives = 145/294 (49%), Gaps = 13/294 (4%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF   I V +AL+ MY+    ++ +  LFD + ++++++W+++I+ Y Q+D+  +A+ +F
Sbjct  99   GFGHDIFVSSALIDMYSKCARLDHACHLFDEIPERNVVSWTSIIAGYVQNDRARDAVRIF  158

Query  188  RRMQLEHGKPNE---------FAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLAS  340
            + + +E     E              ++ ACS +  + V E +H  V+K G+  +  + +
Sbjct  159  KELLVEESGSLESEDGVFVDSVLLGCVVSACSKVGRRSVTEGVHGWVIKRGFEGSVGVGN  218

Query  341  GLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHG-IQ  517
             L+D Y K G +   + +FD   + D   W+SMI  Y  NG   EA   F +M+  G ++
Sbjct  219  TLMDAYAKCGEMGVARKVFDGMDESDDYSWNSMIAEYAQNGLSAEAFCVFGEMVKSGKVR  278

Query  518  PNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALE  697
             N V   +VL AC+  G    G    H    K D+   +     +VDM  + G VE A +
Sbjct  279  YNAVTLSAVLLACASSGALQLG-KCIHDQVIKMDLEDSVFVGTSIVDMYCKCGRVEMARK  337

Query  698  FVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLIS-LDPTNASYYVILS  856
              ++M ++  K  W A++AG      + E  E+  K + S + P   ++  +L+
Sbjct  338  AFDRMKVKNVKS-WTAMIAGYGMHGCAKEAMEIFYKMIRSGVKPNYITFVSVLA  390


 Score = 93.6 bits (231),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 78/336 (23%), Positives = 142/336 (42%), Gaps = 48/336 (14%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + +  + +W+ +I+  ++S     AL+ F  M+     PN   F   ++AC++++    G
Sbjct  29   VDKTSVHSWNTVIADLSRSGDSVEALSAFASMRKLSLHPNRSTFPCAIKACAALSDLRAG  88

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
               H Q    G+  + F++S LIDMY K  R+     +FDE P+++++ W+S+I GY  N
Sbjct  89   AQAHQQAFAFGFGHDIFVSSALIDMYSKCARLDHACHLFDEIPERNVVSWTSIIAGYVQN  148

Query  461  GHGNEALECFLDML---SHGIQPNDVVFIS------VLSACSHCGLE-----YEGWNWFH  598
                +A+  F ++L   S  ++  D VF+       V+SACS  G         GW    
Sbjct  149  DRARDAVRIFKELLVEESGSLESEDGVFVDSVLLGCVVSACSKVGRRSVTEGVHGWVIKR  208

Query  599  AMEEKYDITPKL--AHYAC-----------------------MVDMLSRQGNVEEAL---  694
              E    +   L  A+  C                       M+   ++ G   EA    
Sbjct  209  GFEGSVGVGNTLMDAYAKCGEMGVARKVFDGMDESDDYSWNSMIAEYAQNGLSAEAFCVF  268

Query  695  -EFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYY-VILSNLYA  868
             E V    +  +     A+L  C  + G+ ++ + +  Q+I +D  ++ +    + ++Y 
Sbjct  269  GEMVKSGKVRYNAVTLSAVLLAC-ASSGALQLGKCIHDQVIKMDLEDSVFVGTSIVDMYC  327

Query  869  DQGRWDEVEKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
              GR   VE  R+  D  K K    ++ +     MH
Sbjct  328  KCGR---VEMARKAFDRMKVKNVKSWTAMIAGYGMH  360



>emb|CBI33742.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   282 bits (721),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/320 (41%), Positives = 193/320 (60%), Gaps = 1/320 (0%)
 Frame = +2

Query  17   KCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM  196
            K +  +TA+L  YA  G ++++R+LFD + ++D + W+ MI  Y Q+  P+ AL +FRRM
Sbjct  122  KSLVSLTAMLTCYAKHGELDAARVLFDGMEERDGVCWNVMIDGYTQNGMPNEALVLFRRM  181

Query  197  QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
                 KPNE    S+L AC  + A + G  +H+ +   G   N  + + L+DMY K G +
Sbjct  182  LKAKAKPNEVTVLSVLSACGQLGALESGRWVHSYIENNGIQFNVHVGTALVDMYSKCGSL  241

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
               + +FD+  DKD++ W+SMI GY M+G   EAL+ F  M   G+ P ++ FI +LSAC
Sbjct  242  EDARLVFDKIDDKDVVAWNSMIVGYAMHGFSQEALQLFKSMCRMGLHPTNITFIGILSAC  301

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
             H G   EGW+ F+ M+++Y I PK+ HY CMV++L R G+VE+A E V  M IEPD  +
Sbjct  302  GHSGWVTEGWDIFNKMKDEYGIEPKIEHYGCMVNLLGRAGHVEQAYELVKNMNIEPDPVL  361

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            WG LL  CR  HG   + E + + L+  +  N+  Y++LSN+YA  G WD V +LR +M 
Sbjct  362  WGTLLGACR-LHGKIALGEKIVELLVDQNLANSGTYILLSNIYAAVGNWDGVARLRTMMK  420

Query  917  GKKRKKGMGYSVVEVNNSMH  976
                KK  G S +EVNN +H
Sbjct  421  DSGVKKEPGCSSIEVNNKVH  440



>ref|XP_010999774.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, 
chloroplastic [Populus euphratica]
Length=879

 Score =   289 bits (740),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/318 (44%), Positives = 210/318 (66%), Gaps = 2/318 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            I V  AL+ MYA  G++E +  +F  +  KDII+W+ MI  Y+++  P+ AL++F  M L
Sbjct  442  IFVCNALMDMYAKCGSMEDANSVFLEIPVKDIISWNTMIGGYSKNSLPNEALSLFGAMVL  501

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            E  KP+      +L AC+S+A+ D G+ +H  +++ G+ S+  +A+ L+DMY K G    
Sbjct  502  EM-KPDGTTLACILPACASLASLDKGKEVHGHILRNGFFSDQQVANALVDMYVKCGVPVL  560

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + +FD  P KDLI W+ MI GYGM+G GN A+  F +M   GI+P++V FIS+L ACSH
Sbjct  561  ARLLFDMIPTKDLITWTVMIAGYGMHGFGNNAITTFNEMRLAGIEPDEVSFISILYACSH  620

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             GL  EGW +F+ M+++ +I PKL HYAC+VD+L+R G +  A +F+  MPIEPD  IWG
Sbjct  621  SGLLEEGWRFFNVMKDECNIKPKLEHYACIVDLLARSGKLAMAYKFIKSMPIEPDATIWG  680

Query  743  ALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGK  922
            ALL+GCR  H   +++E VA+ +  L+P N  YYV+L+N YA+  +W+EV+KLRQ +  +
Sbjct  681  ALLSGCR-IHHDVKLAEKVAEHVFELEPENTGYYVLLANTYAEAEKWEEVKKLRQKIGQR  739

Query  923  KRKKGMGYSVVEVNNSMH  976
              KK  G S +EV + +H
Sbjct  740  GLKKNPGCSWIEVKSKIH  757


 Score =   119 bits (299),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 137/278 (49%), Gaps = 14/278 (5%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
             LL MYA  G ++ +  +FD +S + ++ W+++I+AYA+      A+ +F  M  E   P
Sbjct  346  TLLDMYAKCGVLDGAIRVFDLMSVRTVVTWTSLIAAYAREGLSDEAIRLFHEMDREGVSP  405

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            + F   ++L AC+   + + G+ +H  + +    SN F+ + L+DMY K G +    ++F
Sbjct  406  DIFTITTVLHACACNGSLENGKDVHNYIRENDMQSNIFVCNALMDMYAKCGSMEDANSVF  465

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC----  565
             E P KD+I W++MI GY  N   NEAL  F  M+   ++P+      +L AC+      
Sbjct  466  LEIPVKDIISWNTMIGGYSKNSLPNEALSLFGAMVLE-MKPDGTTLACILPACASLASLD  524

Query  566  -GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             G E  G    H +   +    ++A+   +VDM  + G    A    + +P + D   W 
Sbjct  525  KGKEVHG----HILRNGFFSDQQVAN--ALVDMYVKCGVPVLARLLFDMIPTK-DLITWT  577

Query  743  ALLAGC-RKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             ++AG      G++ I+     +L  ++P   S+  IL
Sbjct  578  VMIAGYGMHGFGNNAITTFNEMRLAGIEPDEVSFISIL  615


 Score =   119 bits (298),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 131/284 (46%), Gaps = 2/284 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G   C  VV +L+  Y     ++ +R LFD L+ +D+I+W++MIS Y  +      + 
Sbjct  233  KLGLGSCNAVVNSLIAFYLKMRRVDVARKLFDELTDRDVISWNSMISGYVANGFSEKGVE  292

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F++M       +     S+LQAC++     +G  +H   +K          + L+DMY 
Sbjct  293  LFKKMLYSGVDMDLATMVSILQACANCGYVSLGRAVHGSAVKACVHGKTTFCNTLLDMYA  352

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +     +FD    + ++ W+S+I  Y   G  +EA+  F +M   G+ P+     +
Sbjct  353  KCGVLDGAIRVFDLMSVRTVVTWTSLIAAYAREGLSDEAIRLFHEMDREGVSPDIFTITT  412

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL AC+ C    E     H    + D+   +     ++DM ++ G++E+A     ++P++
Sbjct  413  VLHACA-CNGSLENGKDVHNYIRENDMQSNIFVCNALMDMYAKCGSMEDANSVFLEIPVK  471

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             D   W  ++ G  K    +E   L    ++ + P   +   IL
Sbjct  472  -DIISWNTMIGGYSKNSLPNEALSLFGAMVLEMKPDGTTLACIL  514


 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/254 (26%), Positives = 124/254 (49%), Gaps = 2/254 (1%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
            + L+ MY   G++   R +FD +  + +  W+ M++ Y +      ++++FR+M     +
Sbjct  143  SKLVFMYVTCGDLREGRPIFDKIRNEKVFLWNLMMNGYTKIGDFKESVSLFRQMLDLGVE  202

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
             N      +L+  +++ +   G+ +H  ++KLG  S   + + LI  Y K  R+   + +
Sbjct  203  VNSHTVSCILKCFAALGSVKEGKWVHGFLLKLGLGSCNAVVNSLIAFYLKMRRVDVARKL  262

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            FDE  D+D+I W+SMI+GY  NG   + +E F  ML  G+  +    +S+L AC++CG  
Sbjct  263  FDELTDRDVISWNSMISGYVANGFSEKGVELFKKMLYSGVDMDLATMVSILQACANCGYV  322

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
              G    H    K  +  K      ++DM ++ G ++ A+   + M +      W +L+A
Sbjct  323  SLG-RAVHGSAVKACVHGKTTFCNTLLDMYAKCGVLDGAIRVFDLMSVRT-VVTWTSLIA  380

Query  755  GCRKTHGSSEISEL  796
               +   S E   L
Sbjct  381  AYAREGLSDEAIRL  394


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 72/152 (47%), Gaps = 4/152 (3%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++GF     V  AL+ MY   G    +R+LFD +  KD+I W+ MI+ Y      +NA+ 
Sbjct  535  RNGFFSDQQVANALVDMYVKCGVPVLARLLFDMIPTKDLITWTVMIAGYGMHGFGNNAIT  594

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLA--SGLIDM  355
             F  M+L   +P+E +F S+L ACS     + G      VMK        L   + ++D+
Sbjct  595  TFNEMRLAGIEPDEVSFISILYACSHSGLLEEGWRFF-NVMKDECNIKPKLEHYACIVDL  653

Query  356  YCKFGRIHQGKTIFDENP-DKDLICWSSMING  448
              + G++          P + D   W ++++G
Sbjct  654  LARSGKLAMAYKFIKSMPIEPDATIWGALLSG  685


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 89/194 (46%), Gaps = 2/194 (1%)
 Frame = +2

Query  236  SLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDK  415
            S+LQ  + + +   G+ +H+ +   G + ++ L S L+ MY   G + +G+ IFD+  ++
Sbjct  109  SILQLSAELKSLQDGKKVHSFICSSGISIDSVLGSKLVFMYVTCGDLREGRPIFDKIRNE  168

Query  416  DLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWF  595
             +  W+ M+NGY   G   E++  F  ML  G++ N      +L   +  G   EG  W 
Sbjct  169  KVFLWNLMMNGYTKIGDFKESVSLFRQMLDLGVEVNSHTVSCILKCFAALGSVKEG-KWV  227

Query  596  HAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHG  775
            H    K  +    A    ++    +   V+ A +  +++  + D   W ++++G      
Sbjct  228  HGFLLKLGLGSCNAVVNSLIAFYLKMRRVDVARKLFDELT-DRDVISWNSMISGYVANGF  286

Query  776  SSEISELVAKQLIS  817
            S +  EL  K L S
Sbjct  287  SEKGVELFKKMLYS  300



>ref|XP_009388285.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=649

 Score =   284 bits (726),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 206/327 (63%), Gaps = 4/327 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G    + V   L   YA  G++   R +F+ ++ +D+++W++MI+ YAQ+   + AL 
Sbjct  203  KVGLEMDVGVGNTLTDAYAKGGDLSLGRKVFEGMAARDVVSWNSMIALYAQNGLSAEALE  262

Query  182  VFRRMQLEHG--KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM  355
            ++ +M L +G  + N     ++L AC+   A  +G+ IH QV+++G   + ++ + ++DM
Sbjct  263  LYTKM-LTNGSIQHNAVTLSAVLLACAHAGALQIGKCIHNQVVRMGLEKDVYVGTSVVDM  321

Query  356  YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVF  535
            YCK GR+   K  FD   +K+++ WS+M+ GYGM+GHG EAL+ F +M   G +PN + F
Sbjct  322  YCKCGRVRMAKKAFDRMKEKNILSWSAMVAGYGMHGHGQEALKVFHEMTRSGEKPNYITF  381

Query  536  ISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMP  715
            +SVL+ACSH GL  EG  W  AM+ K++I P + HY CMVD+L R G + EA   +  M 
Sbjct  382  VSVLAACSHAGLVNEGRYWLDAMKRKFNIEPGVEHYGCMVDLLGRAGCLNEAYRLIKDMK  441

Query  716  IEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVE  895
            ++PD  +WGALL+ CR  H + E+ E+ A++L  LDP N  YYV+LSN+YAD GRW++V+
Sbjct  442  VKPDFVVWGALLSACR-IHKNVELGEISARKLFELDPKNCGYYVLLSNIYADAGRWNDVQ  500

Query  896  KLRQLMDGKKRKKGMGYSVVEVNNSMH  976
            +LR ++  K   K  GYS VE    +H
Sbjct  501  RLRVIIKNKGLVKPPGYSSVEFKGRVH  527


 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 89/313 (28%), Positives = 151/313 (48%), Gaps = 8/313 (3%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            + G L  + V ++L+ MYA    +  +R  FD    ++ + W+AM++ Y  +D P +A+ 
Sbjct  100  RLGLLPDLFVASSLVDMYAKCRELSDARRAFDESPHRNAVLWTAMVAGYVWNDAPEDAIF  159

Query  182  VFRRMQLEHGKP--NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM  355
            +F+    + G    +  A  ++L ACS ++ + V E IH  VMK+G   +  + + L D 
Sbjct  160  LFKDFLADEGGAGIDSVAAVAVLSACSRVSGKKVAEGIHGLVMKVGLEMDVGVGNTLTDA  219

Query  356  YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHG-IQPNDVV  532
            Y K G +  G+ +F+    +D++ W+SMI  Y  NG   EALE +  ML++G IQ N V 
Sbjct  220  YAKGGDLSLGRKVFEGMAARDVVSWNSMIALYAQNGLSAEALELYTKMLTNGSIQHNAVT  279

Query  533  FISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
              +VL AC+H G    G    H    +  +   +     +VDM  + G V  A +  ++M
Sbjct  280  LSAVLLACAHAGALQIG-KCIHNQVVRMGLEKDVYVGTSVVDMYCKCGRVRMAKKAFDRM  338

Query  713  PIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEV  892
              E +   W A++AG        E  ++  +   S +  N   Y+   ++ A       V
Sbjct  339  K-EKNILSWSAMVAGYGMHGHGQEALKVFHEMTRSGEKPN---YITFVSVLAACSHAGLV  394

Query  893  EKLRQLMDGKKRK  931
             + R  +D  KRK
Sbjct  395  NEGRYWLDAMKRK  407


 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 76/324 (23%), Positives = 143/324 (44%), Gaps = 41/324 (13%)
 Frame = +2

Query  116  IIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHT  295
            + +W+A I+  A++    +AL  F  ++    +P+  +F   L++ +++A+   G  +H 
Sbjct  37   VASWNAAIADLARAGDFVDALRAFASLRRLRLRPDRSSFPPALKSAAALASLPSGRQLHL  96

Query  296  QVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNE  475
              ++LG   + F+AS L+DMY K   +   +  FDE+P ++ + W++M+ GY  N    +
Sbjct  97   FALRLGLLPDLFVASSLVDMYAKCRELSDARRAFDESPHRNAVLWTAMVAGYVWNDAPED  156

Query  476  ALECFLDMLSH--GIQPNDVVFISVLSACSH----------------CGLEYE---GWNW  592
            A+  F D L+   G   + V  ++VLSACS                  GLE +   G   
Sbjct  157  AIFLFKDFLADEGGAGIDSVAAVAVLSACSRVSGKKVAEGIHGLVMKVGLEMDVGVGNTL  216

Query  593  FHAMEEKYDIT-----------PKLAHYACMVDMLSRQGNVEEALEFVNKM----PIEPD  727
              A  +  D++             +  +  M+ + ++ G   EALE   KM     I+ +
Sbjct  217  TDAYAKGGDLSLGRKVFEGMAARDVVSWNSMIALYAQNGLSAEALELYTKMLTNGSIQHN  276

Query  728  KRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYY-VILSNLYADQGRWDEVEKLR  904
                 A+L  C    G+ +I + +  Q++ +      Y    + ++Y   GR   V   +
Sbjct  277  AVTLSAVLLACAHA-GALQIGKCIHNQVVRMGLEKDVYVGTSVVDMYCKCGR---VRMAK  332

Query  905  QLMDGKKRKKGMGYSVVEVNNSMH  976
            +  D  K K  + +S +     MH
Sbjct  333  KAFDRMKEKNILSWSAMVAGYGMH  356



>ref|XP_011025095.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like 
[Populus euphratica]
 ref|XP_011025096.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like 
[Populus euphratica]
 ref|XP_011025097.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like 
[Populus euphratica]
Length=558

 Score =   281 bits (720),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/314 (43%), Positives = 207/314 (66%), Gaps = 2/314 (1%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
            A+L  YA  G++ ++R LF+ + Q+++I+W+A+I+ YAQ+++P +A+A+FRRMQLE+ +P
Sbjct  203  AMLNGYAKLGDLCNARDLFERMPQRNVISWTALITGYAQANRPHDAIALFRRMQLENVEP  262

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGY-TSNAFLASGLIDMYCKFGRIHQGKTI  394
            +E      L AC+ + A ++GE I   + +LG  T+N  L + LIDMY K G I +   +
Sbjct  263  DEITMLVALTACARLGALELGEWIRHYIDRLGLLTTNIPLNNALIDMYAKSGDIKRALKV  322

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            F+    K +I W++MI G  ++G G EALE F  M    ++PND+ FI++LSACSH GL 
Sbjct  323  FENMNHKTIITWTAMIAGLALHGLGTEALEMFSRMERARVKPNDITFIAILSACSHVGLV  382

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
              G  +F+ M  +Y I P++ HY CM+D+L R G+++EA   + +MP EP+  IWG+LLA
Sbjct  383  KTGRWYFNRMISRYGIEPRIEHYGCMIDLLGRAGHLKEARTLLAQMPFEPNAVIWGSLLA  442

Query  755  GCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKK  934
             C  THG  E+ EL  + L+ L+P N+  Y +LSN+YA +GRW+E   +R++M     KK
Sbjct  443  AC-NTHGDPELGELALQHLLELEPDNSGNYALLSNIYASRGRWNESRVVRKVMCDAGVKK  501

Query  935  GMGYSVVEVNNSMH  976
              G S++EVNN +H
Sbjct  502  MPGGSLIEVNNRVH  515


 Score = 87.4 bits (215),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 64/308 (21%), Positives = 134/308 (44%), Gaps = 45/308 (15%)
 Frame = +2

Query  89   LFDSLSQ-KDIIAWSAMISAYAQS-DQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSM  262
            LF S++   DI  ++ +I A + S   P  ++ ++  +QL   +P+ ++F   L+A +  
Sbjct  82   LFTSITHAPDIYLYNNIIKALSSSPTHPKASIFLYNNIQLAGLRPDSYSFPFALKAVTRF  141

Query  263  AAQDVGETIHTQVMKLGYTSNAFLASGLIDMY----------------------------  358
            ++   G  +H+Q ++ G  SN  + +  + MY                            
Sbjct  142  SSIQTGRQLHSQSIRCGLHSNLHVITAFVRMYSSCGSGYICDARKMFDGMSMSTGDVALW  201

Query  359  -------CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQ  517
                    K G +   + +F+  P +++I W+++I GY      ++A+  F  M    ++
Sbjct  202  NAMLNGYAKLGDLCNARDLFERMPQRNVISWTALITGYAQANRPHDAIALFRRMQLENVE  261

Query  518  PNDVVFISVLSACSHCG-LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEAL  694
            P+++  +  L+AC+  G LE   W   H ++    +T  +     ++DM ++ G+++ AL
Sbjct  262  PDEITMLVALTACARLGALELGEW-IRHYIDRLGLLTTNIPLNNALIDMYAKSGDIKRAL  320

Query  695  EFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAK-QLISLDPTNASYYVILSNL---  862
            +    M        W A++AG       +E  E+ ++ +   + P + ++  ILS     
Sbjct  321  KVFENMN-HKTIITWTAMIAGLALHGLGTEALEMFSRMERARVKPNDITFIAILSACSHV  379

Query  863  -YADQGRW  883
                 GRW
Sbjct  380  GLVKTGRW  387


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 85/164 (52%), Gaps = 5/164 (3%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            IP+  AL+ MYA  G+I+ +  +F++++ K II W+AMI+  A     + AL +F RM+ 
Sbjct  300  IPLNNALIDMYAKSGDIKRALKVFENMNHKTIITWTAMIAGLALHGLGTEALEMFSRMER  359

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGE-TIHTQVMKLGYTSNAFLASGLIDMYCKFGRIH  379
               KPN+  F ++L ACS +     G    +  + + G          +ID+  + G + 
Sbjct  360  ARVKPNDITFIAILSACSHVGLVKTGRWYFNRMISRYGIEPRIEHYGCMIDLLGRAGHLK  419

Query  380  QGKTIFDENP-DKDLICWSSMI---NGYGMNGHGNEALECFLDM  499
            + +T+  + P + + + W S++   N +G    G  AL+  L++
Sbjct  420  EARTLLAQMPFEPNAVIWGSLLAACNTHGDPELGELALQHLLEL  463



>ref|XP_010430773.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial-like [Camelina sativa]
Length=567

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/346 (38%), Positives = 213/346 (62%), Gaps = 7/346 (2%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFG--NIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNA  175
             K GF + + V   LL  YA  G   +  +R +FD +  KD +++++++  YAQS   + A
Sbjct  145   KRGFDRGVSVGNTLLDAYAKGGEGGVAVARNIFDQIVDKDRVSYNSIMGVYAQSGMSNEA  204

Query  176   LAVFRRMQLEHGKP-NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
               VFRR+  +     N     ++L A S   A  +G+ IH QV+++G   +  + + LID
Sbjct  205   FEVFRRLVEDKVVTFNSITLSTVLLAVSHSGALRIGKCIHDQVIRMGLEDDVIIGTSLID  264

Query  353   MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVV  532
             MYCK GR+   + +FD    K++  W++MI GYGM+GH  +ALE F  M+  G++PN + 
Sbjct  265   MYCKCGRVETARKVFDRMKYKNVRSWTAMIAGYGMHGHAAKALELFPAMIDSGVRPNYIT  324

Query  533   FISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
             F+SVL+ACSH GL  EGW WF+AM+ ++ + P L HY CMVD+L R G +++A + +  M
Sbjct  325   FVSVLAACSHAGLHVEGWRWFNAMKGRFGLEPGLEHYGCMVDLLGRAGFLQKAYDLIQTM  384

Query  713   PIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEV  892
              ++PD  IW +LLAGCR  H + E++E+   +L  LD +N  YY++LS++YAD GRW +V
Sbjct  385   KMKPDSIIWSSLLAGCR-VHKNVELAEISVARLFELDSSNCGYYMLLSHIYADAGRWKDV  443

Query  893   EKLRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             E++R +M  +   K  G+S++E+N  +H        ++E+ +H ++
Sbjct  444   ERVRMIMKNRGLVKPAGFSLLELNGEVHVFLI---GDEEHPEHEKI  486


 Score =   115 bits (287),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 81/314 (26%), Positives = 157/314 (50%), Gaps = 17/314 (5%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G+   I V +AL+ MY+  G ++ +R +FD +  ++I++W++MI  Y  +    +A+++F
Sbjct  40   GYQSDIFVSSALIVMYSTCGQLKDARKVFDEIPSRNIVSWTSMIRGYDLNGNALDAVSLF  99

Query  188  RRMQLEHGKPNEFAFH------SLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLI  349
            + + +E  + ++  F       S++ ACS +A + + E+IH+ V+K G+     + + L+
Sbjct  100  KDLLVEENEGDDAMFLDSMGMVSVISACSRVATKGLTESIHSFVVKRGFDRGVSVGNTLL  159

Query  350  DMYCKFGR--IHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQP-  520
            D Y K G   +   + IFD+  DKD + ++S++  Y  +G  NEA E F  ++   +   
Sbjct  160  DAYAKGGEGGVAVARNIFDQIVDKDRVSYNSIMGVYAQSGMSNEAFEVFRRLVEDKVVTF  219

Query  521  NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEF  700
            N +   +VL A SH G    G    H    +  +   +     ++DM  + G VE A + 
Sbjct  220  NSITLSTVLLAVSHSGALRIG-KCIHDQVIRMGLEDDVIIGTSLIDMYCKCGRVETARKV  278

Query  701  VNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLIS-LDPTNASYYVIL-----SNL  862
             ++M  + + R W A++AG      +++  EL    + S + P   ++  +L     + L
Sbjct  279  FDRMKYK-NVRSWTAMIAGYGMHGHAAKALELFPAMIDSGVRPNYITFVSVLAACSHAGL  337

Query  863  YADQGRWDEVEKLR  904
            + +  RW    K R
Sbjct  338  HVEGWRWFNAMKGR  351


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 70/122 (57%), Gaps = 6/122 (5%)
 Frame = +2

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
            P   +F   ++ACSS+     G+  H Q    GY S+ F++S LI MY   G++   + +
Sbjct  8    PTRSSFPCTIKACSSLLDIFSGKQTHQQAFVFGYQSDIFVSSALIVMYSTCGQLKDARKV  67

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVF------ISVLSAC  556
            FDE P ++++ W+SMI GY +NG+  +A+  F D+L    + +D +F      +SV+SAC
Sbjct  68   FDEIPSRNIVSWTSMIRGYDLNGNALDAVSLFKDLLVEENEGDDAMFLDSMGMVSVISAC  127

Query  557  SH  562
            S 
Sbjct  128  SR  129



>ref|XP_004295634.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Fragaria vesca subsp. vesca]
Length=611

 Score =   282 bits (722),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 210/322 (65%), Gaps = 1/322 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++G    + V  ALL +YA  G +ES+  +F+S+S++D++AW+++I+ ++ + +P+ AL 
Sbjct  166  RNGLESLVFVKNALLHLYAVCGQVESAHKVFESMSERDLVAWNSVINGFSLNGRPNEALT  225

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +FR M LE   P+ F   SLL AC+ + A  +G  IH  ++KLG T NA  ++ L+D+Y 
Sbjct  226  IFREMSLEGVVPDGFTMVSLLGACAELGALALGGRIHVYMVKLGLTRNAHASNALLDVYA  285

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G I + + +F E  ++ ++ W++++ G+ +NG G EALE F +  + G+ P ++ F+ 
Sbjct  286  KCGSIREAQKVFGEMEERSVVSWTALVVGWAVNGFGKEALELFKEFKAEGLVPTEITFVG  345

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL A SHCG+  EG+ +F  M+E+Y I P++ HY CMVD+L+R G V+EA E++  MP++
Sbjct  346  VLYAFSHCGMVDEGFEYFRMMKEEYGIVPRIEHYGCMVDLLARAGKVKEAYEYIKDMPVQ  405

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            P+  IW  LL  C   HG S + E+    ++ L+P ++  YV++SNLYA + RW +V+K+
Sbjct  406  PNAVIWRTLLGAC-TIHGHSALGEIARGHILRLEPRHSGDYVLISNLYASERRWSDVQKV  464

Query  902  RQLMDGKKRKKGMGYSVVEVNN  967
            R+ M  +  KK  GYS+VE+ N
Sbjct  465  RRTMLSEGVKKTPGYSIVELRN  486


 Score =   115 bits (288),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/223 (27%), Positives = 113/223 (51%), Gaps = 2/223 (1%)
 Frame = +2

Query  89   LFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAA  268
            +F  +   ++  W+ MI  YA+S  P   + ++R+M++   +P+   +  LL+A + +  
Sbjct  94   IFSQIKHPNVFTWNTMIRGYAESQNPMPVIQLYRQMRVSCIEPDTHTYPFLLKAVAKLLD  153

Query  269  QDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMING  448
               GE +H   ++ G  S  F+ + L+ +Y   G++     +F+   ++DL+ W+S+ING
Sbjct  154  VREGEKVHCIALRNGLESLVFVKNALLHLYAVCGQVESAHKVFESMSERDLVAWNSVING  213

Query  449  YGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITP  628
            + +NG  NEAL  F +M   G+ P+    +S+L AC+  G    G    H    K  +T 
Sbjct  214  FSLNGRPNEALTIFREMSLEGVVPDGFTMVSLLGACAELGALALGGR-IHVYMVKLGLTR  272

Query  629  KLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
                   ++D+ ++ G++ EA +   +M  E     W AL+ G
Sbjct  273  NAHASNALLDVYAKCGSIREAQKVFGEME-ERSVVSWTALVVG  314



>emb|CAN77232.1| hypothetical protein VITISV_001089 [Vitis vinifera]
Length=575

 Score =   281 bits (720),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/320 (41%), Positives = 192/320 (60%), Gaps = 1/320 (0%)
 Frame = +2

Query  17   KCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM  196
            K +  +TA+L  YA  G ++++R+LFD + ++D + W+ MI  Y Q+  P+ AL +FRRM
Sbjct  135  KSLVSLTAMLTCYAKHGELDAARVLFDGMEERDGVCWNVMIDGYTQNGMPNEALVLFRRM  194

Query  197  QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
                 KPNE    S+L AC  + A + G  +H+ +   G   N  + + L+DMY K G +
Sbjct  195  LKAKAKPNEVTVLSVLSACGQLGALESGRWVHSYIENNGIQFNVHVGTALVDMYSKCGSL  254

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
               + +FD+  DKD++ W+SMI GY M G   EAL+ F  M   G+ P ++ FI +LSAC
Sbjct  255  EDARLVFDKIDDKDVVAWNSMIVGYAMXGFSQEALQLFKSMCRMGLHPTNITFIGILSAC  314

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
             H G   EGW+ F+ M+++Y I PK+ HY CMV++L R G+VE+A E V  M IEPD  +
Sbjct  315  GHSGWVTEGWDIFNKMKDEYGIEPKIEHYGCMVNLLGRAGHVEQAYELVKNMNIEPDPVL  374

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            WG LL  CR  HG   + E + + L+  +  N+  Y++LSN+YA  G WD V +LR +M 
Sbjct  375  WGTLLGACR-LHGKIALGEKIVELLVDQNLANSGTYILLSNIYAAVGNWDGVARLRTMMK  433

Query  917  GKKRKKGMGYSVVEVNNSMH  976
                KK  G S +EVNN +H
Sbjct  434  DSGVKKEPGCSSIEVNNKVH  453


 Score =   134 bits (338),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 93/324 (29%), Positives = 151/324 (47%), Gaps = 43/324 (13%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            L + YA+ G ++ S  LF       +  W+A+I  +A       AL  + +M  +  +PN
Sbjct  15   LQRSYASLGRLDYSVALFGRTQNPSVFFWTAIIHGHALRGLHEQALNFYAQMLTQGVEPN  74

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
             F F S+L+ C      + G+ +H+Q +KLG+ S+ ++ +GL+D+Y + G +   + +FD
Sbjct  75   AFTFSSILKLCPI----EPGKALHSQAVKLGFDSDLYVRTGLLDVYARGGDVVSAQQLFD  130

Query  401  ENPDKDL-------------------------------ICWSSMINGYGMNGHGNEALEC  487
              P+K L                               +CW+ MI+GY  NG  NEAL  
Sbjct  131  TMPEKSLVSLTAMLTCYAKHGELDAARVLFDGMEERDGVCWNVMIDGYTQNGMPNEALVL  190

Query  488  FLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLS  667
            F  ML    +PN+V  +SVLSAC   G   E   W H+  E   I   +     +VDM S
Sbjct  191  FRRMLKAKAKPNEVTVLSVLSACGQLG-ALESGRWVHSYIENNGIQFNVHVGTALVDMYS  249

Query  668  RQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQL-ISLDPTNASYY  844
            + G++E+A    +K+  + D   W +++ G      S E  +L      + L PTN ++ 
Sbjct  250  KCGSLEDARLVFDKID-DKDVVAWNSMIVGYAMXGFSQEALQLFKSMCRMGLHPTNITFI  308

Query  845  VILSNL----YADQGRWDEVEKLR  904
             ILS      +  +G WD   K++
Sbjct  309  GILSACGHSGWVTEG-WDIFNKMK  331



>ref|XP_009121419.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Brassica rapa]
Length=657

 Score =   283 bits (725),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/328 (40%), Positives = 207/328 (63%), Gaps = 4/328 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANF--GNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNA  175
            K GF + + V   LL  YA    G +  +R +FD +  KD +++++++S YAQ+   S A
Sbjct  209  KRGFERGVSVGNTLLDAYAKGREGGVAVARRIFDEIVGKDSVSYNSIMSVYAQNGMSSEA  268

Query  176  LAVFRRMQLEHGKP-NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
              VFR +  + G   N     ++L A S   A  VG+ +H QV+++G   +  + + +ID
Sbjct  269  FDVFRILMNDKGVTFNSITLSTVLLAVSHSGALRVGKCVHDQVVRMGLEDDVVVGTSIID  328

Query  353  MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVV  532
            MYCK GR+   + +FD    K++  W++MI GYGM+GH  +ALE F  M+S G++PN + 
Sbjct  329  MYCKCGRVETARKVFDRMRKKNVRTWTAMIAGYGMHGHAVKALELFPVMISSGVRPNYIT  388

Query  533  FISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
            F+SVL+ACSH GL  EGW WF++M+ ++ + P L HY CMVD+L R G +++A + V  M
Sbjct  389  FVSVLAACSHAGLHVEGWRWFNSMKGRFGVEPGLEHYGCMVDLLGRAGYLQKAYDLVQTM  448

Query  713  PIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEV  892
             ++PD  IW +LLA CR  H + E++E+   +L  LDP+N  YY++LS++YAD GRW EV
Sbjct  449  KMKPDSVIWSSLLAACR-IHKNVELAEISVARLFELDPSNCGYYMLLSHIYADAGRWKEV  507

Query  893  EKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
            E++R +M  +   K  G+S++E+N  +H
Sbjct  508  ERVRTVMKKRGLVKPPGFSLLELNGEVH  535


 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/257 (29%), Positives = 135/257 (53%), Gaps = 9/257 (4%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G+   + V +AL+ MY+  G +E +R +FD +  ++I+ W++MI  Y  +    +A+++F
Sbjct  106  GYHSDVFVSSALIVMYSTCGQVEDARKVFDEMPVRNIVCWTSMIRGYDLNGNALDAVSLF  165

Query  188  RRMQLEHGKPNE----FAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM  355
            + + L  G+ +E        S++ ACS +AA+ + E+IH  V+K G+     + + L+D 
Sbjct  166  KELLLLDGRDHEDVDSKGMVSVISACSRVAAKGLTESIHGFVVKRGFERGVSVGNTLLDA  225

Query  356  YCKF--GRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECF-LDMLSHGIQPND  526
            Y K   G +   + IFDE   KD + ++S+++ Y  NG  +EA + F + M   G+  N 
Sbjct  226  YAKGREGGVAVARRIFDEIVGKDSVSYNSIMSVYAQNGMSSEAFDVFRILMNDKGVTFNS  285

Query  527  VVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVN  706
            +   +VL A SH G    G    H    +  +   +     ++DM  + G VE A +  +
Sbjct  286  ITLSTVLLAVSHSGALRVG-KCVHDQVVRMGLEDDVVVGTSIIDMYCKCGRVETARKVFD  344

Query  707  KMPIEPDKRIWGALLAG  757
            +M  + + R W A++AG
Sbjct  345  RMR-KKNVRTWTAMIAG  360


 Score =   107 bits (267),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 90/158 (57%), Gaps = 4/158 (3%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + + D+ +W+++I+  A+S+  S AL  F  M+     PN   F   ++ACSS+     G
Sbjct  36   IDKTDVFSWNSVIADLARSNDSSEALRAFSSMRKLSLHPNRSTFPCAIKACSSLLDLFSG  95

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q    GY S+ F++S LI MY   G++   + +FDE P ++++CW+SMI GY +N
Sbjct  96   KQTHQQAFVFGYHSDVFVSSALIVMYSTCGQVEDARKVFDEMPVRNIVCWTSMIRGYDLN  155

Query  461  GHGNEALECFLD-MLSHGIQPNDV---VFISVLSACSH  562
            G+  +A+  F + +L  G    DV     +SV+SACS 
Sbjct  156  GNALDAVSLFKELLLLDGRDHEDVDSKGMVSVISACSR  193



>ref|XP_008341243.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial-like [Malus domestica]
Length=653

 Score =   283 bits (725),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/344 (40%), Positives = 208/344 (60%), Gaps = 5/344 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF   + V   L+  YA  G +   R +FD +SQKD+++W++MI+ YAQS   S A  
Sbjct  207   KRGFDGDLWVGNTLMDAYAKCGELGLVRKVFDGMSQKDLVSWNSMIATYAQSGLSSEAWQ  266

Query  182   VFRRMQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VF  M  +     N     +LL AC+      VG++IH QV+K G   N  +++ +IDMY
Sbjct  267   VFYGMARDGDVHYNAVTLSTLLLACAHAGPLLVGKSIHDQVLKKGLEENVIVSTSIIDMY  326

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK GR+   +  FD   +K++  W++M+ GYGM+G   EALE F  M+  G+ PN + F+
Sbjct  327   CKRGRVDLARKAFDCMKEKNVRTWTAMVAGYGMHGXAKEALEVFYKMIRDGVTPNYITFV  386

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             S+L+ACSH GL  +GW WF+AM  K+ + P + HY CMVD+L R G++ +A + +  M I
Sbjct  387   SLLNACSHAGLLEQGWYWFNAMSRKFGVEPGIEHYGCMVDLLGRSGDLNKAYDLIKGMRI  446

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
              PD  +WG+ L  CR  H +   +E+ A++L  LDP N  YY++LSN+YAD GRW++VE+
Sbjct  447   MPDCVVWGSFLGACR-VHKNVTFAEISARKLFELDPHNCGYYILLSNIYADAGRWEDVER  505

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             +R LM  +   K  G+S+VE+   +H        ++E+ QH ++
Sbjct  506   MRVLMKNRGLVKPPGFSLVELRGIVHLFLV---GDREHPQHEKI  546


 Score =   126 bits (317),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 82/293 (28%), Positives = 152/293 (52%), Gaps = 10/293 (3%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF   + V +AL+ MY+  G +  +  LFD++  ++++ W++MI+   Q+D    ALA+F
Sbjct  103  GFESDLFVSSALIDMYSRCGRLTDAWKLFDTIPHRNVVTWTSMITGCVQNDDACQALALF  162

Query  188  RRMQLEHGKPNEFAFH-----SLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
            + + +E     + +       S+L ACS ++++ + +++H  V+K G+  + ++ + L+D
Sbjct  163  KELLIEEIDNEDVSLDPVVLVSVLSACSRVSSKGLAQSVHGLVVKRGFDGDLWVGNTLMD  222

Query  353  MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHG-IQPNDV  529
             Y K G +   + +FD    KDL+ W+SMI  Y  +G  +EA + F  M   G +  N V
Sbjct  223  AYAKCGELGLVRKVFDGMSQKDLVSWNSMIATYAQSGLSSEAWQVFYGMARDGDVHYNAV  282

Query  530  VFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNK  709
               ++L AC+H G    G +  H    K  +   +     ++DM  ++G V+ A +  + 
Sbjct  283  TLSTLLLACAHAGPLLVGKS-IHDQVLKKGLEENVIVSTSIIDMYCKRGRVDLARKAFDC  341

Query  710  MPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYA  868
            M  E + R W A++AG    HG ++ +  V  ++I  D    +Y   +S L A
Sbjct  342  MK-EKNVRTWTAMVAG-YGMHGXAKEALEVFYKMIR-DGVTPNYITFVSLLNA  391


 Score = 99.4 bits (246),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 87/158 (55%), Gaps = 5/158 (3%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + + D+ +W+++I+  A+S     AL  F  M+    +PN  +F   +++CS++     G
Sbjct  33   VDKDDVASWNSVIADLARSGDSLEALRAFSSMRKLSLRPNRSSFPCAIKSCSALLDLHSG  92

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q +  G+ S+ F++S LIDMY + GR+     +FD  P ++++ W+SMI G   N
Sbjct  93   KQAHQQALVFGFESDLFVSSALIDMYSRCGRLTDAWKLFDTIPHRNVVTWTSMITGCVQN  152

Query  461  GHGNEALECFLDMLSHGIQPND-----VVFISVLSACS  559
                +AL  F ++L   I   D     VV +SVLSACS
Sbjct  153  DDACQALALFKELLIEEIDNEDVSLDPVVLVSVLSACS  190



>ref|XP_010068636.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like 
[Eucalyptus grandis]
 gb|KCW64279.1| hypothetical protein EUGRSUZ_G01917 [Eucalyptus grandis]
Length=628

 Score =   283 bits (723),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/318 (42%), Positives = 201/318 (63%), Gaps = 2/318 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            + V+ A + MYA  G I+ +R LFD + +KD++ WS+MI AYA++D P  AL +FR +  
Sbjct  267  LSVLHAAMVMYARCGRIDVARALFDGIHEKDLVCWSSMIEAYAKADMPLKALDLFRELLC  326

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
                P+     S+L+AC  + +     T+H  +++  + S+  L + ++D+Y K G +  
Sbjct  327  LCIYPDAITLLSVLRACLELGSFLQACTVHAMIIRRFFESHVELNTCMVDLYAKCGNLEH  386

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             +  FD  P+K+LI WS+MI+GY M+GHG E L  F D +   ++P+ +VF+SVLSACSH
Sbjct  387  ARKFFDRMPEKNLISWSAMISGYAMHGHGREVLHLF-DQMKFSVKPDHIVFVSVLSACSH  445

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             GL  EGW  F +M   + +TP   HYACMVD+L R G+++EA++F+ KMPIEPD  +WG
Sbjct  446  SGLLNEGWECFESMSRDFGVTPIHEHYACMVDLLGRAGHLDEAVDFIEKMPIEPDAGVWG  505

Query  743  ALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGK  922
            ALL  CR  H   E +E  AK L  LDP N+  Y + SN+YA  G  +E +++R LM  +
Sbjct  506  ALLGACR-IHRDVERAEKAAKFLFELDPENSGRYAVFSNIYASLGNKEEADQIRDLMKRR  564

Query  923  KRKKGMGYSVVEVNNSMH  976
            + +K  G+S++E+ N +H
Sbjct  565  EVRKLSGHSIIEIGNRIH  582


 Score =   124 bits (311),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 140/285 (49%), Gaps = 5/285 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            +SG+   + V  +L+ MY   G +E +R +FD + ++++I+WS+MI A A++    + L 
Sbjct  162  RSGYGSDVFVGNSLVAMYGKCGRVEVARQVFDRMPERNVISWSSMIGACARNGCYEDGLR  221

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M     +PN  A    +      A  DV   +   V   G  S+  +    + MY 
Sbjct  222  LFWEMLDGGVRPNRGAAVDAMACVHREAEADV---VCGVVKDNGLDSDLSVLHAAMVMYA  278

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            + GRI   + +FD   +KDL+CWSSMI  Y       +AL+ F ++L   I P+ +  +S
Sbjct  279  RCGRIDVARALFDGIHEKDLVCWSSMIEAYAKADMPLKALDLFRELLCLCIYPDAITLLS  338

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL AC   G   +     HAM  +      +    CMVD+ ++ GN+E A +F ++MP E
Sbjct  339  VLRACLELGSFLQACT-VHAMIIRRFFESHVELNTCMVDLYAKCGNLEHARKFFDRMP-E  396

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILS  856
             +   W A+++G        E+  L  +   S+ P +  +  +LS
Sbjct  397  KNLISWSAMISGYAMHGHGREVLHLFDQMKFSVKPDHIVFVSVLS  441


 Score =   105 bits (262),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 94/181 (52%), Gaps = 2/181 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFD-SLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQ  199
            +  +T L+  YA+ G++  +R LF  S    D+  W+ ++       +   AL ++ RM+
Sbjct  67   LTFLTHLVARYASLGSLPHARALFALSAEPPDVFLWNVVVRGCVDGLRFRPALGLYARMR  126

Query  200  LEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIH  379
             +   P+ F +  +L+AC  +     G  +H   ++ GY S+ F+ + L+ MY K GR+ 
Sbjct  127  GQGIGPDNFTYPFVLKACGCLGDVKSGALVHHDALRSGYGSDVFVGNSLVAMYGKCGRVE  186

Query  380  QGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACS  559
              + +FD  P++++I WSSMI     NG   + L  F +ML  G++PN    +  + AC 
Sbjct  187  VARQVFDRMPERNVISWSSMIGACARNGCYEDGLRLFWEMLDGGVRPNRGAAVDAM-ACV  245

Query  560  H  562
            H
Sbjct  246  H  246



>ref|XP_010315902.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial isoform X2 [Solanum lycopersicum]
Length=639

 Score =   283 bits (724),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/344 (41%), Positives = 208/344 (60%), Gaps = 8/344 (2%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF + + V    +  YA  G ++ SR +FD +  KDII+W++MI+ YAQ    + A+ 
Sbjct  196   KRGFNEDMGVGNTFIDAYAKCGQVDLSRKMFDIMPYKDIISWNSMIAVYAQHGLSAQAME  255

Query  182   VFRRMQLEHGKP-NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             +FR +  +     N     +LL AC+   A   G+ IH Q   +    N ++ + +IDMY
Sbjct  256   IFRSLSWDREVDYNAVTLSALLLACAHSGALQAGKCIHDQ---MNLEDNVYVGTSMIDMY  312

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK GR+   +  F+   +K++  WS++I GYGM+G   EAL+ F +M S G++P+ + F+
Sbjct  313   CKCGRLRMARNAFNRMKEKNVKSWSALIAGYGMHGRAREALQVFYEMNSAGVKPSYITFV  372

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             SVL+ACSH GL  EGW WF AME ++ I P + HYACMVD+L R G +  A + + +M +
Sbjct  373   SVLAACSHGGLLDEGWYWFKAMEPRFCIQPGVEHYACMVDLLGRAGFLTRAYDLLKEMKV  432

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
              PD  IWG+LLA CR  H + E+ E+ A  L  LDPTN  YYV+LSN+YAD GRW +VEK
Sbjct  433   TPDFVIWGSLLAACR-IHKNVELGEISASNLFELDPTNCGYYVLLSNIYADAGRWGDVEK  491

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             +R LM  +   K  G+S++E+   +H        ++E+ QH +V
Sbjct  492   MRILMKNRGLSKPPGFSLLELKGRVHVFVV---GDREHPQHEKV  532


 Score =   122 bits (307),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 130/245 (53%), Gaps = 7/245 (3%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL-E  205
            V +AL+ MY+  G +  +R LFD + QK++++W++MI+ Y Q+D+P  A+ +F+ +   E
Sbjct  103  VSSALIDMYSKCGQLADARKLFDQIPQKNVVSWTSMITGYVQNDRPHEAIWLFKELLAGE  162

Query  206  HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQG  385
                +  A  S+L A S ++ + + + +H  V K G+  +  + +  ID Y K G++   
Sbjct  163  VVFLDSVAMVSVLSASSRLSGKTLTQGLHGFVTKRGFNEDMGVGNTFIDAYAKCGQVDLS  222

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDM-LSHGIQPNDVVFISVLSACSH  562
            + +FD  P KD+I W+SMI  Y  +G   +A+E F  +     +  N V   ++L AC+H
Sbjct  223  RKMFDIMPYKDIISWNSMIAVYAQHGLSAQAMEIFRSLSWDREVDYNAVTLSALLLACAH  282

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             G    G      + ++ ++   +     M+DM  + G +  A    N+M  E + + W 
Sbjct  283  SGALQAG----KCIHDQMNLEDNVYVGTSMIDMYCKCGRLRMARNAFNRMK-EKNVKSWS  337

Query  743  ALLAG  757
            AL+AG
Sbjct  338  ALIAG  342


 Score =   107 bits (268),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 113/219 (52%), Gaps = 3/219 (1%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            L + D+ +W+++I+  A+S     AL  F  M+    KPN   F   +++CSS++    G
Sbjct  26   LDKSDVFSWNSIIADLARSGDAVEALRAFSSMRKLSLKPNRSTFPCAVKSCSSLSDLTSG  85

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q +  GY ++ F++S LIDMY K G++   + +FD+ P K+++ W+SMI GY  N
Sbjct  86   KQTHQQALIFGYDTDLFVSSALIDMYSKCGQLADARKLFDQIPQKNVVSWTSMITGYVQN  145

Query  461  GHGNEALECFLDMLSHGIQPND-VVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLA  637
               +EA+  F ++L+  +   D V  +SVLSA S    +       H    K      + 
Sbjct  146  DRPHEAIWLFKELLAGEVVFLDSVAMVSVLSASSRLSGKTLTQG-LHGFVTKRGFNEDMG  204

Query  638  HYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
                 +D  ++ G V+ + +  + MP + D   W +++A
Sbjct  205  VGNTFIDAYAKCGQVDLSRKMFDIMPYK-DIISWNSMIA  242



>ref|XP_010916743.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, 
chloroplastic [Elaeis guineensis]
Length=873

 Score =   288 bits (736),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 209/320 (65%), Gaps = 2/320 (1%)
 Frame = +2

Query  17   KCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM  196
            K + V  AL+ MY+  G++E +R +FD+ + K+II+W+ +I  Y+++  P+ AL++F +M
Sbjct  434  KNLIVANALMDMYSKCGSMEEARSIFDNTTSKNIISWNTLIGGYSKNCFPNEALSLFSKM  493

Query  197  QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
            Q  H +PN      +L A +S+++ + G  IH  +++ G+ S+ ++A+ L+DMY K G +
Sbjct  494  QF-HMRPNSVTMACVLPAAASLSSLEKGREIHGHILRAGHFSDGYVANALVDMYTKCGAL  552

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
               + +FD    KDLI W+ MI GYGM+GH   A+  F +M   G++P++V F  +L AC
Sbjct  553  LLARLLFDRMFQKDLISWTVMIAGYGMHGHRRNAITVFKEMRGSGVEPDEVSFTVILYAC  612

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
            SH GL +EGW +++ M  +Y I PKL HYAC+VD+LSR G + +A EF+  MPIEPD  +
Sbjct  613  SHSGLIHEGWEFYNIMRNEYKIEPKLEHYACVVDLLSRAGCLVKAYEFIKSMPIEPDSTV  672

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            WGALL GCR  H + +++E VA+ +  L+P N  YYV+L+N+YA+   W+ V KLRQ + 
Sbjct  673  WGALLCGCR-IHRNVKLAERVAEHVFELEPENTGYYVLLANIYAEAEEWEAVRKLRQKIS  731

Query  917  GKKRKKGMGYSVVEVNNSMH  976
            G   +K  G S +E+ + +H
Sbjct  732  GHGLRKSPGCSWIEIKSKIH  751


 Score =   127 bits (318),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 148/292 (51%), Gaps = 18/292 (6%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+ + K + V  +L+ MY+   ++E +  +F+ + Q+ +++W++MI AY ++     A+A
Sbjct  328  KAAYSKEVTVNNSLVDMYSKCCSLEGASRIFERMVQRSVVSWTSMIQAYTRAGLFDEAIA  387

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M+    +P+ FA  S L ACS   + D G+ IH  +++     N  +A+ L+DMY 
Sbjct  388  LFGEMESVGVRPDLFAVTSALHACSCRGSLDQGKNIHDYIVRNRLEKNLIVANALMDMYS  447

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G + + ++IFD    K++I W+++I GY  N   NEAL  F  M  H ++PN V    
Sbjct  448  KCGSMEEARSIFDNTTSKNIISWNTLIGGYSKNCFPNEALSLFSKMQFH-MRPNSVTMAC  506

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYA------CMVDMLSRQGNVEEALEFV  703
            VL A +      +G        E +    +  H++       +VDM ++ G +  A    
Sbjct  507  VLPAAASLSSLEKG-------REIHGHILRAGHFSDGYVANALVDMYTKCGALLLARLLF  559

Query  704  NKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQL--ISLDPTNASYYVIL  853
            ++M  + D   W  ++AG    HG    +  V K++    ++P   S+ VIL
Sbjct  560  DRM-FQKDLISWTVMIAG-YGMHGHRRNAITVFKEMRGSGVEPDEVSFTVIL  609


 Score =   119 bits (297),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/229 (30%), Positives = 118/229 (52%), Gaps = 2/229 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKD-IIAWSAMISAYAQSDQPSNALAVFRRMQLE  205
            + + L+ MY   G++   R +FD  + KD I  W+ +++ YAQ      ++ +F+ MQ  
Sbjct  134  LASKLVFMYVKCGDLGEGRRVFDKSAAKDHIFPWNLLLNEYAQVGDLEESIDLFKEMQYS  193

Query  206  HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQG  385
              KP+ + F  +L+  +++     GE +H +++KLG+ +   + + LI  Y K  RI+  
Sbjct  194  SVKPDSYTFSLILKCFATVGGVSEGEQVHGRLIKLGFGAYNAVGNALIAFYSKCNRINSA  253

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC  565
              +FDE PDKD+I W+S+ING   N    + +E F DM   G+  +    +SVL AC+  
Sbjct  254  VDMFDEMPDKDVISWNSLINGCVSNSLPRKGVELFTDMWFSGMDIDSATLVSVLPACAEL  313

Query  566  GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
            G+   G    H    K   + ++     +VDM S+  ++E A     +M
Sbjct  314  GILTLG-KAVHGYSIKAAYSKEVTVNNSLVDMYSKCCSLEGASRIFERM  361


 Score =   108 bits (270),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 129/286 (45%), Gaps = 6/286 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     V  AL+  Y+    I S+  +FD +  KD+I+W+++I+    +  P   + 
Sbjct  227  KLGFGAYNAVGNALIAFYSKCNRINSAVDMFDEMPDKDVISWNSLINGCVSNSLPRKGVE  286

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M       +     S+L AC+ +    +G+ +H   +K  Y+    + + L+DMY 
Sbjct  287  LFTDMWFSGMDIDSATLVSVLPACAELGILTLGKAVHGYSIKAAYSKEVTVNNSLVDMYS  346

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K   +     IF+    + ++ W+SMI  Y   G  +EA+  F +M S G++P+     S
Sbjct  347  KCCSLEGASRIFERMVQRSVVSWTSMIQAYTRAGLFDEAIALFGEMESVGVRPDLFAVTS  406

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
             L ACS  G   +G N  H    +  +   L     ++DM S+ G++EEA    +     
Sbjct  407  ALHACSCRGSLDQGKN-IHDYIVRNRLEKNLIVANALMDMYSKCGSMEEARSIFDNT---  462

Query  722  PDKRI--WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
              K I  W  L+ G  K    +E   L +K    + P + +   +L
Sbjct  463  TSKNIISWNTLIGGYSKNCFPNEALSLFSKMQFHMRPNSVTMACVL  508


 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/182 (26%), Positives = 85/182 (47%), Gaps = 3/182 (2%)
 Frame = +2

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            N   F S+LQ C+ + +   G  +H  +   G   +  LAS L+ MY K G + +G+ +F
Sbjct  96   NSETFCSVLQLCAELCSLADGRKVHAILSSSGIKIDTLLASKLVFMYVKCGDLGEGRRVF  155

Query  398  DENPDKD-LICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            D++  KD +  W+ ++N Y   G   E+++ F +M    ++P+   F  +L   +  G  
Sbjct  156  DKSAAKDHIFPWNLLLNEYAQVGDLEESIDLFKEMQYSSVKPDSYTFSLILKCFATVGGV  215

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
             EG    H    K       A    ++   S+   +  A++  ++MP + D   W +L+ 
Sbjct  216  SEG-EQVHGRLIKLGFGAYNAVGNALIAFYSKCNRINSAVDMFDEMP-DKDVISWNSLIN  273

Query  755  GC  760
            GC
Sbjct  274  GC  275



>emb|CDY63199.1| BnaA09g52240D [Brassica napus]
Length=657

 Score =   283 bits (724),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 132/328 (40%), Positives = 206/328 (63%), Gaps = 4/328 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANF--GNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNA  175
            K GF + + V   LL  YA    G +  +R +FD +  KD +++++++S YAQ+   S A
Sbjct  209  KRGFERGVSVGNTLLDAYAKGREGGVAVARRIFDEIVGKDSVSYNSIMSVYAQNGMSSEA  268

Query  176  LAVFRRMQLEHGKP-NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
              VFR +  + G   N     +LL A S      VG+ +H QV+++G   +  + + +ID
Sbjct  269  FDVFRILMKDKGVTFNSITLSTLLLAVSHSGGLRVGKCVHDQVVRMGLEDDVVVGTSIID  328

Query  353  MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVV  532
            MYCK GR+   + +FD    K++  W++MI GYGM+GH  +ALE F  M+S G++PN + 
Sbjct  329  MYCKCGRVEAARKVFDRMRKKNVRTWTAMIAGYGMHGHAVKALELFPVMISSGVRPNYIT  388

Query  533  FISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
            F+SVL+ACSH GL  EGW WF++M+ ++ + P L HY CMVD+L R G +++A + V  M
Sbjct  389  FVSVLAACSHAGLHVEGWRWFNSMKGRFGVEPGLEHYGCMVDLLGRAGYLQKAYDLVQTM  448

Query  713  PIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEV  892
             ++PD  IW +LLA CR  H + E++E+   +L  LDP+N  YY++LS++YAD GRW EV
Sbjct  449  KMKPDSVIWSSLLAACR-IHKNVELAEISIARLFELDPSNCGYYMLLSHIYADAGRWKEV  507

Query  893  EKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
            E++R +M  +   K  G+S++E+N  +H
Sbjct  508  ERVRTVMKKRGLVKPPGFSLLELNGEVH  535


 Score =   115 bits (287),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 135/257 (53%), Gaps = 9/257 (4%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G+   + V +AL+ MY+  G +E +R +FD + +++I+ W++MI  Y  +    +A+++F
Sbjct  106  GYHSDVFVSSALIVMYSTCGQVEDARKVFDEMPKRNIVCWTSMIRGYDLNGNALDAVSLF  165

Query  188  RRMQL----EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM  355
            + + L    +H   +     S++ ACS +AA+ + E+IH  V+K G+     + + L+D 
Sbjct  166  KELLLLDSGDHEDVDSKGMVSVISACSRVAAKGLTESIHGFVVKRGFERGVSVGNTLLDA  225

Query  356  YCKF--GRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECF-LDMLSHGIQPND  526
            Y K   G +   + IFDE   KD + ++S+++ Y  NG  +EA + F + M   G+  N 
Sbjct  226  YAKGREGGVAVARRIFDEIVGKDSVSYNSIMSVYAQNGMSSEAFDVFRILMKDKGVTFNS  285

Query  527  VVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVN  706
            +   ++L A SH G    G    H    +  +   +     ++DM  + G VE A +  +
Sbjct  286  ITLSTLLLAVSHSGGLRVG-KCVHDQVVRMGLEDDVVVGTSIIDMYCKCGRVEAARKVFD  344

Query  707  KMPIEPDKRIWGALLAG  757
            +M  + + R W A++AG
Sbjct  345  RMR-KKNVRTWTAMIAG  360


 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/158 (34%), Positives = 89/158 (56%), Gaps = 4/158 (3%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
              + D+ +W+++I+  A+S+  S AL  F  M+     PN   F   ++ACSS+     G
Sbjct  36   FDKTDVFSWNSVIADLARSNDSSEALRAFSSMRKLSLHPNRSTFPCAIKACSSLLDLFSG  95

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q    GY S+ F++S LI MY   G++   + +FDE P ++++CW+SMI GY +N
Sbjct  96   KQTHQQAFVFGYHSDVFVSSALIVMYSTCGQVEDARKVFDEMPKRNIVCWTSMIRGYDLN  155

Query  461  GHGNEALECFLDMLSHGIQPNDVV----FISVLSACSH  562
            G+  +A+  F ++L      ++ V     +SV+SACS 
Sbjct  156  GNALDAVSLFKELLLLDSGDHEDVDSKGMVSVISACSR  193



>ref|XP_010274829.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Nelumbo nucifera]
 ref|XP_010274830.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Nelumbo nucifera]
Length=798

 Score =   286 bits (732),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/325 (42%), Positives = 205/325 (63%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++GF   + + TAL+ MY   G I S+R LFD++ ++D++ W+AMISAYAQ+   + AL 
Sbjct  353  RNGFNMSVALTTALVDMYGKCGRISSARALFDAMDERDVMTWTAMISAYAQTKCLNQALD  412

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M+    KPNE    ++L  C    A D+G+ IH  + K G  ++  L + L+DMY 
Sbjct  413  LFILMRNAGIKPNEVTMVNILPLCGDAGALDLGKWIHAYIDKQGIHTDVVLMTALVDMYA  472

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G I   + IF +  ++D+  W++M++G+ M+G G +ALE FL+M   GI+PND+ FI 
Sbjct  473  KCGDIDAARWIFTKATNRDICMWNAMMSGFAMHGCGEKALELFLEMERRGIKPNDITFIG  532

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL ACSH GL  EG   F  M  ++ + PK+ HY CMVD+L R G +++A E +N MPI 
Sbjct  533  VLHACSHAGLVAEGQRLFGRMVHEFGLNPKVEHYGCMVDLLGRAGLLDKAHEMINSMPIR  592

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            P+  +WGALLA C K H ++ + EL A+QL+ L+P N  Y V+LSN+YA   RW++V ++
Sbjct  593  PNAIVWGALLAAC-KIHKNTTLGELAARQLLELEPLNCGYNVLLSNIYASAKRWNDVAEV  651

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R+ M     KK  G S +EVN  +H
Sbjct  652  RRTMKETGIKKAPGLSSIEVNGVVH  676


 Score =   152 bits (385),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/253 (33%), Positives = 137/253 (54%), Gaps = 3/253 (1%)
 Frame = +2

Query  26   PVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLE  205
            P VTAL+ MYA   +I  +R LFD L+ K I++W+AMI+ Y + +     + +F  M  E
Sbjct  260  PTVTALIDMYAKCRSITLARRLFDRLTHKSIVSWTAMIAGYIRCNCFEEGVKLFVEMLEE  319

Query  206  HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQG  385
               PNE    SL+  C S  A ++G+ +H  +++ G+  +  L + L+DMY K GRI   
Sbjct  320  GVIPNEITMLSLVLECGSTGAIELGKQLHAYILRNGFNMSVALTTALVDMYGKCGRISSA  379

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC  565
            + +FD   ++D++ W++MI+ Y      N+AL+ F+ M + GI+PN+V  +++L  C   
Sbjct  380  RALFDAMDERDVMTWTAMISAYAQTKCLNQALDLFILMRNAGIKPNEVTMVNILPLCGDA  439

Query  566  GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGA  745
            G    G  W HA  +K  I   +     +VDM ++ G+++ A     K     D  +W A
Sbjct  440  GALDLG-KWIHAYIDKQGIHTDVVLMTALVDMYAKCGDIDAARWIFTK-ATNRDICMWNA  497

Query  746  LLAGCRKTHGSSE  784
            +++G    HG  E
Sbjct  498  MMSGF-AMHGCGE  509


 Score =   117 bits (293),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 83/321 (26%), Positives = 151/321 (47%), Gaps = 10/321 (3%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G    + V  AL+ +YA  G+I S+R +F+ + ++D+++WS MI  Y++S     AL 
Sbjct  149  KNGLDMDVFVNNALILVYAECGSINSARQMFNKMPERDVVSWSTMIRTYSRSTSYDEALD  208

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTS--NAFLASGLIDM  355
            + R M     +P+E A  +++   + +   ++G  +H  V+K   +        + LIDM
Sbjct  209  LIREMHHLQVRPSEIAMINMINLFADIGIMEIGRPMHAYVIKSSSSVSIRTPTVTALIDM  268

Query  356  YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVF  535
            Y K   I   + +FD    K ++ W++MI GY       E ++ F++ML  G+ PN++  
Sbjct  269  YAKCRSITLARRLFDRLTHKSIVSWTAMIAGYIRCNCFEEGVKLFVEMLEEGVIPNEITM  328

Query  536  ISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMP  715
            +S++  C   G   E     HA   +      +A    +VDM  + G +  A    + M 
Sbjct  329  LSLVLECGSTG-AIELGKQLHAYILRNGFNMSVALTTALVDMYGKCGRISSARALFDAMD  387

Query  716  IEPDKRIWGALLAGCRKTHGSSEISEL-VAKQLISLDPTNASYYVILSNLYADQGRWDEV  892
             E D   W A+++   +T   ++  +L +  +   + P   +   IL  L  D G  D  
Sbjct  388  -ERDVMTWTAMISAYAQTKCLNQALDLFILMRNAGIKPNEVTMVNILP-LCGDAGALDLG  445

Query  893  EKLRQLMDGKKRKKGMGYSVV  955
            + +   +D    K+G+   VV
Sbjct  446  KWIHAYID----KQGIHTDVV  462


 Score = 90.9 bits (224),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 126/228 (55%), Gaps = 10/228 (4%)
 Frame = +2

Query  92   FDSLSQKDIIA--WSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMA  265
            FDS+ +    A  ++ +I++Y ++++P +AL+++  M+    + + F   S+L+ACS ++
Sbjct  76   FDSIQRHSSPASQFNFLITSYIKNNRPRDALSIYAHMRNSDAEVDNFTVPSILKACSQLS  135

Query  266  AQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMIN  445
             +  G+ IH  V+K G   + F+ + LI +Y + G I+  + +F++ P++D++ WS+MI 
Sbjct  136  WEQQGKEIHGFVLKNGLDMDVFVNNALILVYAECGSINSARQMFNKMPERDVVSWSTMIR  195

Query  446  GYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHA--MEEKYD  619
             Y  +   +EAL+   +M    ++P+++  I++++  +  G+   G    HA  ++    
Sbjct  196  TYSRSTSYDEALDLIREMHHLQVRPSEIAMINMINLFADIGIMEIG-RPMHAYVIKSSSS  254

Query  620  ITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI--WGALLAG  757
            ++ +      ++DM ++  ++  A    +++     K I  W A++AG
Sbjct  255  VSIRTPTVTALIDMYAKCRSITLARRLFDRL---THKSIVSWTAMIAG  299



>ref|XP_010100741.1| hypothetical protein L484_005808 [Morus notabilis]
 gb|EXB84044.1| hypothetical protein L484_005808 [Morus notabilis]
Length=877

 Score =   287 bits (735),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 141/325 (43%), Positives = 208/325 (64%), Gaps = 3/325 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            +SG    + V  AL+ MY+  G+++ + ++F  +  KDII+W+ MI  Y+++  P+ AL 
Sbjct  434  ESGMESNLFVCNALMDMYSKCGSMDDANLVFSRMPAKDIISWNTMIGGYSKNRLPNEALK  493

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  MQ    K +      +L AC+S+AA   G  IH  V++ GY  +  +A+ L+DMY 
Sbjct  494  LFAEMQ-GKSKADSITAACILPACASLAALAKGREIHGHVLRNGYFQDRHVANALVDMYV  552

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +   + +FD  P KDLI W+ MI GYGM+G G EA+  F +M   GI+P++V FIS
Sbjct  553  KCGLLALAQVLFDMIPVKDLISWTVMIAGYGMHGFGREAIAAFDEMRHAGIEPDEVSFIS  612

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L ACSH GL+ EGW++F+ M  +Y I P L HYACMVD+LSR GN+ +A  F+ KMPIE
Sbjct  613  ILYACSHSGLD-EGWSFFNVMRNEYSIEPMLEHYACMVDLLSRTGNLSKAYRFIRKMPIE  671

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD  IWGALL GCR  H   +++E VA+ +  L+P N  YYV+L+N+YA+  +W+EV KL
Sbjct  672  PDATIWGALLCGCRTYH-DVKLAERVAEHVFELEPDNTGYYVLLANIYAEAEKWEEVRKL  730

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R+ +  +  KK  G S +E+   ++
Sbjct  731  REKIGRRGLKKNPGCSWIEIKGKVN  755


 Score =   120 bits (301),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 138/269 (51%), Gaps = 4/269 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     V+ +L+  Y   G +ES++ +FD L+ +D+I+W++MIS Y+ +      + 
Sbjct  232  KLGFGCYNTVLNSLVAFYFKSGRVESAQKVFDELTDRDVISWNSMISGYSSNGLGEKGVG  291

Query  182  VFRRMQLEHGKPNEFA-FHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
            +F +M L  G   + A   + L AC+++    +G  +H   +K  +       + L+DMY
Sbjct  292  IFGKM-LSLGVNVDLATIVNALVACANIGTHLLGRAVHAYAIKACFDGEIMFRNTLLDMY  350

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             K G +     +F++  ++ ++ W+SMI GY   G  NEA+  F +M  +G+ P+     
Sbjct  351  SKCGELDAAVQVFEKTGERSVVSWTSMIAGYAREGRSNEAIRLFYEMERNGVSPDIFTIT  410

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            S+L AC+  G   +G +  + + E   +   L     ++DM S+ G++++A    ++MP 
Sbjct  411  SILHACACSGSLEDGKDVHNYIRES-GMESNLFVCNALMDMYSKCGSMDDANLVFSRMPA  469

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAK  805
            + D   W  ++ G  K    +E  +L A+
Sbjct  470  K-DIISWNTMIGGYSKNRLPNEALKLFAE  497


 Score =   117 bits (293),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/252 (28%), Positives = 127/252 (50%), Gaps = 2/252 (1%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            L+ MY N G++  +R +FD++    +  W+ +I+ YA+      ++++F++MQ    + N
Sbjct  144  LVFMYVNCGDLREARRIFDNIYTDRVFVWNLVINEYAKIRNFRESVSLFKKMQELGIQAN  203

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
                  +L+   ++     GE IH  + KLG+     + + L+  Y K GR+   + +FD
Sbjct  204  SHTLSCVLKCFGALGNLKEGERIHAYLYKLGFGCYNTVLNSLVAFYFKSGRVESAQKVFD  263

Query  401  ENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYE  580
            E  D+D+I W+SMI+GY  NG G + +  F  MLS G+  +    ++ L AC++ G    
Sbjct  264  ELTDRDVISWNSMISGYSSNGLGEKGVGIFGKMLSLGVNVDLATIVNALVACANIGTHLL  323

Query  581  GWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
            G    HA   K     ++     ++DM S+ G ++ A++   K   E     W +++AG 
Sbjct  324  G-RAVHAYAIKACFDGEIMFRNTLLDMYSKCGELDAAVQVFEKTG-ERSVVSWTSMIAGY  381

Query  761  RKTHGSSEISEL  796
             +   S+E   L
Sbjct  382  AREGRSNEAIRL  393


 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/278 (27%), Positives = 136/278 (49%), Gaps = 14/278 (5%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
             LL MY+  G ++++  +F+   ++ +++W++MI+ YA+  + + A+ +F  M+     P
Sbjct  345  TLLDMYSKCGELDAAVQVFEKTGERSVVSWTSMIAGYAREGRSNEAIRLFYEMERNGVSP  404

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            + F   S+L AC+   + + G+ +H  + + G  SN F+ + L+DMY K G +     +F
Sbjct  405  DIFTITSILHACACSGSLEDGKDVHNYIRESGMESNLFVCNALMDMYSKCGSMDDANLVF  464

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC----  565
               P KD+I W++MI GY  N   NEAL+ F +M     + + +    +L AC+      
Sbjct  465  SRMPAKDIISWNTMIGGYSKNRLPNEALKLFAEMQGKS-KADSITAACILPACASLAALA  523

Query  566  -GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             G E  G    H +   Y     +A+   +VDM  + G +  A    + +P++ D   W 
Sbjct  524  KGREIHG----HVLRNGYFQDRHVAN--ALVDMYVKCGLLALAQVLFDMIPVK-DLISWT  576

Query  743  ALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             ++AG      G   I+     +   ++P   S+  IL
Sbjct  577  VMIAGYGMHGFGREAIAAFDEMRHAGIEPDEVSFISIL  614



>ref|XP_002279137.1| PREDICTED: pentatricopeptide repeat-containing protein ELI1, 
chloroplastic [Vitis vinifera]
Length=628

 Score =   282 bits (721),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 131/320 (41%), Positives = 193/320 (60%), Gaps = 1/320 (0%)
 Frame = +2

Query  17   KCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM  196
            K +  +TA+L  YA  G ++++R+LFD + ++D + W+ MI  Y Q+  P+ AL +FRRM
Sbjct  188  KSLVSLTAMLTCYAKHGELDAARVLFDGMEERDGVCWNVMIDGYTQNGMPNEALVLFRRM  247

Query  197  QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
                 KPNE    S+L AC  + A + G  +H+ +   G   N  + + L+DMY K G +
Sbjct  248  LKAKAKPNEVTVLSVLSACGQLGALESGRWVHSYIENNGIQFNVHVGTALVDMYSKCGSL  307

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
               + +FD+  DKD++ W+SMI GY M+G   EAL+ F  M   G+ P ++ FI +LSAC
Sbjct  308  EDARLVFDKIDDKDVVAWNSMIVGYAMHGFSQEALQLFKSMCRMGLHPTNITFIGILSAC  367

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
             H G   EGW+ F+ M+++Y I PK+ HY CMV++L R G+VE+A E V  M IEPD  +
Sbjct  368  GHSGWVTEGWDIFNKMKDEYGIEPKIEHYGCMVNLLGRAGHVEQAYELVKNMNIEPDPVL  427

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            WG LL  CR  HG   + E + + L+  +  N+  Y++LSN+YA  G WD V +LR +M 
Sbjct  428  WGTLLGACR-LHGKIALGEKIVELLVDQNLANSGTYILLSNIYAAVGNWDGVARLRTMMK  486

Query  917  GKKRKKGMGYSVVEVNNSMH  976
                KK  G S +EVNN +H
Sbjct  487  DSGVKKEPGCSSIEVNNKVH  506


 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 96/331 (29%), Positives = 158/331 (48%), Gaps = 46/331 (14%)
 Frame = +2

Query  26   PVVTALLQM-YANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            P++   LQ  YA+ G ++ S  LF       +  W+A+I  +A       AL  + +M  
Sbjct  62   PILNFKLQRSYASLGRLDYSVALFGRTQNPSVFFWTAIIHGHALRGLHEQALNFYAQMLT  121

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            +  +PN F F S+L+ C      + G+ +H+Q +KLG+ S+ ++ +GL+D+Y + G +  
Sbjct  122  QGVEPNAFTFSSILKLCPI----EPGKALHSQAVKLGFDSDLYVRTGLLDVYARGGDVVS  177

Query  383  GKTIFDENPDKDL-------------------------------ICWSSMINGYGMNGHG  469
             + +FD  P+K L                               +CW+ MI+GY  NG  
Sbjct  178  AQQLFDTMPEKSLVSLTAMLTCYAKHGELDAARVLFDGMEERDGVCWNVMIDGYTQNGMP  237

Query  470  NEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYAC  649
            NEAL  F  ML    +PN+V  +SVLSAC   G   E   W H+  E   I   +     
Sbjct  238  NEALVLFRRMLKAKAKPNEVTVLSVLSACGQLG-ALESGRWVHSYIENNGIQFNVHVGTA  296

Query  650  MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQL--ISLD  823
            +VDM S+ G++E+A    +K+  + D   W +++ G    HG S+ +  + K +  + L 
Sbjct  297  LVDMYSKCGSLEDARLVFDKID-DKDVVAWNSMIVG-YAMHGFSQEALQLFKSMCRMGLH  354

Query  824  PTNASYYVILSNL----YADQGRWDEVEKLR  904
            PTN ++  ILS      +  +G WD   K++
Sbjct  355  PTNITFIGILSACGHSGWVTEG-WDIFNKMK  384


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 62/143 (43%), Gaps = 5/143 (3%)
 Frame = +2

Query  287  IHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGH  466
            IH  + + G   +  L   L   Y   GR+     +F    +  +  W+++I+G+ + G 
Sbjct  49   IHAVLFRHGLDHHPILNFKLQRSYASLGRLDYSVALFGRTQNPSVFFWTAIIHGHALRGL  108

Query  467  GNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYA  646
              +AL  +  ML+ G++PN   F S+L  C       E     H+   K      L    
Sbjct  109  HEQALNFYAQMLTQGVEPNAFTFSSILKLCP-----IEPGKALHSQAVKLGFDSDLYVRT  163

Query  647  CMVDMLSRQGNVEEALEFVNKMP  715
             ++D+ +R G+V  A +  + MP
Sbjct  164  GLLDVYARGGDVVSAQQLFDTMP  186



>gb|EYU38858.1| hypothetical protein MIMGU_mgv1a002593mg [Erythranthe guttata]
Length=656

 Score =   283 bits (723),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 135/344 (39%), Positives = 207/344 (60%), Gaps = 5/344 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K G  + + V   L+  YA  G +E SR +FD ++ KD+I+W+++I+  AQ      A+ 
Sbjct  210   KRGLDEVLGVGNTLIDAYAKCGMVEFSRKVFDEMNDKDLISWNSIIAVCAQHGLADEAIG  269

Query  182   VFRRM-QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VF+ M        N     ++L AC+   A  +G+ IH QV+K+   SN F+ + +IDMY
Sbjct  270   VFQSMVSNAEADYNAITLSAVLLACAHSGALRIGKEIHVQVIKMTLESNVFVGTSVIDMY  329

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK GR++  +  FD    K++  WS+MI GYGM+G   EAL+   DM++ G++PN + FI
Sbjct  330   CKCGRVNTARRAFDRMNVKNVKSWSAMIAGYGMHGQAREALKVLSDMINAGVKPNSISFI  389

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             SVLSAC H G+  EGW+WF AM+ +++I P + HY CMVD+  R G ++ A   +  M  
Sbjct  390   SVLSACCHAGMVDEGWHWFCAMQHRFNIKPSVEHYGCMVDLFGRAGYIKRAYNLIMDMRA  449

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
              PD  IW +LLA CR  H + E+ E+ A++L+ LDP N+ YY +LSN+YAD GRW++V K
Sbjct  450   RPDFVIWCSLLASCR-IHKNVELGEISARKLLELDPNNSGYYTLLSNIYADAGRWEDVNK  508

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             +R  M      K  G+S+VE+   +H        ++++ QH ++
Sbjct  509   MRVFMKNHGVVKSPGFSLVELKGRVHVFLV---GDRQHTQHEKI  549


 Score =   117 bits (294),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 80/287 (28%), Positives = 142/287 (49%), Gaps = 16/287 (6%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH--  208
            +AL+ MY+    ++ +R +FD +  +++++W++MI+ Y Q+D    AL +F+   +E   
Sbjct  110  SALIDMYSKCRELDDARNVFDEIPHRNVVSWTSMINGYVQNDCAREALLLFKERLVEESD  169

Query  209  --------GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK  364
                    G  +  A  ++L ACS +  ++V   +H  V+K G      + + LID Y K
Sbjct  170  VGGVDDDEGCVDGVAMVAILAACSRICEKNVTRGVHGFVIKRGLDEVLGVGNTLIDAYAK  229

Query  365  FGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHG-IQPNDVVFIS  541
             G +   + +FDE  DKDLI W+S+I     +G  +EA+  F  M+S+     N +   +
Sbjct  230  CGMVEFSRKVFDEMNDKDLISWNSIIAVCAQHGLADEAIGVFQSMVSNAEADYNAITLSA  289

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL AC+H G    G    H    K  +   +     ++DM  + G V  A    ++M ++
Sbjct  290  VLLACAHSGALRIG-KEIHVQVIKMTLESNVFVGTSVIDMYCKCGRVNTARRAFDRMNVK  348

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLIS--LDPTNASYYVILS  856
              K  W A++AG    HG +  +  V   +I+  + P + S+  +LS
Sbjct  349  NVKS-WSAMIAG-YGMHGQAREALKVLSDMINAGVKPNSISFISVLS  393


 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/269 (26%), Positives = 129/269 (48%), Gaps = 13/269 (5%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            LLQ      N   + +    + + ++++W+++I+  A+S     +L  F  M+     PN
Sbjct  11   LLQRRHCSTNANITTLFNKYVDKTNVLSWNSIIAELARSGDSVESLKAFSSMRKSAINPN  70

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
               F   +++CS++     G+  H Q    GY S+ F +S LIDMY K   +   + +FD
Sbjct  71   RSTFPCAIKSCSALCDLISGKQAHQQAFVFGYASDLFTSSALIDMYSKCRELDDARNVFD  130

Query  401  ENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSH-----GIQPND-----VVFISVLS  550
            E P ++++ W+SMINGY  N    EAL  F + L       G+  ++     V  +++L+
Sbjct  131  EIPHRNVVSWTSMINGYVQNDCAREALLLFKERLVEESDVGGVDDDEGCVDGVAMVAILA  190

Query  551  ACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDK  730
            ACS    E       H    K  +   L     ++D  ++ G VE + +  ++M  + D 
Sbjct  191  ACSRI-CEKNVTRGVHGFVIKRGLDEVLGVGNTLIDAYAKCGMVEFSRKVFDEMN-DKDL  248

Query  731  RIWGALLAGCRKTHGSSEISELVAKQLIS  817
              W +++A C + HG ++ +  V + ++S
Sbjct  249  ISWNSIIAVCAQ-HGLADEAIGVFQSMVS  276



>ref|XP_006395522.1| hypothetical protein EUTSA_v10003772mg [Eutrema salsugineum]
 gb|ESQ32808.1| hypothetical protein EUTSA_v10003772mg [Eutrema salsugineum]
Length=664

 Score =   283 bits (723),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/328 (40%), Positives = 206/328 (63%), Gaps = 4/328 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANF--GNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNA  175
            K GF + + VV  LL  YA    G +  +R +FD +  KD +++++++S YAQ+   S A
Sbjct  216  KRGFDRGVSVVNTLLDAYAKSREGGVAVARKVFDQIVDKDRVSYNSIMSVYAQNGMSSEA  275

Query  176  LAVFRRMQLEHGKP-NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
              VFRR+  +     N     ++L A S   A  +G+ IH  V+++G   +  + + LID
Sbjct  276  FEVFRRLVKDKVVTFNSVTLSTVLLAVSHSGALRIGKCIHDLVIRMGLEDDVIVGTSLID  335

Query  353  MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVV  532
            MYCK GR+   +  FD   +K++  W++MI GYGM+GH ++ALE F  M+  G++PN + 
Sbjct  336  MYCKCGRVETARKAFDRMKNKNVRTWTAMIAGYGMHGHADKALELFPVMIDSGVRPNHIT  395

Query  533  FISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
            F+SVL+ACSH GL  EGW WF+ M+ ++ + P L HY CMVD+L R G++++A   +  M
Sbjct  396  FVSVLAACSHAGLHVEGWRWFNEMKGRFGVEPGLEHYGCMVDLLGRAGHLQKAYNLIQTM  455

Query  713  PIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEV  892
             ++PD  IW +LLA CR  H + E++E+   +L  LDP+N  YY++LS++YAD GRW +V
Sbjct  456  KMKPDSIIWSSLLAACR-IHKNVELAEISVSRLFDLDPSNCGYYMLLSHIYADAGRWKDV  514

Query  893  EKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
            E++R +M  +   K  G+S++E+N  +H
Sbjct  515  ERVRMVMKNRGLVKPPGFSLLELNGKVH  542


 Score =   107 bits (268),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/265 (27%), Positives = 133/265 (50%), Gaps = 18/265 (7%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF   I V +AL+ MY+  G +E +R +FD +  ++I++W++MI  Y  +     A+++F
Sbjct  106  GFQSDIFVSSALIVMYSTCGQLEDARKVFDEIPNRNIVSWTSMIRGYDLNGNALEAVSLF  165

Query  188  RRMQLEHGKPNEF------------AFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAF  331
            + + L  G   ++               S++ ACS ++ + + E++H  V+K G+     
Sbjct  166  KDL-LVSGACGDYDDDDASMFLDSMGMVSVISACSRVSDKGLTESVHGFVIKRGFDRGVS  224

Query  332  LASGLIDMYCKF--GRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLS  505
            + + L+D Y K   G +   + +FD+  DKD + ++S+++ Y  NG  +EA E F  ++ 
Sbjct  225  VVNTLLDAYAKSREGGVAVARKVFDQIVDKDRVSYNSIMSVYAQNGMSSEAFEVFRRLVK  284

Query  506  HGIQP-NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNV  682
              +   N V   +VL A SH G    G    H +  +  +   +     ++DM  + G V
Sbjct  285  DKVVTFNSVTLSTVLLAVSHSGALRIG-KCIHDLVIRMGLEDDVIVGTSLIDMYCKCGRV  343

Query  683  EEALEFVNKMPIEPDKRIWGALLAG  757
            E A +  ++M    + R W A++AG
Sbjct  344  ETARKAFDRMK-NKNVRTWTAMIAG  367


 Score =   102 bits (255),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 77/287 (27%), Positives = 129/287 (45%), Gaps = 49/287 (17%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + + D+ +W+++I+  A+S   + AL  F  M+     PN  +F   ++ACSS+     G
Sbjct  36   VDKTDVFSWNSVIADLARSGDSAEALRAFSSMRKLSLYPNRSSFPCAIKACSSLLDIFSG  95

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q    G+ S+ F++S LI MY   G++   + +FDE P+++++ W+SMI GY +N
Sbjct  96   KQTHQQAFVFGFQSDIFVSSALIVMYSTCGQLEDARKVFDEIPNRNIVSWTSMIRGYDLN  155

Query  461  GHGNEALECFLDMLSHG-----------IQPNDVVFISVLSACSHCGLEYEGWNWFHAME  607
            G+  EA+  F D+L  G           +  + +  +SV+SACS                
Sbjct  156  GNALEAVSLFKDLLVSGACGDYDDDDASMFLDSMGMVSVISACSR---------------  200

Query  608  EKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALL-AGCRKTHGSSE  784
                              +S +G  E    FV K   +    +   LL A  +   G   
Sbjct  201  ------------------VSDKGLTESVHGFVIKRGFDRGVSVVNTLLDAYAKSREGGVA  242

Query  785  ISELVAKQLISLDPTNASYYVILSNLYADQGRWDEV-EKLRQLMDGK  922
            ++  V  Q++  D    SY  I+S +YA  G   E  E  R+L+  K
Sbjct  243  VARKVFDQIV--DKDRVSYNSIMS-VYAQNGMSSEAFEVFRRLVKDK  286



>gb|KDP41842.1| hypothetical protein JCGZ_26860 [Jatropha curcas]
Length=659

 Score =   283 bits (723),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 139/326 (43%), Positives = 204/326 (63%), Gaps = 2/326 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G  K I V   LL  YA  G + SS+ +FD +  KD ++W++MI+ YAQ+   S A  
Sbjct  213  KRGLDKDIGVENTLLDAYAKCGEMASSKNVFDGIINKDAVSWNSMIAVYAQNGLSSEAFQ  272

Query  182  VFRRMQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             F  M ++   K N F   SLL AC+   A  +G+ IH QV++LG+  N  + + +IDMY
Sbjct  273  TFHGMIMDGDVKYNAFTLSSLLLACAHSGALRMGQCIHDQVIRLGFDDNVIVGTSIIDMY  332

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             K GR+   +  F+    K++  W++MI GYGM+G   EALE F  M+  G++PN + FI
Sbjct  333  SKCGRVEMARKAFNGMQVKNVKSWTAMIAGYGMHGCAREALEVFYMMIKVGVKPNYITFI  392

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            SVL+ACSH GL  EG  WF+AM+ ++++ P + HY CMVD+L R G++ EA   +  M  
Sbjct  393  SVLAACSHAGLLDEGRYWFNAMKHQFNVEPGVEHYGCMVDLLGRTGHLNEAYHMIKGMTA  452

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
            +PD  +WG+LLA CR  H + E++E+ A +L  LDP+N  YY++LSN+YAD GRW +VEK
Sbjct  453  KPDFVLWGSLLAACR-IHKNVELAEISAGELFELDPSNCGYYILLSNIYADAGRWKDVEK  511

Query  899  LRQLMDGKKRKKGMGYSVVEVNNSMH  976
            +R L+  +   K  G+S+VE+   +H
Sbjct  512  MRVLVQDRGLVKPPGFSLVELKGRVH  537


 Score =   129 bits (324),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 93/306 (30%), Positives = 149/306 (49%), Gaps = 18/306 (6%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF     V +AL+ MY+  G +  ++ILFD + Q+ I++W++MI+ Y Q+     AL +F
Sbjct  108  GFESDFFVSSALIDMYSKCGRLNDAKILFDEIPQRSIVSWTSMITGYVQNGNAHEALLLF  167

Query  188  RRMQLEHGKPNEFAFH------SLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLI  349
            +   +E  + N+  F       S+L ACS +    V E IH  V+K G   +  + + L+
Sbjct  168  KEFLIEESERNDEVFMDSVAMVSVLSACSRVPRAGVIEGIHGFVVKRGLDKDIGVENTLL  227

Query  350  DMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHG-IQPND  526
            D Y K G +   K +FD   +KD + W+SMI  Y  NG  +EA + F  M+  G ++ N 
Sbjct  228  DAYAKCGEMASSKNVFDGIINKDAVSWNSMIAVYAQNGLSSEAFQTFHGMIMDGDVKYNA  287

Query  527  VVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVN  706
                S+L AC+H G    G    H    +      +     ++DM S+ G VE A +  N
Sbjct  288  FTLSSLLLACAHSGALRMG-QCIHDQVIRLGFDDNVIVGTSIIDMYSKCGRVEMARKAFN  346

Query  707  KMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYA------  868
             M ++  K  W A++AG    HG +  +  V   +I +     +Y   +S L A      
Sbjct  347  GMQVKNVKS-WTAMIAG-YGMHGCAREALEVFYMMIKVG-VKPNYITFISVLAACSHAGL  403

Query  869  -DQGRW  883
             D+GR+
Sbjct  404  LDEGRY  409


 Score =   115 bits (289),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 94/163 (58%), Gaps = 7/163 (4%)
 Frame = +2

Query  92   FDSLSQK-DIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAA  268
            FD   +K ++ +W+ +I+  A+      +L  F  M+  + KPN F F   ++ACS++  
Sbjct  34   FDKYFEKTNVFSWNELIAELARGGDSLESLRAFSSMRKLNLKPNRFTFPCTIKACSAVLD  93

Query  269  QDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMING  448
               G+  H Q +  G+ S+ F++S LIDMY K GR++  K +FDE P + ++ W+SMI G
Sbjct  94   LHSGKQAHQQALVFGFESDFFVSSALIDMYSKCGRLNDAKILFDEIPQRSIVSWTSMITG  153

Query  449  YGMNGHGNEALECFLDMLSHGIQPNDVVF------ISVLSACS  559
            Y  NG+ +EAL  F + L    + ND VF      +SVLSACS
Sbjct  154  YVQNGNAHEALLLFKEFLIEESERNDEVFMDSVAMVSVLSACS  196



>gb|EYU34329.1| hypothetical protein MIMGU_mgv1a001967mg [Erythranthe guttata]
Length=732

 Score =   284 bits (727),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 138/325 (42%), Positives = 204/325 (63%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            KS FL    + TAL  +Y+    +E +R LFD   +K + +W+AMIS YAQ+ Q   A++
Sbjct  286  KSNFLLNSSISTALTTVYSRLNELELARKLFDESPEKTLASWNAMISGYAQNGQTETAIS  345

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  MQ  + +PN     S+L AC+ + A  +G+ +H  + K  + SN ++++ LIDMY 
Sbjct  346  LFHEMQNLNIQPNPVTVTSILSACAQLGALGLGKWVHDLIKKECFESNIYVSTALIDMYT  405

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G I + +T+F+   +K+++ W+SMI+GYG++G+G+EAL+ F +ML  GI P  V F+S
Sbjct  406  KCGSIDEARTVFNSLQEKNVVTWNSMISGYGLHGYGHEALKLFDEMLLSGISPTGVTFVS  465

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L ACSH GL  EG   FH+M   +   P   HYACMVD+L R G +EEA+EF+NKMPI+
Sbjct  466  ILYACSHAGLVKEGERIFHSMVSDHGFEPNSEHYACMVDILGRAGKLEEAVEFINKMPIK  525

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            P    WGALL GC   H +S ++ L + QL  LDP N  Y V+LSN+Y++   +D    L
Sbjct  526  PGPAEWGALLGGCM-VHKNSNLARLASDQLFELDPENVGYRVLLSNIYSNNQNYDRAASL  584

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            RQ++  K   K  G +++EVN   H
Sbjct  585  RQVVRRKNLVKTPGCTLIEVNGQQH  609


 Score =   130 bits (327),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/277 (28%), Positives = 147/277 (53%), Gaps = 5/277 (2%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V+T L+ +Y+  G+I ++R+LF+ + + D++A++AMIS Y+ + +   ++ +F+ + L  
Sbjct  194  VLTCLVSLYSKCGDIFTARLLFNLIGKPDLVAYNAMISGYSCNGETELSVQLFQELLLSG  253

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             K +      L+         D+  +IH   +K  +  N+ +++ L  +Y +   +   +
Sbjct  254  CKVSSSTIVGLIPVFYPFGYLDLTRSIHGFCVKSNFLLNSSISTALTTVYSRLNELELAR  313

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FDE+P+K L  W++MI+GY  NG    A+  F +M +  IQPN V   S+LSAC+  G
Sbjct  314  KLFDESPEKTLASWNAMISGYAQNGQTETAISLFHEMQNLNIQPNPVTVTSILSACAQLG  373

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
                G  W H + +K      +     ++DM ++ G+++EA    N +  E +   W ++
Sbjct  374  ALGLG-KWVHDLIKKECFESNIYVSTALIDMYTKCGSIDEARTVFNSLQ-EKNVVTWNSM  431

Query  749  LAGCRKTHG-SSEISELVAKQLIS-LDPTNASYYVIL  853
            ++G    HG   E  +L  + L+S + PT  ++  IL
Sbjct  432  ISG-YGLHGYGHEALKLFDEMLLSGISPTGVTFVSIL  467


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/298 (19%), Positives = 122/298 (41%), Gaps = 37/298 (12%)
 Frame = +2

Query  113  DIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIH  292
            D + W+ +IS   ++     +L VFR M       +      +L + + +     G  + 
Sbjct  121  DTVLWNTIISGLVKTCCFDESLQVFRDMVKRTKSFDSTTLAVVLSSIAELLEMKTGMMVQ  180

Query  293  TQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGN  472
               +K+G  S+  + + L+ +Y K G I   + +F+     DL+ +++MI+GY  NG   
Sbjct  181  ALALKIGCHSHDHVLTCLVSLYSKCGDIFTARLLFNLIGKPDLVAYNAMISGYSCNGETE  240

Query  473  EALECFLDMLSHGIQPNDVVFISVL----------------------------SACSHCG  568
             +++ F ++L  G + +    + ++                            S  +   
Sbjct  241  LSVQLFQELLLSGCKVSSSTIVGLIPVFYPFGYLDLTRSIHGFCVKSNFLLNSSISTALT  300

Query  569  LEYEGWNWFHAMEEKYDITPK--LAHYACMVDMLSRQGNVEEALEFVNKMP---IEPDKR  733
              Y   N      + +D +P+  LA +  M+   ++ G  E A+   ++M    I+P+  
Sbjct  301  TVYSRLNELELARKLFDESPEKTLASWNAMISGYAQNGQTETAISLFHEMQNLNIQPNPV  360

Query  734  IWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYV--ILSNLYADQGRWDEVEKL  901
               ++L+ C +  G+  + + V   LI  +   ++ YV   L ++Y   G  DE   +
Sbjct  361  TVTSILSACAQL-GALGLGKWV-HDLIKKECFESNIYVSTALIDMYTKCGSIDEARTV  416



>ref|XP_004159154.1| PREDICTED: uncharacterized protein LOC101226880 [Cucumis sativus]
Length=1725

 Score =   293 bits (750),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/326 (43%), Positives = 202/326 (62%), Gaps = 2/326 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF   I V   L+  YA  G    S+ +FD + +KD I+W++MI+ YAQS     AL 
Sbjct  1279  KKGFDGSIGVGNTLMDAYAKCGQPLVSKKVFDWMEEKDDISWNSMIAVYAQSGLSGEALE  1338

Query  182   VFRRMQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VF  M    G + N     ++L AC+   A   G+ IH QV+K+    N  + + +IDMY
Sbjct  1339  VFHGMVRHVGVRYNAVTLSAVLLACAHAGALRAGKCIHDQVIKMDLEYNVCVGTSIIDMY  1398

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK GR+   K  FD   +K++  W++M+ GYGM+G   EAL+ F  M+  G++PN + F+
Sbjct  1399  CKCGRVEMAKKTFDRMKEKNVKSWTAMVAGYGMHGRAKEALDIFYKMVRAGVKPNYITFV  1458

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             SVL+ACSH GL  EGW+WF+AM+ KYDI P + HY CMVD+  R G + EA   + +M +
Sbjct  1459  SVLAACSHAGLVEEGWHWFNAMKHKYDIEPGIEHYGCMVDLFGRAGCLNEAYNLIKRMKM  1518

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
             +PD  +WG+LL  CR  H + ++ E+ A++L  LDP N  YYV+LSNLYAD GRW +VE+
Sbjct  1519  KPDFVVWGSLLGACR-IHKNVDLGEIAAQKLFELDPDNCGYYVLLSNLYADAGRWADVER  1577

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMH  976
             +R LM  ++  K  G+S+VE+   +H
Sbjct  1578  MRMLMKNRQLVKPPGFSLVELKGRVH  1603


 Score =   169 bits (427),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 126/221 (57%), Gaps = 0/221 (0%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
            T ++    + G+++ +R +FD +  K++++W+AMI+ Y ++ QP  AL +F+RMQ E+  
Sbjct  195  TTVISGLISCGDLQEARRIFDEIPSKNVVSWTAMINGYIRNQQPEEALELFKRMQAENIF  254

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
            PNE+   SL++AC+ M    +G  IH   +K       +L + LIDMY K G I     +
Sbjct  255  PNEYTMVSLIKACTEMGILTLGRGIHDYAIKNCIEIGVYLGTALIDMYSKCGSIKDAIEV  314

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            F+  P K L  W+SMI   G++G G EAL  F +M    ++P+ + FI VL AC H    
Sbjct  315  FETMPRKSLPTWNSMITSLGVHGLGQEALNLFSEMERVNVKPDAITFIGVLCACVHIKNV  374

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALE  697
             EG  +F  M + Y I P   HY CM ++ +R  N++EA +
Sbjct  375  KEGCAYFTRMTQHYGIAPIPEHYECMTELYARSNNLDEAFK  415


 Score =   134 bits (337),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 140/259 (54%), Gaps = 11/259 (4%)
 Frame = +2

Query  8     GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
             GF   + V +AL+ MY+  G ++ +R LFD +  +++++W++MI+ Y Q++Q  NAL +F
Sbjct  1172  GFETDLFVSSALIDMYSKCGQLKDARALFDEIPLRNVVSWTSMITGYVQNEQADNALLLF  1231

Query  188   R-----RMQLEHGKP---NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASG  343
             +       ++E G     +     S+L ACS ++ + + E +H  V+K G+  +  + + 
Sbjct  1232  KDFLEEETEVEDGNNVPLDSVVMVSVLSACSRVSGKGITEGVHGFVVKKGFDGSIGVGNT  1291

Query  344   LIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSH-GIQP  520
             L+D Y K G+    K +FD   +KD I W+SMI  Y  +G   EALE F  M+ H G++ 
Sbjct  1292  LMDAYAKCGQPLVSKKVFDWMEEKDDISWNSMIAVYAQSGLSGEALEVFHGMVRHVGVRY  1351

Query  521   NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEF  700
             N V   +VL AC+H G    G    H    K D+   +     ++DM  + G VE A + 
Sbjct  1352  NAVTLSAVLLACAHAGALRAG-KCIHDQVIKMDLEYNVCVGTSIIDMYCKCGRVEMAKKT  1410

Query  701   VNKMPIEPDKRIWGALLAG  757
              ++M  E + + W A++AG
Sbjct  1411  FDRMK-EKNVKSWTAMVAG  1428


 Score =   113 bits (283),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/256 (26%), Positives = 121/256 (47%), Gaps = 32/256 (13%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            L+ +Y+  G I  + +LF  +       W+ +I A   +     AL +++ M  +    +
Sbjct  65   LIHLYSTHGRIAYAILLFYQIQNPCTFTWNLIIRANTINGLSEQALMLYKNMVCQGIAAD  124

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGR---------  373
            +F F  +++AC++  + D+G+ +H  ++K G++ + F+ + LID Y K G          
Sbjct  125  KFTFPFVIKACTNFLSIDLGKVVHGSLIKYGFSGDVFVQNNLIDFYFKCGHTRFALKVFE  184

Query  374  ----------------------IHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALEC  487
                                  + + + IFDE P K+++ W++MINGY  N    EALE 
Sbjct  185  KMRVRNVVSWTTVISGLISCGDLQEARRIFDEIPSKNVVSWTAMINGYIRNQQPEEALEL  244

Query  488  FLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLS  667
            F  M +  I PN+   +S++ AC+  G+   G    H    K  I   +     ++DM S
Sbjct  245  FKRMQAENIFPNEYTMVSLIKACTEMGILTLG-RGIHDYAIKNCIEIGVYLGTALIDMYS  303

Query  668  RQGNVEEALEFVNKMP  715
            + G++++A+E    MP
Sbjct  304  KCGSIKDAIEVFETMP  319


 Score = 99.0 bits (245),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 83/344 (24%), Positives = 142/344 (41%), Gaps = 57/344 (17%)
 Frame = +2

Query  89    LFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAA  268
              +  + + ++ +W+++I+  A+      AL  F  ++     P   +F   +++CS++  
Sbjct  1098  FYKYVDKSNVHSWNSVIADLARGGDSVEALRAFSSLRKLGLIPTRSSFPCTIKSCSALCD  1157

Query  269   QDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMING  448
                G   H Q    G+ ++ F++S LIDMY K G++   + +FDE P ++++ W+SMI G
Sbjct  1158  LVSGRMSHQQAFVFGFETDLFVSSALIDMYSKCGQLKDARALFDEIPLRNVVSWTSMITG  1217

Query  449   YGMNGHGNEALECFLDMLSHGIQPND--------VVFISVLSACSH--------------  562
             Y  N   + AL  F D L    +  D        VV +SVLSACS               
Sbjct  1218  YVQNEQADNALLLFKDFLEEETEVEDGNNVPLDSVVMVSVLSACSRVSGKGITEGVHGFV  1277

Query  563   ---------------------CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGN  679
                                  CG        F  MEEK DI+     +  M+ + ++ G 
Sbjct  1278  VKKGFDGSIGVGNTLMDAYAKCGQPLVSKKVFDWMEEKDDIS-----WNSMIAVYAQSGL  1332

Query  680   VEEALE----FVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLD-PTNASYY  844
               EALE     V  + +  +     A+L  C    G+    + +  Q+I +D   N    
Sbjct  1333  SGEALEVFHGMVRHVGVRYNAVTLSAVLLACAHA-GALRAGKCIHDQVIKMDLEYNVCVG  1391

Query  845   VILSNLYADQGRWDEVEKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
               + ++Y   GR   VE  ++  D  K K    ++ +     MH
Sbjct  1392  TSIIDMYCKCGR---VEMAKKTFDRMKEKNVKSWTAMVAGYGMH  1432


 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 76/173 (44%), Gaps = 5/173 (3%)
 Frame = +2

Query  239  LLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKD  418
            LLQ C +         IH ++++ G +++  L   LI +Y   GRI     +F +  +  
Sbjct  33   LLQNCKNFKHL---RQIHAKIIRSGLSNDQLLTRKLIHLYSTHGRIAYAILLFYQIQNPC  89

Query  419  LICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFH  598
               W+ +I    +NG   +AL  + +M+  GI  +   F  V+ AC++  L  +     H
Sbjct  90   TFTWNLIIRANTINGLSEQALMLYKNMVCQGIAADKFTFPFVIKACTNF-LSIDLGKVVH  148

Query  599  AMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
                KY  +  +     ++D   + G+   AL+   KM +  +   W  +++G
Sbjct  149  GSLIKYGFSGDVFVQNNLIDFYFKCGHTRFALKVFEKMRVR-NVVSWTTVISG  200



>ref|XP_009352737.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic [Pyrus x bretschneideri]
Length=879

 Score =   286 bits (733),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/311 (43%), Positives = 200/311 (64%), Gaps = 2/311 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V   L+ MYA  G++E +  +F  +  KDI++W+ MI  Y+++  P+ AL +F  M ++ 
Sbjct  444  VCNTLMDMYAKCGSMEDAHSVFSRMPAKDIVSWNTMIGGYSKNCLPNEALKLFSEM-MQK  502

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KP+     S+L AC+S+AA + G+ IH  +++ GY S   +A+ L+DMY K G +   +
Sbjct  503  SKPDSMTIASILPACASLAALNRGQEIHGHILRNGYFSERHVANALVDMYVKCGVLVLAR  562

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD  P KDLI W+ ++ GYGM+G G EA+  F +M   G +P+ V F+S+L ACSH G
Sbjct  563  LLFDMFPVKDLISWTVIVAGYGMHGFGREAIAAFNEMRKAGTEPDGVSFVSILYACSHSG  622

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  E W +F  M   Y I PKL HYACMVD+LSR GN+ +A +F+  MPIEPD  IWG+L
Sbjct  623  LRDEAWRFFDTMRNDYGIVPKLEHYACMVDLLSRTGNLTKAYKFIKTMPIEPDATIWGSL  682

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L GCR  H   +++E VA+ +  L+P N  YYV+L+N+YA+  +W+EV+KLR+ +  +  
Sbjct  683  LCGCR-IHHDVKLAEKVAEHVFELEPENTGYYVLLANIYAEAEKWEEVKKLRERITRRGL  741

Query  929  KKGMGYSVVEV  961
            KK  G S +E+
Sbjct  742  KKNPGCSWIEI  752


 Score =   119 bits (297),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 84/276 (30%), Positives = 134/276 (49%), Gaps = 4/276 (1%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            L+ MY   G++  +R +FD LS   +  W+ MI+ YA+       + +F +MQ    + N
Sbjct  145  LVFMYVKCGDLREARRVFDKLSNGKVFVWNLMINEYAKVRNFREGVYLFGKMQELGIQAN  204

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
             + F  +L+  S++     GE IH  + KLG+ S+  + + L+  Y K  RI     +FD
Sbjct  205  SYTFSCVLKCFSALGCVREGEWIHGYLYKLGFGSDNTVGNSLMAFYFKNRRIESACKVFD  264

Query  401  ENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYE  580
            E  D+D+I W+SMI+ Y  NG   + +E F  M+S GI  +    I+VL AC   G    
Sbjct  265  ELCDRDVISWNSMISAYVSNGLAEKGVEIFRQMVSLGIDVDLATIINVLMACVAGGNLSL  324

Query  581  GWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
            G    HA   K      +     ++DM S+ G++  A++   KM  E     W +++AG 
Sbjct  325  G-RALHAYAIKASFDEDVMFCNNVLDMYSKCGDLSSAIQVFKKMG-ERSVVSWTSMIAGH  382

Query  761  RKTHGSSEISELVAKQLISLDPTNASYYVILSNLYA  868
             +   S E   L ++  +  D  N   Y I S L+A
Sbjct  383  IREGLSDEAIGLFSE--MERDGVNPDAYTITSILHA  416


 Score =   115 bits (287),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 74/290 (26%), Positives = 140/290 (48%), Gaps = 14/290 (5%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+ F + +     +L MY+  G++ S+  +F  + ++ +++W++MI+ + +      A+ 
Sbjct  334  KASFDEDVMFCNNVLDMYSKCGDLSSAIQVFKKMGERSVVSWTSMIAGHIREGLSDEAIG  393

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M+ +   P+ +   S+L AC+S  +   G  IH  + + G  S+ ++ + L+DMY 
Sbjct  394  LFSEMERDGVNPDAYTITSILHACASSGSLKKGRDIHNYIKEHGMDSSLYVCNTLMDMYA  453

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +    ++F   P KD++ W++MI GY  N   NEAL+ F +M+    +P+ +   S
Sbjct  454  KCGSMEDAHSVFSRMPAKDIVSWNTMIGGYSKNCLPNEALKLFSEMMQKS-KPDSMTIAS  512

Query  542  VLSACSHC-----GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVN  706
            +L AC+       G E  G    H +   Y     +A+   +VDM  + G +  A    +
Sbjct  513  ILPACASLAALNRGQEIHG----HILRNGYFSERHVAN--ALVDMYVKCGVLVLARLLFD  566

Query  707  KMPIEPDKRIWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
              P++ D   W  ++AG      G   I+     +    +P   S+  IL
Sbjct  567  MFPVK-DLISWTVIVAGYGMHGFGREAIAAFNEMRKAGTEPDGVSFVSIL  615


 Score =   110 bits (275),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/286 (26%), Positives = 139/286 (49%), Gaps = 6/286 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     V  +L+  Y     IES+  +FD L  +D+I+W++MISAY  +      + 
Sbjct  233  KLGFGSDNTVGNSLMAFYFKNRRIESACKVFDELCDRDVISWNSMISAYVSNGLAEKGVE  292

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +FR+M       +     ++L AC +     +G  +H   +K  +  +    + ++DMY 
Sbjct  293  IFRQMVSLGIDVDLATIINVLMACVAGGNLSLGRALHAYAIKASFDEDVMFCNNVLDMYS  352

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +     +F +  ++ ++ W+SMI G+   G  +EA+  F +M   G+ P+     S
Sbjct  353  KCGDLSSAIQVFKKMGERSVVSWTSMIAGHIREGLSDEAIGLFSEMERDGVNPDAYTITS  412

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYAC--MVDMLSRQGNVEEALEFVNKMP  715
            +L AC+  G   +G +  H   +++ +   L  Y C  ++DM ++ G++E+A    ++MP
Sbjct  413  ILHACASSGSLKKGRD-IHNYIKEHGMDSSL--YVCNTLMDMYAKCGSMEDAHSVFSRMP  469

Query  716  IEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             + D   W  ++ G  K    +E  +L ++ +    P + +   IL
Sbjct  470  AK-DIVSWNTMIGGYSKNCLPNEALKLFSEMMQKSKPDSMTIASIL  514


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 60/125 (48%), Gaps = 1/125 (1%)
 Frame = +2

Query  227  AFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDEN  406
            A+ S+++ C+ M +   G+ +H+ +   G  ++  L + L+ MY K G + + + +FD+ 
Sbjct  106  AYCSVVELCAGMMSLQDGKKVHSVICDNGVEADGQLGAKLVFMYVKCGDLREARRVFDKL  165

Query  407  PDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGW  586
             +  +  W+ MIN Y    +  E +  F  M   GIQ N   F  VL   S  G   EG 
Sbjct  166  SNGKVFVWNLMINEYAKVRNFREGVYLFGKMQELGIQANSYTFSCVLKCFSALGCVREG-  224

Query  587  NWFHA  601
             W H 
Sbjct  225  EWIHG  229


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/151 (25%), Positives = 67/151 (44%), Gaps = 2/151 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++G+     V  AL+ MY   G +  +R+LFD    KD+I+W+ +++ Y        A+A
Sbjct  535  RNGYFSERHVANALVDMYVKCGVLVLARLLFDMFPVKDLISWTVIVAGYGMHGFGREAIA  594

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG-ETIHTQVMKLGYTSNAFLASGLIDMY  358
             F  M+    +P+  +F S+L ACS    +D       T     G        + ++D+ 
Sbjct  595  AFNEMRKAGTEPDGVSFVSILYACSHSGLRDEAWRFFDTMRNDYGIVPKLEHYACMVDLL  654

Query  359  CKFGRIHQGKTIFDENP-DKDLICWSSMING  448
             + G + +        P + D   W S++ G
Sbjct  655  SRTGNLTKAYKFIKTMPIEPDATIWGSLLCG  685



>ref|XP_011094314.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g11460 [Sesamum indicum]
Length=634

 Score =   281 bits (719),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/325 (40%), Positives = 202/325 (62%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G    + V    L MY + G+IES+R LFD + +K +I W+AMIS Y+Q+      L 
Sbjct  194  KYGLSTILAVANCFLSMYVHCGSIESARKLFDEIPKKSLITWNAMISGYSQNGLGKEVLD  253

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +++ MQ     P+E  F  +L +C+++ AQ +G  +  ++  LG   N FL + LI MY 
Sbjct  254  LYQEMQSLGVCPDEVTFVGVLSSCANLGAQRIGREVEEKIDCLGIGFNPFLKNSLISMYA  313

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            + G + + + IFD  P+K+L+ W++++ GYGM+GHG  A+E F  M+  GIQP+  VF+ 
Sbjct  314  RCGNLMRARAIFDAMPEKNLVSWTAILGGYGMHGHGEVAVELFDQMIGAGIQPDKAVFVC  373

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL+ACSH GL  +G  +FH+M+ KY++ P   HY+C+VD+L R G ++EA   +  MPIE
Sbjct  374  VLTACSHAGLTEKGLEYFHSMQRKYNLNPGSEHYSCVVDLLGRAGRLDEAHNLIEAMPIE  433

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD  +WGALL  C K H + +++EL   +++ L+P N  YYV+LSN+Y + G  + V ++
Sbjct  434  PDGPVWGALLGAC-KIHKNVDLAELAFDKVVELEPANIGYYVLLSNIYTEAGNAEGVLRI  492

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R +M  +  KK  GYS VE    +H
Sbjct  493  RVMMRERGLKKDPGYSYVEWKGRIH  517


 Score =   136 bits (342),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 88/285 (31%), Positives = 146/285 (51%), Gaps = 17/285 (6%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSL--SQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            V TAL+ MY  F  +E +  +FD +  S +  + ++A+IS + Q ++ SN L +F  M+ 
Sbjct  100  VQTALISMYCRFSLLEKAYNVFDEIPDSARLTVCYNALISGFVQKNRLSNGLVLFSEMRG  159

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            +    NE     L   C+      +G ++H    K G ++   +A+  + MY   G I  
Sbjct  160  KGVSLNEVTILGLAPGCTDPMQLYLGMSLHCLTWKYGLSTILAVANCFLSMYVHCGSIES  219

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + +FDE P K LI W++MI+GY  NG G E L+ + +M S G+ P++V F+ VLS+C++
Sbjct  220  ARKLFDEIPKKSLITWNAMISGYSQNGLGKEVLDLYQEMQSLGVCPDEVTFVGVLSSCAN  279

Query  563  CGLEYEGWNWFHAMEEKYD-----ITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPD  727
             G +  G      +EEK D       P L +   ++ M +R GN+  A    + MP E +
Sbjct  280  LGAQRIG----REVEEKIDCLGIGFNPFLKN--SLISMYARCGNLMRARAIFDAMP-EKN  332

Query  728  KRIWGALLAGCRKTHGSSEISELVAKQLI--SLDPTNASYYVILS  856
               W A+L G    HG  E++  +  Q+I   + P  A +  +L+
Sbjct  333  LVSWTAILGG-YGMHGHGEVAVELFDQMIGAGIQPDKAVFVCVLT  376


 Score = 99.8 bits (247),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 122/248 (49%), Gaps = 5/248 (2%)
 Frame = +2

Query  125  WSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVM  304
            W+  +   ++  Q   AL ++R+M       N F F  +L++ ++++    G  +H  V+
Sbjct  31   WNTQLRNLSKQGQYKQALILYRQMLRSGATQNAFTFPFILKSSAALSMPLPGVQLHCHVI  90

Query  305  KLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPD--KDLICWSSMINGYGMNGHGNEA  478
            K G  S  F+ + LI MYC+F  + +   +FDE PD  +  +C++++I+G+      +  
Sbjct  91   KSGCHSEPFVQTALISMYCRFSLLEKAYNVFDEIPDSARLTVCYNALISGFVQKNRLSNG  150

Query  479  LECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVD  658
            L  F +M   G+  N+V  + +   C+     Y G +  H +  KY ++  LA   C + 
Sbjct  151  LVLFSEMRGKGVSLNEVTILGLAPGCTDPMQLYLGMS-LHCLTWKYGLSTILAVANCFLS  209

Query  659  MLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAK-QLISLDPTNA  835
            M    G++E A +  +++P +     W A+++G  +     E+ +L  + Q + + P   
Sbjct  210  MYVHCGSIESARKLFDEIP-KKSLITWNAMISGYSQNGLGKEVLDLYQEMQSLGVCPDEV  268

Query  836  SYYVILSN  859
            ++  +LS+
Sbjct  269  TFVGVLSS  276



>ref|XP_006643885.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like [Oryza brachyantha]
Length=658

 Score =   281 bits (720),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/325 (40%), Positives = 206/325 (63%), Gaps = 2/325 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++G  + +PV  AL++MY   G +E +R +FD ++ KD I+W+ +I  Y++++  + A  
Sbjct  214  RNGMEEVLPVANALMEMYVKCGYMEEARFIFDHVTNKDTISWNTLIGGYSRNNLANEAFT  273

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +FR M L+   PN      +L A SS+++ + G  +H   ++ GY  + F+A+ L+DMY 
Sbjct  274  LFREMLLQL-SPNAVTMACILPAASSLSSLERGREMHAYAVRRGYLEDKFVANTLVDMYV  332

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +   + +FD+  +K+LI W+ MI GYGM+G G +A+  F  M  +GIQP+   F +
Sbjct  333  KCGALLLARRLFDKLTNKNLISWTIMIAGYGMHGRGRDAIALFEQMKGNGIQPDAGSFSA  392

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L ACSH GL  EGW +F+AM  ++ I PKL HY CMVD+LS  GN++EA EF+  MPIE
Sbjct  393  ILYACSHSGLRDEGWRFFNAMRNEHRIEPKLKHYTCMVDLLSNTGNLKEAYEFIESMPIE  452

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD  IW +LL GCR TH   +++E VA+++  L+P N  YYV+L+N+YA+  RW+ V +L
Sbjct  453  PDSSIWVSLLHGCR-THRDVKLAEEVAERVFELEPDNTGYYVLLANIYAEAERWEAVRRL  511

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            +  + G+  ++  G S +E     H
Sbjct  512  KNKVGGRGLRENTGCSWIEARGKAH  536


 Score =   111 bits (277),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 101/186 (54%), Gaps = 1/186 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G +    +  ALL MY+N  +  S+  +F ++ QK +++W+AMI++Y ++        
Sbjct  113  KTGLISETSLGNALLDMYSNCSDWRSTNKIFRNMEQKTVVSWTAMITSYIRAGHFDKVAG  172

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F+ M LE  +P+ FA  S L A +   +   G+++H   ++ G      +A+ L++MY 
Sbjct  173  LFQEMGLEGIRPDVFAITSALDAFAGNESLKHGKSVHGYAIRNGMEEVLPVANALMEMYV  232

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G + + + IFD   +KD I W+++I GY  N   NEA   F +ML   + PN V    
Sbjct  233  KCGYMEEARFIFDHVTNKDTISWNTLIGGYSRNNLANEAFTLFREMLLQ-LSPNAVTMAC  291

Query  542  VLSACS  559
            +L A S
Sbjct  292  ILPAAS  297


 Score =   109 bits (273),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 78/289 (27%), Positives = 127/289 (44%), Gaps = 12/289 (4%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     V  AL+  YA    IE + ++FD + ++DII+W+++I   A +     A+ 
Sbjct  12   KYGFGAQCAVCNALISFYAKSNRIEDALVVFDEMPRRDIISWNSIIGGCASNGLSHKAIE  71

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F RM LE  + +     S+L AC+      +G  +H   +K G  S   L + L+DMY 
Sbjct  72   LFVRMWLEGQELDSTTLLSVLPACAQSHYSFIGRVVHGYSVKTGLISETSLGNALLDMYS  131

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
                      IF     K ++ W++MI  Y   GH ++    F +M   GI+P+     S
Sbjct  132  NCSDWRSTNKIFRNMEQKTVVSWTAMITSYIRAGHFDKVAGLFQEMGLEGIRPDVFAITS  191

Query  542  VLSACS-----HCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVN  706
             L A +       G    G+   + MEE   +   L      ++M  + G +EEA  F+ 
Sbjct  192  ALDAFAGNESLKHGKSVHGYAIRNGMEEVLPVANAL------MEMYVKCGYMEEA-RFIF  244

Query  707  KMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
                  D   W  L+ G  + + ++E   L  + L+ L P   +   IL
Sbjct  245  DHVTNKDTISWNTLIGGYSRNNLANEAFTLFREMLLQLSPNAVTMACIL  293


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 111/254 (44%), Gaps = 11/254 (4%)
 Frame = +2

Query  278   GETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGM  457
             G  +H  ++K G+ +   + + LI  Y K  RI     +FDE P +D+I W+S+I G   
Sbjct  3     GLVVHGYLVKYGFGAQCAVCNALISFYAKSNRIEDALVVFDEMPRRDIISWNSIIGGCAS  62

Query  458   NGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLA  637
             NG  ++A+E F+ M   G + +    +SVL AC+     + G    H    K  +  + +
Sbjct  63    NGLSHKAIELFVRMWLEGQELDSTTLLSVLPACAQSHYSFIG-RVVHGYSVKTGLISETS  121

Query  638   HYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLIS  817
                 ++DM S   +     +    M  +     W A++    +     +++ L   Q + 
Sbjct  122   LGNALLDMYSNCSDWRSTNKIFRNME-QKTVVSWTAMITSYIRAGHFDKVAGLF--QEMG  178

Query  818   LDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**R  997
             L+      + I S L A  G  +E  K  + + G   + GM   V+ V N++  M     
Sbjct  179   LEGIRPDVFAITSALDAFAG--NESLKHGKSVHGYAIRNGM-EEVLPVANALMEMYV---  232

Query  998   SEQEYIQHSRVIID  1039
              +  Y++ +R I D
Sbjct  233   -KCGYMEEARFIFD  245



>ref|XP_010274720.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01510, 
mitochondrial [Nelumbo nucifera]
Length=638

 Score =   281 bits (718),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/318 (45%), Positives = 198/318 (62%), Gaps = 3/318 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V T L+ +YA  G + S+  LF S+S++D+++W+A+I+AY Q      AL +FR M    
Sbjct  200  VRTELMLLYAKVGELGSADYLFRSMSERDLVSWNALIAAYVQIGNAGKALRLFREMGPAG  259

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KP+     S+L AC+ +    +G+ I   V+  G   N F+ +  +DMY K G +    
Sbjct  260  VKPDSVTVVSVLGACAQLGCLGIGKQIDQFVVDEGLERNIFVNNARLDMYAKCGNMDLAS  319

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
            ++F+E  ++++I WS+MI GY +NG   +AL  F  M    ++PN V F+ VLSACSH G
Sbjct  320  SLFNEMQERNIISWSTMIGGYAINGDFEKALHLFSLMQHERVKPNHVTFLGVLSACSHAG  379

Query  569  LEYEGWNWFHAMEEKYD--ITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
            L  EG N+F+ M E  D  I P+L HYACMVD+L R G++EEA  F+  MP+EPD  +WG
Sbjct  380  LVSEGKNYFNYMVESSDSNIHPRLEHYACMVDLLGRSGHLEEAYGFIKSMPVEPDSGVWG  439

Query  743  ALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGK  922
            ALL  C  TH + E+ +LVA  L  L P  ASYYV+LSN+YA  GRWD+V+K+RQ M GK
Sbjct  440  ALLGAC-STHNNIELGQLVADVLFDLAPETASYYVLLSNIYAAAGRWDDVKKVRQKMRGK  498

Query  923  KRKKGMGYSVVEVNNSMH  976
              KK  GYS VE N  +H
Sbjct  499  SIKKVAGYSSVESNGEIH  516


 Score =   108 bits (270),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 98/180 (54%), Gaps = 0/180 (0%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            ++T +L      G++  +R +FD + +     W+ +I  Y +++ P  A+AV+++M    
Sbjct  99   LITQILSSLTLLGDMTYARQIFDEMHKPRAFLWNTLIKGYVKNNLPVEAIAVYQKMHCLG  158

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             +P+++ F  +L+AC+ +     G  +H  V+K G   +A + + L+ +Y K G +    
Sbjct  159  ARPDQYTFPFVLKACAEIDDFWAGAEVHALVVKFGIDFDAIVRTELMLLYAKVGELGSAD  218

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +F    ++DL+ W+++I  Y   G+  +AL  F +M   G++P+ V  +SVL AC+  G
Sbjct  219  YLFRSMSERDLVSWNALIAAYVQIGNAGKALRLFREMGPAGVKPDSVTVVSVLGACAQLG  278


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 65/254 (26%), Positives = 107/254 (42%), Gaps = 51/254 (20%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G  + I V  A L MYA  GN++ +  LF+ + +++II+WS MI  YA +     AL +F
Sbjct  294  GLERNIFVNNARLDMYAKCGNMDLASSLFNEMQERNIISWSTMIGGYAINGDFEKALHLF  353

Query  188  RRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKF  367
              MQ E  KPN   F  +L ACS                                     
Sbjct  354  SLMQHERVKPNHVTFLGVLSACSHA-----------------------------------  378

Query  368  GRIHQGKTIF-------DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPND  526
            G + +GK  F       D N    L  ++ M++  G +GH  EA      M    ++P+ 
Sbjct  379  GLVSEGKNYFNYMVESSDSNIHPRLEHYACMVDLLGRSGHLEEAYGFIKSM---PVEPDS  435

Query  527  VVFISVLSACS-HCGLEYEGWNWFHAMEEKYDITPKLA-HYACMVDMLSRQGNVEEALEF  700
             V+ ++L ACS H  +E          +  +D+ P+ A +Y  + ++ +  G  ++  + 
Sbjct  436  GVWGALLGACSTHNNIELGQL----VADVLFDLAPETASYYVLLSNIYAAAGRWDDVKKV  491

Query  701  VNKMPIEPDKRIWG  742
              KM  +  K++ G
Sbjct  492  RQKMRGKSIKKVAG  505


 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/177 (25%), Positives = 77/177 (44%), Gaps = 4/177 (2%)
 Frame = +2

Query  227  AFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDEN  406
            AF SL+  CS+   Q   + IH  ++  G +    L + ++      G +   + IFDE 
Sbjct  66   AFTSLINCCSTQPNQL--KQIHALLLTAGLSIKNSLITQILSSLTLLGDMTYARQIFDEM  123

Query  407  PDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGW  586
                   W+++I GY  N    EA+  +  M   G +P+   F  VL AC+     + G 
Sbjct  124  HKPRAFLWNTLIKGYVKNNLPVEAIAVYQKMHCLGARPDQYTFPFVLKACAEIDDFWAGA  183

Query  587  NWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
               HA+  K+ I         ++ + ++ G +  A +++ +   E D   W AL+A 
Sbjct  184  E-VHALVVKFGIDFDAIVRTELMLLYAKVGELGSA-DYLFRSMSERDLVSWNALIAA  238



>ref|XP_004289184.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=619

 Score =   280 bits (717),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/320 (43%), Positives = 197/320 (62%), Gaps = 1/320 (0%)
 Frame = +2

Query  17   KCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM  196
            K +  +TA++  YA  G ++ +R+LFD + ++D++ W+ MI AYAQ   P+ AL +FRRM
Sbjct  179  KSLVSLTAMITCYAKRGEVDEARVLFDGMEERDVVCWNVMIDAYAQHGMPNEALLLFRRM  238

Query  197  QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
             +E  KP+     SLL AC  + A + G  +H+ V   G   +  + S LIDMYCK G  
Sbjct  239  LVEKVKPDGVTVLSLLSACGQIGALESGRWVHSYVESNGIRIDVQVGSALIDMYCKCGSW  298

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
               + +FD    KD++ W+SMI GY M+G   EAL+ F +M   G +P D+ FI VL+AC
Sbjct  299  EDARLVFDRIGGKDVVVWNSMIVGYAMHGFSREALDLFSEMCRIGYRPTDITFIGVLNAC  358

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
            ++ GL  EG  +F +M+++Y I PK+ HY CMV++LSR G VEEA EFV  M IEPD  +
Sbjct  359  AYAGLVSEGEAFFCSMKDQYGIEPKIEHYGCMVNLLSRAGKVEEAYEFVKNMKIEPDPVL  418

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            WG LL  CR  HG   + E +A+ L+  +  N+  Y++LSN+YA  G W+ V K+R L+ 
Sbjct  419  WGTLLGACR-LHGDIALGENIAEFLVGQNLANSGTYILLSNIYAAAGNWEGVAKVRTLLK  477

Query  917  GKKRKKGMGYSVVEVNNSMH  976
                +K  G S +EVNN +H
Sbjct  478  NSGIQKEPGCSSIEVNNKVH  497


 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/304 (25%), Positives = 143/304 (47%), Gaps = 38/304 (13%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            L + YA+F  ++ S  LF       +  WS++I+++++      AL  + +M     +PN
Sbjct  59   LQRSYASFNRLDYSVALFRQTQNPSVFFWSSIINSHSKRGLHHLALTFYTQMLTNGVEPN  118

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
             F F +L ++C  +     G+ +H   +K G+ S+ ++ +GL+D+Y + G +   + +FD
Sbjct  119  CFTFSALFKSCPIVT----GKVLHCHAIKFGFDSDLYVRTGLVDVYARGGDVVGARELFD  174

Query  401  ENPDK-------------------------------DLICWSSMINGYGMNGHGNEALEC  487
              P+K                               D++CW+ MI+ Y  +G  NEAL  
Sbjct  175  TMPEKSLVSLTAMITCYAKRGEVDEARVLFDGMEERDVVCWNVMIDAYAQHGMPNEALLL  234

Query  488  FLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLS  667
            F  ML   ++P+ V  +S+LSAC   G   E   W H+  E   I   +   + ++DM  
Sbjct  235  FRRMLVEKVKPDGVTVLSLLSACGQIG-ALESGRWVHSYVESNGIRIDVQVGSALIDMYC  293

Query  668  RQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQL-ISLDPTNASYY  844
            + G+ E+A    +++  + D  +W +++ G      S E  +L ++   I   PT+ ++ 
Sbjct  294  KCGSWEDARLVFDRIGGK-DVVVWNSMIVGYAMHGFSREALDLFSEMCRIGYRPTDITFI  352

Query  845  VILS  856
             +L+
Sbjct  353  GVLN  356



>ref|XP_008801333.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At4g21065-like [Phoenix dactylifera]
Length=791

 Score =   284 bits (727),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/325 (42%), Positives = 199/325 (61%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++GF   + + T L+ MY   G++ S++ LFDS ++KD++ W+AMIS YA  +    A  
Sbjct  346  RNGFRMSVVLATTLVDMYCKCGDMRSAKALFDSTNEKDVMTWTAMISGYAWVNHIEEAFD  405

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F +M+    +PNE    +LL  C+   A   G  +H  + K G  S+  LA+ L+DMY 
Sbjct  406  LFGQMKDADIRPNEVTMVNLLSLCAKAGALGRGRWVHACIDKQGIESDVVLATALVDMYA  465

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G I     +F    DKD+  W++M+NG  +NGHG++A++ F  M   GI+PNDV FI 
Sbjct  466  KCGDIDAAYMVFSRATDKDVCMWNAMLNGLAVNGHGDKAIKLFSQMEREGIKPNDVTFIG  525

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L ACSH GL  EG  +F+ M+  Y + PK+ HY CMVD+L R G ++EA E +N MP +
Sbjct  526  ILRACSHAGLVVEGRQFFNRMDHDYGLGPKIEHYGCMVDLLGRAGKLDEAHELINGMPFK  585

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            P+  IWGALLA C K H +  + E+ A  L+ L+P N+ Y ++LSN+YA   RWDEV ++
Sbjct  586  PNVVIWGALLAAC-KVHKNPXLGEVAANNLLKLEPYNSGYRILLSNIYAMNHRWDEVAEV  644

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R+ M     KK  G S +EVN S+H
Sbjct  645  RKAMKDTGLKKTPGISSIEVNGSVH  669


 Score =   157 bits (397),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 147/278 (53%), Gaps = 3/278 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            +  +TAL+ MY   G++  +R +FD ++ K I +WSAMI+   +  +   A+ +F +M+ 
Sbjct  252  VNAITALIDMYVKCGSVSVARRVFDQMTTKSIASWSAMIAGCIRCRELEAAVELFGKMRQ  311

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            E+  PNE    SL+  C    A ++G+ +H  +++ G+  +  LA+ L+DMYCK G +  
Sbjct  312  ENVSPNEITMLSLVTECGQTGALELGKWLHAYMLRNGFRMSVVLATTLVDMYCKCGDMRS  371

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             K +FD   +KD++ W++MI+GY    H  EA + F  M    I+PN+V  +++LS C+ 
Sbjct  372  AKALFDSTNEKDVMTWTAMISGYAWVNHIEEAFDLFGQMKDADIRPNEVTMVNLLSLCAK  431

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             G    G  W HA  +K  I   +     +VDM ++ G+++ A    ++   + D  +W 
Sbjct  432  AGALGRG-RWVHACIDKQGIESDVVLATALVDMYAKCGDIDAAYMVFSR-ATDKDVCMWN  489

Query  743  ALLAGCR-KTHGSSEISELVAKQLISLDPTNASYYVIL  853
            A+L G     HG   I      +   + P + ++  IL
Sbjct  490  AMLNGLAVNGHGDKAIKLFSQMEREGIKPNDVTFIGIL  527


 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/254 (26%), Positives = 123/254 (48%), Gaps = 4/254 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G    + V  +L+QMY+    ++S+  +F+ + ++D+++WS MI  + +S     A+ 
Sbjct  142  KAGLDWDVFVHNSLMQMYSECERVDSAIRVFNEMPERDVVSWSTMIKTFTRSKSFDEAID  201

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGY--TSNAFLASGLIDM  355
            +   M L + KP++    S+L   + +A    G  +HT ++K G   +++    + LIDM
Sbjct  202  LVGEMFLLNIKPSDITMISMLNLFADIADLKKGRPLHTYLIKNGEAGSTDVNAITALIDM  261

Query  356  YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVF  535
            Y K G +   + +FD+   K +  WS+MI G         A+E F  M    + PN++  
Sbjct  262  YVKCGSVSVARRVFDQMTTKSIASWSAMIAGCIRCRELEAAVELFGKMRQENVSPNEITM  321

Query  536  ISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMP  715
            +S+++ C   G   E   W HA   +      +     +VDM  + G++  A    +   
Sbjct  322  LSLVTECGQTG-ALELGKWLHAYMLRNGFRMSVVLATTLVDMYCKCGDMRSAKALFDSTN  380

Query  716  IEPDKRIWGALLAG  757
             E D   W A+++G
Sbjct  381  -EKDVMTWTAMISG  393


 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 110/225 (49%), Gaps = 2/225 (1%)
 Frame = +2

Query  134  MISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLG  313
            ++++Y ++  P+ AL ++  M+      + F   S+L+AC+ ++    G  IH   +K G
Sbjct  85   LVTSYIKNSGPAAALRLYAYMRKTGTGLDNFTVPSVLKACAQLSRIRQGMEIHGFALKAG  144

Query  314  YTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFL  493
               + F+ + L+ MY +  R+     +F+E P++D++ WS+MI  +  +   +EA++   
Sbjct  145  LDWDVFVHNSLMQMYSECERVDSAIRVFNEMPERDVVSWSTMIKTFTRSKSFDEAIDLVG  204

Query  494  DMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDI-TPKLAHYACMVDMLSR  670
            +M    I+P+D+  IS+L+  +      +G      + +  +  +  +     ++DM  +
Sbjct  205  EMFLLNIKPSDITMISMLNLFADIADLKKGRPLHTYLIKNGEAGSTDVNAITALIDMYVK  264

Query  671  QGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAK  805
             G+V  A    ++M  +     W A++AGC +        EL  K
Sbjct  265  CGSVSVARRVFDQMTTKSIAS-WSAMIAGCIRCRELEAAVELFGK  308



>ref|XP_007147940.1| hypothetical protein PHAVU_006G167300g [Phaseolus vulgaris]
 gb|ESW19934.1| hypothetical protein PHAVU_006G167300g [Phaseolus vulgaris]
Length=611

 Score =   280 bits (716),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/336 (38%), Positives = 215/336 (64%), Gaps = 1/336 (0%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             ++GF   + V  +LL +YA  G  ES+  +F+ + ++D++AW+++I+ +A + +P+ AL 
Sbjct  166   RNGFQSLVFVQNSLLHIYAACGYTESAYKVFELMKERDLVAWNSVINGFALNGRPNEALT  225

Query  182   VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             +FR M +E  +P+ F   SLL AC+ + A ++G  +H  ++K+G   N+++ + L+D+Y 
Sbjct  226   LFREMSVEGVEPDGFTVVSLLSACAELGALELGRRVHVYLLKVGLRENSYVTNSLLDLYA  285

Query  362   KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
             K G I + + +F E  +++ + W+S+I G  +NG G EALE F +M   G+ P+++ F+ 
Sbjct  286   KCGTIREAQQVFGEMSERNAVSWTSLIVGLAVNGFGEEALELFKEMEGQGLVPSEITFVG  345

Query  542   VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
             VL ACSHCG+  EG+N+F  MEE+Y I P++ HY CMVD+LSR G V++A +++  MP++
Sbjct  346   VLYACSHCGMLDEGFNYFKRMEEEYGILPRIEHYGCMVDLLSRAGLVKQAYKYIQNMPVQ  405

Query  722   PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
             P+  IW  LL  C   HG  ++ E+    ++ L+P ++  YV+LSNLYA + RW +V+ +
Sbjct  406   PNAVIWRTLLGAC-TIHGHLDLGEIARSHILKLEPKHSGDYVLLSNLYASERRWSDVQVV  464

Query  902   RQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQE  1009
             R+ M     KK  GYS+VE+ N ++      RS  +
Sbjct  465   RRSMLKDGVKKTPGYSLVELGNRVYEFTIGDRSHPQ  500


 Score =   117 bits (294),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/223 (29%), Positives = 113/223 (51%), Gaps = 2/223 (1%)
 Frame = +2

Query  89   LFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAA  268
            +F  +   ++  W+ MI  YA+S  PS AL  +R+M +   +P+   +  LL+A S    
Sbjct  94   VFTRIHNPNVFTWNTMIRGYAESQNPSPALHFYRQMTVSCVEPDTHTYPFLLKAISKSLN  153

Query  269  QDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMING  448
               GE IH+  ++ G+ S  F+ + L+ +Y   G       +F+   ++DL+ W+S+ING
Sbjct  154  VREGEAIHSVTIRNGFQSLVFVQNSLLHIYAACGYTESAYKVFELMKERDLVAWNSVING  213

Query  449  YGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITP  628
            + +NG  NEAL  F +M   G++P+    +S+LSAC+  G   E     H    K  +  
Sbjct  214  FALNGRPNEALTLFREMSVEGVEPDGFTVVSLLSACAELG-ALELGRRVHVYLLKVGLRE  272

Query  629  KLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
                   ++D+ ++ G + EA +   +M  E +   W +L+ G
Sbjct  273  NSYVTNSLLDLYAKCGTIREAQQVFGEMS-ERNAVSWTSLIVG  314



>ref|XP_011083605.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Sesamum indicum]
 ref|XP_011083606.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Sesamum indicum]
Length=654

 Score =   281 bits (718),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/347 (39%), Positives = 215/347 (62%), Gaps = 11/347 (3%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K G  + + V   L+  YA  G ++ S+ +FD +++KD+I+W++MI+  AQ      A+ 
Sbjct  208   KRGLDEVLGVGNTLIDAYAKCGLVDFSKKVFDEMNEKDLISWNSMIAVCAQHGLGEEAIG  267

Query  182   VFRRM----QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLI  349
             VF+ M    ++E+   N     ++L AC+   A   G+ +HTQ++K+   SN  + + +I
Sbjct  268   VFQSMVWCAEVEY---NAVTLSAVLLACAHSGALRTGKGMHTQIIKMNLESNVVVGTSII  324

Query  350   DMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDV  529
             DMYCK GR++  +  FD   +K++  WS+MI GYGM+G   EALE   DM+  GI+PN +
Sbjct  325   DMYCKCGRVNSARRAFDRMNEKNVKSWSAMIAGYGMHGKAREALEVLSDMIRAGIKPNGI  384

Query  530   VFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNK  709
              F+SVLSAC H GL  +GW+WF AM+ +++I P + HY CMVD+L R G +++A   + +
Sbjct  385   TFVSVLSACCHAGLVDQGWHWFCAMQHRFNIEPSVEHYGCMVDLLGRAGFLQKAYNLIEE  444

Query  710   MPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDE  889
             M + PD  IW +LLA CR  H + E+ E+ A++L  LDP N+ YY +LSN+YA+ GRW++
Sbjct  445   MRVRPDFVIWCSLLASCR-IHKNVELGEISARKLFELDPNNSGYYTLLSNIYAEAGRWED  503

Query  890   VEKLRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             V+K+R  M      K  G+S+VE+   +H        ++++ QH ++
Sbjct  504   VKKMRIFMKNHGVVKSPGFSLVELKGRVHIFLV---GDRQHPQHEKI  547


 Score =   127 bits (319),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 88/288 (31%), Positives = 143/288 (50%), Gaps = 16/288 (6%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL--  202
            V +AL+ MY+  G +  +RILFD +  +++++W++MI+ Y Q+D    AL +F+  QL  
Sbjct  108  VSSALIDMYSKCGQLRDARILFDEIHMRNVVSWTSMINGYVQNDCAREALLLFKE-QLAE  166

Query  203  -------EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
                   E G  +  A  S+L ACS    ++V   +H  V+K G      + + LID Y 
Sbjct  167  ESGGSMEEDGCVDGVAMVSILAACSRTCEKNVTRGVHGFVIKRGLDEVLGVGNTLIDAYA  226

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDML-SHGIQPNDVVFI  538
            K G +   K +FDE  +KDLI W+SMI     +G G EA+  F  M+    ++ N V   
Sbjct  227  KCGLVDFSKKVFDEMNEKDLISWNSMIAVCAQHGLGEEAIGVFQSMVWCAEVEYNAVTLS  286

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            +VL AC+H G    G    H    K ++   +     ++DM  + G V  A    ++M  
Sbjct  287  AVLLACAHSGALRTG-KGMHTQIIKMNLESNVVVGTSIIDMYCKCGRVNSARRAFDRMN-  344

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLI--SLDPTNASYYVILS  856
            E + + W A++AG    HG +  +  V   +I   + P   ++  +LS
Sbjct  345  EKNVKSWSAMIAG-YGMHGKAREALEVLSDMIRAGIKPNGITFVSVLS  391


 Score =   104 bits (260),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/256 (29%), Positives = 123/256 (48%), Gaps = 11/256 (4%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            LLQ      N   + +    + + ++ +W+++I+  A+S     AL  F  M+    KPN
Sbjct  11   LLQKRHCSTNANITTLFNKYVDKTNVFSWNSIIAELARSGDSVEALKAFSSMRKSALKPN  70

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
               F   +++CS++     G+  H Q    GY S+ F++S LIDMY K G++   + +FD
Sbjct  71   RSTFPCAIKSCSALCDLASGKQAHQQAFVFGYGSDLFVSSALIDMYSKCGQLRDARILFD  130

Query  401  ENPDKDLICWSSMINGYGMNGHGNEALECFLDML---SHGIQPND-----VVFISVLSAC  556
            E   ++++ W+SMINGY  N    EAL  F + L   S G    D     V  +S+L+AC
Sbjct  131  EIHMRNVVSWTSMINGYVQNDCAREALLLFKEQLAEESGGSMEEDGCVDGVAMVSILAAC  190

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
            S    E       H    K  +   L     ++D  ++ G V+ + +  ++M  E D   
Sbjct  191  SR-TCEKNVTRGVHGFVIKRGLDEVLGVGNTLIDAYAKCGLVDFSKKVFDEMN-EKDLIS  248

Query  737  WGALLAGCRKTHGSSE  784
            W +++A C + HG  E
Sbjct  249  WNSMIAVCAQ-HGLGE  263



>ref|XP_004145727.1| PREDICTED: uncharacterized protein LOC101212001 [Cucumis sativus]
Length=2598

 Score =   292 bits (748),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/326 (43%), Positives = 202/326 (62%), Gaps = 2/326 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF   I V   L+  YA  G    S+ +FD + +KD I+W++MI+ YAQS     AL 
Sbjct  2152  KKGFDGSIGVGNTLMDAYAKCGQPLVSKKVFDWMEEKDDISWNSMIAVYAQSGLSGEALE  2211

Query  182   VFRRMQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VF  M    G + N     ++L AC+   A   G+ IH QV+K+    N  + + +IDMY
Sbjct  2212  VFHGMVRHVGVRYNAVTLSAVLLACAHAGALRAGKCIHDQVIKMDLEYNVCVGTSIIDMY  2271

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK GR+   K  FD   +K++  W++M+ GYGM+G   EAL+ F  M+  G++PN + F+
Sbjct  2272  CKCGRVEMAKKTFDRMKEKNVKSWTAMVAGYGMHGRAKEALDIFYKMVRAGVKPNYITFV  2331

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             SVL+ACSH GL  EGW+WF+AM+ KYDI P + HY CMVD+  R G + EA   + +M +
Sbjct  2332  SVLAACSHAGLVEEGWHWFNAMKHKYDIEPGIEHYGCMVDLFGRAGCLNEAYNLIKRMKM  2391

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
             +PD  +WG+LL  CR  H + ++ E+ A++L  LDP N  YYV+LSNLYAD GRW +VE+
Sbjct  2392  KPDFVVWGSLLGACR-IHKNVDLGEIAAQKLFELDPDNCGYYVLLSNLYADAGRWADVER  2450

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMH  976
             +R LM  ++  K  G+S+VE+   +H
Sbjct  2451  MRMLMKNRQLVKPPGFSLVELKGRVH  2476


 Score =   169 bits (427),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 126/221 (57%), Gaps = 0/221 (0%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
            T ++    + G+++ +R +FD +  K++++W+AMI+ Y ++ QP  AL +F+RMQ E+  
Sbjct  195  TTVISGLISCGDLQEARRIFDEIPSKNVVSWTAMINGYIRNQQPEEALELFKRMQAENIF  254

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
            PNE+   SL++AC+ M    +G  IH   +K       +L + LIDMY K G I     +
Sbjct  255  PNEYTMVSLIKACTEMGILTLGRGIHDYAIKNCIEIGVYLGTALIDMYSKCGSIKDAIEV  314

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            F+  P K L  W+SMI   G++G G EAL  F +M    ++P+ + FI VL AC H    
Sbjct  315  FETMPRKSLPTWNSMITSLGVHGLGQEALNLFSEMERVNVKPDAITFIGVLCACVHIKNV  374

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALE  697
             EG  +F  M + Y I P   HY CM ++ +R  N++EA +
Sbjct  375  KEGCAYFTRMTQHYGIAPIPEHYECMTELYARSNNLDEAFK  415


 Score =   134 bits (338),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 140/259 (54%), Gaps = 11/259 (4%)
 Frame = +2

Query  8     GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
             GF   + V +AL+ MY+  G ++ +R LFD +  +++++W++MI+ Y Q++Q  NAL +F
Sbjct  2045  GFETDLFVSSALIDMYSKCGQLKDARALFDEIPLRNVVSWTSMITGYVQNEQADNALLLF  2104

Query  188   R-----RMQLEHGKP---NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASG  343
             +       ++E G     +     S+L ACS ++ + + E +H  V+K G+  +  + + 
Sbjct  2105  KDFLEEETEVEDGNNVPLDSVVMVSVLSACSRVSGKGITEGVHGFVVKKGFDGSIGVGNT  2164

Query  344   LIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSH-GIQP  520
             L+D Y K G+    K +FD   +KD I W+SMI  Y  +G   EALE F  M+ H G++ 
Sbjct  2165  LMDAYAKCGQPLVSKKVFDWMEEKDDISWNSMIAVYAQSGLSGEALEVFHGMVRHVGVRY  2224

Query  521   NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEF  700
             N V   +VL AC+H G    G    H    K D+   +     ++DM  + G VE A + 
Sbjct  2225  NAVTLSAVLLACAHAGALRAG-KCIHDQVIKMDLEYNVCVGTSIIDMYCKCGRVEMAKKT  2283

Query  701   VNKMPIEPDKRIWGALLAG  757
              ++M  E + + W A++AG
Sbjct  2284  FDRMK-EKNVKSWTAMVAG  2301


 Score =   113 bits (283),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/256 (26%), Positives = 121/256 (47%), Gaps = 32/256 (13%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            L+ +Y+  G I  + +LF  +       W+ +I A   +     AL +++ M  +    +
Sbjct  65   LIHLYSTHGRIAYAILLFYQIQNPCTFTWNLIIRANTINGLSEQALMLYKNMVCQGIAAD  124

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGR---------  373
            +F F  +++AC++  + D+G+ +H  ++K G++ + F+ + LID Y K G          
Sbjct  125  KFTFPFVIKACTNFLSIDLGKVVHGSLIKYGFSGDVFVQNNLIDFYFKCGHTRFALKVFE  184

Query  374  ----------------------IHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALEC  487
                                  + + + IFDE P K+++ W++MINGY  N    EALE 
Sbjct  185  KMRVRNVVSWTTVISGLISCGDLQEARRIFDEIPSKNVVSWTAMINGYIRNQQPEEALEL  244

Query  488  FLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLS  667
            F  M +  I PN+   +S++ AC+  G+   G    H    K  I   +     ++DM S
Sbjct  245  FKRMQAENIFPNEYTMVSLIKACTEMGILTLG-RGIHDYAIKNCIEIGVYLGTALIDMYS  303

Query  668  RQGNVEEALEFVNKMP  715
            + G++++A+E    MP
Sbjct  304  KCGSIKDAIEVFETMP  319


 Score = 98.6 bits (244),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 83/344 (24%), Positives = 142/344 (41%), Gaps = 57/344 (17%)
 Frame = +2

Query  89    LFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAA  268
              +  + + ++ +W+++I+  A+      AL  F  ++     P   +F   +++CS++  
Sbjct  1971  FYKYVDKSNVHSWNSVIADLARGGDSVEALRAFSSLRKLGLIPTRSSFPCTIKSCSALCD  2030

Query  269   QDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMING  448
                G   H Q    G+ ++ F++S LIDMY K G++   + +FDE P ++++ W+SMI G
Sbjct  2031  LVSGRMSHQQAFVFGFETDLFVSSALIDMYSKCGQLKDARALFDEIPLRNVVSWTSMITG  2090

Query  449   YGMNGHGNEALECFLDMLSHGIQPND--------VVFISVLSACSH--------------  562
             Y  N   + AL  F D L    +  D        VV +SVLSACS               
Sbjct  2091  YVQNEQADNALLLFKDFLEEETEVEDGNNVPLDSVVMVSVLSACSRVSGKGITEGVHGFV  2150

Query  563   ---------------------CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGN  679
                                  CG        F  MEEK DI+     +  M+ + ++ G 
Sbjct  2151  VKKGFDGSIGVGNTLMDAYAKCGQPLVSKKVFDWMEEKDDIS-----WNSMIAVYAQSGL  2205

Query  680   VEEALE----FVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLD-PTNASYY  844
               EALE     V  + +  +     A+L  C    G+    + +  Q+I +D   N    
Sbjct  2206  SGEALEVFHGMVRHVGVRYNAVTLSAVLLACAHA-GALRAGKCIHDQVIKMDLEYNVCVG  2264

Query  845   VILSNLYADQGRWDEVEKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
               + ++Y   GR   VE  ++  D  K K    ++ +     MH
Sbjct  2265  TSIIDMYCKCGR---VEMAKKTFDRMKEKNVKSWTAMVAGYGMH  2305


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 76/173 (44%), Gaps = 5/173 (3%)
 Frame = +2

Query  239  LLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKD  418
            LLQ C +         IH ++++ G +++  L   LI +Y   GRI     +F +  +  
Sbjct  33   LLQNCKNFKHL---RQIHAKIIRSGLSNDQLLTRKLIHLYSTHGRIAYAILLFYQIQNPC  89

Query  419  LICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFH  598
               W+ +I    +NG   +AL  + +M+  GI  +   F  V+ AC++  L  +     H
Sbjct  90   TFTWNLIIRANTINGLSEQALMLYKNMVCQGIAADKFTFPFVIKACTNF-LSIDLGKVVH  148

Query  599  AMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
                KY  +  +     ++D   + G+   AL+   KM +  +   W  +++G
Sbjct  149  GSLIKYGFSGDVFVQNNLIDFYFKCGHTRFALKVFEKMRVR-NVVSWTTVISG  200



>ref|XP_010655542.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, 
chloroplastic [Vitis vinifera]
Length=876

 Score =   285 bits (729),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/316 (42%), Positives = 208/316 (66%), Gaps = 2/316 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V  AL+ MYA  G++  +  +F  +  KDI++W+ MI  Y+++  P+ AL +F  MQ  +
Sbjct  441  VSNALMDMYAKCGSMGDAHSVFSEMQVKDIVSWNTMIGGYSKNSLPNEALNLFVEMQY-N  499

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KPN      +L AC+S+AA + G+ IH  +++ G++ +  +A+ L+DMY K G +   +
Sbjct  500  SKPNSITMACILPACASLAALERGQEIHGHILRNGFSLDRHVANALVDMYLKCGALGLAR  559

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD  P+KDL+ W+ MI GYGM+G+G+EA+  F +M + GI+P++V FIS+L ACSH G
Sbjct  560  LLFDMIPEKDLVSWTVMIAGYGMHGYGSEAIAAFNEMRNSGIEPDEVSFISILYACSHSG  619

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  EGW +F+ M     I PK  HYAC+VD+L+R GN+ +A +F+  MPIEPD  IWGAL
Sbjct  620  LLDEGWGFFNMMRNNCCIEPKSEHYACIVDLLARAGNLSKAYKFIKMMPIEPDATIWGAL  679

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L GCR  H   +++E VA+ +  L+P N  YYV+L+N+YA+  +W+EV+KLR+ +  +  
Sbjct  680  LCGCRIYH-DVKLAEKVAEHVFELEPENTGYYVLLANIYAEAEKWEEVKKLRERIGRRGL  738

Query  929  KKGMGYSVVEVNNSMH  976
            +K  G S +E+   +H
Sbjct  739  RKNPGCSWIEIKGKVH  754


 Score =   127 bits (320),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/241 (29%), Positives = 127/241 (53%), Gaps = 2/241 (1%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
            + L+ MY   G++   R +FD ++ + +  W+ +++ YA+      +L++F+RM+    K
Sbjct  140  SKLVFMYVTCGDLREGRRIFDKVANEKVFLWNLLMNGYAKIGNFRESLSLFKRMRELGVK  199

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
             N + F  +++  ++  + + GE +H  + +LG+ S   + + LI  Y K  R+   + +
Sbjct  200  MNSYTFSCVMKCYAASGSVEEGEGVHAYLSRLGFGSYNTVVNSLIAFYFKIRRVESARKL  259

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            FDE  D+D+I W+SMI+GY  NG   + L+ F  ML  GI  +    +SV++ CS+ G+ 
Sbjct  260  FDELGDRDVISWNSMISGYVSNGLSEKGLDLFEQMLLLGINTDLATMVSVVAGCSNTGML  319

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
              G    H    K     +L    C++DM S+ GN+  A++    M  E     W +++A
Sbjct  320  LLG-RALHGYAIKASFGKELTLNNCLLDMYSKSGNLNSAIQVFETMG-ERSVVSWTSMIA  377

Query  755  G  757
            G
Sbjct  378  G  378


 Score =   125 bits (313),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 146/286 (51%), Gaps = 6/286 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+ F K + +   LL MY+  GN+ S+  +F+++ ++ +++W++MI+ YA+      ++ 
Sbjct  331  KASFGKELTLNNCLLDMYSKSGNLNSAIQVFETMGERSVVSWTSMIAGYAREGLSDMSVR  390

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M+ E   P+ F   ++L AC+     + G+ +H  + +    S+ F+++ L+DMY 
Sbjct  391  LFHEMEKEGISPDIFTITTILHACACTGLLENGKDVHNYIKENKMQSDLFVSNALMDMYA  450

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +    ++F E   KD++ W++MI GY  N   NEAL  F++M  +  +PN +    
Sbjct  451  KCGSMGDAHSVFSEMQVKDIVSWNTMIGGYSKNSLPNEALNLFVEM-QYNSKPNSITMAC  509

Query  542  VLSAC-SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            +L AC S   LE       H +   + +   +A+   +VDM  + G +  A    + +P 
Sbjct  510  ILPACASLAALERGQEIHGHILRNGFSLDRHVAN--ALVDMYLKCGALGLARLLFDMIP-  566

Query  719  EPDKRIWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
            E D   W  ++AG     +GS  I+     +   ++P   S+  IL
Sbjct  567  EKDLVSWTVMIAGYGMHGYGSEAIAAFNEMRNSGIEPDEVSFISIL  612


 Score =   112 bits (280),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 72/282 (26%), Positives = 134/282 (48%), Gaps = 2/282 (1%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF     VV +L+  Y     +ES+R LFD L  +D+I+W++MIS Y  +      L +F
Sbjct  232  GFGSYNTVVNSLIAFYFKIRRVESARKLFDELGDRDVISWNSMISGYVSNGLSEKGLDLF  291

Query  188  RRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKF  367
             +M L     +     S++  CS+     +G  +H   +K  +     L + L+DMY K 
Sbjct  292  EQMLLLGINTDLATMVSVVAGCSNTGMLLLGRALHGYAIKASFGKELTLNNCLLDMYSKS  351

Query  368  GRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVL  547
            G ++    +F+   ++ ++ W+SMI GY   G  + ++  F +M   GI P+     ++L
Sbjct  352  GNLNSAIQVFETMGERSVVSWTSMIAGYAREGLSDMSVRLFHEMEKEGISPDIFTITTIL  411

Query  548  SACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPD  727
             AC+  GL   G +  + ++E   +   L     ++DM ++ G++ +A    ++M ++ D
Sbjct  412  HACACTGLLENGKDVHNYIKEN-KMQSDLFVSNALMDMYAKCGSMGDAHSVFSEMQVK-D  469

Query  728  KRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
               W  ++ G  K    +E   L  +   +  P + +   IL
Sbjct  470  IVSWNTMIGGYSKNSLPNEALNLFVEMQYNSKPNSITMACIL  511


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++GF     V  AL+ MY   G +  +R+LFD + +KD+++W+ MI+ Y      S A+A
Sbjct  532  RNGFSLDRHVANALVDMYLKCGALGLARLLFDMIPEKDLVSWTVMIAGYGMHGYGSEAIA  591

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
             F  M+    +P+E +F S+L ACS     D G
Sbjct  592  AFNEMRNSGIEPDEVSFISILYACSHSGLLDEG  624


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 64/136 (47%), Gaps = 4/136 (3%)
 Frame = +2

Query  188  RRMQLEHGKPNE----FAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM  355
            R M+L +  P        + S+LQ C+ + +   G  IH+ +       +  L S L+ M
Sbjct  86   RAMELINQSPKPDLELRTYCSVLQLCADLKSIQDGRRIHSIIQSNDVEVDGVLGSKLVFM  145

Query  356  YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVF  535
            Y   G + +G+ IFD+  ++ +  W+ ++NGY   G+  E+L  F  M   G++ N   F
Sbjct  146  YVTCGDLREGRRIFDKVANEKVFLWNLLMNGYAKIGNFRESLSLFKRMRELGVKMNSYTF  205

Query  536  ISVLSACSHCGLEYEG  583
              V+   +  G   EG
Sbjct  206  SCVMKCYAASGSVEEG  221



>gb|KGN65613.1| hypothetical protein Csa_1G470290 [Cucumis sativus]
Length=871

 Score =   285 bits (729),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/316 (42%), Positives = 208/316 (66%), Gaps = 2/316 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V  AL  MYA  G+++ +  +F  + +KD+I+W+ MI  Y ++  P+ AL +F  MQ E 
Sbjct  436  VSNALTDMYAKCGSMKDAHDVFSHMKKKDVISWNTMIGGYTKNSLPNEALTLFAEMQRE-  494

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KP+      +L AC+S+AA D G  IH   ++ GY+ + ++ + ++DMY K G +   +
Sbjct  495  SKPDGTTVACILPACASLAALDKGREIHGYALRNGYSEDKYVTNAVVDMYVKCGLLVLAR  554

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
            ++FD  P+KDL+ W+ MI GYGM+G+G+EA+  F  M   GI+P++V FIS+L ACSH G
Sbjct  555  SLFDMIPNKDLVSWTVMIAGYGMHGYGSEAINTFNQMRMTGIEPDEVSFISILYACSHSG  614

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  EGW  F+ M+++  I P L HYACMVD+L+R GN+ +A +F+  MPI+PD  IWGAL
Sbjct  615  LLDEGWKIFNIMKKECQIEPNLEHYACMVDLLARTGNLVKAHKFIKAMPIKPDATIWGAL  674

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L GCR  H   +++E VA+++  L+P N  YYV+L+N+YA+  +W+EV+KLR+ +  +  
Sbjct  675  LCGCR-IHHDVKLAEKVAERIFELEPENTGYYVLLANIYAEAEKWEEVQKLRKKIGQRGL  733

Query  929  KKGMGYSVVEVNNSMH  976
            KK  G S +E+   ++
Sbjct  734  KKNPGCSWIEIKGKIN  749


 Score =   122 bits (307),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/241 (30%), Positives = 128/241 (53%), Gaps = 5/241 (2%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHG-KP  217
            L+ MY   G+++  R++FD LS+  I  W+ MIS Y+ S     ++ +F++M LE G KP
Sbjct  136  LVFMYVKCGDLKEGRMVFDKLSESKIFLWNLMISEYSGSGNYGESINLFKQM-LELGIKP  194

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            N + F S+L+  +++A  + G  +H  + KLG+ S   + + LI  Y    ++   + +F
Sbjct  195  NSYTFSSILKCFAAVARVEEGRQVHGLICKLGFNSYNTVVNSLISFYFVGRKVRCAQKLF  254

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEY  577
            DE  D+D+I W+SMI+GY  NG  +  +E F+ ML  G+  +    ++V  AC++ G   
Sbjct  255  DELTDRDVISWNSMISGYVKNGLDDRGIEIFIKMLVFGVDIDLATMVNVFVACANIGTLL  314

Query  578  EGWNWFHAMEEKYDITPKLAHY-ACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
             G    H+   K     +   +   ++DM S+ G++  A+    +M  E     W +++ 
Sbjct  315  LG-KVLHSYSIKAATLDREVRFNNTLLDMYSKCGDLNSAIRVFERMD-EKTVVSWTSMIT  372

Query  755  G  757
            G
Sbjct  373  G  373


 Score =   115 bits (287),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 80/300 (27%), Positives = 141/300 (47%), Gaps = 19/300 (6%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
             LL MY+  G++ S+  +F+ + +K +++W++MI+ Y +      A+ +F  M+     P
Sbjct  338  TLLDMYSKCGDLNSAIRVFERMDEKTVVSWTSMITGYVREGLSDGAIKLFDEMKSRGVVP  397

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            + +A  S+L AC+       G+ +H  + +    +N+F+++ L DMY K G +     +F
Sbjct  398  DVYAVTSILNACAINGNLKSGKIVHDYIRENNLETNSFVSNALTDMYAKCGSMKDAHDVF  457

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC----  565
                 KD+I W++MI GY  N   NEAL  F +M     +P+      +L AC+      
Sbjct  458  SHMKKKDVISWNTMIGGYTKNSLPNEALTLFAEMQRES-KPDGTTVACILPACASLAALD  516

Query  566  -GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             G E  G+   +   E   +T        +VDM  + G +  A    + +P   D   W 
Sbjct  517  KGREIHGYALRNGYSEDKYVTN------AVVDMYVKCGLLVLARSLFDMIP-NKDLVSWT  569

Query  743  ALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYA--DQGRWDEVEKLRQLM  913
             ++AG     +GS  I+     ++  ++P   S+   +S LYA    G  DE  K+  +M
Sbjct  570  VMIAGYGMHGYGSEAINTFNQMRMTGIEPDEVSF---ISILYACSHSGLLDEGWKIFNIM  626


 Score = 98.6 bits (244),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 141/298 (47%), Gaps = 7/298 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     VV +L+  Y     +  ++ LFD L+ +D+I+W++MIS Y ++      + 
Sbjct  224  KLGFNSYNTVVNSLISFYFVGRKVRCAQKLFDELTDRDVISWNSMISGYVKNGLDDRGIE  283

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAF-LASGLIDMY  358
            +F +M +     +     ++  AC+++    +G+ +H+  +K           + L+DMY
Sbjct  284  IFIKMLVFGVDIDLATMVNVFVACANIGTLLLGKVLHSYSIKAATLDREVRFNNTLLDMY  343

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             K G ++    +F+   +K ++ W+SMI GY   G  + A++ F +M S G+ P+     
Sbjct  344  SKCGDLNSAIRVFERMDEKTVVSWTSMITGYVREGLSDGAIKLFDEMKSRGVVPDVYAVT  403

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            S+L+AC+  G    G      + E    T      A + DM ++ G++++A +  + M  
Sbjct  404  SILNACAINGNLKSGKIVHDYIRENNLETNSFVSNA-LTDMYAKCGSMKDAHDVFSHMK-  461

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL---SNLYA-DQGR  880
            + D   W  ++ G  K    +E   L A+      P   +   IL   ++L A D+GR
Sbjct  462  KKDVISWNTMIGGYTKNSLPNEALTLFAEMQRESKPDGTTVACILPACASLAALDKGR  519



>ref|XP_007198996.1| hypothetical protein PRUPE_ppa002176mg [Prunus persica]
 gb|EMJ00195.1| hypothetical protein PRUPE_ppa002176mg [Prunus persica]
Length=705

 Score =   281 bits (720),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/322 (42%), Positives = 209/322 (65%), Gaps = 2/322 (1%)
 Frame = +2

Query  11   FLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFR  190
            F++ + +  A++ MYA  G I S+R +F+ L  KD+I+W+ +I+ YAQ+   S A+ V+R
Sbjct  262  FVQDVVIGNAVVDMYAKLGAIYSARTVFEGLPIKDVISWNTLITGYAQNGLASEAIEVYR  321

Query  191  RMQ-LEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKF  367
             MQ  +   PN   + S+L A +S+ A   G  IH +V+K     + F+ + LIDMY K 
Sbjct  322  MMQEYKEIIPNHGTWVSILPAYTSVGALQQGMKIHGRVIKNCLDLDVFVGTCLIDMYAKC  381

Query  368  GRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVL  547
            GR+     +F + P K  I W+++I+ +G++GHG +AL+ F DML  G++P+ V F+S+L
Sbjct  382  GRLDDALLLFSQVPRKSAIPWNAVISSHGVHGHGEKALKLFKDMLDEGVKPDHVTFVSLL  441

Query  548  SACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPD  727
            SACSH GL  EG ++FH M+E+Y I P L HY CMVD+L R G++ +A  F++ MP+ PD
Sbjct  442  SACSHSGLVDEGQSYFHMMQEQYRIKPNLKHYGCMVDLLGRAGHLNKAYSFIDNMPVRPD  501

Query  728  KRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQ  907
              +WGALL  CR  HG+ ++  + +++L  +D  N  YYV+LSN+YA+ G+W+ VEK+R 
Sbjct  502  ASVWGALLGACR-IHGNVDLGRIASERLFEVDSENVGYYVLLSNIYANSGKWEGVEKVRS  560

Query  908  LMDGKKRKKGMGYSVVEVNNSM  973
            L   +   K  G+S +EVNN++
Sbjct  561  LARNRGLSKTPGWSSIEVNNNV  582


 Score =   111 bits (278),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 137/286 (48%), Gaps = 3/286 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   + V  +L+ +Y+ FG +  +  LFD +  +D+ +W+AMIS + Q+   ++AL 
Sbjct  56   KLGFEWDVFVAASLVHLYSRFGFVGIACRLFDEMPIRDVGSWNAMISGFCQNGNAADALD  115

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            V   M+ +  K +     SLL AC+       G  IH  V+K G   +  + + LI+MY 
Sbjct  116  VLIEMRSDGVKMDRVTATSLLTACAQSGDILSGMLIHLYVIKHGLDFDLLICNALINMYS  175

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            KFG +   + IFD+   +DL+ W+S+I  Y  N     AL  F  M   GIQP+ +  +S
Sbjct  176  KFGSLGHARRIFDQMDIRDLVSWNSIIAAYEQNDDPMTALGLFYSMQLLGIQPDFLTLVS  235

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            + S  +      +  +    +  +      +     +VDM ++ G +  A      +PI+
Sbjct  236  LASILAQLSDAAKSRSVHGFILRRDFFVQDVVIGNAVVDMYAKLGAIYSARTVFEGLPIK  295

Query  722  PDKRIWGALLAGCRKTHGSSEISEL--VAKQLISLDPTNASYYVIL  853
             D   W  L+ G  +   +SE  E+  + ++   + P + ++  IL
Sbjct  296  -DVISWNTLITGYAQNGLASEAIEVYRMMQEYKEIIPNHGTWVSIL  340


 Score =   108 bits (270),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 130/248 (52%), Gaps = 10/248 (4%)
 Frame = +2

Query  134  MISAYAQSDQPSNALAVFRRMQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKL  310
            M+SAY +S     A+  F +  L  G +P+ + F  +L+AC ++     G+ IH Q++KL
Sbjct  1    MVSAYVRSGHFREAIDCFSQFLLTSGLRPDFYTFPPVLKACQNLVD---GKRIHCQILKL  57

Query  311  GYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECF  490
            G+  + F+A+ L+ +Y +FG +     +FDE P +D+  W++MI+G+  NG+  +AL+  
Sbjct  58   GFEWDVFVAASLVHLYSRFGFVGIACRLFDEMPIRDVGSWNAMISGFCQNGNAADALDVL  117

Query  491  LDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSR  670
            ++M S G++ + V   S+L+AC+  G    G    H    K+ +   L     +++M S+
Sbjct  118  IEMRSDGVKMDRVTATSLLTACAQSGDILSGM-LIHLYVIKHGLDFDLLICNALINMYSK  176

Query  671  QGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGS-SEISELVAKQLISLDP---TNAS  838
             G++  A    ++M I  D   W +++A   +     + +    + QL+ + P   T  S
Sbjct  177  FGSLGHARRIFDQMDIR-DLVSWNSIIAAYEQNDDPMTALGLFYSMQLLGIQPDFLTLVS  235

Query  839  YYVILSNL  862
               IL+ L
Sbjct  236  LASILAQL  243



>ref|XP_004150218.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like [Cucumis sativus]
 ref|XP_004161200.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like [Cucumis sativus]
Length=926

 Score =   286 bits (731),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/316 (42%), Positives = 208/316 (66%), Gaps = 2/316 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V  AL  MYA  G+++ +  +F  + +KD+I+W+ MI  Y ++  P+ AL +F  MQ E 
Sbjct  491  VSNALTDMYAKCGSMKDAHDVFSHMKKKDVISWNTMIGGYTKNSLPNEALTLFAEMQRE-  549

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KP+      +L AC+S+AA D G  IH   ++ GY+ + ++ + ++DMY K G +   +
Sbjct  550  SKPDGTTVACILPACASLAALDKGREIHGYALRNGYSEDKYVTNAVVDMYVKCGLLVLAR  609

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
            ++FD  P+KDL+ W+ MI GYGM+G+G+EA+  F  M   GI+P++V FIS+L ACSH G
Sbjct  610  SLFDMIPNKDLVSWTVMIAGYGMHGYGSEAINTFNQMRMTGIEPDEVSFISILYACSHSG  669

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  EGW  F+ M+++  I P L HYACMVD+L+R GN+ +A +F+  MPI+PD  IWGAL
Sbjct  670  LLDEGWKIFNIMKKECQIEPNLEHYACMVDLLARTGNLVKAHKFIKAMPIKPDATIWGAL  729

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L GCR  H   +++E VA+++  L+P N  YYV+L+N+YA+  +W+EV+KLR+ +  +  
Sbjct  730  LCGCR-IHHDVKLAEKVAERIFELEPENTGYYVLLANIYAEAEKWEEVQKLRKKIGQRGL  788

Query  929  KKGMGYSVVEVNNSMH  976
            KK  G S +E+   ++
Sbjct  789  KKNPGCSWIEIKGKIN  804


 Score =   123 bits (309),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/241 (30%), Positives = 128/241 (53%), Gaps = 5/241 (2%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHG-KP  217
            L+ MY   G+++  R++FD LS+  I  W+ MIS Y+ S     ++ +F++M LE G KP
Sbjct  191  LVFMYVKCGDLKEGRMVFDKLSESKIFLWNLMISEYSGSGNYGESINLFKQM-LELGIKP  249

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            N + F S+L+  +++A  + G  +H  + KLG+ S   + + LI  Y    ++   + +F
Sbjct  250  NSYTFSSILKCFAAVARVEEGRQVHGLICKLGFNSYNTVVNSLISFYFVGRKVRCAQKLF  309

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEY  577
            DE  D+D+I W+SMI+GY  NG  +  +E F+ ML  G+  +    ++V  AC++ G   
Sbjct  310  DELTDRDVISWNSMISGYVKNGLDDRGIEIFIKMLVFGVDIDLATMVNVFVACANIGTLL  369

Query  578  EGWNWFHAMEEKYDITPKLAHY-ACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
             G    H+   K     +   +   ++DM S+ G++  A+    +M  E     W +++ 
Sbjct  370  LG-KVLHSYSIKAATLDREVRFNNTLLDMYSKCGDLNSAIRVFERMD-EKTVVSWTSMIT  427

Query  755  G  757
            G
Sbjct  428  G  428


 Score =   115 bits (287),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 80/300 (27%), Positives = 141/300 (47%), Gaps = 19/300 (6%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
             LL MY+  G++ S+  +F+ + +K +++W++MI+ Y +      A+ +F  M+     P
Sbjct  393  TLLDMYSKCGDLNSAIRVFERMDEKTVVSWTSMITGYVREGLSDGAIKLFDEMKSRGVVP  452

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            + +A  S+L AC+       G+ +H  + +    +N+F+++ L DMY K G +     +F
Sbjct  453  DVYAVTSILNACAINGNLKSGKIVHDYIRENNLETNSFVSNALTDMYAKCGSMKDAHDVF  512

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC----  565
                 KD+I W++MI GY  N   NEAL  F +M     +P+      +L AC+      
Sbjct  513  SHMKKKDVISWNTMIGGYTKNSLPNEALTLFAEMQRES-KPDGTTVACILPACASLAALD  571

Query  566  -GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             G E  G+   +   E   +T        +VDM  + G +  A    + +P   D   W 
Sbjct  572  KGREIHGYALRNGYSEDKYVTN------AVVDMYVKCGLLVLARSLFDMIP-NKDLVSWT  624

Query  743  ALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYA--DQGRWDEVEKLRQLM  913
             ++AG     +GS  I+     ++  ++P   S+   +S LYA    G  DE  K+  +M
Sbjct  625  VMIAGYGMHGYGSEAINTFNQMRMTGIEPDEVSF---ISILYACSHSGLLDEGWKIFNIM  681


 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 141/298 (47%), Gaps = 7/298 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     VV +L+  Y     +  ++ LFD L+ +D+I+W++MIS Y ++      + 
Sbjct  279  KLGFNSYNTVVNSLISFYFVGRKVRCAQKLFDELTDRDVISWNSMISGYVKNGLDDRGIE  338

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAF-LASGLIDMY  358
            +F +M +     +     ++  AC+++    +G+ +H+  +K           + L+DMY
Sbjct  339  IFIKMLVFGVDIDLATMVNVFVACANIGTLLLGKVLHSYSIKAATLDREVRFNNTLLDMY  398

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             K G ++    +F+   +K ++ W+SMI GY   G  + A++ F +M S G+ P+     
Sbjct  399  SKCGDLNSAIRVFERMDEKTVVSWTSMITGYVREGLSDGAIKLFDEMKSRGVVPDVYAVT  458

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            S+L+AC+  G    G      + E    T      A + DM ++ G++++A +  + M  
Sbjct  459  SILNACAINGNLKSGKIVHDYIRENNLETNSFVSNA-LTDMYAKCGSMKDAHDVFSHMK-  516

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL---SNLYA-DQGR  880
            + D   W  ++ G  K    +E   L A+      P   +   IL   ++L A D+GR
Sbjct  517  KKDVISWNTMIGGYTKNSLPNEALTLFAEMQRESKPDGTTVACILPACASLAALDKGR  574



>ref|XP_009600379.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 
[Nicotiana tomentosiformis]
Length=508

 Score =   276 bits (706),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 133/324 (41%), Positives = 201/324 (62%), Gaps = 3/324 (1%)
 Frame = +2

Query  14   LKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRR  193
            +K +P   +L+  YA  GN+E +  LF ++  +++I+W+AMIS Y+Q+ + +NALAV++ 
Sbjct  145  MKDVPTWNSLIAGYAKNGNVEEAFKLFSAMPSRNVISWTAMISGYSQNGKYANALAVYKE  204

Query  194  MQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFG  370
            M+ + G KPNE    S+L AC+++ A +VGE I       GY  N F+ + +++MY K G
Sbjct  205  MERDRGVKPNEVTIASVLPACANLGALEVGEKIEAYARANGYFKNMFVCNAVVEMYMKCG  264

Query  371  RIHQGKTIFDE-NPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVL  547
            RI +   +F E    ++L  W++MI G  ++G G+EAL+ F  ML  G  P+DV F+  +
Sbjct  265  RIDRAMQLFHEIGRRRNLCSWNTMIMGLAVHGKGDEALKLFDQMLGEGNAPDDVTFVGAI  324

Query  548  SACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPD  727
             AC+H G+  +GW     ME+++ I PKL HY CMVD+L R G ++EA + +  MP+ PD
Sbjct  325  LACTHGGMVAKGWELLSLMEQRFSIAPKLEHYGCMVDLLGRAGKLQEAYDLIQSMPMRPD  384

Query  728  KRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQ  907
              IWG LL  C   HG+ E++E  A+ L  L+P N   YVILSN+YA  GRWD V +LR+
Sbjct  385  SVIWGTLLGAC-SFHGNVELAEKAAEFLSVLEPWNPGNYVILSNIYARAGRWDGVARLRK  443

Query  908  LMDGKKRKKGMGYSVVEVNNSMHR  979
            LM   +  K  GYS +E    +H+
Sbjct  444  LMKSSQITKAAGYSFIEEGGDIHK  467


 Score = 98.6 bits (244),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 130/291 (45%), Gaps = 52/291 (18%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            ++T L+++     NI  +  +FD++ +  +  ++ +I AY+    PS   +++ +M+ + 
Sbjct  22   LITKLIEI----PNIPYAHKVFDNIPRPAVFLYNKLIQAYSSHGLPSQCFSLYIQMRRQG  77

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
              PN  +F  L  AC++ ++   G+  H   +K G+  + +  + L+DMY K G +   +
Sbjct  78   CSPNPHSFTFLFAACTNRSSPIQGQMFHVHFVKWGFKFDIYALTALVDMYAKMGLLPAAR  137

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLS---------------------  505
             +FDE   KD+  W+S+I GY  NG+  EA + F  M S                     
Sbjct  138  KLFDEMEMKDVPTWNSLIAGYAKNGNVEEAFKLFSAMPSRNVISWTAMISGYSQNGKYAN  197

Query  506  -----------HGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHY---  643
                        G++PN+V   SVL AC++ G    G        EK +   +   Y   
Sbjct  198  ALAVYKEMERDRGVKPNEVTIASVLPACANLGALEVG--------EKIEAYARANGYFKN  249

Query  644  --AC--MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSE  784
               C  +V+M  + G ++ A++  +++    +   W  ++ G    HG  +
Sbjct  250  MFVCNAVVEMYMKCGRIDRAMQLFHEIGRRRNLCSWNTMIMGL-AVHGKGD  299


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 87/202 (43%), Gaps = 12/202 (6%)
 Frame = +2

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            + IH   ++ G     FL + LI++      I     +FD  P   +  ++ +I  Y  +
Sbjct  5    KQIHAHTLRNGIDFTQFLITKLIEI----PNIPYAHKVFDNIPRPAVFLYNKLIQAYSSH  60

Query  461  GHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAH  640
            G  ++    ++ M   G  PN   F  + +AC++     +G   FH    K+     +  
Sbjct  61   GLPSQCFSLYIQMRRQGCSPNPHSFTFLFAACTNRSSPIQG-QMFHVHFVKWGFKFDIYA  119

Query  641  YACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISL  820
               +VDM ++ G +  A +  ++M ++ D   W +L+AG  K     E     A +L S 
Sbjct  120  LTALVDMYAKMGLLPAARKLFDEMEMK-DVPTWNSLIAGYAKNGNVEE-----AFKLFSA  173

Query  821  DPT-NASYYVILSNLYADQGRW  883
             P+ N   +  + + Y+  G++
Sbjct  174  MPSRNVISWTAMISGYSQNGKY  195



>ref|XP_008366040.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like [Malus domestica]
Length=877

 Score =   285 bits (729),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 135/311 (43%), Positives = 199/311 (64%), Gaps = 2/311 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V   L+ MYA  G++E +  +F  +  KDI++W+ MI  Y+++  P+ AL +F  M ++ 
Sbjct  442  VCNTLMDMYAKCGSMEDAHSVFSRMPAKDIVSWNTMIGGYSKNCLPNEALKLFSEM-MQK  500

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KP+     S+L AC+S+AA + G+ IH  +++ GY S   +A+ L+DMY K G +   +
Sbjct  501  SKPDSMTIASVLPACASLAALNRGQEIHGHILRNGYFSERHVANALVDMYVKCGVLVLAR  560

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD  P KDLI W+ +  GYGM+G G EA+  F +M   GI+P+ V FIS+L ACSH G
Sbjct  561  LLFDXIPVKDLISWTVIXAGYGMHGFGREAIAAFNEMRKAGIEPDSVSFISILYACSHSG  620

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  E W +F  M   Y I PKL HYACMVD+LSR GN+ +A +F+  MPIEPD  IWG+L
Sbjct  621  LXDEAWRFFDTMRNDYGIVPKLEHYACMVDLLSRTGNLTKAYKFIKTMPIEPDATIWGSL  680

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L GCR  H   +++E VA+ +  L+P N  YYV+L+N+YA+  +W+EV+ LR+ +  +  
Sbjct  681  LCGCR-IHHDVKLAEKVAEHVFELEPENTGYYVLLANIYAEAEKWEEVKMLRERITRRGL  739

Query  929  KKGMGYSVVEV  961
            KK  G S +E+
Sbjct  740  KKNPGCSWIEI  750


 Score =   120 bits (302),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 84/276 (30%), Positives = 135/276 (49%), Gaps = 4/276 (1%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            L+ MY   G++  +R +FD LS   +  W+ MI+ YA+       + +F +MQ    + N
Sbjct  143  LVFMYVKCGDLREARRVFDKLSNGKVFVWNLMINEYAKVRNFREGVYLFGKMQELGIQAN  202

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
             + F  +L+  S++     GE IH  + KLG+ S+  + + L+  Y K  RI   + +FD
Sbjct  203  SYTFSCVLKCFSALGCVREGEWIHGYLYKLGFGSDNTVGNSLMAFYFKNRRIEXARKVFD  262

Query  401  ENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYE  580
            E  D+D+I W+SMI+ Y  NG   + +E F  M+S GI  +    I+VL AC   G    
Sbjct  263  ELCDRDVISWNSMISAYVSNGLAEKGVEIFRQMVSLGIDVDLATIINVLMACVAGGNLSL  322

Query  581  GWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
            G    HA   K      +     ++DM S+ G++  A++   KM  E     W +++AG 
Sbjct  323  G-RALHAYAIKASFDEDVMFCNNVLDMYSKCGDLSSAIQVFKKMG-ERSVVSWTSMIAGH  380

Query  761  RKTHGSSEISELVAKQLISLDPTNASYYVILSNLYA  868
             +   S E   L ++  +  D  N   Y I S L+A
Sbjct  381  IREGLSDEAIGLFSE--MERDGVNPDAYTITSILHA  414


 Score =   117 bits (292),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/290 (26%), Positives = 142/290 (49%), Gaps = 14/290 (5%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+ F + +     +L MY+  G++ S+  +F  + ++ +++W++MI+ + +      A+ 
Sbjct  332  KASFDEDVMFCNNVLDMYSKCGDLSSAIQVFKKMGERSVVSWTSMIAGHIREGLSDEAIG  391

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M+ +   P+ +   S+L AC+S  +   G  IH  + + G  S+ ++ + L+DMY 
Sbjct  392  LFSEMERDGVNPDAYTITSILHACASSGSLKKGRDIHNYIKEHGMDSSLYVCNTLMDMYA  451

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +    ++F   P KD++ W++MI GY  N   NEAL+ F +M+    +P+ +   S
Sbjct  452  KCGSMEDAHSVFSRMPAKDIVSWNTMIGGYSKNCLPNEALKLFSEMMQKS-KPDSMTIAS  510

Query  542  VLSACSHC-----GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVN  706
            VL AC+       G E  G    H +   Y     +A+   +VDM  + G +  A    +
Sbjct  511  VLPACASLAALNRGQEIHG----HILRNGYFSERHVAN--ALVDMYVKCGVLVLARLLFD  564

Query  707  KMPIEPDKRIWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             +P++ D   W  + AG      G   I+     +   ++P + S+  IL
Sbjct  565  XIPVK-DLISWTVIXAGYGMHGFGREAIAAFNEMRKAGIEPDSVSFISIL  613


 Score =   112 bits (279),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 139/286 (49%), Gaps = 6/286 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     V  +L+  Y     IE +R +FD L  +D+I+W++MISAY  +      + 
Sbjct  231  KLGFGSDNTVGNSLMAFYFKNRRIEXARKVFDELCDRDVISWNSMISAYVSNGLAEKGVE  290

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +FR+M       +     ++L AC +     +G  +H   +K  +  +    + ++DMY 
Sbjct  291  IFRQMVSLGIDVDLATIINVLMACVAGGNLSLGRALHAYAIKASFDEDVMFCNNVLDMYS  350

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +     +F +  ++ ++ W+SMI G+   G  +EA+  F +M   G+ P+     S
Sbjct  351  KCGDLSSAIQVFKKMGERSVVSWTSMIAGHIREGLSDEAIGLFSEMERDGVNPDAYTITS  410

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYAC--MVDMLSRQGNVEEALEFVNKMP  715
            +L AC+  G   +G +  H   +++ +   L  Y C  ++DM ++ G++E+A    ++MP
Sbjct  411  ILHACASSGSLKKGRD-IHNYIKEHGMDSSL--YVCNTLMDMYAKCGSMEDAHSVFSRMP  467

Query  716  IEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             + D   W  ++ G  K    +E  +L ++ +    P + +   +L
Sbjct  468  AK-DIVSWNTMIGGYSKNCLPNEALKLFSEMMQKSKPDSMTIASVL  512


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 60/125 (48%), Gaps = 1/125 (1%)
 Frame = +2

Query  227  AFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDEN  406
            A+ S+++ C+ M +   G+ +H+ +   G  ++  L + L+ MY K G + + + +FD+ 
Sbjct  104  AYCSVVELCAGMMSLQDGKXVHSVICDNGVEADGQLGAKLVFMYVKCGDLREARRVFDKL  163

Query  407  PDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGW  586
             +  +  W+ MIN Y    +  E +  F  M   GIQ N   F  VL   S  G   EG 
Sbjct  164  SNGKVFVWNLMINEYAKVRNFREGVYLFGKMQELGIQANSYTFSCVLKCFSALGCVREG-  222

Query  587  NWFHA  601
             W H 
Sbjct  223  EWIHG  227


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/151 (25%), Positives = 66/151 (44%), Gaps = 2/151 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++G+     V  AL+ MY   G +  +R+LFD +  KD+I+W+ + + Y        A+A
Sbjct  533  RNGYFSERHVANALVDMYVKCGVLVLARLLFDXIPVKDLISWTVIXAGYGMHGFGREAIA  592

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG-ETIHTQVMKLGYTSNAFLASGLIDMY  358
             F  M+    +P+  +F S+L ACS     D       T     G        + ++D+ 
Sbjct  593  AFNEMRKAGIEPDSVSFISILYACSHSGLXDEAWRFFDTMRNDYGIVPKLEHYACMVDLL  652

Query  359  CKFGRIHQGKTIFDENP-DKDLICWSSMING  448
             + G + +        P + D   W S++ G
Sbjct  653  SRTGNLTKAYKFIKTMPIEPDATIWGSLLCG  683



>ref|XP_002875341.1| binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51600.1| binding protein [Arabidopsis lyrata subsp. lyrata]
Length=659

 Score =   280 bits (717),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 132/328 (40%), Positives = 206/328 (63%), Gaps = 4/328 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGN--IESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNA  175
            K GF + + V   LL  YA  G   +  +R +FD +  KD +++++++S YAQS   + A
Sbjct  211  KRGFDRGVSVGNTLLDAYAKGGEGGVAVARKIFDQIVDKDRVSYNSIMSVYAQSGMSNEA  270

Query  176  LAVFRRMQLEHGKP-NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
              VFRR+  E     N     ++L A S   A  +G+ IH QV+++G   +  + + +ID
Sbjct  271  FDVFRRLIKEKVVTFNCITLSTVLLAVSHSGALRIGKCIHDQVIRMGLEDDVIVGTSIID  330

Query  353  MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVV  532
            MYCK GR+   +  FD   +K++  W++MI GYGM+GH  +ALE F  M+  G++PN + 
Sbjct  331  MYCKCGRVETARLAFDRMKNKNVRSWTAMIAGYGMHGHAAKALELFPAMIDSGVRPNYIT  390

Query  533  FISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
            F+SVL+ACSH GL   GW+WF+AM+ ++ + P L HY CMVD+L R G +++A + + KM
Sbjct  391  FVSVLAACSHAGLHDVGWHWFNAMKGRFGVEPGLEHYGCMVDLLGRAGFLQKAYDLIQKM  450

Query  713  PIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEV  892
             +EPD  IW +LLA CR  H + E++E+   +L  LDP+N  YY++LS++YAD GRW +V
Sbjct  451  KMEPDSIIWSSLLAACR-IHKNVELAEISVARLFELDPSNCGYYMLLSHIYADSGRWKDV  509

Query  893  EKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
            E++R  M  +   K  G+S++E+N  +H
Sbjct  510  ERVRMTMKNRGLVKPPGFSLLELNGEVH  537


 Score =   114 bits (284),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/259 (28%), Positives = 135/259 (52%), Gaps = 11/259 (4%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G+   I V +AL+ MY+  G +E +R +FD + +++I++W++MI  Y  +    +A+++F
Sbjct  106  GYQSDIFVSSALIVMYSTCGKLEDARKVFDEIPKRNIVSWTSMIRGYDLNGNALDAVSLF  165

Query  188  RRMQLEHGKPNEFAFH------SLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLI  349
            + + +E    +   F       S++ ACS +AA+ + E+IH+ V+K G+     + + L+
Sbjct  166  KDLLIEENDDDATMFLDSMGMVSVISACSRVAAKGLTESIHSFVIKRGFDRGVSVGNTLL  225

Query  350  DMYCKFGR--IHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQP-  520
            D Y K G   +   + IFD+  DKD + ++S+++ Y  +G  NEA + F  ++   +   
Sbjct  226  DAYAKGGEGGVAVARKIFDQIVDKDRVSYNSIMSVYAQSGMSNEAFDVFRRLIKEKVVTF  285

Query  521  NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEF  700
            N +   +VL A SH G    G    H    +  +   +     ++DM  + G VE A   
Sbjct  286  NCITLSTVLLAVSHSGALRIG-KCIHDQVIRMGLEDDVIVGTSIIDMYCKCGRVETARLA  344

Query  701  VNKMPIEPDKRIWGALLAG  757
             ++M    + R W A++AG
Sbjct  345  FDRMK-NKNVRSWTAMIAG  362


 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 90/163 (55%), Gaps = 12/163 (7%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + + D+ +W+++I+  A+S   + AL  F  M+     P   +F   ++ACSS+     G
Sbjct  36   VDKTDVFSWNSVIADLARSGDSAEALRAFSSMRKLSLYPTRSSFPCAIKACSSLLDIFSG  95

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q    GY S+ F++S LI MY   G++   + +FDE P ++++ W+SMI GY +N
Sbjct  96   KQTHQQAFVFGYQSDIFVSSALIVMYSTCGKLEDARKVFDEIPKRNIVSWTSMIRGYDLN  155

Query  461  GHGNEALECFLDMLSHGIQPND---------VVFISVLSACSH  562
            G+  +A+  F D+L   I+ ND         +  +SV+SACS 
Sbjct  156  GNALDAVSLFKDLL---IEENDDDATMFLDSMGMVSVISACSR  195



>ref|XP_007025334.1| Pentatricopeptide, putative [Theobroma cacao]
 gb|EOY27956.1| Pentatricopeptide, putative [Theobroma cacao]
Length=874

 Score =   285 bits (728),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/316 (42%), Positives = 207/316 (66%), Gaps = 2/316 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V  AL+ MYA  G++E +  +F  ++ KDII+W+ MI  Y+++  P+ AL +   M L+ 
Sbjct  439  VCNALMDMYAKCGSMEDANSIFSRMAVKDIISWNTMIGGYSKNCLPNEALKMLAAM-LKE  497

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KP+      +L AC+S+AA + G+ IH  +++ GY S+  +A+ L+D+Y K G +   +
Sbjct  498  LKPDSRTLACILPACASLAALERGKEIHGHILRNGYFSDRHVANALVDLYVKCGVLALAR  557

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD    KDL+ W+ MI GYGM+G  NEA+  F +M   GI+P++V FIS+L ACSH G
Sbjct  558  LLFDMISSKDLVSWTVMIAGYGMHGFANEAITTFNEMRDAGIEPDEVSFISILYACSHSG  617

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  EGW +F+ M   Y+I PKL HYACMVD+LSR GN+ +A  F+ +MPI PD  IWGA+
Sbjct  618  LLEEGWRFFYIMRNDYNIEPKLEHYACMVDLLSRTGNLSKAFHFIERMPIAPDATIWGAV  677

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L GCR  H   +++E VA+++  L+P N  YYV+L+N+YA+  +W+EV+++R+ +  K  
Sbjct  678  LCGCRIYH-DVKLAERVAERVFELEPENTGYYVLLANIYAEAEKWEEVKRVRERIGRKGL  736

Query  929  KKGMGYSVVEVNNSMH  976
            +K  G S +E+   ++
Sbjct  737  RKNPGCSWIEIKGKVN  752


 Score =   120 bits (302),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 73/266 (27%), Positives = 137/266 (52%), Gaps = 5/266 (2%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
            + L+  Y   G+++  R +FD + +K +  W+ M++ YA+      ++ +F+ M  +  +
Sbjct  138  SKLVSFYVTCGDLKEGRGIFDEMEKKKVFLWNYMLNEYAKFGDFKESIYLFKMMMKKGIE  197

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
             + + F  +L+  ++      GE +H  ++KLG+ S   + + LI  Y K  R+     +
Sbjct  198  VDSYTFSCILKCLAASGGLKEGERVHGYLLKLGFGSYNSVVNSLITFYFKGKRVESASEL  257

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            FDE  D+D+I W+SMI+GY  NG   + LE F +ML  GI  +    ++VL  C++ G  
Sbjct  258  FDELIDRDVISWNSMISGYVSNGLAEKGLEVFKEMLYLGIDVDLATIVTVLVGCANSGTL  317

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
              G    HA+  K     KL     ++DM S+ G+++ AL    KM  E +   W +++A
Sbjct  318  SLG-KAVHALAIKACFERKLNFNNTLLDMYSKCGDLDGALRVFEKMG-ERNVVSWTSMIA  375

Query  755  GCRK---THGSSEISELVAKQLISLD  823
            G  +   + G+  + + + ++ + LD
Sbjct  376  GYTRDGQSDGAIRLLQQMEREGVKLD  401


 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/284 (26%), Positives = 135/284 (48%), Gaps = 2/284 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     VV +L+  Y     +ES+  LFD L  +D+I+W++MIS Y  +      L 
Sbjct  228  KLGFGSYNSVVNSLITFYFKGKRVESASELFDELIDRDVISWNSMISGYVSNGLAEKGLE  287

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            VF+ M       +     ++L  C++     +G+ +H   +K  +       + L+DMY 
Sbjct  288  VFKEMLYLGIDVDLATIVTVLVGCANSGTLSLGKAVHALAIKACFERKLNFNNTLLDMYS  347

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +     +F++  +++++ W+SMI GY  +G  + A+     M   G++ + V   S
Sbjct  348  KCGDLDGALRVFEKMGERNVVSWTSMIAGYTRDGQSDGAIRLLQQMEREGVKLDVVAITS  407

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL AC+  G   E     H   +  ++   L     ++DM ++ G++E+A    ++M ++
Sbjct  408  VLHACARSG-SLENGKDVHDYIKANNVESNLFVCNALMDMYAKCGSMEDANSIFSRMAVK  466

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             D   W  ++ G  K    +E  +++A  L  L P + +   IL
Sbjct  467  -DIISWNTMIGGYSKNCLPNEALKMLAAMLKELKPDSRTLACIL  509


 Score =   108 bits (271),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 139/287 (48%), Gaps = 8/287 (3%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+ F + +     LL MY+  G+++ +  +F+ + ++++++W++MI+ Y +  Q   A+ 
Sbjct  329  KACFERKLNFNNTLLDMYSKCGDLDGALRVFEKMGERNVVSWTSMIAGYTRDGQSDGAIR  388

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            + ++M+ E  K +  A  S+L AC+   + + G+ +H  +      SN F+ + L+DMY 
Sbjct  389  LLQQMEREGVKLDVVAITSVLHACARSGSLENGKDVHDYIKANNVESNLFVCNALMDMYA  448

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +    +IF     KD+I W++MI GY  N   NEAL+    ML   ++P+      
Sbjct  449  KCGSMEDANSIFSRMAVKDIISWNTMIGGYSKNCLPNEALKMLAAMLKE-LKPDSRTLAC  507

Query  542  VLSAC-SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            +L AC S   LE       H +   Y     +A+   +VD+  + G +  A   +  M  
Sbjct  508  ILPACASLAALERGKEIHGHILRNGYFSDRHVAN--ALVDLYVKCGVLALA-RLLFDMIS  564

Query  719  EPDKRIWGALLAGCRKTHG--SSEISELVAKQLISLDPTNASYYVIL  853
              D   W  ++AG    HG  +  I+     +   ++P   S+  IL
Sbjct  565  SKDLVSWTVMIAG-YGMHGFANEAITTFNEMRDAGIEPDEVSFISIL  610


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 61/267 (23%), Positives = 117/267 (44%), Gaps = 14/267 (5%)
 Frame = +2

Query  32   VTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHG  211
             T L  +++++  I+ S     ++  + +  ++A I  + Q     NA      M+L   
Sbjct  39   TTLLSPIFSSYTPIQISATPGKTIDNQ-VTDYNARIFQFCQLGNLHNA------MELLSM  91

Query  212  KPNE----FAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIH  379
             PN       + S+LQ C+ + +   G+ +H+ +   G   +  L S L+  Y   G + 
Sbjct  92   SPNSELESKTYCSILQLCADLKSLKDGKKVHSIINSNGVAVDEVLGSKLVSFYVTCGDLK  151

Query  380  QGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACS  559
            +G+ IFDE   K +  W+ M+N Y   G   E++  F  M+  GI+ +   F  +L   +
Sbjct  152  EGRGIFDEMEKKKVFLWNYMLNEYAKFGDFKESIYLFKMMMKKGIEVDSYTFSCILKCLA  211

Query  560  HCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIW  739
              G   EG    H    K       +    ++    +   VE A E  +++ I+ D   W
Sbjct  212  ASGGLKEG-ERVHGYLLKLGFGSYNSVVNSLITFYFKGKRVESASELFDEL-IDRDVISW  269

Query  740  GALLAGCRKTHGSSEISELVAKQLISL  820
             ++++G   ++G +E    V K+++ L
Sbjct  270  NSMISG-YVSNGLAEKGLEVFKEMLYL  295


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 73/152 (48%), Gaps = 4/152 (3%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++G+     V  AL+ +Y   G +  +R+LFD +S KD+++W+ MI+ Y      + A+ 
Sbjct  530  RNGYFSDRHVANALVDLYVKCGVLALARLLFDMISSKDLVSWTVMIAGYGMHGFANEAIT  589

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLA--SGLIDM  355
             F  M+    +P+E +F S+L ACS     + G      +M+  Y     L   + ++D+
Sbjct  590  TFNEMRDAGIEPDEVSFISILYACSHSGLLEEGWRFF-YIMRNDYNIEPKLEHYACMVDL  648

Query  356  YCKFGRIHQGKTIFDENP-DKDLICWSSMING  448
              + G + +     +  P   D   W +++ G
Sbjct  649  LSRTGNLSKAFHFIERMPIAPDATIWGAVLCG  680



>ref|XP_006413827.1| hypothetical protein EUTSA_v10027143mg [Eutrema salsugineum]
 gb|ESQ55280.1| hypothetical protein EUTSA_v10027143mg [Eutrema salsugineum]
Length=595

 Score =   278 bits (711),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/326 (40%), Positives = 209/326 (64%), Gaps = 2/326 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            +SGF   I    +LL +YAN G++ S+  +FD +  KD++AW+++I+ +A++ +P+ AL 
Sbjct  149  RSGFGSLIFAQNSLLHLYANCGDVSSAYKVFDKMPVKDLVAWNSVINGFAENGKPNEALK  208

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++  M  +  KP+ F   SLL AC+ + A  +G  +H  ++K G T     ++ L+D Y 
Sbjct  209  LYTEMDSKGIKPDGFTVVSLLSACAKIGALTLGRRVHVYMIKAGLTRKLHSSNVLLDFYS  268

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLS-HGIQPNDVVFI  538
            + GR+ + KT FDE  DK+ + W+S+I G  +NG G EA+E F DM S  G+ P ++ F+
Sbjct  269  RCGRVEEAKTCFDEMVDKNSVSWTSLIVGLAVNGFGKEAIELFRDMESKEGLSPCEITFV  328

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             +L ACSHCG+  +G+ +F  M E+Y I P++ H+ CMVD+L+R G V++A E++ KMP+
Sbjct  329  GILYACSHCGMVEQGFEYFRRMREEYKIEPRIEHFGCMVDLLARAGQVKKAYEYIMKMPM  388

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
            +P+  IW  LL  C   HG SE++E    Q++ L+P ++  YV+LSN+YA + RW +V+K
Sbjct  389  QPNVVIWRTLLGAC-TVHGDSELAEFARIQILQLEPNHSGDYVLLSNMYASEQRWSDVQK  447

Query  899  LRQLMDGKKRKKGMGYSVVEVNNSMH  976
            +R+ M     +K  G S+VEV N +H
Sbjct  448  IRRQMLRDGVRKVPGQSLVEVGNRVH  473


 Score =   128 bits (322),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 71/216 (33%), Positives = 121/216 (56%), Gaps = 3/216 (1%)
 Frame = +2

Query  113  DIIAWSAMISAYAQSDQPSNALAVFRRMQLE-HGKPNEFAFHSLLQACSSMAAQDVGETI  289
            ++  W+ +I  YA+     +A++++R M++    +P+   +  LL+A + MA   +GETI
Sbjct  84   NVFIWNTLIRGYAEIGDSVSAVSLYREMRVSGFVEPDTHTYPFLLKAVAKMADARLGETI  143

Query  290  HTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHG  469
            H+ V++ G+ S  F  + L+ +Y   G +     +FD+ P KDL+ W+S+ING+  NG  
Sbjct  144  HSVVIRSGFGSLIFAQNSLLHLYANCGDVSSAYKVFDKMPVKDLVAWNSVINGFAENGKP  203

Query  470  NEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYAC  649
            NEAL+ + +M S GI+P+    +S+LSAC+  G    G    H    K  +T KL     
Sbjct  204  NEALKLYTEMDSKGIKPDGFTVVSLLSACAKIGALTLG-RRVHVYMIKAGLTRKLHSSNV  262

Query  650  MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            ++D  SR G VEEA    ++M ++ +   W +L+ G
Sbjct  263  LLDFYSRCGRVEEAKTCFDEM-VDKNSVSWTSLIVG  297



>ref|XP_006658490.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial-like, partial [Oryza brachyantha]
Length=576

 Score =   278 bits (710),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 131/329 (40%), Positives = 210/329 (64%), Gaps = 6/329 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFG--NIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNA  175
            K G  +   VV  +L  YA  G  ++E++R +FD++ ++D+++W++MI+ YAQ+   + A
Sbjct  128  KIGLERNAGVVNTMLDSYAKGGHHDLEAARKVFDTM-ERDVVSWNSMIALYAQNGMSAEA  186

Query  176  LAVFRRMQLEHG--KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLI  349
            + ++  M    G  + N     ++L AC+       G+ +H QV+++G   N ++ + L+
Sbjct  187  IGLYSEMLNVGGGIRCNAVVLSAVLLACAHAGTIQTGKRVHNQVVRMGLEENVYVGTSLV  246

Query  350  DMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDV  529
            DMY K GR+      F +  +K+++ WS+MI GYGM+GHG EALE F +M   G++PN +
Sbjct  247  DMYSKCGRVEMANKAFRKIKEKNILSWSAMITGYGMHGHGQEALEVFAEMKRSGLRPNYI  306

Query  530  VFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNK  709
             FISVL+ACSH GL  EG +W+ AM++++ I P + HY CMVD+L R G ++EA   + +
Sbjct  307  TFISVLAACSHAGLLDEGRHWYSAMKQEFGIEPGVEHYGCMVDLLGRAGCLDEAYGLIKE  366

Query  710  MPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDE  889
            M ++PD  +WGALL+ CR  H + E++E+  K+L  LD TN+ YYV+LSN+YAD G W +
Sbjct  367  MKVKPDAALWGALLSSCR-IHKNVELAEICVKRLFELDATNSGYYVLLSNIYADAGMWKD  425

Query  890  VEKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
            VE++R L+  +  +K  GYS VE+    H
Sbjct  426  VERIRLLVKTRGIEKPPGYSSVELKGKTH  454


 Score = 92.8 bits (229),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 135/293 (46%), Gaps = 11/293 (4%)
 Frame = +2

Query  2    KSGFLKCIPV-VTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNAL  178
            +SG     P   +ALL MY +      +R  FD +   + +  +AM S Y +++   ++L
Sbjct  24   RSGLFPSDPYSASALLHMYHHCSRPMDARRAFDEIPDPNPVTVTAMASGYLRNNLVYHSL  83

Query  179  AVFRRM--QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
             +FR M   +     +E A      A + +  + V  ++H  + K+G   NA + + ++D
Sbjct  84   DLFRAMITSVSVSVVDEAAALVAFSASARLPDRGVTASLHALIAKIGLERNAGVVNTMLD  143

Query  353  MYCKFGR--IHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLS--HGIQP  520
             Y K G   +   + +FD   ++D++ W+SMI  Y  NG   EA+  + +ML+   GI+ 
Sbjct  144  SYAKGGHHDLEAARKVFD-TMERDVVSWNSMIALYAQNGMSAEAIGLYSEMLNVGGGIRC  202

Query  521  NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEF  700
            N VV  +VL AC+H G    G    H    +  +   +     +VDM S+ G VE A + 
Sbjct  203  NAVVLSAVLLACAHAGTIQTG-KRVHNQVVRMGLEENVYVGTSLVDMYSKCGRVEMANKA  261

Query  701  VNKMPIEPDKRIWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVILS  856
              K+  E +   W A++ G     HG   +      +   L P   ++  +L+
Sbjct  262  FRKIK-EKNILSWSAMITGYGMHGHGQEALEVFAEMKRSGLRPNYITFISVLA  313



>gb|AHB18405.1| pentatricopeptide repeat-containing protein [Gossypium hirsutum]
Length=875

 Score =   284 bits (727),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 211/316 (67%), Gaps = 2/316 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V  AL+ MYA  G++E +  +F ++  KDII+W+ M+  Y+++  P+ AL  F  M L+ 
Sbjct  439  VCNALMDMYAKCGSMEGANSVFSTMVVKDIISWNTMVGGYSKNCLPNEALKTFAAM-LKE  497

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KP+      +L AC+S++A + G+ IH  +++ GY+S+  +A+ L+D+Y K G +   +
Sbjct  498  LKPDSRTMACILPACASLSALERGKEIHGYILRNGYSSDRHVANALVDLYVKCGVLGLAR  557

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD  P KDL+ W+ MI GYGM+G+GNEA+  F +M   GI+P++V FIS+L ACSH G
Sbjct  558  LLFDMIPSKDLVSWTVMIAGYGMHGYGNEAIATFNEMRDAGIEPDEVSFISILYACSHSG  617

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  +GW +F+ M+  ++I PKL HYACMVD+LSR GN+ +A +F+  +PI PD  IWGAL
Sbjct  618  LLEQGWRFFYIMKNDFNIEPKLEHYACMVDLLSRTGNLSKAYKFIETLPIAPDATIWGAL  677

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L GCR  H   E++E VA+++  L+P N  YYV+L+N+YA+  + +EV+++R+ +  K  
Sbjct  678  LCGCRIYH-DIELAEKVAERVFELEPENTGYYVLLANIYAEAEKREEVKRMREKIGKKGL  736

Query  929  KKGMGYSVVEVNNSMH  976
            +K  G S +E+   ++
Sbjct  737  RKNPGCSWIEIKGRVN  752


 Score =   115 bits (289),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 125/239 (52%), Gaps = 2/239 (1%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            L+  YA  G+++  R +FD++ +K++  W+ M+S YA+      ++ +F+ M  +  + N
Sbjct  140  LVSFYATCGDLKEGRRVFDTMEKKNVYLWNFMVSEYAKIGDFKESICLFKIMVEKGIEVN  199

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
             + F  +L+  +++ +   GE +H  ++KLG+ S   + + LI  Y K  R      +FD
Sbjct  200  SYTFSCVLKCFAALGSLKEGECVHGYLLKLGFGSCNSVVNSLIAFYFKGKRPESASELFD  259

Query  401  ENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYE  580
            +  D+D+I W+SMI+GY  NG     L  +  M+  GI  +    ISVL  C++ G    
Sbjct  260  KLCDRDVISWNSMISGYVSNGLTERGLGIYKQMMYLGIDVDLATIISVLVGCANSGTLSL  319

Query  581  GWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            G    H++  K     ++     ++DM S+ G+++ AL    KM  E +   W +++AG
Sbjct  320  G-KAVHSLAIKSSFERRINFSNTLLDMYSKCGDLDGALRVFEKMG-ERNVVSWTSMIAG  376


 Score =   112 bits (281),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/290 (26%), Positives = 141/290 (49%), Gaps = 14/290 (5%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            KS F + I     LL MY+  G+++ +  +F+ + ++++++W++MI+ Y +      A+ 
Sbjct  329  KSSFERRINFSNTLLDMYSKCGDLDGALRVFEKMGERNVVSWTSMIAGYTRDGWSDGAII  388

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            + ++M+ E  K +  A  S+L AC+   + D G+ +H  +      SN F+ + L+DMY 
Sbjct  389  LLQQMEKEGVKLDVVAITSILHACARSGSLDNGKDVHDYIKANNMASNLFVCNALMDMYA  448

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +    ++F     KD+I W++M+ GY  N   NEAL+ F  ML   ++P+      
Sbjct  449  KCGSMEGANSVFSTMVVKDIISWNTMVGGYSKNCLPNEALKTFAAMLKE-LKPDSRTMAC  507

Query  542  VLSACSHC-----GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVN  706
            +L AC+       G E  G+     +   Y     +A+   +VD+  + G +  A    +
Sbjct  508  ILPACASLSALERGKEIHGY----ILRNGYSSDRHVAN--ALVDLYVKCGVLGLARLLFD  561

Query  707  KMPIEPDKRIWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             +P   D   W  ++AG     +G+  I+     +   ++P   S+  IL
Sbjct  562  MIP-SKDLVSWTVMIAGYGMHGYGNEAIATFNEMRDAGIEPDEVSFISIL  610


 Score =   108 bits (271),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 135/284 (48%), Gaps = 2/284 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF  C  VV +L+  Y      ES+  LFD L  +D+I+W++MIS Y  +      L 
Sbjct  228  KLGFGSCNSVVNSLIAFYFKGKRPESASELFDKLCDRDVISWNSMISGYVSNGLTERGLG  287

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++++M       +     S+L  C++     +G+ +H+  +K  +      ++ L+DMY 
Sbjct  288  IYKQMMYLGIDVDLATIISVLVGCANSGTLSLGKAVHSLAIKSSFERRINFSNTLLDMYS  347

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +     +F++  +++++ W+SMI GY  +G  + A+     M   G++ + V   S
Sbjct  348  KCGDLDGALRVFEKMGERNVVSWTSMIAGYTRDGWSDGAIILLQQMEKEGVKLDVVAITS  407

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L AC+  G    G +  H   +  ++   L     ++DM ++ G++E A    + M ++
Sbjct  408  ILHACARSGSLDNGKD-VHDYIKANNMASNLFVCNALMDMYAKCGSMEGANSVFSTMVVK  466

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             D   W  ++ G  K    +E  +  A  L  L P + +   IL
Sbjct  467  -DIISWNTMVGGYSKNCLPNEALKTFAAMLKELKPDSRTMACIL  509


 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +2

Query  227  AFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDEN  406
             + S+LQ C+ + +   G+ +H+ +       +  L   L+  Y   G + +G+ +FD  
Sbjct  101  TYGSVLQLCAGLKSLTDGKKVHSIIKSNSVGVDEALGLKLVSFYATCGDLKEGRRVFDTM  160

Query  407  PDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEG  583
              K++  W+ M++ Y   G   E++  F  M+  GI+ N   F  VL   +  G   EG
Sbjct  161  EKKNVYLWNFMVSEYAKIGDFKESICLFKIMVEKGIEVNSYTFSCVLKCFAALGSLKEG  219



>ref|XP_008791994.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Phoenix dactylifera]
Length=629

 Score =   279 bits (713),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 131/312 (42%), Positives = 193/312 (62%), Gaps = 1/312 (0%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            ++  Y   G +E +R LFDS+ +  I++W+A+I+ Y Q   P  A+ +F  M+    + N
Sbjct  197  MITQYTKVGEMEIARELFDSMPESSILSWTALIAGYVQCRNPREAIRLFHEMEAAGMRSN  256

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
            E    ++L AC+ + A D+G  +H    + G+  N  + + LIDMY K G +   + +FD
Sbjct  257  EVTVVAVLAACADLGALDLGRRVHEYSDQCGFQKNIRVCNTLIDMYIKCGCVEIARRVFD  316

Query  401  ENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYE  580
                + ++ WS+MI G+ M+G G EALE F  M   GIQPN V F+ +L ACSH GL  E
Sbjct  317  GMEVRSVVSWSAMIGGHAMHGQGEEALELFSRMTQAGIQPNAVTFVGLLHACSHMGLLEE  376

Query  581  GWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
            G  +F +M   Y ITP++ HY CMVD+LSR G +EEA EF++ MP+EP+  +WGALL G 
Sbjct  377  GRRFFASMTRDYGITPEIEHYGCMVDLLSRAGLLEEAHEFISNMPVEPNSVVWGALLGGA  436

Query  761  RKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKKGM  940
            R  H S E+ E   + L  LDP N  YYV+LSN+YAD GRW++V ++R+LM  +  KK  
Sbjct  437  R-VHKSIEMGEEAIRHLSVLDPLNDGYYVVLSNIYADAGRWEDVARMRRLMRDRGVKKTP  495

Query  941  GYSVVEVNNSMH  976
            G+S V ++ ++H
Sbjct  496  GWSTVALDGAVH  507


 Score = 94.4 bits (233),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 133/300 (44%), Gaps = 35/300 (12%)
 Frame = +2

Query  86   ILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMA  265
            I   +  Q + + W+  +++ A S  P +ALA+F R++      + F    +L+ACS ++
Sbjct  80   IFHRAAHQPETVLWNTHLNSLASSASPVDALALFARLRCSDIALDTFTLSFVLKACSKLS  139

Query  266  AQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMIN  445
            A  +G  +H  V KLG+ S+ FL + ++ MY   G +   + +FD+ P +D++ W+ MI 
Sbjct  140  ALPLGRAVHGLVEKLGFHSDLFLLNTVLHMYASCGEMDVARLLFDKMPMRDVVTWNIMIT  199

Query  446  GYGMNG-------------------------------HGNEALECFLDMLSHGIQPNDVV  532
             Y   G                               +  EA+  F +M + G++ N+V 
Sbjct  200  QYTKVGEMEIARELFDSMPESSILSWTALIAGYVQCRNPREAIRLFHEMEAAGMRSNEVT  259

Query  533  FISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
             ++VL+AC+  G    G    H   ++      +     ++DM  + G VE A    + M
Sbjct  260  VVAVLAACADLGALDLG-RRVHEYSDQCGFQKNIRVCNTLIDMYIKCGCVEIARRVFDGM  318

Query  713  PIEPDKRIWGALLAGCRKTHGSSEIS-ELVAKQLISLDPTNASYYVILSNLYADQGRWDE  889
             +      W A++ G    HG  E + EL ++   +    NA  +V L +  +  G  +E
Sbjct  319  EVR-SVVSWSAMIGG-HAMHGQGEEALELFSRMTQAGIQPNAVTFVGLLHACSHMGLLEE  376


 Score = 74.7 bits (182),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/177 (28%), Positives = 81/177 (46%), Gaps = 7/177 (4%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            + GF K I V   L+ MY   G +E +R +FD +  + +++WSAMI  +A   Q   AL 
Sbjct  285  QCGFQKNIRVCNTLIDMYIKCGCVEIARRVFDGMEVRSVVSWSAMIGGHAMHGQGEEALE  344

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMK-LGYTSNAFLASGLIDMY  358
            +F RM     +PN   F  LL ACS M   + G      + +  G T        ++D+ 
Sbjct  345  LFSRMTQAGIQPNAVTFVGLLHACSHMGLLEEGRRFFASMTRDYGITPEIEHYGCMVDLL  404

Query  359  CKFGRIHQGKTIFDENP-DKDLICWSSMINGYGMNGH---GNEALE--CFLDMLSHG  511
             + G + +        P + + + W +++ G  ++     G EA+     LD L+ G
Sbjct  405  SRAGLLEEAHEFISNMPVEPNSVVWGALLGGARVHKSIEMGEEAIRHLSVLDPLNDG  461



>ref|XP_010241118.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Nelumbo nucifera]
Length=762

 Score =   282 bits (721),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 138/322 (43%), Positives = 200/322 (62%), Gaps = 5/322 (2%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            I V TA+L +YA  G I+ +R +F  + +KD++ W+AMI  Y Q+ +P  A+ +FR MQ 
Sbjct  320  ISVSTAVLNLYAKLGRIDDARKVFYEIPEKDLVTWNAMIGGYTQNQRPVEAVKLFREMQA  379

Query  203  E---HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGR  373
            E     KP+     SL+ ACS M A  +GE +HT + K G   + FLA+ L+DMY K G 
Sbjct  380  ECKDSVKPDGVTMVSLIAACSQMGAXGLGEWVHTYIEKNGVEMDVFLATALVDMYAKCGD  439

Query  374  IHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSA  553
            I +   +F   P KDL  W++MI G  M+G G +ALE F  M   G+ PND+ F+ +L+A
Sbjct  440  IDRSWHLFQGMPTKDLASWNAMIKGLAMHGQGKKALEIFSLMERTGVVPNDITFVGLLNA  499

Query  554  CSH-CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDK  730
            CSH  GL  EG   F+ M+ +Y I P+L HY C+VD+L R G + +A EFV  MPI+PDK
Sbjct  500  CSHGGGLTAEGLELFNLMQSRYSIVPRLEHYGCVVDLLGRAGRLADAYEFVRSMPIKPDK  559

Query  731  RIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQL  910
             +WGALL  CR +H + +++E   + L+ LDP++   YV+LSN+YA  G+W +V ++R  
Sbjct  560  VVWGALLGACR-SHQNVKLAEEAVRMLVELDPSHDGNYVLLSNVYASAGKWRDVSRVRAQ  618

Query  911  MDGKKRKKGMGYSVVEVNNSMH  976
            M  ++ +K  G S VEV   +H
Sbjct  619  MKXQQVQKTPGCSAVEVGGVIH  640


 Score =   122 bits (307),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/244 (27%), Positives = 132/244 (54%), Gaps = 8/244 (3%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
             ++  YA  GN+E+++ LF+ + ++++++W+A+I+ ++Q+     AL+ F +M      P
Sbjct  225  TMISAYAKAGNLETAQKLFNEMPKRNLVSWNALIAGFSQNGWNDEALSAFAQMLRSGISP  284

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAF-LASGLIDMYCKFGRIHQGKTI  394
            +     S+  A S   + D   T   +++    ++N+  +++ ++++Y K GRI   + +
Sbjct  285  DNTTILSVASAVSGAISPD--PTAVERIISFAKSTNSISVSTAVLNLYAKLGRIDDARKV  342

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSH---GIQPNDVVFISVLSACSHC  565
            F E P+KDL+ W++MI GY  N    EA++ F +M +     ++P+ V  +S+++ACS  
Sbjct  343  FYEIPEKDLVTWNAMIGGYTQNQRPVEAVKLFREMQAECKDSVKPDGVTMVSLIAACSQM  402

Query  566  GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGA  745
            G    G  W H   EK  +   +     +VDM ++ G+++ +      MP + D   W A
Sbjct  403  GAXGLG-EWVHTYIEKNGVEMDVFLATALVDMYAKCGDIDRSWHLFQGMPTK-DLASWNA  460

Query  746  LLAG  757
            ++ G
Sbjct  461  MIKG  464


 Score = 80.9 bits (198),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 69/319 (22%), Positives = 131/319 (41%), Gaps = 66/319 (21%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            +V  L+ + +  G ++ +  LF+ + + D +  ++M+  Y ++     AL  + ++  + 
Sbjct  58   LVAKLISVCSASGTMDYATRLFNYVEEPDTVLCNSMLRGYTRNGLFELALLFYVQLLGKG  117

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTS-NAFLASGLIDMYCK-------  364
             KP+ F F  +L+AC++M    +G  IH  +MK    S N F+ + L+DMY K       
Sbjct  118  FKPDHFTFPCVLKACAAMLGTSLGSQIHASLMKNACVSDNIFVLNSLLDMYFKSHQKECA  177

Query  365  ------------------------FGRIHQGKTIFDENPDKDLICWSSMIN---------  445
                                     G +   + +F E P +D+I W++MI+         
Sbjct  178  VRVFWQIDEPNSTSWNIMLAGLLNSGDLDSAQKLFVEMPQRDVISWNTMISAYAKAGNLE  237

Query  446  ----------------------GYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACS  559
                                  G+  NG  +EAL  F  ML  GI P++   +SV SA S
Sbjct  238  TAQKLFNEMPKRNLVSWNALIAGFSQNGWNDEALSAFAQMLRSGISPDNTTILSVASAVS  297

Query  560  HCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIW  739
              G           +      T  ++    ++++ ++ G +++A +   ++P E D   W
Sbjct  298  --GAISPDPTAVERIISFAKSTNSISVSTAVLNLYAKLGRIDDARKVFYEIP-EKDLVTW  354

Query  740  GALLAGCRKTHGSSEISEL  796
             A++ G  +     E  +L
Sbjct  355  NAMIGGYTQNQRPVEAVKL  373


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 68/150 (45%), Gaps = 3/150 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G    + + TAL+ MYA  G+I+ S  LF  +  KD+ +W+AMI   A   Q   AL 
Sbjct  417  KNGVEMDVFLATALVDMYAKCGDIDRSWHLFQGMPTKDLASWNAMIKGLAMHGQGKKALE  476

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLA--SGLIDM  355
            +F  M+     PN+  F  LL ACS              +M+  Y+    L     ++D+
Sbjct  477  IFSLMERTGVVPNDITFVGLLNACSHGGGLTAEGLELFNLMQSRYSIVPRLEHYGCVVDL  536

Query  356  YCKFGRIHQGKTIFDENPDK-DLICWSSMI  442
              + GR+          P K D + W +++
Sbjct  537  LGRAGRLADAYEFVRSMPIKPDKVVWGALL  566



>ref|XP_003632994.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Vitis vinifera]
Length=613

 Score =   278 bits (712),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/325 (39%), Positives = 206/325 (63%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++GF   + V   L+ MYA  G+ ES+  LF+ +++++++ W+++I+ YA + +P+ AL 
Sbjct  168  RNGFESLVFVQNTLVHMYAACGHAESAHKLFELMAERNLVTWNSVINGYALNGRPNEALT  227

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +FR M L   +P+ F   SLL AC+ + A  +G   H  ++K+G   N    + L+D+Y 
Sbjct  228  LFREMGLRGVEPDGFTMVSLLSACAELGALALGRRAHVYMVKVGLDGNLHAGNALLDLYA  287

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G I Q   +FDE  +K ++ W+S+I G  +NG G EALE F ++   G+ P+++ F+ 
Sbjct  288  KCGSIRQAHKVFDEMEEKSVVSWTSLIVGLAVNGFGKEALELFKELERKGLMPSEITFVG  347

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL ACSHCG+  EG+++F  M+E+Y I PK+ HY CMVD+L R G V++A EF+  MP++
Sbjct  348  VLYACSHCGMVDEGFDYFKRMKEEYGIVPKIEHYGCMVDLLGRAGLVKQAHEFIQNMPMQ  407

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            P+  +W  LL  C   HG   + E+   QL+ L+P ++  YV+LSNLYA + RW +V K+
Sbjct  408  PNAVVWRTLLGAC-TIHGHLALGEVARAQLLQLEPKHSGDYVLLSNLYASEQRWSDVHKV  466

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R+ M  +  KK  G+S+VE+ N +H
Sbjct  467  RRTMLREGVKKTPGHSLVELRNRLH  491


 Score =   118 bits (295),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 117/223 (52%), Gaps = 2/223 (1%)
 Frame = +2

Query  89   LFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAA  268
            +F  +   +I  W+ MI  YA+S+ P  AL ++R+M +   +P+   +  LL+A + +  
Sbjct  96   IFSQIQNPNIFTWNTMIRGYAESENPMPALELYRQMHVSCIEPDTHTYPFLLKAIAKLMD  155

Query  269  QDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMING  448
               GE +H+  ++ G+ S  F+ + L+ MY   G       +F+   +++L+ W+S+ING
Sbjct  156  VREGEKVHSIAIRNGFESLVFVQNTLVHMYAACGHAESAHKLFELMAERNLVTWNSVING  215

Query  449  YGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITP  628
            Y +NG  NEAL  F +M   G++P+    +S+LSAC+  G    G    H    K  +  
Sbjct  216  YALNGRPNEALTLFREMGLRGVEPDGFTMVSLLSACAELGALALGRRA-HVYMVKVGLDG  274

Query  629  KLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
             L     ++D+ ++ G++ +A +  ++M  E     W +L+ G
Sbjct  275  NLHAGNALLDLYAKCGSIRQAHKVFDEME-EKSVVSWTSLIVG  316



>ref|NP_001042337.2| Os01g0205200 [Oryza sativa Japonica Group]
 dbj|BAD72991.1| pentatricopeptide repeat protein -like [Oryza sativa Japonica 
Group]
 dbj|BAF04251.2| Os01g0205200 [Oryza sativa Japonica Group]
Length=658

 Score =   280 bits (715),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/325 (40%), Positives = 205/325 (63%), Gaps = 2/325 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++G  + +PV  AL++MY   G +E +R +FD +++KD I+W+ +I  Y++S+  + A  
Sbjct  214  RNGIEEVLPVANALMEMYVKCGYMEEARFIFDHVTKKDTISWNTLIGGYSRSNLANEAFT  273

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M L+  +PN      +L A +S+++ + G  +H   ++ GY  + F+A+ L+DMY 
Sbjct  274  LFNEMLLQL-RPNAVTMACILPAAASLSSLERGREMHAYAVRRGYLEDNFVANALVDMYV  332

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +   + +FD   +K+LI W+ MI GYGM+G G +A+  F  M   GIQP+   F +
Sbjct  333  KCGALLLARRLFDMLTNKNLISWTIMIAGYGMHGRGRDAIALFEQMKGSGIQPDAGSFSA  392

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L ACSH GL  EGW +F+AM  ++ I PKL HYACMVD+L   GN++EA EF+  MPIE
Sbjct  393  ILYACSHSGLRDEGWRFFNAMRNEHRIEPKLKHYACMVDLLCHTGNLKEAYEFIETMPIE  452

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD  IW +LL GCR  H + +++E VA+ +  L+P N  YYV+L+N+YA+  RW+ V KL
Sbjct  453  PDSSIWVSLLRGCR-IHRNVKLAEKVAEMVFELEPENTGYYVLLANIYAEAERWEAVRKL  511

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            +  + G+  ++  G S +EV    H
Sbjct  512  KNKVGGRGLRENTGCSWIEVRGKAH  536


 Score =   107 bits (268),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 102/186 (55%), Gaps = 1/186 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++G +    +  ALL MY+N  +  S+  +F ++ QK++++W+AMI++Y ++        
Sbjct  113  RTGLISETSLGNALLDMYSNCSDWRSTNKIFRNMEQKNVVSWTAMITSYTRAGHFDKVAG  172

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F+ M LE  +P+ FA  S L A +   +   G+++H   ++ G      +A+ L++MY 
Sbjct  173  LFQEMGLEGIRPDVFAITSALDAFAGNESLKHGKSVHGYAIRNGIEEVLPVANALMEMYV  232

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G + + + IFD    KD I W+++I GY  +   NEA   F +ML   ++PN V    
Sbjct  233  KCGYMEEARFIFDHVTKKDTISWNTLIGGYSRSNLANEAFTLFNEMLLQ-LRPNAVTMAC  291

Query  542  VLSACS  559
            +L A +
Sbjct  292  ILPAAA  297


 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 129/289 (45%), Gaps = 12/289 (4%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     V  AL+  YA    IE + ++FD + Q+DII+W+++I   A +     A+ 
Sbjct  12   KYGFGAQCAVCNALISFYAKSNRIEDALMVFDEMPQRDIISWNSIIGGCASNGLYDKAVE  71

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F RM LE  + +     S++ AC       +G  +H   ++ G  S   L + L+DMY 
Sbjct  72   LFVRMWLEGQELDSTTLLSVMPACVQSHYSFIGGVVHGYSVRTGLISETSLGNALLDMYS  131

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
                      IF     K+++ W++MI  Y   GH ++    F +M   GI+P+     S
Sbjct  132  NCSDWRSTNKIFRNMEQKNVVSWTAMITSYTRAGHFDKVAGLFQEMGLEGIRPDVFAITS  191

Query  542  VLSACS-----HCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVN  706
             L A +       G    G+   + +EE   +   L      ++M  + G +EEA  F+ 
Sbjct  192  ALDAFAGNESLKHGKSVHGYAIRNGIEEVLPVANAL------MEMYVKCGYMEEA-RFIF  244

Query  707  KMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
                + D   W  L+ G  +++ ++E   L  + L+ L P   +   IL
Sbjct  245  DHVTKKDTISWNTLIGGYSRSNLANEAFTLFNEMLLQLRPNAVTMACIL  293


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 111/254 (44%), Gaps = 11/254 (4%)
 Frame = +2

Query  278   GETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGM  457
             G  +H  ++K G+ +   + + LI  Y K  RI     +FDE P +D+I W+S+I G   
Sbjct  3     GLVVHGYLVKYGFGAQCAVCNALISFYAKSNRIEDALMVFDEMPQRDIISWNSIIGGCAS  62

Query  458   NGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLA  637
             NG  ++A+E F+ M   G + +    +SV+ AC      + G    H    +  +  + +
Sbjct  63    NGLYDKAVELFVRMWLEGQELDSTTLLSVMPACVQSHYSFIG-GVVHGYSVRTGLISETS  121

Query  638   HYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLIS  817
                 ++DM S   +     +    M  + +   W A++    +     +++ L   Q + 
Sbjct  122   LGNALLDMYSNCSDWRSTNKIFRNME-QKNVVSWTAMITSYTRAGHFDKVAGLF--QEMG  178

Query  818   LDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**R  997
             L+      + I S L A  G  +E  K  + + G   + G+   V+ V N++  M     
Sbjct  179   LEGIRPDVFAITSALDAFAG--NESLKHGKSVHGYAIRNGI-EEVLPVANALMEMYV---  232

Query  998   SEQEYIQHSRVIID  1039
              +  Y++ +R I D
Sbjct  233   -KCGYMEEARFIFD  245



>gb|KDO63496.1| hypothetical protein CISIN_1g005512mg [Citrus sinensis]
Length=693

 Score =   280 bits (717),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 197/313 (63%), Gaps = 2/313 (1%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
            A + MYA  G ++ +R  F+ +  KD+++W++MI AYAQ+D P  AL V+R+M L    P
Sbjct  282  AAMVMYARCGRMDMARRFFEGILNKDLVSWTSMIEAYAQADLPLEALEVYRQMILRRVLP  341

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            +   F  +++ACSS+A+     T+H  ++     +   L + ++D+Y K G +   + +F
Sbjct  342  DSVTFLGVIRACSSLASFQQARTVHGIIIHCFLGNQLALDTAVVDLYVKCGSLMHARKVF  401

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEY  577
            D    K++I WS+MI+GYGM+GHG EAL  F D +   I+P+ + F+SVLSACSH GL  
Sbjct  402  DRMKQKNVISWSTMISGYGMHGHGREALFLF-DQMKALIKPDHITFVSVLSACSHAGLID  460

Query  578  EGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            EGW  F++M   + + P+  HYACMVDML R G + EA EF+ +MPI PD  +WG+LL  
Sbjct  461  EGWECFNSMLRDFGVAPRPEHYACMVDMLGRAGKLNEAREFIERMPIRPDAGVWGSLLGA  520

Query  758  CRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKKG  937
            CR  H + E++E+ AK L  LD  N   YVILSN+YA  G+  E  ++R LM  +  KK 
Sbjct  521  CR-IHSNVELAEMAAKALFDLDAENPGRYVILSNIYASSGKRIEANRIRALMKRRGVKKI  579

Query  938  MGYSVVEVNNSMH  976
             G++V+E+ N +H
Sbjct  580  TGHTVIEIKNKVH  592


 Score =   115 bits (287),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 99/175 (57%), Gaps = 1/175 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQK-DIIAWSAMISAYAQSDQPSNALAVFRRMQLE  205
            +VT L+  YA+ G+I  +  LF S+S   D+  W+ MI A+  + Q   +L ++ +M+  
Sbjct  79   LVTNLVSQYASLGSISHAFSLFSSVSDSCDLFLWNVMIRAFVDNRQFDRSLQLYAQMREL  138

Query  206  HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQG  385
               P++F F  +L+AC  +   + G  +H   +  GY S+ F+ + LI MY K GR+   
Sbjct  139  DINPDKFTFPFVLKACGYLRDIEFGVKVHKDAVDSGYWSDVFVGNSLIAMYGKCGRVDVC  198

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLS  550
            + +FDE P+++++ WSS+   Y  NG   E L  F  M+  GI+PN VV ++ ++
Sbjct  199  RQLFDEMPERNVVTWSSLTGAYAQNGCYEEGLLLFKRMMDEGIRPNRVVILNAMA  253


 Score =   104 bits (260),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/285 (25%), Positives = 137/285 (48%), Gaps = 7/285 (2%)
 Frame = +2

Query  5    SGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAV  184
            SG+   + V  +L+ MY   G ++  R LFD + +++++ WS++  AYAQ+      L +
Sbjct  173  SGYWSDVFVGNSLIAMYGKCGRVDVCRQLFDEMPERNVVTWSSLTGAYAQNGCYEEGLLL  232

Query  185  FRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK  364
            F+RM  E  +PN      +L A + +      + +   V+  G   +  L +  + MY +
Sbjct  233  FKRMMDEGIRPNRVV---ILNAMACVRKVSEADDVCRVVVDNGLDLDQSLQNAAMVMYAR  289

Query  365  FGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISV  544
             GR+   +  F+   +KDL+ W+SMI  Y       EALE +  M+   + P+ V F+ V
Sbjct  290  CGRMDMARRFFEGILNKDLVSWTSMIEAYAQADLPLEALEVYRQMILRRVLPDSVTFLGV  349

Query  545  LSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEP  724
            + ACS     ++     H +     +  +LA    +VD+  + G++  A +  ++M  + 
Sbjct  350  IRACSSLA-SFQQARTVHGIIIHCFLGNQLALDTAVVDLYVKCGSLMHARKVFDRMK-QK  407

Query  725  DKRIWGALLAGCRKTHGSSEISELVAKQLISL-DPTNASYYVILS  856
            +   W  +++G    HG    +  +  Q+ +L  P + ++  +LS
Sbjct  408  NVISWSTMISG-YGMHGHGREALFLFDQMKALIKPDHITFVSVLS  451



>ref|XP_006446876.1| hypothetical protein CICLE_v10017898mg [Citrus clementina]
 gb|ESR60116.1| hypothetical protein CICLE_v10017898mg [Citrus clementina]
Length=714

 Score =   281 bits (718),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 198/313 (63%), Gaps = 2/313 (1%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
            A + MYA  G ++ +R  F+ +  KD+++W++MI AYAQ+D P  AL V+R+M L    P
Sbjct  282  AAMVMYARCGRMDMARRFFEGILNKDLVSWTSMIEAYAQADLPLEALEVYRQMILRRVLP  341

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            +   F  +++ACSS+A+     T+H  ++     +   L + ++D+Y K G +   + +F
Sbjct  342  DSVTFLGVIRACSSLASFQQARTVHGIIIHCFLGNQLALDTAVVDLYVKCGSLMYARKVF  401

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEY  577
            D    K++I WS+MI+GYGM+GHG EAL  F D +   I+P+ + F+SVLSACSH GL  
Sbjct  402  DRMKQKNVISWSTMISGYGMHGHGREALFLF-DQMKALIKPDHITFVSVLSACSHAGLID  460

Query  578  EGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            EGW  F++M   + + P+  HYACMVDML R G + EA EF+ +MPI PD  +WG+LL  
Sbjct  461  EGWECFNSMLRDFGVAPRPEHYACMVDMLGRAGKLNEAREFIERMPIRPDAGVWGSLLGA  520

Query  758  CRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKKG  937
            CR  H + E++E+ AK L  LD  N   YVILSN+YA  G+  E +++R LM  +  KK 
Sbjct  521  CR-IHSNVELAEMAAKALFDLDAENPGRYVILSNIYASSGKRIEADRIRALMKRRGVKKI  579

Query  938  MGYSVVEVNNSMH  976
             G++V+E+ N +H
Sbjct  580  TGHTVIEIKNKVH  592


 Score =   114 bits (285),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 100/175 (57%), Gaps = 1/175 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQK-DIIAWSAMISAYAQSDQPSNALAVFRRMQLE  205
            +VT L+  YA+  +I  +  LF S+S   D+  W+ MI A+  + Q   +L ++ +M+  
Sbjct  79   LVTNLVSQYASLCSISHAFSLFSSVSDSCDLFLWNVMIRAFVDNRQFDRSLQLYAQMREL  138

Query  206  HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQG  385
               P++F F  +L+AC  +   + G  +H  V+  GY S+ F+ + LI MY K GR+   
Sbjct  139  DINPDKFTFPFVLKACGYLRDIEFGVKVHKDVVDSGYWSDVFVGNSLIAMYGKCGRVDVC  198

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLS  550
            + +FDE P+++++ WSS+   Y  NG   E L  F  ++  GI+PN VV ++V++
Sbjct  199  RQLFDEMPERNVVTWSSLTGAYAQNGGYEEGLLLFKRVMDEGIRPNRVVILNVMA  253


 Score =   102 bits (255),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 70/285 (25%), Positives = 139/285 (49%), Gaps = 7/285 (2%)
 Frame = +2

Query  5    SGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAV  184
            SG+   + V  +L+ MY   G ++  R LFD + +++++ WS++  AYAQ+      L +
Sbjct  173  SGYWSDVFVGNSLIAMYGKCGRVDVCRQLFDEMPERNVVTWSSLTGAYAQNGGYEEGLLL  232

Query  185  FRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK  364
            F+R+  E  +PN     +++ AC    ++   + +   V+  G   +  L +  + MY +
Sbjct  233  FKRVMDEGIRPNRVVILNVM-ACVRKVSE--ADDVCRVVVDNGLDLDQSLQNAAMVMYAR  289

Query  365  FGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISV  544
             GR+   +  F+   +KDL+ W+SMI  Y       EALE +  M+   + P+ V F+ V
Sbjct  290  CGRMDMARRFFEGILNKDLVSWTSMIEAYAQADLPLEALEVYRQMILRRVLPDSVTFLGV  349

Query  545  LSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEP  724
            + ACS     ++     H +     +  +LA    +VD+  + G++  A +  ++M  + 
Sbjct  350  IRACSSLA-SFQQARTVHGIIIHCFLGNQLALDTAVVDLYVKCGSLMYARKVFDRMK-QK  407

Query  725  DKRIWGALLAGCRKTHGSSEISELVAKQLISL-DPTNASYYVILS  856
            +   W  +++G    HG    +  +  Q+ +L  P + ++  +LS
Sbjct  408  NVISWSTMISG-YGMHGHGREALFLFDQMKALIKPDHITFVSVLS  451



>emb|CBI30711.3| unnamed protein product [Vitis vinifera]
Length=697

 Score =   280 bits (717),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 207/312 (66%), Gaps = 1/312 (0%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            LL MY+  GN+ S+  +F+++ ++ +++W++MI+ YA+      ++ +F  M+ E   PN
Sbjct  265  LLDMYSKSGNLNSAIQVFETMGERSVVSWTSMIAGYAREGLSDMSVRLFHEMEKEDLFPN  324

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
                  +L AC+S+AA + G+ IH  +++ G++ +  +A+ L+DMY K G +   + +FD
Sbjct  325  SITMACILPACASLAALERGQEIHGHILRNGFSLDRHVANALVDMYLKCGALGLARLLFD  384

Query  401  ENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYE  580
              P+KDL+ W+ MI GYGM+G+G+EA+  F +M + GI+P++V FIS+L ACSH GL  E
Sbjct  385  MIPEKDLVSWTVMIAGYGMHGYGSEAIAAFNEMRNSGIEPDEVSFISILYACSHSGLLDE  444

Query  581  GWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
            GW +F+ M     I PK  HYAC+VD+L+R GN+ +A +F+  MPIEPD  IWGALL GC
Sbjct  445  GWGFFNMMRNNCCIEPKSEHYACIVDLLARAGNLSKAYKFIKMMPIEPDATIWGALLCGC  504

Query  761  RKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKKGM  940
            R  H   +++E VA+ +  L+P N  YYV+L+N+YA+  +W+EV+KLR+ +  +  +K  
Sbjct  505  RIYH-DVKLAEKVAEHVFELEPENTGYYVLLANIYAEAEKWEEVKKLRERIGRRGLRKNP  563

Query  941  GYSVVEVNNSMH  976
            G S +E+   +H
Sbjct  564  GCSWIEIKGKVH  575


 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 67/297 (23%), Positives = 134/297 (45%), Gaps = 27/297 (9%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL----  202
            + L+ MY   G++   R +FD ++ + +  W+ +++ YA+      +L++F+RM+     
Sbjct  140  SKLVFMYVTCGDLREGRRIFDKVANEKVFLWNLLMNGYAKIGNFRESLSLFKRMRELGIR  199

Query  203  ----------EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSN--------A  328
                      E G  +  +++S++    S    + G  +  Q++ LG  ++         
Sbjct  200  RVESARKLFDELGDRDVISWNSMISGYVSNGLSEKGLDLFEQMLLLGINTDLATMVSVEL  259

Query  329  FLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSH  508
             L + L+DMY K G ++    +F+   ++ ++ W+SMI GY   G  + ++  F +M   
Sbjct  260  TLNNCLLDMYSKSGNLNSAIQVFETMGERSVVSWTSMIAGYAREGLSDMSVRLFHEMEKE  319

Query  509  GIQPNDVVFISVLSAC-SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVE  685
             + PN +    +L AC S   LE       H +   + +   +A+   +VDM  + G + 
Sbjct  320  DLFPNSITMACILPACASLAALERGQEIHGHILRNGFSLDRHVAN--ALVDMYLKCGALG  377

Query  686  EALEFVNKMPIEPDKRIWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             A    + +P E D   W  ++AG     +GS  I+     +   ++P   S+  IL
Sbjct  378  LARLLFDMIP-EKDLVSWTVMIAGYGMHGYGSEAIAAFNEMRNSGIEPDEVSFISIL  433


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 97/215 (45%), Gaps = 26/215 (12%)
 Frame = +2

Query  188  RRMQLEHGKPNE----FAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM  355
            R M+L +  P        + S+LQ C+ + +   G  IH+ +       +  L S L+ M
Sbjct  86   RAMELINQSPKPDLELRTYCSVLQLCADLKSIQDGRRIHSIIQSNDVEVDGVLGSKLVFM  145

Query  356  YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQ------  517
            Y   G + +G+ IFD+  ++ +  W+ ++NGY   G+  E+L  F  M   GI+      
Sbjct  146  YVTCGDLREGRRIFDKVANEKVFLWNLLMNGYAKIGNFRESLSLFKRMRELGIRRVESAR  205

Query  518  -------PNDVV-FISVLSACSHCGLEYEGWNWFHAM-------EEKYDITPKLAHYACM  652
                     DV+ + S++S     GL  +G + F  M       +    ++ +L    C+
Sbjct  206  KLFDELGDRDVISWNSMISGYVSNGLSEKGLDLFEQMLLLGINTDLATMVSVELTLNNCL  265

Query  653  VDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            +DM S+ GN+  A++    M  E     W +++AG
Sbjct  266  LDMYSKSGNLNSAIQVFETMG-ERSVVSWTSMIAG  299


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++GF     V  AL+ MY   G +  +R+LFD + +KD+++W+ MI+ Y      S A+A
Sbjct  353  RNGFSLDRHVANALVDMYLKCGALGLARLLFDMIPEKDLVSWTVMIAGYGMHGYGSEAIA  412

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
             F  M+    +P+E +F S+L ACS     D G
Sbjct  413  AFNEMRNSGIEPDEVSFISILYACSHSGLLDEG  445



>emb|CBI31859.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/309 (39%), Positives = 197/309 (64%), Gaps = 1/309 (0%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
             L+ MY   GN+ ++R LFD++ ++D+I+W++MI+ Y+Q+ Q S+A+ +F+ M     KP
Sbjct  165  TLIDMYGRLGNLTAARKLFDNMPKRDVISWTSMITGYSQASQFSDAVKLFQEMMAAKVKP  224

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            ++    S+L AC+ +   DVG  +H  + + G  ++ ++ + LIDMYCK G + +   +F
Sbjct  225  DKVTVASVLSACAHLGKLDVGWAVHHYIRRHGVQADIYVGNSLIDMYCKCGMVEKALEVF  284

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEY  577
                DKD + W+S+I+G  +NG  N AL+ F  ML  G+QP    F+ +L AC+H GL  
Sbjct  285  HRMKDKDSVSWTSVISGLAVNGFANSALDLFSQMLREGVQPTHGTFVGILLACAHAGLVN  344

Query  578  EGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            +G  +F +ME  + + P + HY C+VD+LSR GN+++A EF+ KMPI PD  +W  LL+ 
Sbjct  345  KGLEYFESMESVHGLVPAMKHYGCVVDLLSRSGNIDKAYEFIKKMPIVPDVVVWRILLSA  404

Query  758  CRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKKG  937
            C K HG+  ++E+  K+L+ LDP ++  YV+LSN YA   RWD+  K+R+LM+    +K 
Sbjct  405  C-KLHGNVVLAEIATKRLLELDPCDSGNYVLLSNTYAGVDRWDDAMKMRELMEDSDVQKP  463

Query  938  MGYSVVEVN  964
             G S +EV+
Sbjct  464  SGSSSIEVD  472


 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/285 (27%), Positives = 150/285 (53%), Gaps = 3/285 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   + V  AL+ MYA  G +  ++ +FD +  +D+++W+ +I  Y+Q ++    L 
Sbjct  52   KLGFESYLFVSNALIHMYAMCGQLGFAQKMFDGMLDRDLVSWNTLICGYSQYNKYKEVLR  111

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M   + K +      ++ ACS +   +  +++   + +     + +L + LIDMY 
Sbjct  112  LFDAMTAANIKADAVTMVKIILACSHLGDWEFADSMVKYIKENNLEIDVYLGNTLIDMYG  171

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            + G +   + +FD  P +D+I W+SMI GY      ++A++ F +M++  ++P+ V   S
Sbjct  172  RLGNLTAARKLFDNMPKRDVISWTSMITGYSQASQFSDAVKLFQEMMAAKVKPDKVTVAS  231

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VLSAC+H G    GW   H +  ++ +   +     ++DM  + G VE+ALE  ++M  +
Sbjct  232  VLSACAHLGKLDVGWAVHHYI-RRHGVQADIYVGNSLIDMYCKCGMVEKALEVFHRMK-D  289

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLI-SLDPTNASYYVIL  853
             D   W ++++G      ++   +L ++ L   + PT+ ++  IL
Sbjct  290  KDSVSWTSVISGLAVNGFANSALDLFSQMLREGVQPTHGTFVGIL  334


 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 101/207 (49%), Gaps = 13/207 (6%)
 Frame = +2

Query  254  SSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWS  433
            +++ A  +  +IH   +KLG+ S  F+++ LI MY   G++   + +FD   D+DL+ W+
Sbjct  35   TNINASTISSSIHVHALKLGFESYLFVSNALIHMYAMCGQLGFAQKMFDGMLDRDLVSWN  94

Query  434  SMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAM---  604
            ++I GY       E L  F  M +  I+ + V  + ++ ACSH G     W +  +M   
Sbjct  95   TLICGYSQYNKYKEVLRLFDAMTAANIKADAVTMVKIILACSHLG----DWEFADSMVKY  150

Query  605  --EEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGS  778
              E   +I   L +   ++DM  R GN+  A +  + MP + D   W +++ G  +    
Sbjct  151  IKENNLEIDVYLGN--TLIDMYGRLGNLTAARKLFDNMP-KRDVISWTSMITGYSQASQF  207

Query  779  SEISELVAKQLIS-LDPTNASYYVILS  856
            S+  +L  + + + + P   +   +LS
Sbjct  208  SDAVKLFQEMMAAKVKPDKVTVASVLS  234



>ref|XP_008388704.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial-like [Malus domestica]
Length=803

 Score =   282 bits (722),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/325 (40%), Positives = 202/325 (62%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            + GF+  +P+ TAL+ MY   G    +R +FDS+  KD++ WSA+ISAYA ++  + A  
Sbjct  358  RHGFVMSLPLATALVDMYGKCGETRYARAVFDSVDXKDVMIWSALISAYAHANCTNEASQ  417

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F RM+    +PN+    SL+  C+ + A D+G+ +H+ + +     +  L + L+DMY 
Sbjct  418  LFARMKNSGARPNQVTMVSLISLCAEVGALDLGKWVHSYINQQRVEVDVILRTALVDMYA  477

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G I     +FDE  ++D+  W++M+ G+ M+G G +ALE F  M    ++PND+ FI 
Sbjct  478  KCGEIDMALRLFDEATNRDICMWNAMMTGFSMHGCGKQALELFEQMNREAVEPNDITFIG  537

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL ACSH GL  EG N+F  M   + + PK+ HY CMVD+L R G + EA E +  MPI+
Sbjct  538  VLHACSHAGLVAEGENFFEKMVRVHGLAPKVEHYGCMVDLLGRAGKLHEAHELIKSMPIQ  597

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            P+  +WGALLA C K H + +++E+ ++QL+ L+P N  Y +++SN+YA   RW++V  +
Sbjct  598  PNTIVWGALLAAC-KIHKNPDLAEVASRQLLXLEPRNCGYNILMSNIYAASNRWNDVAGV  656

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R+ M  +  KK  G S +EVN S+H
Sbjct  657  RKAMKDRGTKKEPGLSSIEVNGSVH  681


 Score =   147 bits (371),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 129/245 (53%), Gaps = 2/245 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            +PV TA++ MY   GN+  +R LFD L QK+I++W+AMI+ Y           +F RM  
Sbjct  264  VPVTTAMIDMYVKCGNVTYARRLFDGLGQKNIVSWTAMIAGYIHCRDLHEGAKLFNRMLA  323

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            E   PNE    SL+    S+ A ++G+ +H  +++ G+  +  LA+ L+DMY K G    
Sbjct  324  EGSFPNEITMLSLIIESGSVGAMELGKWLHAYILRHGFVMSLPLATALVDMYGKCGETRY  383

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + +FD    KD++ WS++I+ Y      NEA + F  M + G +PN V  +S++S C+ 
Sbjct  384  ARAVFDSVDXKDVMIWSALISAYAHANCTNEASQLFARMKNSGARPNQVTMVSLISLCAE  443

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             G    G  W H+   +  +   +     +VDM ++ G ++ AL   ++     D  +W 
Sbjct  444  VGALDLG-KWVHSYINQQRVEVDVILRTALVDMYAKCGEIDMALRLFDE-ATNRDICMWN  501

Query  743  ALLAG  757
            A++ G
Sbjct  502  AMMTG  506


 Score =   126 bits (317),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 146/297 (49%), Gaps = 4/297 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            KSG    + V  AL+QMY+  GN+  +R+LFD ++ +D+++WS MI +  ++     AL 
Sbjct  154  KSGLDGDVFVRNALIQMYSESGNVVLARLLFDKMTDRDVVSWSTMIRSCVRNRLFGEALD  213

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSN--AFLASGLIDM  355
            + R M     KP+E A  S++   + +A  ++G+ +H  V++ G        + + +IDM
Sbjct  214  LIREMHRVRVKPSEIAMISMVNLFAGVADIEMGKAMHVHVVRNGKHEKFGVPVTTAMIDM  273

Query  356  YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVF  535
            Y K G +   + +FD    K+++ W++MI GY      +E  + F  ML+ G  PN++  
Sbjct  274  YVKCGNVTYARRLFDGLGQKNIVSWTAMIAGYIHCRDLHEGAKLFNRMLAEGSFPNEITM  333

Query  536  ISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMP  715
            +S++      G   E   W HA   ++     L     +VDM  + G    A    + + 
Sbjct  334  LSLIIESGSVG-AMELGKWLHAYILRHGFVMSLPLATALVDMYGKCGETRYARAVFDSVD  392

Query  716  IEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWD  886
             + D  IW AL++     + ++E S+L A+   S    N    V L +L A+ G  D
Sbjct  393  XK-DVMIWSALISAYAHANCTNEASQLFARMKNSGARPNQVTMVSLISLCAEVGALD  448


 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/226 (25%), Positives = 113/226 (50%), Gaps = 13/226 (6%)
 Frame = +2

Query  134  MISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLG  313
            +I++Y +++ P+ AL ++ +M+    + + F   S+L+AC   +   +G+  H   +K G
Sbjct  97   LITSYIKNNCPAIALEIYAQMRRMDTQVDSFTIPSVLKACGQSSFAXLGKETHGFALKSG  156

Query  314  YTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFL  493
               + F+ + LI MY + G +   + +FD+  D+D++ WS+MI     N    EAL+   
Sbjct  157  LDGDVFVRNALIQMYSESGNVVLARLLFDKMTDRDVVSWSTMIRSCVRNRLFGEALDLIR  216

Query  494  DMLSHGIQPNDVVFISVLSACSHCG-LEYEGWNWFHAME----EKYDITPKLAHYACMVD  658
            +M    ++P+++  IS+++  +    +E       H +     EK+ +    A    M+D
Sbjct  217  EMHRVRVKPSEIAMISMVNLFAGVADIEMGKAMHVHVVRNGKHEKFGVPVTTA----MID  272

Query  659  MLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG---CRKTHGSSEI  787
            M  + GNV  A    + +  + +   W A++AG   CR  H  +++
Sbjct  273  MYVKCGNVTYARRLFDGLG-QKNIVSWTAMIAGYIHCRDLHEGAKL  317



>ref|XP_007159470.1| hypothetical protein PHAVU_002G240000g [Phaseolus vulgaris]
 gb|ESW31464.1| hypothetical protein PHAVU_002G240000g [Phaseolus vulgaris]
Length=618

 Score =   278 bits (711),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/313 (42%), Positives = 199/313 (64%), Gaps = 2/313 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            +PV  AL+ MYA  G +E + ++F  +  KDI++W+ MI  Y+Q+  P+ AL +F  MQ 
Sbjct  181  LPVSNALMNMYAKCGTMEEAHLIFSQIPVKDIVSWNTMIGGYSQNSLPNEALELFLDMQ-  239

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            +  KPN+     +L AC+ +AA + G  +H  +++ GY S+  +A  L+DMY K G +  
Sbjct  240  KQLKPNDITIACVLPACAGLAALEKGRELHGHILRKGYFSDLHVACALVDMYVKCGLVVL  299

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + +FD  P KD+I W+ MI GYGM+G G EA+  F  M   G +P++  F S+L ACSH
Sbjct  300  AQKLFDMIPKKDIILWTVMIAGYGMHGFGKEAVSTFEKMRIAGFEPDEACFTSILYACSH  359

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             GL  EGW +F++M  +++I PKL HYACMVD+  R GN+ +A +F+  +PI+PD  IWG
Sbjct  360  SGLLKEGWKFFNSMRSEFNIEPKLEHYACMVDLFVRSGNLSKAYKFIETIPIKPDAAIWG  419

Query  743  ALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGK  922
            ALL+GC   H   E++E VA+ +  L+P N  YYV+L+N+YA+  + +EV+KL+  +   
Sbjct  420  ALLSGC-GIHHDVELAEKVAEHIFELEPENTRYYVLLANIYAEAEKLEEVKKLQTKIGNG  478

Query  923  KRKKGMGYSVVEV  961
              KK  G S +E+
Sbjct  479  GFKKDQGCSWIEI  491


 Score =   128 bits (322),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/281 (30%), Positives = 142/281 (51%), Gaps = 20/281 (7%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
             LL MY+  G ++ +  +F  + +  I++W+++I+AY +     +A+ +F  MQ +  +P
Sbjct  85   TLLDMYSKCGYLKGATDVFVKMGETTIVSWTSIIAAYVRKGLYDDAIMLFDEMQSKGLRP  144

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            + +   S++ AC+   + D G  IH  + K     N  +++ L++MY K G + +   IF
Sbjct  145  DAYTVSSVVHACACSNSLDKGRNIHNFIKKNNMALNLPVSNALMNMYAKCGTMEEAHLIF  204

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC----  565
             + P KD++ W++MI GY  N   NEALE FLDM    ++PND+    VL AC+      
Sbjct  205  SQIPVKDIVSWNTMIGGYSQNSLPNEALELFLDMQKQ-LKPNDITIACVLPACAGLAALE  263

Query  566  -GLEYEGWNWFHAMEEKY--DITPKLAHYAC-MVDMLSRQGNVEEALEFVNKMPIEPDKR  733
             G E  G    H + + Y  D+     H AC +VDM  + G V  A +  + +P + D  
Sbjct  264  KGRELHG----HILRKGYFSDL-----HVACALVDMYVKCGLVVLAQKLFDMIP-KKDII  313

Query  734  IWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
            +W  ++AG      G   +S     ++   +P  A +  IL
Sbjct  314  LWTVMIAGYGMHGFGKEAVSTFEKMRIAGFEPDEACFTSIL  354


 Score = 94.4 bits (233),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/255 (24%), Positives = 122/255 (48%), Gaps = 2/255 (1%)
 Frame = +2

Query  89   LFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAA  268
            +FD LS  D+++W++MIS    + +  N L  F +M       +     ++L AC+++  
Sbjct  1    MFDELSDPDVVSWNSMISGCVMNGRSWNGLKFFIQMLHFGIDMDLVTLVNVLVACANVGK  60

Query  269  QDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMING  448
              +G  +H   +K G + +    + L+DMY K G +     +F +  +  ++ W+S+I  
Sbjct  61   LSLGRALHACGVKTGCSGDVVFDNTLLDMYSKCGYLKGATDVFVKMGETTIVSWTSIIAA  120

Query  449  YGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITP  628
            Y   G  ++A+  F +M S G++P+     SV+ AC+ C    +     H   +K ++  
Sbjct  121  YVRKGLYDDAIMLFDEMQSKGLRPDAYTVSSVVHACA-CSNSLDKGRNIHNFIKKNNMAL  179

Query  629  KLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQ  808
             L     +++M ++ G +EEA    +++P++ D   W  ++ G  +    +E  EL    
Sbjct  180  NLPVSNALMNMYAKCGTMEEAHLIFSQIPVK-DIVSWNTMIGGYSQNSLPNEALELFLDM  238

Query  809  LISLDPTNASYYVIL  853
               L P + +   +L
Sbjct  239  QKQLKPNDITIACVL  253


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 76/156 (49%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            + G+   + V  AL+ MY   G +  ++ LFD + +KDII W+ MI+ Y        A++
Sbjct  274  RKGYFSDLHVACALVDMYVKCGLVVLAQKLFDMIPKKDIILWTVMIAGYGMHGFGKEAVS  333

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLA--SGLIDM  355
             F +M++   +P+E  F S+L ACS       G       M+  +     L   + ++D+
Sbjct  334  TFEKMRIAGFEPDEACFTSILYACSHSGLLKEGWKFFNS-MRSEFNIEPKLEHYACMVDL  392

Query  356  YCKFGRIHQGKTIFDENPDK-DLICWSSMINGYGMN  460
            + + G + +     +  P K D   W ++++G G++
Sbjct  393  FVRSGNLSKAYKFIETIPIKPDAAIWGALLSGCGIH  428



>ref|XP_008777053.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790-like 
[Phoenix dactylifera]
 ref|XP_008777054.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790-like 
[Phoenix dactylifera]
Length=535

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/318 (39%), Positives = 204/318 (64%), Gaps = 1/318 (0%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V  AL+ MY+  G+++ +R++FD +S++D+++W++MIS YA +   +  L  FR MQ   
Sbjct  166  VGAALVDMYSKCGDVDDARLVFDKMSKRDLVSWTSMISGYAHNGCSTETLEFFRLMQQSD  225

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             K N  +  S L AC  + A   GE  H  V+K G   +  +A+ ++DMY K G +   +
Sbjct  226  VKSNRVSLLSALLACGHLGALRRGECFHCYVIKTGLEPDILVATAVVDMYAKCGSLDLAR  285

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +F+   +KD++CWS+MI  YG +G G +A+  F  M+   ++PN   F S+LSACSH G
Sbjct  286  LVFELADEKDVVCWSAMIASYGYHGLGKDAIAVFDQMVEARVKPNHATFTSLLSACSHSG  345

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  EG  +FH+M + + + PKL+HYACMVD+L R G + EA   +  MP++PD  +WG+L
Sbjct  346  LLEEGERYFHSMNDTFGVEPKLSHYACMVDILGRAGKLYEAQVLIEHMPMDPDSSLWGSL  405

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L  C + +G  +++E +A ++  L+  ++ YYV+LSN+YA + RW +VE++R+LM G+K 
Sbjct  406  LGAC-QIYGDLDLAERIADRIFELNTNHSGYYVLLSNIYAAKSRWSDVERVRKLMVGRKV  464

Query  929  KKGMGYSVVEVNNSMHRM  982
             K  G+S++E++N +++ 
Sbjct  465  SKVQGFSMIELDNQVYKF  482


 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/270 (28%), Positives = 137/270 (51%), Gaps = 5/270 (2%)
 Frame = +2

Query  53   YANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAF  232
            Y +FG ++ + +LF S+       W+ ++ + A   +  ++L ++  +     +P +F F
Sbjct  73   YLSFGLLDFAFLLFRSIPNPSTYLWNILMRSCATHARFHHSLHLYSNLLSSGLRPGKFTF  132

Query  233  HSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPD  412
               L++C+++A   +G  +H  V+  G   + F+ + L+DMY K G +   + +FD+   
Sbjct  133  PFALKSCAALADLQLGRQLHHHVICFGCADDLFVGAALVDMYSKCGDVDDARLVFDKMSK  192

Query  413  KDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNW  592
            +DL+ W+SMI+GY  NG   E LE F  M    ++ N V  +S L AC H G    G   
Sbjct  193  RDLVSWTSMISGYAHNGCSTETLEFFRLMQQSDVKSNRVSLLSALLACGHLGALRRG-EC  251

Query  593  FHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTH  772
            FH    K  + P +     +VDM ++ G+++ A   V ++  E D   W A++A     H
Sbjct  252  FHCYVIKTGLEPDILVATAVVDMYAKCGSLDLA-RLVFELADEKDVVCWSAMIAS-YGYH  309

Query  773  GSSEISELVAKQLIS--LDPTNASYYVILS  856
            G  + +  V  Q++   + P +A++  +LS
Sbjct  310  GLGKDAIAVFDQMVEARVKPNHATFTSLLS  339


 Score = 81.6 bits (200),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 82/156 (53%), Gaps = 2/156 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G    I V TA++ MYA  G+++ +R++F+   +KD++ WSAMI++Y       +A+A
Sbjct  258  KTGLEPDILVATAVVDMYAKCGSLDLARLVFELADEKDVVCWSAMIASYGYHGLGKDAIA  317

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGET-IHTQVMKLGYTSNAFLASGLIDMY  358
            VF +M     KPN   F SLL ACS     + GE   H+     G        + ++D+ 
Sbjct  318  VFDQMVEARVKPNHATFTSLLSACSHSGLLEEGERYFHSMNDTFGVEPKLSHYACMVDIL  377

Query  359  CKFGRIHQGKTIFDENP-DKDLICWSSMINGYGMNG  463
             + G++++ + + +  P D D   W S++    + G
Sbjct  378  GRAGKLYEAQVLIEHMPMDPDSSLWGSLLGACQIYG  413



>ref|XP_006290700.1| hypothetical protein CARUB_v10016795mg [Capsella rubella]
 gb|EOA23598.1| hypothetical protein CARUB_v10016795mg [Capsella rubella]
Length=663

 Score =   279 bits (714),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/328 (39%), Positives = 206/328 (63%), Gaps = 4/328 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGN--IESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNA  175
            K GF + + V   LL  YA  G   +  +R +FD +  KD +++++++S YAQ+   + A
Sbjct  215  KRGFDRGVSVGNTLLDAYAKGGEGGVAVARKIFDQIVDKDRVSYNSIMSVYAQNGMSNEA  274

Query  176  LAVFRRMQLEHGKP-NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
              VFRR+  +     N     ++L A S   A  +G+ IH QV+++G   +  + + +ID
Sbjct  275  FEVFRRLVEDKVVTFNSITLTTVLLAASHSGALRIGKCIHDQVIRMGLEDDVIIGTSIID  334

Query  353  MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVV  532
            MYCK GR+   +  FD   +K++  W++MI GYGM+GH  +ALE F  M+  G++PN + 
Sbjct  335  MYCKCGRVETARKAFDRMKNKNVRSWTAMIAGYGMHGHAAKALELFPAMIDSGVRPNYIT  394

Query  533  FISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
            F+SVL+ACSH GL  EGW WF+AM+ ++ + P L HY CMVD+L R G +++A + +  M
Sbjct  395  FVSVLAACSHAGLHIEGWRWFNAMKGRFGVEPGLEHYGCMVDLLGRAGFLQKAYDLIQTM  454

Query  713  PIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEV  892
             ++PD  IW +LLAGCR  H + E++E+   +L  LD +N  YY++LS++YAD GRW +V
Sbjct  455  KMKPDSIIWSSLLAGCR-IHKNVELAEISVTRLFELDSSNCGYYMLLSHIYADAGRWKDV  513

Query  893  EKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
            E++R +M  +   K  G+S++E+N  +H
Sbjct  514  ERVRMIMKNRGLVKPPGFSLLELNGEVH  541


 Score =   114 bits (285),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 71/263 (27%), Positives = 135/263 (51%), Gaps = 15/263 (6%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G+   I V +AL+ MY+  G ++ +R +FD + +++I++W++MI  Y  +    +A+++F
Sbjct  106  GYQSDIFVSSALIVMYSTCGQLQDARKVFDEIPKRNIVSWTSMIRGYDLNGNALDAVSLF  165

Query  188  RRMQLEHGKPNE----------FAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLA  337
            + + +E    +               S++ ACS +AA+ + E+IH+ ++K G+     + 
Sbjct  166  KDLLVEENDGDHEDDDAMFLDFMGMVSVISACSRVAAKGLTESIHSFLIKRGFDRGVSVG  225

Query  338  SGLIDMYCKFGR--IHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHG  511
            + L+D Y K G   +   + IFD+  DKD + ++S+++ Y  NG  NEA E F  ++   
Sbjct  226  NTLLDAYAKGGEGGVAVARKIFDQIVDKDRVSYNSIMSVYAQNGMSNEAFEVFRRLVEDK  285

Query  512  IQP-NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEE  688
            +   N +   +VL A SH G    G    H    +  +   +     ++DM  + G VE 
Sbjct  286  VVTFNSITLTTVLLAASHSGALRIG-KCIHDQVIRMGLEDDVIIGTSIIDMYCKCGRVET  344

Query  689  ALEFVNKMPIEPDKRIWGALLAG  757
            A +  ++M    + R W A++AG
Sbjct  345  ARKAFDRMK-NKNVRSWTAMIAG  366


 Score =   102 bits (254),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 91/164 (55%), Gaps = 10/164 (6%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + + D+ +W+++I+  A+S   + AL  F  M+     PN  +F   ++ACSS+     G
Sbjct  36   VDKTDVFSWNSVIADLARSGDSAEALRAFSSMRKLSLYPNRSSFPCTIKACSSLLDIFSG  95

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q    GY S+ F++S LI MY   G++   + +FDE P ++++ W+SMI GY +N
Sbjct  96   KQTHQQAFVFGYQSDIFVSSALIVMYSTCGQLQDARKVFDEIPKRNIVSWTSMIRGYDLN  155

Query  461  GHGNEALECFLDMLSH----GIQPNDVVF------ISVLSACSH  562
            G+  +A+  F D+L        + +D +F      +SV+SACS 
Sbjct  156  GNALDAVSLFKDLLVEENDGDHEDDDAMFLDFMGMVSVISACSR  199



>ref|XP_010518818.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, 
chloroplastic [Tarenaya hassleriana]
Length=872

 Score =   283 bits (725),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/317 (42%), Positives = 209/317 (66%), Gaps = 2/317 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLE-  205
            V  AL+ MYA  G++E +R++F  +  KDI++W+ +I  Y+++   + AL++F  M  E 
Sbjct  435  VSNALMDMYAKCGSMEEARLVFSEMPVKDIVSWNTVIGGYSKNCFANEALSLFSAMLEEC  494

Query  206  HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQG  385
              +P+E     +L AC+S+AA D G  IH+ +M+  Y S+  +A+ L+DMY K G +   
Sbjct  495  QSRPDERTMVCVLPACASVAAFDKGREIHSYIMRNRYFSDRHVANSLVDMYAKCGALKFA  554

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC  565
            + +FD+   KDL+ W+ MI GYGM+G GNEA++ F +M   GI+P+++ F+SVL ACSH 
Sbjct  555  RLLFDDIVSKDLVSWTVMIAGYGMHGFGNEAIDMFNEMRKAGIEPDEISFVSVLYACSHS  614

Query  566  GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGA  745
            GL  EGW +F+ M  +  I P L HYACMVD+L+R GN+ +A  F+ KMPI PD  IWGA
Sbjct  615  GLLDEGWRFFNIMRHECKIEPTLEHYACMVDLLARTGNLSKAYRFIEKMPIPPDSTIWGA  674

Query  746  LLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKK  925
            LL GCR  H   +++E VA+++  L+P N  YYV+++N+YA+  +W+EV++LRQ +  + 
Sbjct  675  LLCGCR-IHHDVKLAEKVAEKVFELEPENTGYYVLMANIYAEAEKWEEVKRLRQRIGQRG  733

Query  926  RKKGMGYSVVEVNNSMH  976
             +K  G S +E+   ++
Sbjct  734  LRKNPGCSWIEIKGKVN  750


 Score =   127 bits (319),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 76/273 (28%), Positives = 136/273 (50%), Gaps = 8/273 (3%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+GF     VV +L+  Y   G +ES+R LFD ++++D+I+W++MI+ Y  +      L 
Sbjct  224  KTGFGNYNSVVNSLMASYLKNGRVESARRLFDEMTERDVISWNSMINGYISNGSAEQGLT  283

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F +M L     +     S+   C+      +G  +H   +K  +       + L+DMY 
Sbjct  284  IFVQMLLSGLNVDLATMVSVFSGCADCRFISLGRAVHCFGLKTRFACKDRFCNTLLDMYS  343

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +   K +F++  D+  + ++SMI GY   G   EA++ F +M   GI P+     +
Sbjct  344  KCGDLGSAKAVFEQMSDRSAVSYTSMIAGYAREGLAGEAVKLFSEMEKEGISPDVYTVTA  403

Query  542  VLSACSHCGLEYEGW---NWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
            VL+ C+  GL  EG    +W    +  +D+    A    ++DM ++ G++EEA    ++M
Sbjct  404  VLNCCARNGLLEEGGQVHDWIRENDMDFDLFVSNA----LMDMYAKCGSMEEARLVFSEM  459

Query  713  PIEPDKRIWGALLAGCRKTHGSSEISELVAKQL  811
            P++ D   W  ++ G  K   ++E   L +  L
Sbjct  460  PVK-DIVSWNTVIGGYSKNCFANEALSLFSAML  491


 Score =   111 bits (277),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 114/226 (50%), Gaps = 1/226 (0%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
            + L+ MY N GN+  +R +FD    +  + W+ +I+ Y ++     ++ +F++M     +
Sbjct  134  SKLVLMYVNCGNLREARRVFDLTRIEKTLFWNLLINEYVKTGDFRESIGLFKKMLNSGIE  193

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
             + + F S+ ++ S + + + GE +H  V+K G+ +   + + L+  Y K GR+   + +
Sbjct  194  TDHYTFSSISKSLSVLGSVNGGEQLHGYVLKTGFGNYNSVVNSLMASYLKNGRVESARRL  253

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            FDE  ++D+I W+SMINGY  NG   + L  F+ ML  G+  +    +SV S C+ C   
Sbjct  254  FDEMTERDVISWNSMINGYISNGSAEQGLTIFVQMLLSGLNVDLATMVSVFSGCADCRFI  313

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
              G    H    K     K      ++DM S+ G++  A     +M
Sbjct  314  SLG-RAVHCFGLKTRFACKDRFCNTLLDMYSKCGDLGSAKAVFEQM  358


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/197 (25%), Positives = 90/197 (46%), Gaps = 11/197 (6%)
 Frame = +2

Query  236  SLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDK  415
            S+LQ C+   + + G  + + +   G+  +A L S L+ MY   G + + + +FD    +
Sbjct  100  SMLQLCADSKSLNHGREVDSFIRANGFAIDANLGSKLVLMYVNCGNLREARRVFDLTRIE  159

Query  416  DLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWF  595
              + W+ +IN Y   G   E++  F  ML+ GI+ +   F S+  + S  G    G    
Sbjct  160  KTLFWNLLINEYVKTGDFRESIGLFKKMLNSGIETDHYTFSSISKSLSVLG-SVNGGEQL  218

Query  596  HAMEEKYDITPKLAHYACMVDMLS----RQGNVEEALEFVNKMPIEPDKRIWGALLAGCR  763
            H     Y +     +Y  +V+ L     + G VE A    ++M  E D   W +++ G  
Sbjct  219  HG----YVLKTGFGNYNSVVNSLMASYLKNGRVESARRLFDEMT-ERDVISWNSMING-Y  272

Query  764  KTHGSSEISELVAKQLI  814
             ++GS+E    +  Q++
Sbjct  273  ISNGSAEQGLTIFVQML  289



>dbj|BAF00431.1| hypothetical protein [Arabidopsis thaliana]
Length=659

 Score =   279 bits (713),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/328 (39%), Positives = 207/328 (63%), Gaps = 4/328 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGN--IESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNA  175
            K GF + + V   LL  YA  G   +  +R +FD +  KD +++++++S YAQS   + A
Sbjct  211  KRGFDRGVSVGNTLLDAYAKGGEGGVAVARKIFDQIVDKDRVSYNSIMSVYAQSGMSNEA  270

Query  176  LAVFRRM-QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
              VFRR+ + +    N     ++L A S   A  +G+ IH QV+++G   +  + + +ID
Sbjct  271  FEVFRRLVKNKVVTFNAITLSTVLLAVSHSGALRIGKCIHDQVIRMGLEDDVIVGTSIID  330

Query  353  MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVV  532
            MYCK GR+   +  FD   +K++  W++MI GYGM+GH  +ALE F  M+  G++PN + 
Sbjct  331  MYCKCGRVETARKAFDRMKNKNVRSWTAMIAGYGMHGHAAKALELFPAMIDSGVRPNYIT  390

Query  533  FISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
            F+SVL+ACSH GL  EGW WF+AM+ ++ + P L HY CMVD+L R G +++A + + +M
Sbjct  391  FVSVLAACSHAGLHVEGWRWFNAMKGRFGVEPGLEHYGCMVDLLGRAGFLQKAYDLIQRM  450

Query  713  PIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEV  892
             ++PD  IW +LLA CR  H + E++E+   +L  LD +N  YY++LS++YAD GRW +V
Sbjct  451  KMKPDSIIWSSLLAACR-IHKNVELAEISVARLFELDSSNCGYYMLLSHIYADAGRWKDV  509

Query  893  EKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
            E++R +M  +   K  G+S++E+N  +H
Sbjct  510  ERVRMIMKNRGLVKPPGFSLLELNGEVH  537


 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/259 (28%), Positives = 137/259 (53%), Gaps = 11/259 (4%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G+   I V +AL+ MY+  G +E +R +FD + ++DI++W++MI  Y  +    +A+++F
Sbjct  106  GYQSDIFVSSALIVMYSTCGKLEDARKVFDEIPKRDIVSWTSMIRGYDLNGNALDAVSLF  165

Query  188  RRMQLEHGKPNEFAFH------SLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLI  349
            + + ++    ++  F       S++ ACS + A+ + E+IH+ V+K G+     + + L+
Sbjct  166  KDLLVDENDDDDAMFLDSMGLVSVISACSRVPAKGLTESIHSFVIKRGFDRGVSVGNTLL  225

Query  350  DMYCKFGR--IHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQP-  520
            D Y K G   +   + IFD+  DKD + ++S+++ Y  +G  NEA E F  ++ + +   
Sbjct  226  DAYAKGGEGGVAVARKIFDQIVDKDRVSYNSIMSVYAQSGMSNEAFEVFRRLVKNKVVTF  285

Query  521  NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEF  700
            N +   +VL A SH G    G    H    +  +   +     ++DM  + G VE A + 
Sbjct  286  NAITLSTVLLAVSHSGALRIG-KCIHDQVIRMGLEDDVIVGTSIIDMYCKCGRVETARKA  344

Query  701  VNKMPIEPDKRIWGALLAG  757
             ++M    + R W A++AG
Sbjct  345  FDRMK-NKNVRSWTAMIAG  362


 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 89/160 (56%), Gaps = 6/160 (4%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + + D+ +W+++I+  A+S   + AL  F  M+     P   +F   ++ACSS+     G
Sbjct  36   VDKTDVFSWNSVIADLARSGDSAEALLAFSSMRKLSLYPTRSSFPCAIKACSSLFDIFSG  95

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q    GY S+ F++S LI MY   G++   + +FDE P +D++ W+SMI GY +N
Sbjct  96   KQTHQQAFVFGYQSDIFVSSALIVMYSTCGKLEDARKVFDEIPKRDIVSWTSMIRGYDLN  155

Query  461  GHGNEALECFLDMLSHGIQPNDVVF------ISVLSACSH  562
            G+  +A+  F D+L      +D +F      +SV+SACS 
Sbjct  156  GNALDAVSLFKDLLVDENDDDDAMFLDSMGLVSVISACSR  195



>ref|NP_001078212.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9LW32.1|PP258_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01225.1| selenium-binding protein-like [Arabidopsis thaliana]
 gb|AEE77215.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=659

 Score =   279 bits (713),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/328 (39%), Positives = 207/328 (63%), Gaps = 4/328 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGN--IESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNA  175
            K GF + + V   LL  YA  G   +  +R +FD +  KD +++++++S YAQS   + A
Sbjct  211  KRGFDRGVSVGNTLLDAYAKGGEGGVAVARKIFDQIVDKDRVSYNSIMSVYAQSGMSNEA  270

Query  176  LAVFRRM-QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
              VFRR+ + +    N     ++L A S   A  +G+ IH QV+++G   +  + + +ID
Sbjct  271  FEVFRRLVKNKVVTFNAITLSTVLLAVSHSGALRIGKCIHDQVIRMGLEDDVIVGTSIID  330

Query  353  MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVV  532
            MYCK GR+   +  FD   +K++  W++MI GYGM+GH  +ALE F  M+  G++PN + 
Sbjct  331  MYCKCGRVETARKAFDRMKNKNVRSWTAMIAGYGMHGHAAKALELFPAMIDSGVRPNYIT  390

Query  533  FISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
            F+SVL+ACSH GL  EGW WF+AM+ ++ + P L HY CMVD+L R G +++A + + +M
Sbjct  391  FVSVLAACSHAGLHVEGWRWFNAMKGRFGVEPGLEHYGCMVDLLGRAGFLQKAYDLIQRM  450

Query  713  PIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEV  892
             ++PD  IW +LLA CR  H + E++E+   +L  LD +N  YY++LS++YAD GRW +V
Sbjct  451  KMKPDSIIWSSLLAACR-IHKNVELAEISVARLFELDSSNCGYYMLLSHIYADAGRWKDV  509

Query  893  EKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
            E++R +M  +   K  G+S++E+N  +H
Sbjct  510  ERVRMIMKNRGLVKPPGFSLLELNGEVH  537


 Score =   115 bits (287),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 137/259 (53%), Gaps = 11/259 (4%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G+   I V +AL+ MY+  G +E +R +FD + +++I++W++MI  Y  +    +A+++F
Sbjct  106  GYQSDIFVSSALIVMYSTCGKLEDARKVFDEIPKRNIVSWTSMIRGYDLNGNALDAVSLF  165

Query  188  RRMQLEHGKPNEFAFH------SLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLI  349
            + + ++    ++  F       S++ ACS + A+ + E+IH+ V+K G+     + + L+
Sbjct  166  KDLLVDENDDDDAMFLDSMGLVSVISACSRVPAKGLTESIHSFVIKRGFDRGVSVGNTLL  225

Query  350  DMYCKFGR--IHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQP-  520
            D Y K G   +   + IFD+  DKD + ++S+++ Y  +G  NEA E F  ++ + +   
Sbjct  226  DAYAKGGEGGVAVARKIFDQIVDKDRVSYNSIMSVYAQSGMSNEAFEVFRRLVKNKVVTF  285

Query  521  NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEF  700
            N +   +VL A SH G    G    H    +  +   +     ++DM  + G VE A + 
Sbjct  286  NAITLSTVLLAVSHSGALRIG-KCIHDQVIRMGLEDDVIVGTSIIDMYCKCGRVETARKA  344

Query  701  VNKMPIEPDKRIWGALLAG  757
             ++M    + R W A++AG
Sbjct  345  FDRMK-NKNVRSWTAMIAG  362


 Score =   104 bits (259),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 89/160 (56%), Gaps = 6/160 (4%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + + D+ +W+++I+  A+S   + AL  F  M+     P   +F   ++ACSS+     G
Sbjct  36   VDKTDVFSWNSVIADLARSGDSAEALLAFSSMRKLSLYPTRSSFPCAIKACSSLFDIFSG  95

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q    GY S+ F++S LI MY   G++   + +FDE P ++++ W+SMI GY +N
Sbjct  96   KQTHQQAFVFGYQSDIFVSSALIVMYSTCGKLEDARKVFDEIPKRNIVSWTSMIRGYDLN  155

Query  461  GHGNEALECFLDMLSHGIQPNDVVF------ISVLSACSH  562
            G+  +A+  F D+L      +D +F      +SV+SACS 
Sbjct  156  GNALDAVSLFKDLLVDENDDDDAMFLDSMGLVSVISACSR  195



>ref|XP_010514342.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Camelina sativa]
Length=663

 Score =   279 bits (713),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/346 (38%), Positives = 212/346 (61%), Gaps = 7/346 (2%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFG--NIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNA  175
             K GF + + V   LL  YA  G   +  +R +FD +  KD +++++++  YAQS   + A
Sbjct  215   KRGFDRGVSVGNTLLDAYAKGGEGGVAVARNIFDQIVDKDRVSYNSIMGVYAQSGMSNEA  274

Query  176   LAVFRRMQLEHGKP-NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
               VFRR+  +     N     ++L A S   A  +G+ IH QV+++G   +  + + LID
Sbjct  275   FEVFRRLVEDKVVTFNSITLSTVLLAVSHSGALRIGKCIHDQVIRMGLEDDVIIGTSLID  334

Query  353   MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVV  532
             MYCK GR+   +  FD    K++  W++MI GYGM+GH  +ALE F  M+  G++PN + 
Sbjct  335   MYCKCGRVETARKAFDRMKYKNVRSWTAMIAGYGMHGHAAKALELFPAMIDSGVKPNFIT  394

Query  533   FISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
             F+SVL+ACSH GL  EGW WF+AM+ ++ + P L HY CMVD+L R G +++A + +  M
Sbjct  395   FVSVLAACSHAGLHVEGWRWFNAMKGRFGVEPGLEHYGCMVDLLGRAGFLQKAYDLIQTM  454

Query  713   PIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEV  892
              ++PD  IW +LLAGCR  H + E++E+   +L  LD +N  YY++LS++YAD GRW +V
Sbjct  455   KMKPDSIIWSSLLAGCR-IHKNVELAEISVARLFELDSSNCGYYMLLSHIYADAGRWKDV  513

Query  893   EKLRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
             E++R +M  +   K  G+S++E+N  +H        ++E+ +H ++
Sbjct  514   ERVRMIMKNRGLVKPPGFSLLELNGEVHVFLI---GDEEHPEHEKI  556


 Score =   111 bits (278),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 155/318 (49%), Gaps = 21/318 (7%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G+   I V +AL+ MY+  G ++ +R +FD +  ++I++W++MI  Y  +    +A+++F
Sbjct  106  GYQSDIFVSSALIVMYSTCGQLKDARKVFDEIPSRNIVSWTSMIRGYDLNGNALDAVSLF  165

Query  188  RRMQLEHGKP----------NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLA  337
            + + +E              +     S++ ACS +AA+ + E+IH+ V+K G+     + 
Sbjct  166  KDLLVEENDGDHEGDDAMFLDSMGMVSVISACSRIAAKGLTESIHSFVVKRGFDRGVSVG  225

Query  338  SGLIDMYCKFGR--IHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHG  511
            + L+D Y K G   +   + IFD+  DKD + ++S++  Y  +G  NEA E F  ++   
Sbjct  226  NTLLDAYAKGGEGGVAVARNIFDQIVDKDRVSYNSIMGVYAQSGMSNEAFEVFRRLVEDK  285

Query  512  IQP-NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEE  688
            +   N +   +VL A SH G    G    H    +  +   +     ++DM  + G VE 
Sbjct  286  VVTFNSITLSTVLLAVSHSGALRIG-KCIHDQVIRMGLEDDVIIGTSLIDMYCKCGRVET  344

Query  689  ALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLIS-LDPTNASYYVIL----  853
            A +  ++M  + + R W A++AG      +++  EL    + S + P   ++  +L    
Sbjct  345  ARKAFDRMKYK-NVRSWTAMIAGYGMHGHAAKALELFPAMIDSGVKPNFITFVSVLAACS  403

Query  854  -SNLYADQGRWDEVEKLR  904
             + L+ +  RW    K R
Sbjct  404  HAGLHVEGWRWFNAMKGR  421


 Score = 99.4 bits (246),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 90/163 (55%), Gaps = 10/163 (6%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + + D+ +W+++I+  A+S   + AL  F  M+     P   +F   ++ACSS+     G
Sbjct  36   VDKTDVFSWNSVIADLARSGDSAEALRAFSSMRKLSLYPTRSSFPCTIKACSSLLDIFSG  95

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q    GY S+ F++S LI MY   G++   + +FDE P ++++ W+SMI GY +N
Sbjct  96   KQTHQQAFVFGYQSDIFVSSALIVMYSTCGQLKDARKVFDEIPSRNIVSWTSMIRGYDLN  155

Query  461  GHGNEALECFLDMLSH----GIQPNDVVF------ISVLSACS  559
            G+  +A+  F D+L        + +D +F      +SV+SACS
Sbjct  156  GNALDAVSLFKDLLVEENDGDHEGDDAMFLDSMGMVSVISACS  198



>emb|CDM82055.1| unnamed protein product [Triticum aestivum]
Length=629

 Score =   278 bits (710),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/340 (40%), Positives = 207/340 (61%), Gaps = 5/340 (1%)
 Frame = +2

Query  35    TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
             T+++  +   G ++ +++LFD + ++D ++W+AMI  Y Q+ Q   AL +FR MQL   +
Sbjct  195   TSVISGFVRLGQVDRAKVLFDRMPERDTVSWTAMIDGYVQAGQFREALEMFREMQLSKVR  254

Query  215   PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
              +EF   S++ AC+ + A + GE     + + G   + F+ + LIDMY K G I +   +
Sbjct  255   ADEFTMVSIVTACAQLGALETGEWARIYMNRHGINMDTFVGNALIDMYSKCGSIERALDV  314

Query  395   FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
             F+E   +D   W+++I G  +NGHG EA++ F  ML     P++V FI VL+AC+H GL 
Sbjct  315   FNEMHSRDKFTWTAVILGLAVNGHGEEAIDMFDRMLRAFEAPDEVTFIGVLTACTHAGLV  374

Query  575   YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
              +G ++F +M   Y I P + HY CM+D+L R G + EALE + KMP++P   IWG LLA
Sbjct  375   EKGRDFFLSMTVTYRIAPNVMHYGCMIDLLGRAGKLREALETIGKMPMKPSSAIWGTLLA  434

Query  755   GCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKK  934
              CR  HG+SEI EL A+ L+ LDP N+  YV+LSNLYA   RW +V  LRQ+M  K  KK
Sbjct  435   ACR-VHGNSEIGELAAEHLLELDPENSMAYVLLSNLYAKSNRWGDVRWLRQVMMEKGIKK  493

Query  935   GMGYSVVEVNNSMHRMEF**R----SEQEYIQHSRVIIDV  1042
               G S++E+N ++H      R    SE+ Y +  +V+ D+
Sbjct  494   EPGCSLIEMNGTIHEFVAGDRSHPMSEEIYSKLDKVLTDL  533


 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/311 (22%), Positives = 135/311 (43%), Gaps = 37/311 (12%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFD---SLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQ  199
            V ++L+ MYA  G+  ++R L D   +      + W+A++S + +S Q   +   F+ M 
Sbjct  58   VASSLVLMYAARGDGVTARALLDVQLARGGGTPVVWNALMSGHKRSRQFRLSCCSFQDMV  117

Query  200  LEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIH  379
                 P    + ++L AC       +G  +H ++++ G   +  + + L+DMY + G + 
Sbjct  118  RAGIVPTPVTYITVLSACGKGNDVLLGMQLHKRIIESGVLPDLKVENALVDMYAECGEME  177

Query  380  QGKTIFDENPDKDLICWSS-------------------------------MINGYGMNGH  466
                +F+    ++++ W+S                               MI+GY   G 
Sbjct  178  AAWDLFEGMQVRNIVSWTSVISGFVRLGQVDRAKVLFDRMPERDTVSWTAMIDGYVQAGQ  237

Query  467  GNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYA  646
              EALE F +M    ++ ++   +S+++AC+  G   E   W      ++ I        
Sbjct  238  FREALEMFREMQLSKVRADEFTMVSIVTACAQLG-ALETGEWARIYMNRHGINMDTFVGN  296

Query  647  CMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLD-  823
             ++DM S+ G++E AL+  N+M    DK  W A++ G        E  ++  + L + + 
Sbjct  297  ALIDMYSKCGSIERALDVFNEMH-SRDKFTWTAVILGLAVNGHGEEAIDMFDRMLRAFEA  355

Query  824  PTNASYYVILS  856
            P   ++  +L+
Sbjct  356  PDEVTFIGVLT  366


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/235 (22%), Positives = 91/235 (39%), Gaps = 47/235 (20%)
 Frame = +2

Query  176  LAVFRRMQLEHGKPNEFAFHSLLQACSS---MAAQDVGETIHTQVMKLGYTSNAFLASGL  346
            L  +  M     +P+ + F  LL+  ++     A   G+ +   V+K G   NA +AS L
Sbjct  3    LRAYVGMLARGARPDAYTFPPLLKVVAAERGAVASAAGDAVLAHVVKFGLELNAHVASSL  62

Query  347  IDMYCKFGRIHQGKTIFDENPDK---DLICWSSMINGYGMNGHGNEALECFLDMLSHGIQ  517
            + MY   G     + + D    +     + W+++++G+  +     +   F DM+  GI 
Sbjct  63   VLMYAARGDGVTARALLDVQLARGGGTPVVWNALMSGHKRSRQFRLSCCSFQDMVRAGIV  122

Query  518  PNDVVFISVLSAC-----------------------------------SHCGLEYEGWNW  592
            P  V +I+VLSAC                                   + CG     W+ 
Sbjct  123  PTPVTYITVLSACGKGNDVLLGMQLHKRIIESGVLPDLKVENALVDMYAECGEMEAAWDL  182

Query  593  FHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            F  M+ +      +  +  ++    R G V+ A    ++MP E D   W A++ G
Sbjct  183  FEGMQVR-----NIVSWTSVISGFVRLGQVDRAKVLFDRMP-ERDTVSWTAMIDG  231



>ref|XP_006433564.1| hypothetical protein CICLE_v10000630mg [Citrus clementina]
 gb|ESR46804.1| hypothetical protein CICLE_v10000630mg [Citrus clementina]
Length=609

 Score =   277 bits (708),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/324 (40%), Positives = 202/324 (62%), Gaps = 3/324 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   +PV+ ++L MY  F  +  +   FD +++KD+I W+ +I+ Y +S   S  L 
Sbjct  242  KHGFGSNLPVMNSILDMYCRFDCLSDANQYFDEMTEKDLITWNTIIAGYEKSGS-SECLN  300

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F +M+ E   PN F F S++ AC+++AA   G+ +H  +++ G   N  LA+ LIDMY 
Sbjct  301  MFSKMKSERFSPNCFTFTSIIAACATLAALSCGQQVHAGIVRRGLDGNLALANALIDMYA  360

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G I   K IF E  D+DL+ W+SM+ GYG +GHG EA+E F +M+  G++P+ +VF++
Sbjct  361  KCGNISDSKKIFSEMSDRDLVTWTSMMIGYGAHGHGKEAIELFDEMVKSGVRPDRIVFMA  420

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL+ACSH GL  EG  +F +M + Y++ P    Y C+VD+L R G V+EA E +  MP +
Sbjct  421  VLTACSHAGLVDEGLKYFKSMND-YNVNPNKEIYGCVVDLLGRAGRVKEAYELIKSMPFK  479

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD+ +WG LL  C K H    + +L A +++ L P     Y+ILSN+YA +G+W+E  K 
Sbjct  480  PDESVWGPLLGAC-KEHRLPNLGKLAALRVLDLKPNIMGTYIILSNIYAAEGKWEEFAKF  538

Query  902  RQLMDGKKRKKGMGYSVVEVNNSM  973
            R++M G   KK +G S +EV + +
Sbjct  539  RKIMRGMGSKKEVGMSWIEVRDKV  562


 Score =   128 bits (321),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 137/258 (53%), Gaps = 14/258 (5%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFG-NIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNAL  178
            K G    I V  +L+ +YA    +++++R++F+ +  K+ ++W+ +I+ YA S      L
Sbjct  140  KEGLEGSIYVENSLMDVYATCCISMDNARLVFNDMKWKNDVSWTTLITGYAHSGNGYGGL  199

Query  179  AVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VF+ M LE  + N ++F   ++AC+S      G+ IH  V+K G+ SN  + + ++DMY
Sbjct  200  GVFKEMLLEGVEMNPYSFSIAVRACASTGWVSFGKLIHAAVIKHGFGSNLPVMNSILDMY  259

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
            C+F  +      FDE  +KDLI W+++I GY  +G  +E L  F  M S    PN   F 
Sbjct  260  CRFDCLSDANQYFDEMTEKDLITWNTIIAGYEKSG-SSECLNMFSKMKSERFSPNCFTFT  318

Query  539  SVLSACS-----HCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFV  703
            S+++AC+      CG +       HA   +  +   LA    ++DM ++ GN+ ++ +  
Sbjct  319  SIIAACATLAALSCGQQ------VHAGIVRRGLDGNLALANALIDMYAKCGNISDSKKIF  372

Query  704  NKMPIEPDKRIWGALLAG  757
            ++M  + D   W +++ G
Sbjct  373  SEMS-DRDLVTWTSMMIG  389


 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/260 (28%), Positives = 129/260 (50%), Gaps = 4/260 (2%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            + T L++ Y + G IE +R LFD + ++D+++W+ MI+ Y   +  + A  VF  M    
Sbjct  48   LATNLIKSYFDEGLIEEARTLFDEMPERDVVSWTVMIAGYTSFNCHNQAWTVFVEMVRNE  107

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFG-RIHQG  385
              PN F   S+L+AC  M +      +H   +K G   + ++ + L+D+Y      +   
Sbjct  108  VNPNAFTLSSVLKACKGMKSLSNAALVHGMAIKEGLEGSIYVENSLMDVYATCCISMDNA  167

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC  565
            + +F++   K+ + W+++I GY  +G+G   L  F +ML  G++ N   F   + AC+  
Sbjct  168  RLVFNDMKWKNDVSWTTLITGYAHSGNGYGGLGVFKEMLLEGVEMNPYSFSIAVRACAST  227

Query  566  GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGA  745
            G    G    HA   K+     L     ++DM  R   + +A ++ ++M  E D   W  
Sbjct  228  GWVSFG-KLIHAAVIKHGFGSNLPVMNSILDMYCRFDCLSDANQYFDEM-TEKDLITWNT  285

Query  746  LLAGCRKTHGSSEISELVAK  805
            ++AG  K+ GSSE   + +K
Sbjct  286  IIAGYEKS-GSSECLNMFSK  304


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = +2

Query  326  AFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLS  505
            + LA+ LI  Y   G I + +T+FDE P++D++ W+ MI GY      N+A   F++M+ 
Sbjct  46   SILATNLIKSYFDEGLIEEARTLFDEMPERDVVSWTVMIAGYTSFNCHNQAWTVFVEMVR  105

Query  506  HGIQPNDVVFISVLSAC  556
            + + PN     SVL AC
Sbjct  106  NEVNPNAFTLSSVLKAC  122



>ref|XP_008236588.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 
[Prunus mume]
Length=820

 Score =   281 bits (720),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/322 (42%), Positives = 209/322 (65%), Gaps = 2/322 (1%)
 Frame = +2

Query  11   FLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFR  190
            F++ + +  A++ MYA  G I S+R +F+ L  KD+I+W+ +I+ YAQ+   S A+ V+R
Sbjct  377  FVQDVVIGNAVVDMYAKLGAIYSARTVFEGLPIKDVISWNTLITGYAQNGLASEAIEVYR  436

Query  191  RMQ-LEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKF  367
             MQ  +   PN   + S+L A +S+ A   G  IH +V+K     + F+ + LIDMY K 
Sbjct  437  MMQEYKEIIPNHGTWVSILPAYTSVGALQQGMKIHGRVIKNCLDLDVFVGTCLIDMYAKC  496

Query  368  GRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVL  547
            GR+     +F + P K  I W+++I+ +G++GHG +AL+ F DML  G++P+ V F+S+L
Sbjct  497  GRLDDALLLFSQVPRKSAIPWNAVISSHGVHGHGEKALKLFKDMLDEGVKPDHVTFVSLL  556

Query  548  SACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPD  727
            SACSH GL  EG ++FH M+E+Y I P L HY CMVD+L R G++ +A  F++ MP+ PD
Sbjct  557  SACSHSGLVDEGQSYFHMMQEQYRIKPSLKHYGCMVDLLGRAGHLNKAYSFIDNMPVRPD  616

Query  728  KRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQ  907
              +WGALL  CR  HG+ ++  + +++L  +D  N  YYV+LSN+YA+ G+W+ VEK+R 
Sbjct  617  ASVWGALLGACR-IHGNVDLGRIASERLFEVDSENVGYYVLLSNIYANSGKWEGVEKVRS  675

Query  908  LMDGKKRKKGMGYSVVEVNNSM  973
            L   +   K  G+S +EVNN++
Sbjct  676  LARNRGLSKTPGWSSIEVNNNV  697


 Score =   140 bits (352),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/276 (29%), Positives = 151/276 (55%), Gaps = 7/276 (3%)
 Frame = +2

Query  5    SGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAV  184
            SG ++ I +   L+  YA  G++  SRI FD + +KD+  W++M+SAY +S     A+  
Sbjct  73   SGKVQNIFLSARLVNRYAYLGDVSFSRITFDLIPRKDVYTWNSMVSAYVRSGHFREAIDC  132

Query  185  FRRMQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            F +  L  G +P+ + F  +L+AC ++     G+ IH Q++KLG+  + F+A+ L+ +Y 
Sbjct  133  FSQFLLTSGLRPDFYTFPPVLKACQNLVD---GKKIHCQILKLGFEWDVFVAASLVHLYS  189

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            +FG +   + +FDE P +D+  W++MI+G+  NG+  +AL+  ++M S G++ + V   S
Sbjct  190  RFGFVGVARRLFDEMPIRDVGSWNAMISGFCQNGNAADALDVLIEMRSEGVKMDRVTATS  249

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L+AC+  G    G    H    K+ +   L     +++M S+ G++  A    ++M I 
Sbjct  250  LLTACAQSGDILSGM-LIHLYVIKHGLDFDLLICNALINMYSKFGSLGHARRIFDQMDIR  308

Query  722  PDKRIWGALLAGCRKTHGS-SEISELVAKQLISLDP  826
             D   W +++A   +     + +    + QL+ + P
Sbjct  309  -DLVSWNSIIAAYEQNDDPMTALGLFYSMQLLGIQP  343


 Score =   116 bits (291),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/286 (28%), Positives = 138/286 (48%), Gaps = 3/286 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   + V  +L+ +Y+ FG +  +R LFD +  +D+ +W+AMIS + Q+   ++AL 
Sbjct  171  KLGFEWDVFVAASLVHLYSRFGFVGVARRLFDEMPIRDVGSWNAMISGFCQNGNAADALD  230

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            V   M+ E  K +     SLL AC+       G  IH  V+K G   +  + + LI+MY 
Sbjct  231  VLIEMRSEGVKMDRVTATSLLTACAQSGDILSGMLIHLYVIKHGLDFDLLICNALINMYS  290

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            KFG +   + IFD+   +DL+ W+S+I  Y  N     AL  F  M   GIQP+ +  +S
Sbjct  291  KFGSLGHARRIFDQMDIRDLVSWNSIIAAYEQNDDPMTALGLFYSMQLLGIQPDFLTLVS  350

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            + S  +      +  +    +  +      +     +VDM ++ G +  A      +PI+
Sbjct  351  LASILAQLSDAAKSRSVHGFILRRDFFVQDVVIGNAVVDMYAKLGAIYSARTVFEGLPIK  410

Query  722  PDKRIWGALLAGCRKTHGSSEISEL--VAKQLISLDPTNASYYVIL  853
             D   W  L+ G  +   +SE  E+  + ++   + P + ++  IL
Sbjct  411  -DVISWNTLITGYAQNGLASEAIEVYRMMQEYKEIIPNHGTWVSIL  455


 Score = 81.3 bits (199),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/197 (28%), Positives = 96/197 (49%), Gaps = 26/197 (13%)
 Frame = +2

Query  239  LLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKD  418
            L Q+C+++      + +H  ++  G   N FL++ L++ Y   G +   +  FD  P KD
Sbjct  53   LFQSCTNVHH---AKQLHAFLVVSGKVQNIFLSARLVNRYAYLGDVSFSRITFDLIPRKD  109

Query  419  LICWSSMINGYGMNGHGNEALECFLD-MLSHGIQPNDVVFISVLSACS--------HCGL  571
            +  W+SM++ Y  +GH  EA++CF   +L+ G++P+   F  VL AC         HC +
Sbjct  110  VYTWNSMVSAYVRSGHFREAIDCFSQFLLTSGLRPDFYTFPPVLKACQNLVDGKKIHCQI  169

Query  572  EYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALL  751
               G+ W        D+       A +V + SR G V  A    ++MPI  D   W A++
Sbjct  170  LKLGFEW--------DVFVA----ASLVHLYSRFGFVGVARRLFDEMPIR-DVGSWNAMI  216

Query  752  AG-CRKTHGSSEISELV  799
            +G C+  + +  +  L+
Sbjct  217  SGFCQNGNAADALDVLI  233



>gb|EMT07478.1| hypothetical protein F775_00276 [Aegilops tauschii]
Length=689

 Score =   279 bits (713),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/340 (40%), Positives = 208/340 (61%), Gaps = 5/340 (1%)
 Frame = +2

Query  35    TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
             T+++  +   G ++ +R+LFD + ++D ++W+AMI  Y Q+ Q   AL +FR MQL   +
Sbjct  194   TSVISGFVRLGQVDRARVLFDRMPERDTVSWTAMIDGYVQAGQFREALEMFREMQLSKVR  253

Query  215   PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
              +EF   S++ AC+ + A + GE     + + G   + F+ + LIDMY K G I +   +
Sbjct  254   ADEFTMVSIVTACAQLGALETGEWARIYMNRHGIKMDTFVGNALIDMYSKCGSIERALDV  313

Query  395   FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
             F+E   +D   W+++I G  +NGHG EA++ F  ML     P++V FI VL+AC+H GL 
Sbjct  314   FNEVHSRDKFTWTAVILGLAVNGHGEEAIDMFDRMLRAFEAPDEVTFIGVLTACTHAGLV  373

Query  575   YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
              +G ++F +M   Y I P + HY CM+D+L R G + EALE + KMP++P   IWG LLA
Sbjct  374   DKGRDFFLSMTGTYRIAPNVMHYGCMIDLLGRAGKLREALETIGKMPMKPSSAIWGTLLA  433

Query  755   GCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKK  934
              CR  HG+SEI EL A++L+ LDP N+  YV+LSNLYA   RW +V  LRQ+M  K  KK
Sbjct  434   ACR-VHGNSEIGELAAERLLELDPENSMAYVLLSNLYAKSNRWGDVRWLRQVMMEKGIKK  492

Query  935   GMGYSVVEVNNSMHRMEF**R----SEQEYIQHSRVIIDV  1042
               G S++E+N ++H      R    SE+ Y +  +V+ D+
Sbjct  493   EPGCSLIEMNGTIHEFVAGDRSHPMSEEIYSKLDKVLTDL  532


 Score = 80.5 bits (197),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 68/323 (21%), Positives = 138/323 (43%), Gaps = 41/323 (13%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFD---SLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQ  199
            V ++L+ MYA  G+  ++R L D   +      + W+A++S + +S Q   +   F  M 
Sbjct  57   VASSLVLMYAARGDGVTARALLDVQPASGGGTPVVWNALMSGHKRSRQFRLSCCSFLDMM  116

Query  200  LEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIH  379
                      + ++L AC       +G  +H ++++ G   +  + + L+DMY + G++ 
Sbjct  117  RAGVVATPVTYITVLSACGKGNDVLLGMQLHKRIIESGVLPDLKVENALVDMYAECGQME  176

Query  380  QGKTIFDENPDKDLICWSS-------------------------------MINGYGMNGH  466
                +F+    ++++ W+S                               MI+GY   G 
Sbjct  177  AAWDLFEGMQVRNIVSWTSVISGFVRLGQVDRARVLFDRMPERDTVSWTAMIDGYVQAGQ  236

Query  467  GNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYA  646
              EALE F +M    ++ ++   +S+++AC+  G   E   W      ++ I        
Sbjct  237  FREALEMFREMQLSKVRADEFTMVSIVTACAQLG-ALETGEWARIYMNRHGIKMDTFVGN  295

Query  647  CMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLD-  823
             ++DM S+ G++E AL+  N++    DK  W A++ G        E  ++  + L + + 
Sbjct  296  ALIDMYSKCGSIERALDVFNEVH-SRDKFTWTAVILGLAVNGHGEEAIDMFDRMLRAFEA  354

Query  824  PTNASYYVILSNL----YADQGR  880
            P   ++  +L+        D+GR
Sbjct  355  PDEVTFIGVLTACTHAGLVDKGR  377


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 94/234 (40%), Gaps = 46/234 (20%)
 Frame = +2

Query  176  LAVFRRMQLEHGKPNEFAFHSLLQACSSMAA--QDVGETIHTQVMKLGYTSNAFLASGLI  349
            L  +  M     +P+ + F  LL+A + + A    VG+ +H  V+K G   NA +AS L+
Sbjct  3    LRAYVGMLARGARPDAYTFPPLLKAAAELGAVPPSVGDAVHAHVVKFGLELNAHVASSLV  62

Query  350  DMYCKFGRIHQGKTIFDENPDK---DLICWSSMINGYGMNGHGNEALECFLDMLSHGIQP  520
             MY   G     + + D  P       + W+++++G+  +     +   FLDM+  G+  
Sbjct  63   LMYAARGDGVTARALLDVQPASGGGTPVVWNALMSGHKRSRQFRLSCCSFLDMMRAGVVA  122

Query  521  NDVVFISVLSAC-----------------------------------SHCGLEYEGWNWF  595
              V +I+VLSAC                                   + CG     W+ F
Sbjct  123  TPVTYITVLSACGKGNDVLLGMQLHKRIIESGVLPDLKVENALVDMYAECGQMEAAWDLF  182

Query  596  HAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
              M+ +      +  +  ++    R G V+ A    ++MP E D   W A++ G
Sbjct  183  EGMQVR-----NIVSWTSVISGFVRLGQVDRARVLFDRMP-ERDTVSWTAMIDG  230



>ref|XP_002274432.2| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 
[Vitis vinifera]
Length=743

 Score =   280 bits (715),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 199/320 (62%), Gaps = 4/320 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            +V AL+ MY+  G+++ +R LF+ + +KDII+W+ MI  Y+  +    ALA+FR+MQ  +
Sbjct  306  LVNALIDMYSKCGDLDKARDLFEGICEKDIISWNVMIGGYSHMNSYKEALALFRKMQQSN  365

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMK--LGYTSNAFLASGLIDMYCKFGRIHQ  382
             +PN+  F S+L AC+ + A D+G+ IH  + K  LG T N  L + LIDMY K G I  
Sbjct  366  VEPNDVTFVSILPACAYLGALDLGKWIHAYIDKKFLGLT-NTSLWTSLIDMYAKCGNIEA  424

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             K +F     K L  W++MI+G  M+GH N ALE F  M   G +P+D+ F+ VLSACSH
Sbjct  425  AKQVFAGMKPKSLGSWNAMISGLAMHGHANMALELFRQMRDEGFEPDDITFVGVLSACSH  484

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             GL   G   F +M E YDI+PKL HY CM+D+L R G  +EA   +  M ++PD  IWG
Sbjct  485  AGLVELGRQCFSSMVEDYDISPKLQHYGCMIDLLGRAGLFDEAEALMKNMEMKPDGAIWG  544

Query  743  ALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGK  922
            +LL  CR  HG+ E+ E  AK L  L+P N   YV+LSN+YA  GRWD+V ++R  ++ K
Sbjct  545  SLLGACR-VHGNVELGEFAAKHLFELEPENPGAYVLLSNIYATAGRWDDVARIRTKLNDK  603

Query  923  KRKKGMGYSVVEVNNSMHRM  982
              KK  G S +EV++ +H  
Sbjct  604  GMKKVPGCSSIEVDSVVHEF  623


 Score =   143 bits (361),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/278 (31%), Positives = 152/278 (55%), Gaps = 8/278 (3%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
            TAL+  Y   G ++ +R LF+ +  +D ++W+AMI+ YAQS +   ALA F+ M+  +  
Sbjct  207  TALITGYTLRGCLDDARRLFEEIPVRDAVSWNAMIAGYAQSGRFEEALAFFQEMKRANVA  266

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
            PNE    ++L AC+   + ++G  + + +   G  SN  L + LIDMY K G + + + +
Sbjct  267  PNESTMVTVLSACAQSGSLELGNWVRSWIEDHGLGSNLRLVNALIDMYSKCGDLDKARDL  326

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            F+   +KD+I W+ MI GY       EAL  F  M    ++PNDV F+S+L AC++ G  
Sbjct  327  FEGICEKDIISWNVMIGGYSHMNSYKEALALFRKMQQSNVEPNDVTFVSILPACAYLGAL  386

Query  575  YEGWNWFHA-MEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKR-IWGAL  748
              G  W HA +++K+      + +  ++DM ++ GN+E A +    M  +P     W A+
Sbjct  387  DLG-KWIHAYIDKKFLGLTNTSLWTSLIDMYAKCGNIEAAKQVFAGM--KPKSLGSWNAM  443

Query  749  LAGCRKTHGSSEISELVAKQLI--SLDPTNASYYVILS  856
            ++G    HG + ++  + +Q+     +P + ++  +LS
Sbjct  444  ISGL-AMHGHANMALELFRQMRDEGFEPDDITFVGVLS  480


 Score =   130 bits (328),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/310 (27%), Positives = 144/310 (46%), Gaps = 38/310 (12%)
 Frame = +2

Query  62   FGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSL  241
            FGN+  + +LF+S+ Q +   W+ MI   + S  P  A+  + RM L   +PN + F  L
Sbjct  84   FGNLSYALLLFESIEQPNQFIWNTMIRGNSLSSSPVGAIDFYVRMLLCGVEPNSYTFPFL  143

Query  242  LQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGR----------------  373
            L++C+ + A   G+ IH  V+KLG  S+ F+ + LI+MY + G                 
Sbjct  144  LKSCAKVGATQEGKQIHGHVLKLGLESDPFVHTSLINMYAQNGELGYAELVFSKSSLRDA  203

Query  374  ---------------IHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSH  508
                           +   + +F+E P +D + W++MI GY  +G   EAL  F +M   
Sbjct  204  VSFTALITGYTLRGCLDDARRLFEEIPVRDAVSWNAMIAGYAQSGRFEEALAFFQEMKRA  263

Query  509  GIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEE  688
             + PN+   ++VLSAC+  G   E  NW  +  E + +   L     ++DM S+ G++++
Sbjct  264  NVAPNESTMVTVLSACAQSG-SLELGNWVRSWIEDHGLGSNLRLVNALIDMYSKCGDLDK  322

Query  689  ALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAK-QLISLDPTNASYYVILSNL-  862
            A +    +  E D   W  ++ G    +   E   L  K Q  +++P + ++  IL    
Sbjct  323  ARDLFEGI-CEKDIISWNVMIGGYSHMNSYKEALALFRKMQQSNVEPNDVTFVSILPACA  381

Query  863  ---YADQGRW  883
                 D G+W
Sbjct  382  YLGALDLGKW  391



>ref|XP_010035215.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820 
[Eucalyptus grandis]
 gb|KCW84216.1| hypothetical protein EUGRSUZ_B01082 [Eucalyptus grandis]
Length=727

 Score =   280 bits (715),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/321 (41%), Positives = 201/321 (63%), Gaps = 1/321 (0%)
 Frame = +2

Query  17   KCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM  196
            K + V TA++  Y+    +E++R++FD L +KD++ WSAMIS YA+SDQP  AL +F++M
Sbjct  287  KNLVVSTAMISWYSKVRKMENARLIFDQLDEKDLVCWSAMISGYAESDQPQEALTLFKKM  346

Query  197  QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
            Q+   KP++    S L AC+ + A D G  +H  V + G+     + + LIDMY K G +
Sbjct  347  QMWGIKPDQVTILSALSACAHLGALDQGRWMHKYVDENGFGEALPVKNVLIDMYAKCGSL  406

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
             + + +F++   K++I W++MIN + M+G  N  L  F  M    ++PN++ FI VL AC
Sbjct  407  ERAQKVFEKTSSKNVISWTTMINSFAMHGDANNVLRFFYQMKEENVEPNEITFIGVLYAC  466

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
            SH GL  +G   F +M  ++++ PK  HY CMVD+  R G + EALE +  MP+ P+  I
Sbjct  467  SHAGLVEKGQEIFSSMVSEHNLKPKHEHYGCMVDLFGRAGLLREALEVIETMPLAPNVVI  526

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            WG+L+A CR  HG  E+ E  AKQL+ L+P +   +V+LSN+YA   RW +V +LRQLM 
Sbjct  527  WGSLMAACR-VHGEDELGEFAAKQLLKLEPDHDGAHVVLSNIYAKHRRWQDVGELRQLMR  585

Query  917  GKKRKKGMGYSVVEVNNSMHR  979
             +   K  G+S +E+NN +H+
Sbjct  586  QRGVFKARGWSRIELNNEVHQ  606


 Score =   134 bits (337),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/258 (30%), Positives = 125/258 (48%), Gaps = 32/258 (12%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V TAL++MYA  G I  +R+LFD++SQ+D+++WS MI  + Q+     A+++F  M+  +
Sbjct  159  VQTALVRMYAAGGRIVDARLLFDTMSQRDVVSWSIMIDGFCQNGLFDEAMSLFEEMRRSN  218

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFG------  370
             +P+     S+L AC        G+ IH  + +     +  + S LI MY   G      
Sbjct  219  VEPDRMILSSILSACGRAGNLSYGKKIHDYITENNVILDPHIWSALISMYASSGCMDLAQ  278

Query  371  -------------------------RIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNE  475
                                     ++   + IFD+  +KDL+CWS+MI+GY  +    E
Sbjct  279  ELFDSMSPKNLVVSTAMISWYSKVRKMENARLIFDQLDEKDLVCWSAMISGYAESDQPQE  338

Query  476  ALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMV  655
            AL  F  M   GI+P+ V  +S LSAC+H G   +G  W H   ++      L     ++
Sbjct  339  ALTLFKKMQMWGIKPDQVTILSALSACAHLGALDQG-RWMHKYVDENGFGEALPVKNVLI  397

Query  656  DMLSRQGNVEEALEFVNK  709
            DM ++ G++E A +   K
Sbjct  398  DMYAKCGSLERAQKVFEK  415


 Score =   107 bits (267),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 82/283 (29%), Positives = 131/283 (46%), Gaps = 42/283 (15%)
 Frame = +2

Query  149  AQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNA  328
            ++ D+P +AL VF  M  E    + F+F  LL+A S       G  IH  V+KLGY  + 
Sbjct  98   SRGDRPGDALIVFDEMWREGVVLDRFSFPPLLKAGSKEVGLVEGSEIHGLVVKLGYGGDP  157

Query  329  FLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSH  508
            F+ + L+ MY   GRI   + +FD    +D++ WS MI+G+  NG  +EA+  F +M   
Sbjct  158  FVQTALVRMYAAGGRIVDARLLFDTMSQRDVVSWSIMIDGFCQNGLFDEAMSLFEEMRRS  217

Query  509  GIQPNDVVFISVLSACSHCG------------------LEYEGWNWFHAM----------  604
             ++P+ ++  S+LSAC   G                  L+   W+   +M          
Sbjct  218  NVEPDRMILSSILSACGRAGNLSYGKKIHDYITENNVILDPHIWSALISMYASSGCMDLA  277

Query  605  EEKYD-ITPK-LAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGS  778
            +E +D ++PK L     M+   S+   +E A    +++  E D   W A+++G  ++   
Sbjct  278  QELFDSMSPKNLVVSTAMISWYSKVRKMENARLIFDQLD-EKDLVCWSAMISGYAESDQP  336

Query  779  SEISELVAK-QLISLDPTNASYYVILSNLYA-------DQGRW  883
             E   L  K Q+  + P   +   ILS L A       DQGRW
Sbjct  337  QEALTLFKKMQMWGIKPDQVT---ILSALSACAHLGALDQGRW  376


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 85/156 (54%), Gaps = 2/156 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++GF + +PV   L+ MYA  G++E ++ +F+  S K++I+W+ MI+++A     +N L 
Sbjct  383  ENGFGEALPVKNVLIDMYAKCGSLERAQKVFEKTSSKNVISWTTMINSFAMHGDANNVLR  442

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASG-LIDMY  358
             F +M+ E+ +PNE  F  +L ACS     + G+ I + ++            G ++D++
Sbjct  443  FFYQMKEENVEPNEITFIGVLYACSHAGLVEKGQEIFSSMVSEHNLKPKHEHYGCMVDLF  502

Query  359  CKFGRIHQGKTIFDENP-DKDLICWSSMINGYGMNG  463
             + G + +   + +  P   +++ W S++    ++G
Sbjct  503  GRAGLLREALEVIETMPLAPNVVIWGSLMAACRVHG  538



>ref|XP_006585174.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like, partial [Glycine max]
Length=832

 Score =   281 bits (720),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/313 (43%), Positives = 200/313 (64%), Gaps = 2/313 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            +PV  AL+ MYA  G++E + ++F  L  K+I++W+ MI  Y+Q+  P+ AL +F  MQ 
Sbjct  456  LPVSNALMNMYAKCGSMEEANLIFSQLPVKNIVSWNTMIGGYSQNSLPNEALQLFLDMQ-  514

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            +  KP++     +L AC+ +AA + G  IH  +++ GY S+  +A  L+DMY K G +  
Sbjct  515  KQLKPDDVTMACVLPACAGLAALEKGREIHGHILRKGYFSDLHVACALVDMYVKCGLLVL  574

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + +FD  P KD+I W+ MI GYGM+G G EA+  F  M   GI+P +  F S+L AC+H
Sbjct  575  AQQLFDMIPKKDMILWTVMIAGYGMHGFGKEAISTFEKMRVAGIEPEESSFTSILYACTH  634

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             GL  EGW  F +M+ + +I PKL HYACMVD+L R GN+  A +F+  MPI+PD  IWG
Sbjct  635  SGLLKEGWKLFDSMKSECNIEPKLEHYACMVDLLIRSGNLSRAYKFIETMPIKPDAAIWG  694

Query  743  ALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGK  922
            ALL+GCR  H   E++E VA+ +  L+P N  YYV+L+N+YA+  +W+EV+K+++ +   
Sbjct  695  ALLSGCR-IHHDVELAEKVAEHIFELEPENTRYYVLLANVYAEAEKWEEVKKIQRRISKG  753

Query  923  KRKKGMGYSVVEV  961
              K   G S +EV
Sbjct  754  GLKNDQGCSWIEV  766


 Score =   130 bits (327),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 150/293 (51%), Gaps = 20/293 (7%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+GF   +     LL MY+  GN+  +  +F  + +  I++W+++I+A+ +      A+ 
Sbjct  348  KAGFSGGVMFNNTLLDMYSKCGNLNGANEVFVKMGETTIVSWTSIIAAHVREGLHYEAIG  407

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  MQ +  +P+ +A  S++ AC+   + D G  +H  + K    SN  +++ L++MY 
Sbjct  408  LFDEMQSKGLRPDIYAVTSVVHACACSNSLDKGREVHNHIKKNNMGSNLPVSNALMNMYA  467

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G + +   IF + P K+++ W++MI GY  N   NEAL+ FLDM    ++P+DV    
Sbjct  468  KCGSMEEANLIFSQLPVKNIVSWNTMIGGYSQNSLPNEALQLFLDMQKQ-LKPDDVTMAC  526

Query  542  VLSACSHC-----GLEYEGWNWFHAMEEKY--DITPKLAHYAC-MVDMLSRQGNVEEALE  697
            VL AC+       G E  G    H + + Y  D+     H AC +VDM  + G +  A +
Sbjct  527  VLPACAGLAALEKGREIHG----HILRKGYFSDL-----HVACALVDMYVKCGLLVLAQQ  577

Query  698  FVNKMPIEPDKRIWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
              + +P + D  +W  ++AG      G   IS     ++  ++P  +S+  IL
Sbjct  578  LFDMIP-KKDMILWTVMIAGYGMHGFGKEAISTFEKMRVAGIEPEESSFTSIL  629


 Score =   116 bits (290),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 121/239 (51%), Gaps = 2/239 (1%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            L+ MY N G++   R +FD +    I  W+ ++S YA+      ++ +F +MQ    + +
Sbjct  159  LVFMYVNCGDLVKGRRIFDGILNDKIFLWNLLMSEYAKIGNYRESVGLFEKMQELGIRGD  218

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
             + F  +L+  ++ A     + +H  V+KLG+ S   + + LI  Y K G +   + +FD
Sbjct  219  SYTFTCVLKGFAASAKVRECKRVHGYVLKLGFGSYNAVVNSLIAAYFKCGEVESARILFD  278

Query  401  ENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYE  580
            E  D+D++ W+SMI+G  MNG     LE F+ ML+ G+  +    ++VL AC++ G    
Sbjct  279  ELSDRDVVSWNSMISGCTMNGFSRNGLEFFIQMLNLGVDVDSATLVNVLVACANVGNLTL  338

Query  581  GWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            G    HA   K   +  +     ++DM S+ GN+  A E   KM  E     W +++A 
Sbjct  339  G-RALHAYGVKAGFSGGVMFNNTLLDMYSKCGNLNGANEVFVKMG-ETTIVSWTSIIAA  395


 Score =   112 bits (279),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 139/284 (49%), Gaps = 2/284 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     VV +L+  Y   G +ES+RILFD LS +D+++W++MIS    +    N L 
Sbjct  247  KLGFGSYNAVVNSLIAAYFKCGEVESARILFDELSDRDVVSWNSMISGCTMNGFSRNGLE  306

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             F +M       +     ++L AC+++    +G  +H   +K G++      + L+DMY 
Sbjct  307  FFIQMLNLGVDVDSATLVNVLVACANVGNLTLGRALHAYGVKAGFSGGVMFNNTLLDMYS  366

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G ++    +F +  +  ++ W+S+I  +   G   EA+  F +M S G++P+     S
Sbjct  367  KCGNLNGANEVFVKMGETTIVSWTSIIAAHVREGLHYEAIGLFDEMQSKGLRPDIYAVTS  426

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            V+ AC+ C    +     H   +K ++   L     +++M ++ G++EEA    +++P++
Sbjct  427  VVHACA-CSNSLDKGREVHNHIKKNNMGSNLPVSNALMNMYAKCGSMEEANLIFSQLPVK  485

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             +   W  ++ G  +    +E  +L       L P + +   +L
Sbjct  486  -NIVSWNTMIGGYSQNSLPNEALQLFLDMQKQLKPDDVTMACVL  528


 Score = 58.9 bits (141),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 75/162 (46%), Gaps = 24/162 (15%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            + G+   + V  AL+ MY   G +  ++ LFD + +KD+I W+ MI+ Y        A++
Sbjct  549  RKGYFSDLHVACALVDMYVKCGLLVLAQQLFDMIPKKDMILWTVMIAGYGMHGFGKEAIS  608

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASG------  343
             F +M++   +P E +F S+L AC+           H+ ++K G+     + S       
Sbjct  609  TFEKMRVAGIEPEESSFTSILYACT-----------HSGLLKEGWKLFDSMKSECNIEPK  657

Query  344  ------LIDMYCKFGRIHQGKTIFDENPDK-DLICWSSMING  448
                  ++D+  + G + +     +  P K D   W ++++G
Sbjct  658  LEHYACMVDLLIRSGNLSRAYKFIETMPIKPDAAIWGALLSG  699


 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 46/211 (22%), Positives = 91/211 (43%), Gaps = 4/211 (2%)
 Frame = +2

Query  128  SAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMK  307
            +A I  + +     NA+ +  R Q    + N +   S+LQ C+ + + + G+ +H+ +  
Sbjct  89   NAKICKFCEMGDLRNAMKLLSRSQRSELELNTYC--SVLQLCAELKSLEDGKRVHSIISS  146

Query  308  LGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALEC  487
             G   +  L + L+ MY   G + +G+ IFD   +  +  W+ +++ Y   G+  E++  
Sbjct  147  NGMAIDEVLGAKLVFMYVNCGDLVKGRRIFDGILNDKIFLWNLLMSEYAKIGNYRESVGL  206

Query  488  FLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLS  667
            F  M   GI+ +   F  VL   +      E     H    K       A    ++    
Sbjct  207  FEKMQELGIRGDSYTFTCVLKGFAASAKVRE-CKRVHGYVLKLGFGSYNAVVNSLIAAYF  265

Query  668  RQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
            + G VE A    +++  + D   W ++++GC
Sbjct  266  KCGEVESARILFDELS-DRDVVSWNSMISGC  295



>ref|XP_006468878.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial-like [Citrus sinensis]
Length=662

 Score =   278 bits (710),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/344 (38%), Positives = 213/344 (62%), Gaps = 5/344 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             K GF   + V   L+  YA  G+++ SR +FD + +KD + W+++I+ YAQ+   + AL 
Sbjct  216   KRGFDSEVGVGNTLIDAYARGGHVDVSRKVFDGMIEKDAVTWNSIIAIYAQNGLAAEALD  275

Query  182   VFRRM-QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VF +M +    K N     ++L A + +    +G+ IH QV+K+    +  + + +IDMY
Sbjct  276   VFDQMVKSTDVKCNAVTLSAVLLAIAHLGVLRLGKCIHDQVIKMDLEESVIVGTSIIDMY  335

Query  359   CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             CK G++   +  F++  +K++  W++MI GYGM+    EAL+ F  M+  G++PN + F+
Sbjct  336   CKCGQVDLARKAFNQMKEKNVRSWTAMIAGYGMHCRAREALDLFYKMIKAGVRPNYITFV  395

Query  539   SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             SVLSACSH GL  EGW+WF+ M  +++I P + HY CMVD+L R G ++EA   +  M +
Sbjct  396   SVLSACSHAGLVQEGWHWFNTMSHEFNIEPGVEHYGCMVDLLGRAGKLKEAYNLIEGMKV  455

Query  719   EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
             +PD  +WG+LL  CR  H + ++ E+ AK+L  L+P N  Y+V+LSN+YA+ GRW++VE+
Sbjct  456   KPDFVVWGSLLGACR-IHKNLDLGEIAAKKLFELEPNNCGYHVLLSNIYANAGRWEDVER  514

Query  899   LRQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRV  1030
              R LM  ++  K  G+S+VE+   +H        ++E+ QH ++
Sbjct  515   TRSLMKNRRLAKTPGFSLVELRGKVHAFLV---GDKEHPQHEKI  555


 Score =   118 bits (295),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 84/265 (32%), Positives = 136/265 (51%), Gaps = 17/265 (6%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQK--DIIAWSAMISAYAQSDQPSNALA  181
            GF + + V +AL+ MY+  G +  +R LFD + Q+  +I++W++M++ Y Q+D    AL 
Sbjct  103  GFHRDVFVSSALIDMYSKCGELSDARKLFDEIPQRIRNIVSWTSMLTGYVQNDNAREALL  162

Query  182  VFRRMQL---EHGKPNE---------FAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSN  325
            +F+   L   E G  +E          A  S+L ACS +    V E  H  V+K G+ S 
Sbjct  163  LFKEFLLEESECGGASENSDNVFVDSVAIASVLSACSRVTVNGVTEGAHGFVIKRGFDSE  222

Query  326  AFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDML-  502
              + + LID Y + G +   + +FD   +KD + W+S+I  Y  NG   EAL+ F  M+ 
Sbjct  223  VGVGNTLIDAYARGGHVDVSRKVFDGMIEKDAVTWNSIIAIYAQNGLAAEALDVFDQMVK  282

Query  503  SHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNV  682
            S  ++ N V   +VL A +H G+   G    H    K D+   +     ++DM  + G V
Sbjct  283  STDVKCNAVTLSAVLLAIAHLGVLRLG-KCIHDQVIKMDLEESVIVGTSIIDMYCKCGQV  341

Query  683  EEALEFVNKMPIEPDKRIWGALLAG  757
            + A +  N+M  E + R W A++AG
Sbjct  342  DLARKAFNQMK-EKNVRSWTAMIAG  365


 Score = 87.8 bits (216),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 113/234 (48%), Gaps = 20/234 (9%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + + ++ +W+++I+  A+      AL  F  M+     P    F   +++CS++     G
Sbjct  33   VDKNNVFSWNSVIADLARGGDSVEALRAFSSMRKLSLTPTRSTFPCAIKSCSALHDLHSG  92

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPD--KDLICWSSMINGYG  454
            +  H Q    G+  + F++S LIDMY K G +   + +FDE P   ++++ W+SM+ GY 
Sbjct  93   KQAHQQAFIFGFHRDVFVSSALIDMYSKCGELSDARKLFDEIPQRIRNIVSWTSMLTGYV  152

Query  455  MNGHGNEAL-----------EC-FLDMLSHGIQPNDVVFISVLSACSHCGLE--YEGWNW  592
             N +  EAL           EC      S  +  + V   SVLSACS   +    EG + 
Sbjct  153  QNDNAREALLLFKEFLLEESECGGASENSDNVFVDSVAIASVLSACSRVTVNGVTEGAHG  212

Query  593  FHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
            F  ++  +D    + +   ++D  +R G+V+ + +  + M IE D   W +++A
Sbjct  213  F-VIKRGFDSEVGVGN--TLIDAYARGGHVDVSRKVFDGM-IEKDAVTWNSIIA  262



>gb|KDP32019.1| hypothetical protein JCGZ_12480 [Jatropha curcas]
Length=628

 Score =   277 bits (708),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 198/320 (62%), Gaps = 1/320 (0%)
 Frame = +2

Query  17   KCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM  196
            K +  +TA++  YA +G ++ +R LFD L ++D++ W+ MI AY Q +QP+  L +FR+M
Sbjct  188  KSLVSMTAMITCYAKYGMVKEARKLFDGLQERDLVCWNVMIDAYVQHEQPNKGLVLFRQM  247

Query  197  QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
                 +PNE    ++L AC  + A + G  +H+ +   G   NA + + LIDMY K G +
Sbjct  248  MKAKVRPNEVTVLAVLSACGQIGALESGRWVHSYIQNNGIEINAHVGTALIDMYSKCGNL  307

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
               + +F+    KD++ W+SMI GY  +G   +AL+ F +M   G +P D+ FI +LSAC
Sbjct  308  EDARLVFERMRYKDVVVWNSMIVGYATHGFSEDALQLFDEMCRLGYRPTDITFIGILSAC  367

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
             H GL  EGW +F +M ++Y I PKL H+ CMV++L R G+++EA E V KM IEPD  +
Sbjct  368  GHAGLVSEGWRFFRSMRDEYGIKPKLEHHGCMVNLLGRAGHLKEAYELVKKMEIEPDPVL  427

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            WG LL  CR  HG+  + E +A+ LIS +  N+  Y++LSNLYA  G W+ V ++R L+ 
Sbjct  428  WGTLLGACR-LHGNLVLGEEIAEFLISRNLANSGTYILLSNLYAAAGNWEGVARMRTLLK  486

Query  917  GKKRKKGMGYSVVEVNNSMH  976
            G   +K  G S +E++N +H
Sbjct  487  GSGIEKEPGCSSIELSNKVH  506


 Score =   120 bits (300),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 80/311 (26%), Positives = 148/311 (48%), Gaps = 41/311 (13%)
 Frame = +2

Query  26   PVVTALLQM-YANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            P++T  LQ  Y++ G++  S  LF+ +   ++  ++++I A+        AL  + +M  
Sbjct  62   PILTFKLQRSYSSLGHLNHSLTLFNQIQNPNVFFYTSIIHAHVLLSLHDRALLFYVQMLT  121

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            +   PN F F ++L++C      +  ++IH Q +K G+ +  ++ + L+D+Y + G I  
Sbjct  122  QEVIPNAFTFSTILKSC----PLEPSKSIHAQAIKFGFDAELYVRTCLLDVYARGGDIES  177

Query  383  GKTIFDENPDK-------------------------------DLICWSSMINGYGMNGHG  469
               +FD+ P+K                               DL+CW+ MI+ Y  +   
Sbjct  178  ACKLFDKMPEKSLVSMTAMITCYAKYGMVKEARKLFDGLQERDLVCWNVMIDAYVQHEQP  237

Query  470  NEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYAC  649
            N+ L  F  M+   ++PN+V  ++VLSAC   G   E   W H+  +   I         
Sbjct  238  NKGLVLFRQMMKAKVRPNEVTVLAVLSACGQIG-ALESGRWVHSYIQNNGIEINAHVGTA  296

Query  650  MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISL--D  823
            ++DM S+ GN+E+A     +M  + D  +W +++ G   THG SE +  +  ++  L   
Sbjct  297  LIDMYSKCGNLEDARLVFERMRYK-DVVVWNSMIVG-YATHGFSEDALQLFDEMCRLGYR  354

Query  824  PTNASYYVILS  856
            PT+ ++  ILS
Sbjct  355  PTDITFIGILS  365


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 69/143 (48%), Gaps = 5/143 (3%)
 Frame = +2

Query  287  IHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGH  466
            IH  + +    ++  L   L   Y   G ++   T+F++  + ++  ++S+I+ + +   
Sbjct  49   IHAFLYRHNLHNHPILTFKLQRSYSSLGHLNHSLTLFNQIQNPNVFFYTSIIHAHVLLSL  108

Query  467  GNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYA  646
             + AL  ++ ML+  + PN   F ++L +C       E     HA   K+    +L    
Sbjct  109  HDRALLFYVQMLTQEVIPNAFTFSTILKSCP-----LEPSKSIHAQAIKFGFDAELYVRT  163

Query  647  CMVDMLSRQGNVEEALEFVNKMP  715
            C++D+ +R G++E A +  +KMP
Sbjct  164  CLLDVYARGGDIESACKLFDKMP  186



>ref|XP_010912878.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Elaeis guineensis]
Length=622

 Score =   276 bits (707),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 204/317 (64%), Gaps = 1/317 (0%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V TA+L+MY   G ++ +R  FD +  +D++AWS+MI+ YAQ+ + + AL +F RM+ E+
Sbjct  265  VQTAVLEMYVKCGAVDEARQEFDRMECRDVVAWSSMIAGYAQNGKSNEALELFERMKAEN  324

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KPNE    S+L AC+   + +VGE I   V   G+    ++ S L+DMY K G I + +
Sbjct  325  CKPNEVTLVSVLSACAQSGSVEVGERIGNYVESQGFALGVYVGSALVDMYSKCGNIKRAR  384

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             IF+    +D++ W+SMI G   NG   +A+E +  M+   ++PND+ F+++L+AC+H G
Sbjct  385  WIFNRMHQRDVVTWNSMIGGLAFNGFAKDAIELYQMMMEENLKPNDITFVALLTACTHVG  444

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  +G  +FH M+  + I PK+ H AC+VD+L R G +E+A +F+ +M +EP+  IWG L
Sbjct  445  LVDQGLKFFHGMKPIHSIAPKIEHCACIVDLLCRSGRLEDAYKFICEMEVEPNAIIWGTL  504

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L+ CR  H +  ++EL  ++L+ L+P N+S YV+LS++YA+ GRW+E  ++R LM  K  
Sbjct  505  LSACR-VHSNVRLAELSIEKLLVLEPENSSNYVLLSSIYANAGRWEEARRVRNLMKSKNV  563

Query  929  KKGMGYSVVEVNNSMHR  979
            +K   YS +E+   +H+
Sbjct  564  QKLAAYSWIELEGIVHK  580


 Score =   135 bits (341),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 82/286 (29%), Positives = 146/286 (51%), Gaps = 12/286 (4%)
 Frame = +2

Query  23   IPV-----VTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            IPV     +  L+  Y+  GN+ ++R LFD ++++   +W++MI+ YA     + AL +F
Sbjct  157  IPVKDPVPINCLISGYSKSGNVLAARRLFDEMTRRTSSSWNSMITCYAHHGNFAEALRLF  216

Query  188  RRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKF  367
             RM  E+ +PNE    ++L  C+ +   + G  +   +       +  + + +++MY K 
Sbjct  217  ERMHTENVRPNEITLVTVLSICAKLGDLETGLKVKKLIENNDLRRDLIVQTAVLEMYVKC  276

Query  368  GRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVL  547
            G + + +  FD    +D++ WSSMI GY  NG  NEALE F  M +   +PN+V  +SVL
Sbjct  277  GAVDEARQEFDRMECRDVVAWSSMIAGYAQNGKSNEALELFERMKAENCKPNEVTLVSVL  336

Query  548  SACSHCGLEYEGWNWFHAMEEKYDITPKLAHY--ACMVDMLSRQGNVEEALEFVNKMPIE  721
            SAC+  G    G    + +E +      L  Y  + +VDM S+ GN++ A    N+M  +
Sbjct  337  SACAQSGSVEVGERIGNYVESQ---GFALGVYVGSALVDMYSKCGNIKRARWIFNRMH-Q  392

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQL-ISLDPTNASYYVILS  856
             D   W +++ G      + +  EL    +  +L P + ++  +L+
Sbjct  393  RDVVTWNSMIGGLAFNGFAKDAIELYQMMMEENLKPNDITFVALLT  438


 Score =   109 bits (272),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 75/294 (26%), Positives = 138/294 (47%), Gaps = 42/294 (14%)
 Frame = +2

Query  26   PVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLE  205
            P+   +L   +N G+ + +   FD++ Q D    +++I+ Y++       L  F  +   
Sbjct  34   PLFLGVLLKRSNVGHAQRT---FDAIPQPDSYLCNSIITTYSKLSMHKEVLKTFFSV---  87

Query  206  HGKPNEFAFHSL---LQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
            H K  +  FHS+   L++C+++AA + G+ +H+ ++  G++SN F+ + LID Y K G +
Sbjct  88   HHKKTQILFHSIPPVLKSCAALAASNEGKQVHSYILIHGFSSNVFIRTALIDFYSKNGDL  147

Query  377  HQGKTIFDENPDKDLI-------------------------------CWSSMINGYGMNG  463
                 +FDE P KD +                                W+SMI  Y  +G
Sbjct  148  DSATRVFDEIPVKDPVPINCLISGYSKSGNVLAARRLFDEMTRRTSSSWNSMITCYAHHG  207

Query  464  HGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHY  643
            +  EAL  F  M +  ++PN++  ++VLS C+  G + E       + E  D+   L   
Sbjct  208  NFAEALRLFERMHTENVRPNEITLVTVLSICAKLG-DLETGLKVKKLIENNDLRRDLIVQ  266

Query  644  ACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAK  805
              +++M  + G V+EA +  ++M    D   W +++AG  +   S+E  EL  +
Sbjct  267  TAVLEMYVKCGAVDEARQEFDRMECR-DVVAWSSMIAGYAQNGKSNEALELFER  319


 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 84/155 (54%), Gaps = 14/155 (9%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            GF   + V +AL+ MY+  GNI+ +R +F+ + Q+D++ W++MI   A +    +A+ ++
Sbjct  359  GFALGVYVGSALVDMYSKCGNIKRARWIFNRMHQRDVVTWNSMIGGLAFNGFAKDAIELY  418

Query  188  RRMQLEHGKPNEFAFHSLLQACSSMAAQDVG-------ETIHTQVMKLGYTSNAFLASGL  346
            + M  E+ KPN+  F +LL AC+ +   D G       + IH+   K+ +       + +
Sbjct  419  QMMMEENLKPNDITFVALLTACTHVGLVDQGLKFFHGMKPIHSIAPKIEH------CACI  472

Query  347  IDMYCKFGRIHQG-KTIFDENPDKDLICWSSMING  448
            +D+ C+ GR+    K I +   + + I W ++++ 
Sbjct  473  VDLLCRSGRLEDAYKFICEMEVEPNAIIWGTLLSA  507



>ref|XP_009782695.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, 
chloroplastic [Nicotiana sylvestris]
Length=627

 Score =   277 bits (708),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/315 (42%), Positives = 191/315 (61%), Gaps = 2/315 (1%)
 Frame = +2

Query  32   VTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHG  211
            +T ++  YA  G+++ +R+LFD + +KD++ W+AMI  Y+Q  +P+ AL +FRRM +   
Sbjct  193  LTTMITGYAKNGHVQEARVLFDGMEEKDVVCWNAMIDGYSQHGRPNEALVLFRRMLMSKV  252

Query  212  KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKT  391
            KPNE    + L AC+ +   + G  IH  V       N  + + LIDMY K G +   + 
Sbjct  253  KPNELTVVAALSACAQVGVLESGRWIHAYVKSNRIQLNKHVGTALIDMYSKSGSLEDARM  312

Query  392  IFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGL  571
            +FD+  DKD++ W+SMI GY M+G   E L+ F +M   G+ P D+ FI +LSAC++ GL
Sbjct  313  VFDQMRDKDVVTWNSMIVGYAMHGFSLETLQLFNEMCKLGLHPTDITFIGILSACANAGL  372

Query  572  EYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALL  751
              EGW++FH M EKY I PK+ HY CM  +L R G +EEA EFV  M I+ D  +WG LL
Sbjct  373  VAEGWDYFHLM-EKYRIKPKIEHYGCMASLLGRAGQLEEAYEFVKSMKIDSDPILWGTLL  431

Query  752  AGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRK  931
            + CR  HG+  ++E + + L+  D   +  YV+LSN+YA  G WD V K+R LM      
Sbjct  432  SACR-IHGNIRLAEKMMEFLVQQDLATSGTYVLLSNIYAAAGNWDGVAKVRALMKSSGVD  490

Query  932  KGMGYSVVEVNNSMH  976
            K  G S +EVNN +H
Sbjct  491  KEPGCSSIEVNNKVH  505


 Score =   118 bits (295),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 82/314 (26%), Positives = 153/314 (49%), Gaps = 40/314 (13%)
 Frame = +2

Query  14   LKCIPVVTALLQM-YANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFR  190
            L+  P++   LQ  Y++ G+++ S  +F   +   + ++SA+I ++  +D    A  ++ 
Sbjct  59   LESDPILNFKLQKSYSSLGHLKHSVSVFKH-THPTVFSYSAIIHSHVINDLYEQAFVLYI  117

Query  191  RMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFG  370
            +M  ++ +PN F F S+L+A    +  + G+ +H+Q +KLGY S+ ++ + L+D+Y + G
Sbjct  118  QMLTQNIEPNAFTFSSILKA----SPLESGKALHSQALKLGYESDTYVRTALVDVYARGG  173

Query  371  RIHQGKTIFDENPDKDLICWSSMINGYGMNGH----------------------------  466
             I     +FD   ++ L+  ++MI GY  NGH                            
Sbjct  174  DIVSACKLFDTMLERSLVSLTTMITGYAKNGHVQEARVLFDGMEEKDVVCWNAMIDGYSQ  233

Query  467  ---GNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLA  637
                NEAL  F  ML   ++PN++  ++ LSAC+  G+  E   W HA  +   I     
Sbjct  234  HGRPNEALVLFRRMLMSKVKPNELTVVAALSACAQVGV-LESGRWIHAYVKSNRIQLNKH  292

Query  638  HYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQL-I  814
                ++DM S+ G++E+A    ++M  + D   W +++ G      S E  +L  +   +
Sbjct  293  VGTALIDMYSKSGSLEDARMVFDQMR-DKDVVTWNSMIVGYAMHGFSLETLQLFNEMCKL  351

Query  815  SLDPTNASYYVILS  856
             L PT+ ++  ILS
Sbjct  352  GLHPTDITFIGILS  365


 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V TAL+ MY+  G++E +R++FD +  KD++ W++MI  YA        L +F  M    
Sbjct  293  VGTALIDMYSKSGSLEDARMVFDQMRDKDVVTWNSMIVGYAMHGFSLETLQLFNEMCKLG  352

Query  209  GKPNEFAFHSLLQACSS  259
              P +  F  +L AC++
Sbjct  353  LHPTDITFIGILSACAN  369



>ref|XP_008350091.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like 
[Malus domestica]
 ref|XP_008364884.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like 
[Malus domestica]
Length=571

 Score =   275 bits (703),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 137/322 (43%), Positives = 200/322 (62%), Gaps = 5/322 (2%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQ-  199
            +P   +++  Y+  G I  +R +FD +  +++I+WS MI  Y       +ALA+FR MQ 
Sbjct  129  LPSWNSIMNAYSKAGLIGDAREVFDKMPXRNVISWSCMIKGYVVCGAYKDALALFREMQK  188

Query  200  LEHG--KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGR  373
            ++ G  +PNEF   S+L AC  + A + G+ +H  + K G   +  L + ++DMY K G 
Sbjct  189  VDAGGVRPNEFTMSSVLLACGRLGALEHGKWVHAYIDKSGMQIDVVLGTAMVDMYAKCGS  248

Query  374  IHQGKTIFDE-NPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLS  550
            I + K +FD   P KD++ WSSMI+G  M+GH  E LE F +M+  G++PN V F+ VL 
Sbjct  249  IEKAKVVFDNMGPYKDVMAWSSMISGLAMHGHATECLELFSEMIKLGVRPNAVTFVGVLC  308

Query  551  ACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDK  730
            AC H GL  EG  +F  M+E++ I P + H+ C+VD+  + G V EAL+ V  MP+EPD 
Sbjct  309  ACVHGGLVSEGKEYFRRMDEEFGIKPLIQHFGCIVDLYGKAGLVREALKVVQSMPMEPDV  368

Query  731  RIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQL  910
             +WGALL+G R  H   E+SE+  K LI LDPTN+  YV+LSN+YA  G+W EV ++R L
Sbjct  369  LVWGALLSGSR-MHRDIEMSEIALKNLIQLDPTNSGAYVLLSNVYAKMGKWSEVRRVRDL  427

Query  911  MDGKKRKKGMGYSVVEVNNSMH  976
            M+ K+ KK  G S+VEV   +H
Sbjct  428  MEVKEVKKVPGCSLVEVGGVLH  449


 Score =   114 bits (284),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 79/281 (28%), Positives = 131/281 (47%), Gaps = 38/281 (14%)
 Frame = +2

Query  122  AWSAMISAYAQSDQPSNA--LAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHT  295
             W+ +I A+ QS   S+   L+VF RM+L   +P++  F  LLQ+C S+     G+ IH 
Sbjct  28   VWNTLIRAHVQSTVLSHPSPLSVFLRMRLHGVEPDDRTFPFLLQSCHSLPHIRPGKQIHA  87

Query  296  QVMKLGYTSNAFLASGLIDM-------------------------------YCKFGRIHQ  382
            QV   G+T + F+ + LI M                               Y K G I  
Sbjct  88   QVFLFGFTDDPFVRTSLIXMYSSCGSLTLARQVFDEITQPDLPSWNSIMNAYSKAGLIGD  147

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDML---SHGIQPNDVVFISVLSA  553
             + +FD+ P +++I WS MI GY + G   +AL  F +M    + G++PN+    SVL A
Sbjct  148  AREVFDKMPXRNVISWSCMIKGYVVCGAYKDALALFREMQKVDAGGVRPNEFTMSSVLLA  207

Query  554  CSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKR  733
            C   G    G  W HA  +K  +   +     MVDM ++ G++E+A    + M    D  
Sbjct  208  CGRLGALEHG-KWVHAYIDKSGMQIDVVLGTAMVDMYAKCGSIEKAKVVFDNMGPYKDVM  266

Query  734  IWGALLAGCRKTHGSSEISELVAKQL-ISLDPTNASYYVIL  853
             W ++++G      ++E  EL ++ + + + P   ++  +L
Sbjct  267  AWSSMISGLAMHGHATECLELFSEMIKLGVRPNAVTFVGVL  307


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/156 (28%), Positives = 76/156 (49%), Gaps = 3/156 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQ-KDIIAWSAMISAYAQSDQPSNAL  178
            KSG    + + TA++ MYA  G+IE ++++FD++   KD++AWS+MIS  A     +  L
Sbjct  226  KSGMQIDVVLGTAMVDMYAKCGSIEKAKVVFDNMGPYKDVMAWSSMISGLAMHGHATECL  285

Query  179  AVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG-ETIHTQVMKLGYTSNAFLASGLIDM  355
             +F  M     +PN   F  +L AC        G E       + G          ++D+
Sbjct  286  ELFSEMIKLGVRPNAVTFVGVLCACVHGGLVSEGKEYFRRMDEEFGIKPLIQHFGCIVDL  345

Query  356  YCKFGRIHQGKTIFDENP-DKDLICWSSMINGYGMN  460
            Y K G + +   +    P + D++ W ++++G  M+
Sbjct  346  YGKAGLVREALKVVQSMPMEPDVLVWGALLSGSRMH  381



>ref|XP_010242076.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, 
chloroplastic [Nelumbo nucifera]
Length=632

 Score =   276 bits (707),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/320 (40%), Positives = 194/320 (61%), Gaps = 1/320 (0%)
 Frame = +2

Query  17   KCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM  196
            K +  +TA++  YA  G++  +R+LFD + ++D++ W+ MI  Y Q  +P+ +L +FR+M
Sbjct  192  KSVVSITAMITCYAKHGDLGEARVLFDGMEKRDVVCWNVMIDGYTQHGRPNESLDLFRQM  251

Query  197  QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
                 +PNE    S+L AC+ + A ++G  +H+ +   G   N  + + L+DMYCK G +
Sbjct  252  LSVKVRPNEVTMISVLSACAQLGALELGRWLHSYIKNNGIQVNVHIGTALVDMYCKCGSL  311

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
               + +FD   +KD++ W+SMI GY M+G    AL  F  M + G  P D+ FI VL+AC
Sbjct  312  DDARVVFDGMINKDVVAWNSMIMGYAMHGFSQSALVLFSKMCAMGFSPTDITFIGVLNAC  371

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
            S  GL  EGW  FH+M+E+Y I PK+ HY CMVD+L R G + EA E V  M IEPD  +
Sbjct  372  SRAGLVTEGWTLFHSMKEQYGIEPKIEHYGCMVDLLGRAGQLVEAFELVKTMAIEPDHVL  431

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            W +LL+ CR  HG+  + E +A+ L+S    ++  +V+LSN+YA  G W  V K+R +M 
Sbjct  432  WSSLLSACR-LHGNVTLGENIAEFLVSSGLADSGTFVLLSNIYAAVGNWKGVAKVRTMMK  490

Query  917  GKKRKKGMGYSVVEVNNSMH  976
                +K  G S +EVNN +H
Sbjct  491  DSGVQKEPGCSSIEVNNKVH  510


 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/311 (27%), Positives = 158/311 (51%), Gaps = 41/311 (13%)
 Frame = +2

Query  26   PVVTALLQM-YANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            P++   LQ  +++ G ++ SR LFD     ++ +W+A+I  YA   +   A+ ++ +M  
Sbjct  66   PILNFKLQRSFSSLGRLDYSRSLFDRTHNPNVFSWTAIIHGYALHGRHQEAVVLYFQMLS  125

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM---------  355
               +PN F F S+L+AC      ++G+ +H+QV+K G  S+ ++ + L+D+         
Sbjct  126  NGVEPNAFTFSSILKACPP----ELGKALHSQVLKFGLDSDVYVRTALLDVYARGGDVVS  181

Query  356  ----------------------YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHG  469
                                  Y K G + + + +FD    +D++CW+ MI+GY  +G  
Sbjct  182  ACQLFNTMREKSVVSITAMITCYAKHGDLGEARVLFDGMEKRDVVCWNVMIDGYTQHGRP  241

Query  470  NEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYAC  649
            NE+L+ F  MLS  ++PN+V  ISVLSAC+  G   E   W H+  +   I   +     
Sbjct  242  NESLDLFRQMLSVKVRPNEVTMISVLSACAQLG-ALELGRWLHSYIKNNGIQVNVHIGTA  300

Query  650  MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISL--D  823
            +VDM  + G++++A    + M I  D   W +++ G    HG S+ + ++  ++ ++   
Sbjct  301  LVDMYCKCGSLDDARVVFDGM-INKDVVAWNSMIMG-YAMHGFSQSALVLFSKMCAMGFS  358

Query  824  PTNASYYVILS  856
            PT+ ++  +L+
Sbjct  359  PTDITFIGVLN  369


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 103/216 (48%), Gaps = 13/216 (6%)
 Frame = +2

Query  287  IHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGH  466
            IH  +++ G   +  L   L   +   GR+   +++FD   + ++  W+++I+GY ++G 
Sbjct  53   IHAAILRHGLEQHPILNFKLQRSFSSLGRLDYSRSLFDRTHNPNVFSWTAIIHGYALHGR  112

Query  467  GNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYA  646
              EA+  +  MLS+G++PN   F S+L AC       E     H+   K+ +   +    
Sbjct  113  HQEAVVLYFQMLSNGVEPNAFTFSSILKAC-----PPELGKALHSQVLKFGLDSDVYVRT  167

Query  647  CMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLI-SLD  823
             ++D+ +R G+V  A +  N M  +    I    +  C   HG  ++ E  A+ L   ++
Sbjct  168  ALLDVYARGGDVVSACQLFNTMREKSVVSI--TAMITCYAKHG--DLGE--ARVLFDGME  221

Query  824  PTNASYYVILSNLYADQGRWDE-VEKLRQLMDGKKR  928
              +   + ++ + Y   GR +E ++  RQ++  K R
Sbjct  222  KRDVVCWNVMIDGYTQHGRPNESLDLFRQMLSVKVR  257



>gb|EAZ03563.1| hypothetical protein OsI_25699 [Oryza sativa Indica Group]
Length=528

 Score =   274 bits (700),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 130/329 (40%), Positives = 212/329 (64%), Gaps = 6/329 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFG--NIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNA  175
            K GF +   VV  +L  YA  G  ++E +R +FD++ ++D+++W++MI+ YAQ+   + A
Sbjct  80   KIGFERNAGVVNTMLDSYAKGGSRDLEVARKVFDTM-ERDVVSWNSMIALYAQNGMSAEA  138

Query  176  LAVFRRMQLEHG--KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLI  349
            + ++ +M    G  K N  A  ++L AC+   A   G+ IH QV+++G   N ++ + ++
Sbjct  139  IGLYSKMLNVGGGIKCNAVALSAVLLACAHAGAIQTGKHIHNQVVRMGLEENVYVGTSIV  198

Query  350  DMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDV  529
            DMY K GR+      F +  +K+++ WS+MI GYGM+G G EALE F +M   G++PN +
Sbjct  199  DMYSKCGRVEMASRAFRKIKEKNILSWSAMITGYGMHGRGQEALEIFTEMKRSGLRPNYI  258

Query  530  VFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNK  709
             FISVL+ACSH GL  EG  W++AM++++ I   + HY CMVD+L R G ++EA   + +
Sbjct  259  TFISVLAACSHAGLLDEGRYWYNAMKQEFGIEAGVEHYGCMVDLLGRAGCLDEAYSLIKE  318

Query  710  MPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDE  889
            M ++PD  IWGALL+ CR  H + E++E+  K+L  LD +N+ YYV+LSN+YA+ G W +
Sbjct  319  MKVKPDAAIWGALLSACR-IHKNVELAEMSVKRLFELDASNSGYYVLLSNIYAEAGMWKD  377

Query  890  VEKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
            VE++R L+  ++ +K  GYS  E+   ++
Sbjct  378  VERIRLLVKTRRIEKPPGYSSFELKGKIY  406


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 111/232 (48%), Gaps = 9/232 (4%)
 Frame = +2

Query  80   SRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP--NEFAFHSLLQAC  253
            +R  FD +   + +  +AM S Y +++   ++L +FR M         +E A      A 
Sbjct  3    ARRAFDEIPDPNPVIVTAMASGYVRNNLVYHSLELFRAMIASDSASVVDEAAALVAFSAS  62

Query  254  SSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGR--IHQGKTIFDENPDKDLIC  427
            + +  + V  ++H  + K+G+  NA + + ++D Y K G   +   + +FD   ++D++ 
Sbjct  63   ARVPDRGVTASLHALIAKIGFERNAGVVNTMLDSYAKGGSRDLEVARKVFD-TMERDVVS  121

Query  428  WSSMINGYGMNGHGNEALECFLDMLS--HGIQPNDVVFISVLSACSHCGLEYEGWNWFHA  601
            W+SMI  Y  NG   EA+  +  ML+   GI+ N V   +VL AC+H G    G +  H 
Sbjct  122  WNSMIALYAQNGMSAEAIGLYSKMLNVGGGIKCNAVALSAVLLACAHAGAIQTGKH-IHN  180

Query  602  MEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
               +  +   +     +VDM S+ G VE A     K+  E +   W A++ G
Sbjct  181  QVVRMGLEENVYVGTSIVDMYSKCGRVEMASRAFRKIK-EKNILSWSAMITG  231



>ref|XP_010243344.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Nelumbo nucifera]
Length=584

 Score =   275 bits (704),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/325 (40%), Positives = 203/325 (62%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G     PV   L+++Y + G+ +S+RILFD +  +D  +W+ MIS YAQ+  P  ALA
Sbjct  139  KMGLDSETPVTNGLMRLYVSCGSTDSARILFDEMDDRDAGSWNVMISGYAQNGGPREALA  198

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +FR MQLE+ + + F   S++ AC  + A D+G+ +H+ + + G   +  L + L+DMY 
Sbjct  199  LFREMQLENVEIDGFTLASVVGACGHLGALDLGKWVHSYIDRKGVKVDVVLGTSLVDMYA  258

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +     +F +  ++D++ WS+MI  + ++GHG +ALE F  M    + PN V F S
Sbjct  259  KCGSLDDAHRVFQKMSERDVMAWSTMIGAFAIHGHGEKALEVFAGMKRARVIPNCVTFTS  318

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL ACSH GL  EG+  F++M  +Y I P++ HY CMVD+  R G + +A   +  MPIE
Sbjct  319  VLCACSHSGLVEEGFQNFNSMCSEYGIAPQIEHYGCMVDLFCRAGLISQAHALIKNMPIE  378

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            P+  +W  LL  C KTHG  E+ E ++K+++ L+P +   YV++SN+YA  G+W +V K+
Sbjct  379  PNVVLWRTLLGAC-KTHGYKELGEHISKEILRLEPHSGQNYVLVSNVYASLGKWSDVGKI  437

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R+LM  K+ +K  G+S +EVN ++H
Sbjct  438  RRLMKRKQARKEHGWSSIEVNFTVH  462


 Score =   118 bits (296),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 118/240 (49%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   GNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLL  244
            G+++ +  +F      ++  W+ +I  Y+ SD  + A++++R M       N F    +L
Sbjct  59   GHVDYAHRIFYWTHHPNLFMWNTIIRGYSLSDSSATAISLYRDMHASGLYANSFTVGFVL  118

Query  245  QACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLI  424
            +AC  +   D G+ IH+QV+K+G  S   + +GL+ +Y   G     + +FDE  D+D  
Sbjct  119  KACCRLLRLDEGKEIHSQVIKMGLDSETPVTNGLMRLYVSCGSTDSARILFDEMDDRDAG  178

Query  425  CWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAM  604
             W+ MI+GY  NG   EAL  F +M    ++ +     SV+ AC H G    G  W H+ 
Sbjct  179  SWNVMISGYAQNGGPREALALFREMQLENVEIDGFTLASVVGACGHLGALDLG-KWVHSY  237

Query  605  EEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSE  784
             ++  +   +     +VDM ++ G++++A     KM  E D   W  ++ G    HG  E
Sbjct  238  IDRKGVKVDVVLGTSLVDMYAKCGSLDDAHRVFQKMS-ERDVMAWSTMI-GAFAIHGHGE  295



>gb|KDO81629.1| hypothetical protein CISIN_1g007288mg [Citrus sinensis]
Length=609

 Score =   276 bits (705),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 130/324 (40%), Positives = 202/324 (62%), Gaps = 3/324 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   +PV+ ++L MY  F  +  +   FD +++KD+I W+ +I+ Y +S   S  L 
Sbjct  242  KHGFGSNLPVMNSILDMYCRFDCLSDANQYFDEMTEKDLITWNTIIAGYEKSGS-SECLN  300

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F +M+ E   PN F F S++ AC+++AA   G+ +H  +++ G   N  LA+ LIDMY 
Sbjct  301  MFSKMKSERFSPNCFTFTSIIAACATLAALSCGQQVHAGIVRRGLDGNLALANALIDMYA  360

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G I   + IF E  D+DL+ W+SM+ GYG +GHG EA+E F +M+  G++P+ +VF++
Sbjct  361  KCGNISDSQKIFSEMSDRDLVTWTSMMIGYGAHGHGKEAIELFDEMVKSGVRPDRIVFMA  420

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL+ACSH GL  EG  +F +M + Y++ P    Y C+VD+L R G V+EA E +  MP +
Sbjct  421  VLTACSHAGLVDEGLKYFKSMND-YNVNPNKEIYGCVVDLLGRAGRVKEAYELIKSMPFK  479

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD+ +WG LL  C K H    + +L A +++ L P     Y+ILSN+YA +G+W+E  K 
Sbjct  480  PDESVWGPLLGAC-KEHRLPNLGKLAALRVLDLKPNMMGTYIILSNIYAAEGKWEEFAKF  538

Query  902  RQLMDGKKRKKGMGYSVVEVNNSM  973
            R++M G   KK +G S +EV + +
Sbjct  539  RKIMRGMGSKKEVGMSWIEVRDKV  562


 Score =   128 bits (321),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 137/258 (53%), Gaps = 14/258 (5%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFG-NIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNAL  178
            K G    I V  +L+ +YA    +++++R++F+ +  K+ ++W+ +I+ YA S      L
Sbjct  140  KEGLEGSIYVENSLMDVYATCCISMDNARLVFNDMKWKNDVSWTTLITGYAHSGNGYGGL  199

Query  179  AVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VF+ M LE  + N ++F   ++AC+S      G+ IH  V+K G+ SN  + + ++DMY
Sbjct  200  GVFKEMLLEGVEMNPYSFSIAVRACASTGWVSFGKLIHAAVIKHGFGSNLPVMNSILDMY  259

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
            C+F  +      FDE  +KDLI W+++I GY  +G  +E L  F  M S    PN   F 
Sbjct  260  CRFDCLSDANQYFDEMTEKDLITWNTIIAGYEKSG-SSECLNMFSKMKSERFSPNCFTFT  318

Query  539  SVLSACS-----HCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFV  703
            S+++AC+      CG +       HA   +  +   LA    ++DM ++ GN+ ++ +  
Sbjct  319  SIIAACATLAALSCGQQ------VHAGIVRRGLDGNLALANALIDMYAKCGNISDSQKIF  372

Query  704  NKMPIEPDKRIWGALLAG  757
            ++M  + D   W +++ G
Sbjct  373  SEMS-DRDLVTWTSMMIG  389


 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/260 (28%), Positives = 129/260 (50%), Gaps = 4/260 (2%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            + T L++ Y + G IE +R LFD + ++D+++W+ MI+ Y   +  + A  VF  M    
Sbjct  48   LATNLIKSYFDEGLIEEARTLFDEMPERDVVSWTVMIAGYTSFNCHNQAWTVFVEMVRNE  107

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFG-RIHQG  385
              PN F   S+L+AC  M +      +H   +K G   + ++ + L+D+Y      +   
Sbjct  108  VNPNAFTLSSVLKACKGMKSLSNAALVHGMAIKEGLEGSIYVENSLMDVYATCCISMDNA  167

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC  565
            + +F++   K+ + W+++I GY  +G+G   L  F +ML  G++ N   F   + AC+  
Sbjct  168  RLVFNDMKWKNDVSWTTLITGYAHSGNGYGGLGVFKEMLLEGVEMNPYSFSIAVRACAST  227

Query  566  GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGA  745
            G    G    HA   K+     L     ++DM  R   + +A ++ ++M  E D   W  
Sbjct  228  GWVSFG-KLIHAAVIKHGFGSNLPVMNSILDMYCRFDCLSDANQYFDEM-TEKDLITWNT  285

Query  746  LLAGCRKTHGSSEISELVAK  805
            ++AG  K+ GSSE   + +K
Sbjct  286  IIAGYEKS-GSSECLNMFSK  304


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = +2

Query  326  AFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLS  505
            + LA+ LI  Y   G I + +T+FDE P++D++ W+ MI GY      N+A   F++M+ 
Sbjct  46   SILATNLIKSYFDEGLIEEARTLFDEMPERDVVSWTVMIAGYTSFNCHNQAWTVFVEMVR  105

Query  506  HGIQPNDVVFISVLSAC  556
            + + PN     SVL AC
Sbjct  106  NEVNPNAFTLSSVLKAC  122



>ref|XP_009337652.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g56570 [Pyrus x bretschneideri]
Length=609

 Score =   276 bits (705),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/325 (41%), Positives = 199/325 (61%), Gaps = 2/325 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   +PV+ ++L MY  FG +  +   F  +S++D+I W+ +IS Y + D P  +L 
Sbjct  241  KHGFESNLPVMNSILDMYCKFGCLSEANQCFHEISERDLITWNTLISGYERLD-PRESLR  299

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M  E   PN F + S++ AC+++A  + GE +H  +++ G   N  LA+ LIDMY 
Sbjct  300  IFSHMDSEGFSPNCFTYSSVISACANLAVLNCGEQVHGGIIRRGLDKNLALANALIDMYA  359

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G I      F+E  D++L+ W+SM+ GYG +G+G EA+E F  M+  GI+P+ +VF++
Sbjct  360  KCGSISNSHKTFNEMSDRNLVSWTSMMIGYGAHGYGKEAVEMFDKMVKSGIRPDQIVFMA  419

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VLSACSH GL  EG  +F +M   Y +TP    Y C+VD+L R G VEEA E +  MP +
Sbjct  420  VLSACSHAGLVDEGLRYFESMISDYKVTPDQDIYGCVVDLLGRGGRVEEAYELIESMPFK  479

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD+ +WGALL  C K H   ++ ++ A++L+ L P     YV+LSN+YA +G W E    
Sbjct  480  PDESVWGALLGAC-KAHELPQLRKVAAQRLLELTPNMVGTYVMLSNIYAAEGEWGEFANT  538

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R++M G   KK +G S +EV N ++
Sbjct  539  RKMMRGMGNKKEVGRSWIEVRNRVY  563


 Score =   130 bits (327),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/289 (29%), Positives = 150/289 (52%), Gaps = 9/289 (3%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANF-GNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNAL  178
            K G    I V  AL+ MYA    ++E + ++FD + +K+ ++W+ +I+ +         L
Sbjct  139  KRGMQGSIYVENALMDMYATCCASMEDACVVFDDICEKNDVSWTTLITGFTHRGDGYGGL  198

Query  179  AVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VF++M LE  + N F+F   ++AC+S+ +   G+ IH+ V+K G+ SN  + + ++DMY
Sbjct  199  RVFQQMLLEEAELNPFSFSIAVRACASIGSHSFGKQIHSAVIKHGFESNLPVMNSILDMY  258

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
            CKFG + +    F E  ++DLI W+++I+GY       E+L  F  M S G  PN   + 
Sbjct  259  CKFGCLSEANQCFHEISERDLITWNTLISGY-ERLDPRESLRIFSHMDSEGFSPNCFTYS  317

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            SV+SAC++  +   G    H    +  +   LA    ++DM ++ G++  + +  N+M  
Sbjct  318  SVISACANLAVLNCG-EQVHGGIIRRGLDKNLALANALIDMYAKCGSISNSHKTFNEM--  374

Query  719  EPDKRI--WGALLAGCRKTHGSSEISELVAKQLIS-LDPTNASYYVILS  856
              D+ +  W +++ G        E  E+  K + S + P    +  +LS
Sbjct  375  -SDRNLVSWTSMMIGYGAHGYGKEAVEMFDKMVKSGIRPDQIVFMAVLS  422


 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/244 (28%), Positives = 120/244 (49%), Gaps = 3/244 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            + T L++ + + G I+ +R +FD + ++D+IAW+AMI+ Y      ++A A+F  M    
Sbjct  47   LATNLIKSHFDKGLIKEARQVFDEMPERDVIAWTAMIAGYTSCSHHNHAWAMFCEMVRNG  106

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK-FGRIHQG  385
             +PN F F S+L+AC  M A   G  +H   +K G   + ++ + L+DMY      +   
Sbjct  107  MEPNAFTFSSVLKACKGMGALSCGALVHGSAVKRGMQGSIYVENALMDMYATCCASMEDA  166

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC  565
              +FD+  +K+ + W+++I G+   G G   L  F  ML    + N   F   + AC+  
Sbjct  167  CVVFDDICEKNDVSWTTLITGFTHRGDGYGGLRVFQQMLLEEAELNPFSFSIAVRACASI  226

Query  566  GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGA  745
            G    G    H+   K+     L     ++DM  + G + EA +  +++  E D   W  
Sbjct  227  GSHSFG-KQIHSAVIKHGFESNLPVMNSILDMYCKFGCLSEANQCFHEIS-ERDLITWNT  284

Query  746  LLAG  757
            L++G
Sbjct  285  LISG  288



>ref|XP_002267596.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540 
[Vitis vinifera]
Length=623

 Score =   276 bits (706),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/339 (38%), Positives = 214/339 (63%), Gaps = 1/339 (0%)
 Frame = +2

Query  35    TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
             T++++ +   G++ES+R LFD + +K+++ WS MIS YAQ++    A+ +F+ +Q +  +
Sbjct  189   TSMIRGFNKCGDVESARKLFDQMPEKNLVTWSTMISGYAQNNHFDKAVELFKVLQSQGVR  248

Query  215   PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
              NE    S++ +C+ + A ++GE  H  V+K G T N  L + L+DMY + G I +   +
Sbjct  249   ANETVMVSVISSCAHLGALELGERAHDYVVKNGMTLNLILGTALVDMYARCGSIDKAVWV  308

Query  395   FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
             F++ P++D + W+++I G  M+G+   +L+ F  M+  G+ P D+ F +VLSACSH GL 
Sbjct  309   FEDLPERDTLSWTALIAGLAMHGYSERSLKYFATMVEAGLTPRDITFTAVLSACSHGGLV  368

Query  575   YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
               G+  F +M+  + + P+L HY CMVD+L R G +EEA  FV KMP++P+  +WGALL 
Sbjct  369   ERGFQIFESMKRDHRVEPRLEHYGCMVDLLGRAGKLEEAERFVLKMPVKPNAPVWGALLG  428

Query  755   GCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKK  934
              CR  H ++EI E V K LI L P ++ YYV+LSN+YA+   W++V ++RQ+M  K  KK
Sbjct  429   ACR-IHKNAEIGERVGKILIQLLPQHSGYYVLLSNIYANAKEWEKVTEMRQMMKAKGLKK  487

Query  935   GMGYSVVEVNNSMHRMEF**RSEQEYIQHSRVIIDVLHR  1051
               G+S++E++  +H+      S  E  +  R+  ++L R
Sbjct  488   PPGHSLIELDGRVHKFTIGDSSHPEMDKIERMWEEILMR  526


 Score =   108 bits (270),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 76/293 (26%), Positives = 133/293 (45%), Gaps = 37/293 (13%)
 Frame = +2

Query  77   SSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACS  256
            +SRI F  +   ++  ++AMI  ++ S  P  A   + + Q +   P+   F  L+++C+
Sbjct  72   ASRI-FSQIQNPNLFIFNAMIRGHSGSKNPDQAFHFYVQSQRQGLLPDNLTFPFLVKSCT  130

Query  257  SMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSS  436
             +    +G   H  ++K G+  + ++ + L+ MY  FG       IF      D++ W+S
Sbjct  131  KLHCISMGSQAHGHIIKHGFEKDVYVQNSLVHMYATFGDTEAATLIFQRMYYVDVVSWTS  190

Query  437  -------------------------------MINGYGMNGHGNEALECFLDMLSHGIQPN  523
                                           MI+GY  N H ++A+E F  + S G++ N
Sbjct  191  MIRGFNKCGDVESARKLFDQMPEKNLVTWSTMISGYAQNNHFDKAVELFKVLQSQGVRAN  250

Query  524  DVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFV  703
            + V +SV+S+C+H G   E     H    K  +T  L     +VDM +R G++++A+   
Sbjct  251  ETVMVSVISSCAHLG-ALELGERAHDYVVKNGMTLNLILGTALVDMYARCGSIDKAVWVF  309

Query  704  NKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLI--SLDPTNASYYVILS  856
              +P E D   W AL+AG    HG SE S      ++   L P + ++  +LS
Sbjct  310  EDLP-ERDTLSWTALIAGL-AMHGYSERSLKYFATMVEAGLTPRDITFTAVLS  360



>ref|XP_007205016.1| hypothetical protein PRUPE_ppa003703mg [Prunus persica]
 gb|EMJ06215.1| hypothetical protein PRUPE_ppa003703mg [Prunus persica]
Length=555

 Score =   274 bits (701),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)
 Frame = +2

Query  17   KCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM  196
            K +  +TA++  YA  G +E +R+LFD + ++D++ W+ MI  YAQ   P+ AL +FR+M
Sbjct  115  KSLVSLTAMITCYAKRGEVEEARVLFDGMEERDVVCWNVMIDGYAQHGMPNEALLLFRKM  174

Query  197  QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
             +   KPNE    SLL AC  + A + G  +H+ +   G   N  + + LIDMY K G +
Sbjct  175  LVAKIKPNELTVLSLLSACGQLGALESGRWLHSYIENNGIQVNTHVGTALIDMYSKCGSL  234

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
                 +FD   +KD++ W+SMI GY M+G   +AL+ F +M     QP D+ FI VLSAC
Sbjct  235  EDACLVFDMIDEKDVVAWNSMIVGYAMHGFSRDALQLFHEMCRLSCQPTDITFIGVLSAC  294

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
            ++ GL  EG  +F +M+++Y I PK+ HY CMV++LSR G +EEA EFV  M I+PD  +
Sbjct  295  AYAGLVSEGRAFFSSMKDEYGIEPKIEHYGCMVNLLSRAGQLEEAYEFVKNMKIDPDPVL  354

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            WG LL  CR  HG+  + E +A+ L+  +  N+  +++LSN+YA  G WD V ++R LM 
Sbjct  355  WGTLLGACR-LHGNITLGEEIAEFLLGQNLANSGTFILLSNIYAAAGNWDGVARVRTLMK  413

Query  917  GKKRKKGMGYSVVEVNNSMH  976
                +K  G S +EV+N +H
Sbjct  414  HSGIQKEPGCSSIEVDNKVH  433


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 87/196 (44%), Gaps = 36/196 (18%)
 Frame = +2

Query  368  GRIHQGKTIFDENPDK-------------------------------DLICWSSMINGYG  454
            G +   + +FD  P+K                               D++CW+ MI+GY 
Sbjct  100  GDVVSARQLFDTMPEKSLVSLTAMITCYAKRGEVEEARVLFDGMEERDVVCWNVMIDGYA  159

Query  455  MNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKL  634
             +G  NEAL  F  ML   I+PN++  +S+LSAC   G   E   W H+  E   I    
Sbjct  160  QHGMPNEALLLFRKMLVAKIKPNELTVLSLLSACGQLG-ALESGRWLHSYIENNGIQVNT  218

Query  635  AHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQL-  811
                 ++DM S+ G++E+A   V  M  E D   W +++ G    HG S  +  +  ++ 
Sbjct  219  HVGTALIDMYSKCGSLEDAC-LVFDMIDEKDVVAWNSMIVG-YAMHGFSRDALQLFHEMC  276

Query  812  -ISLDPTNASYYVILS  856
             +S  PT+ ++  +LS
Sbjct  277  RLSCQPTDITFIGVLS  292



>ref|XP_004973954.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like [Setaria italica]
Length=1088

 Score =   284 bits (726),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/325 (40%), Positives = 207/325 (64%), Gaps = 2/325 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++G  K +PV  AL++MY   GN E +R++FD ++ +DII+W+ +I  Y++++  + + +
Sbjct  644  RNGIEKLLPVANALMEMYVRCGNTEEARLIFDRVTNRDIISWNTLIGGYSRNNLANESFS  703

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M L+  KPN      +L A +S+++ + G  IH   ++ GY  + + ++ L+DMY 
Sbjct  704  LFIDMLLQF-KPNAVTMTCILPAAASLSSLERGREIHAYALRRGYLEDNYTSNALVDMYV  762

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +   + +FD    K+LI W+ MI GYGM+GHG +A+  F  M   G++P+   F +
Sbjct  763  KCGALMVARLLFDRLTKKNLISWTIMIAGYGMHGHGKDAIALFEQMRGSGVEPDSASFSA  822

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L AC H GL  EGW +F+AM  ++ I PKL HYAC+VD+LS  GN++EA EF+  MPIE
Sbjct  823  ILYACCHSGLRNEGWRFFNAMRNEHKIEPKLKHYACIVDLLSHTGNLKEAFEFIESMPIE  882

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD  IW +LL GCR  H   +++E VA ++  L+P N  YYV+LSN+YA+  RW+ V+KL
Sbjct  883  PDSSIWVSLLHGCR-IHRDVKLAEKVADRVFKLEPENTGYYVLLSNIYAEAERWEAVKKL  941

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            +  + G+  ++  G S +EV   ++
Sbjct  942  KNKIGGRGLRENTGCSWIEVRGKVY  966


 Score =   116 bits (291),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/285 (27%), Positives = 141/285 (49%), Gaps = 4/285 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G +  I +  ALL MY+N  +  S+  +F+S+ QK++++W+AMI++Y ++        
Sbjct  543  KTGLVGEISLANALLDMYSNCSDWHSTNQIFESMDQKNVVSWTAMITSYTRAGLFDKVGG  602

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            + + M L+  +P+ FA  S L A +S  +   G+++H   ++ G      +A+ L++MY 
Sbjct  603  LLQEMVLDGIRPDVFAVTSALHAFASDESLKQGKSVHGYAIRNGIEKLLPVANALMEMYV  662

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            + G   + + IFD   ++D+I W+++I GY  N   NE+   F+DML    +PN V    
Sbjct  663  RCGNTEEARLIFDRVTNRDIISWNTLIGGYSRNNLANESFSLFIDMLLQ-FKPNAVTMTC  721

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L A +      E     HA   +            +VDM  + G +  A    +++  +
Sbjct  722  ILPAAASLS-SLERGREIHAYALRRGYLEDNYTSNALVDMYVKCGALMVARLLFDRLT-K  779

Query  722  PDKRIWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             +   W  ++AG     HG   I+     +   ++P +AS+  IL
Sbjct  780  KNLISWTIMIAGYGMHGHGKDAIALFEQMRGSGVEPDSASFSAIL  824


 Score =   105 bits (263),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 132/279 (47%), Gaps = 5/279 (2%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQK-DIIAWSAMISAYAQSDQPSNALAVFRRMQLEHG  211
            + L+ MY   G++ S+R +FD +S K ++  W+ ++  YA++ +   +L +F +M     
Sbjct  351  SKLVFMYVKCGDMASARTVFDVMSSKSNVHVWNLLMGGYAKAGEFQESLLLFEQMHDLGI  410

Query  212  KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKT  391
             P+E     LL+  +S+     G   H  ++KLG+ +   + + LI  Y K  RI     
Sbjct  411  TPDEHTISCLLKCITSLFRVRDGLMAHGYLIKLGFGAQCAVCNALISFYAKSNRIEDALE  470

Query  392  IFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGL  571
            +FD  P +D+I W+S+I+G   NG  NEA+E FL M   G + +    +SVL ACS    
Sbjct  471  VFDGMPHQDIISWNSIISGCTSNGLNNEAIELFLTMWIQGQELDSATLLSVLPACSQSCY  530

Query  572  EYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALL  751
             + G    H    K  +  +++    ++DM S   +     +    M  + +   W A++
Sbjct  531  WFLG-RGLHGYSVKTGLVGEISLANALLDMYSNCSDWHSTNQIFESMD-QKNVVSWTAMI  588

Query  752  AGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYA  868
                +     ++  L+  Q + LD      + + S L+A
Sbjct  589  TSYTRAGLFDKVGGLL--QEMVLDGIRPDVFAVTSALHA  625


 Score = 97.1 bits (240),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 73/284 (26%), Positives = 125/284 (44%), Gaps = 2/284 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     V  AL+  YA    IE +  +FD +  +DII+W+++IS    +   + A+ 
Sbjct  442  KLGFGAQCAVCNALISFYAKSNRIEDALEVFDGMPHQDIISWNSIISGCTSNGLNNEAIE  501

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M ++  + +     S+L ACS      +G  +H   +K G      LA+ L+DMY 
Sbjct  502  LFLTMWIQGQELDSATLLSVLPACSQSCYWFLGRGLHGYSVKTGLVGEISLANALLDMYS  561

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
                 H    IF+    K+++ W++MI  Y   G  ++      +M+  GI+P+     S
Sbjct  562  NCSDWHSTNQIFESMDQKNVVSWTAMITSYTRAGLFDKVGGLLQEMVLDGIRPDVFAVTS  621

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
             L A +      +G +  H    +  I   L     +++M  R GN EEA    +++   
Sbjct  622  ALHAFASDESLKQGKS-VHGYAIRNGIEKLLPVANALMEMYVRCGNTEEARLIFDRVT-N  679

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             D   W  L+ G  + + ++E   L    L+   P   +   IL
Sbjct  680  RDIISWNTLIGGYSRNNLANESFSLFIDMLLQFKPNAVTMTCIL  723


 Score = 94.7 bits (234),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 71/274 (26%), Positives = 127/274 (46%), Gaps = 13/274 (5%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQK--DIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
            L+ MY    ++ S+R +FD +  +  D+  W++++SAYA++      + +FR+M      
Sbjct  140  LVLMYLKCSDLGSARRVFDEMPPQVADVRVWTSLMSAYAKAGDFQEGVLLFRQMHCCGVS  199

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
             +  A   +L+  +S+ +   GE +   + KLG      + + LI +Y + GR+     +
Sbjct  200  LDAHAISCVLKCIASLGSIMDGEVVRGLLEKLGLGEECAVTNALIAVYTRCGRMEDAMQV  259

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            F+    +D I W+SMI+G   NG    A++ F  M S G++ + V  +SVL AC   G E
Sbjct  260  FNSMHSRDAISWNSMISGCFSNGWHGRAVDLFSKMWSEGVEISSVTMVSVLPACVELGYE  319

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVD---------MLSRQGNVEEALEFVNKMPIEPD  727
              G    H    K  +  +L      +D         M  + G++  A    + M  + +
Sbjct  320  LVG-KVVHGYSVKAGLLWELESLERGIDEVLGSKLVFMYVKCGDMASARTVFDVMSSKSN  378

Query  728  KRIWGALLAGCRKTHGSSEISELVAKQLISLDPT  829
              +W  L+ G  K  G  + S L+ +Q+  L  T
Sbjct  379  VHVWNLLMGGYAKA-GEFQESLLLFEQMHDLGIT  411


 Score = 90.1 bits (222),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 71/275 (26%), Positives = 121/275 (44%), Gaps = 12/275 (4%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G  +   V  AL+ +Y   G +E +  +F+S+  +D I+W++MIS    +     A+ 
Sbjct  230  KLGLGEECAVTNALIAVYTRCGRMEDAMQVFNSMHSRDAISWNSMISGCFSNGWHGRAVD  289

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYT---------SNAFL  334
            +F +M  E  + +     S+L AC  +  + VG+ +H   +K G            +  L
Sbjct  290  LFSKMWSEGVEISSVTMVSVLPACVELGYELVGKVVHGYSVKAGLLWELESLERGIDEVL  349

Query  335  ASGLIDMYCKFGRIHQGKTIFDENPDKDLI-CWSSMINGYGMNGHGNEALECFLDMLSHG  511
             S L+ MY K G +   +T+FD    K  +  W+ ++ GY   G   E+L  F  M   G
Sbjct  350  GSKLVFMYVKCGDMASARTVFDVMSSKSNVHVWNLLMGGYAKAGEFQESLLLFEQMHDLG  409

Query  512  IQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEA  691
            I P++   IS L  C             H    K     + A    ++   ++   +E+A
Sbjct  410  ITPDEHT-ISCLLKCITSLFRVRDGLMAHGYLIKLGFGAQCAVCNALISFYAKSNRIEDA  468

Query  692  LEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISEL  796
            LE  + MP   D   W ++++GC     ++E  EL
Sbjct  469  LEVFDGMP-HQDIISWNSIISGCTSNGLNNEAIEL  502



>gb|KHN48006.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=877

 Score =   281 bits (719),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/313 (43%), Positives = 200/313 (64%), Gaps = 2/313 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            +PV  AL+ MYA  G++E + ++F  L  K+I++W+ MI  Y+Q+  P+ AL +F  MQ 
Sbjct  440  LPVSNALMNMYAKCGSMEEANLIFSQLPVKNIVSWNTMIGGYSQNSLPNEALQLFLDMQ-  498

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            +  KP++     +L AC+ +AA + G  IH  +++ GY S+  +A  L+DMY K G +  
Sbjct  499  KQLKPDDVTMACVLPACAGLAALEKGREIHGHILRKGYFSDLHVACALVDMYVKCGLLVL  558

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + +FD  P KD+I W+ MI GYGM+G G EA+  F  M   GI+P +  F S+L AC+H
Sbjct  559  AQQLFDMIPKKDMILWTVMIAGYGMHGFGKEAISTFEKMRVAGIEPEESSFTSILYACTH  618

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             GL  EGW  F +M+ + +I PKL HYACMVD+L R GN+  A +F+  MPI+PD  IWG
Sbjct  619  SGLLKEGWKLFDSMKSECNIEPKLEHYACMVDLLIRSGNLSRAYKFIETMPIKPDAAIWG  678

Query  743  ALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGK  922
            ALL+GCR  H   E++E VA+ +  L+P N  YYV+L+N+YA+  +W+EV+K+++ +   
Sbjct  679  ALLSGCR-IHHDVELAEKVAEHIFELEPENTRYYVLLANVYAEAEKWEEVKKIQRRISKG  737

Query  923  KRKKGMGYSVVEV  961
              K   G S +EV
Sbjct  738  GLKNDQGCSWIEV  750


 Score =   130 bits (327),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 150/293 (51%), Gaps = 20/293 (7%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+GF   +     LL MY+  GN+  +  +F  + +  I++W+++I+A+ +      A+ 
Sbjct  332  KAGFSGGVMFNNTLLDMYSKCGNLNGANEVFVKMGETTIVSWTSIIAAHVREGLHYEAIG  391

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  MQ +  +P+ +A  S++ AC+   + D G  +H  + K    SN  +++ L++MY 
Sbjct  392  LFDEMQSKGLRPDIYAVTSVVHACACSNSLDKGREVHNHIKKNNMGSNLPVSNALMNMYA  451

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G + +   IF + P K+++ W++MI GY  N   NEAL+ FLDM    ++P+DV    
Sbjct  452  KCGSMEEANLIFSQLPVKNIVSWNTMIGGYSQNSLPNEALQLFLDMQKQ-LKPDDVTMAC  510

Query  542  VLSACSHC-----GLEYEGWNWFHAMEEKY--DITPKLAHYAC-MVDMLSRQGNVEEALE  697
            VL AC+       G E  G    H + + Y  D+     H AC +VDM  + G +  A +
Sbjct  511  VLPACAGLAALEKGREIHG----HILRKGYFSDL-----HVACALVDMYVKCGLLVLAQQ  561

Query  698  FVNKMPIEPDKRIWGALLAG-CRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
              + +P + D  +W  ++AG      G   IS     ++  ++P  +S+  IL
Sbjct  562  LFDMIP-KKDMILWTVMIAGYGMHGFGKEAISTFEKMRVAGIEPEESSFTSIL  613


 Score =   115 bits (289),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 121/239 (51%), Gaps = 2/239 (1%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            L+ MY N G++   R +FD +    I  W+ ++S YA+      ++ +F +MQ    + +
Sbjct  143  LVFMYVNCGDLVKGRRIFDGILNDKIFLWNLLMSEYAKIGNYRESVGLFEKMQELGIRGD  202

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
             + F  +L+  ++ A     + +H  V+KLG+ S   + + LI  Y K G +   + +FD
Sbjct  203  SYTFTCVLKCFAASAKVRECKRVHGYVLKLGFGSYNAVVNSLIAAYFKCGEVESARILFD  262

Query  401  ENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYE  580
            E  D+D++ W+SMI+G  MNG     LE F+ ML+ G+  +    ++VL AC++ G    
Sbjct  263  ELSDRDVVSWNSMISGCTMNGFSRNGLEFFIQMLNLGVDVDSATLVNVLVACANVGNLTL  322

Query  581  GWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            G    HA   K   +  +     ++DM S+ GN+  A E   KM  E     W +++A 
Sbjct  323  G-RALHAYGVKAGFSGGVMFNNTLLDMYSKCGNLNGANEVFVKMG-ETTIVSWTSIIAA  379


 Score =   112 bits (280),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 139/284 (49%), Gaps = 2/284 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     VV +L+  Y   G +ES+RILFD LS +D+++W++MIS    +    N L 
Sbjct  231  KLGFGSYNAVVNSLIAAYFKCGEVESARILFDELSDRDVVSWNSMISGCTMNGFSRNGLE  290

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             F +M       +     ++L AC+++    +G  +H   +K G++      + L+DMY 
Sbjct  291  FFIQMLNLGVDVDSATLVNVLVACANVGNLTLGRALHAYGVKAGFSGGVMFNNTLLDMYS  350

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G ++    +F +  +  ++ W+S+I  +   G   EA+  F +M S G++P+     S
Sbjct  351  KCGNLNGANEVFVKMGETTIVSWTSIIAAHVREGLHYEAIGLFDEMQSKGLRPDIYAVTS  410

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            V+ AC+ C    +     H   +K ++   L     +++M ++ G++EEA    +++P++
Sbjct  411  VVHACA-CSNSLDKGREVHNHIKKNNMGSNLPVSNALMNMYAKCGSMEEANLIFSQLPVK  469

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             +   W  ++ G  +    +E  +L       L P + +   +L
Sbjct  470  -NIVSWNTMIGGYSQNSLPNEALQLFLDMQKQLKPDDVTMACVL  512


 Score = 58.9 bits (141),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 75/162 (46%), Gaps = 24/162 (15%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            + G+   + V  AL+ MY   G +  ++ LFD + +KD+I W+ MI+ Y        A++
Sbjct  533  RKGYFSDLHVACALVDMYVKCGLLVLAQQLFDMIPKKDMILWTVMIAGYGMHGFGKEAIS  592

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASG------  343
             F +M++   +P E +F S+L AC+           H+ ++K G+     + S       
Sbjct  593  TFEKMRVAGIEPEESSFTSILYACT-----------HSGLLKEGWKLFDSMKSECNIEPK  641

Query  344  ------LIDMYCKFGRIHQGKTIFDENPDK-DLICWSSMING  448
                  ++D+  + G + +     +  P K D   W ++++G
Sbjct  642  LEHYACMVDLLIRSGNLSRAYKFIETMPIKPDAAIWGALLSG  683


 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 90/211 (43%), Gaps = 4/211 (2%)
 Frame = +2

Query  128  SAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMK  307
            +A I  + +     NA+ +  R Q    + N +   S+LQ C+ + + + G+ +H+ +  
Sbjct  73   NAKICKFCEMGDLRNAMKLLSRSQRSELELNTYC--SVLQLCAELKSLEDGKRVHSIISS  130

Query  308  LGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALEC  487
             G   +    + L+ MY   G + +G+ IFD   +  +  W+ +++ Y   G+  E++  
Sbjct  131  NGMAIDEVFGAKLVFMYVNCGDLVKGRRIFDGILNDKIFLWNLLMSEYAKIGNYRESVGL  190

Query  488  FLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLS  667
            F  M   GI+ +   F  VL  C     +       H    K       A    ++    
Sbjct  191  FEKMQELGIRGDSYTFTCVLK-CFAASAKVRECKRVHGYVLKLGFGSYNAVVNSLIAAYF  249

Query  668  RQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
            + G VE A    +++  + D   W ++++GC
Sbjct  250  KCGEVESARILFDELS-DRDVVSWNSMISGC  279



>ref|XP_003572732.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Brachypodium distachyon]
Length=669

 Score =   277 bits (708),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/329 (40%), Positives = 211/329 (64%), Gaps = 6/329 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFG--NIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNA  175
            K+G      VV  +L  YA  G  ++ ++R +FD++ +KD+++W++MI+ YAQ+   ++A
Sbjct  221  KTGLDGDAGVVNTMLDAYAKGGRRDLGAARKVFDTM-EKDVVSWNSMIALYAQNGMSADA  279

Query  176  LAVFRRMQLEHG--KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLI  349
            L ++R+M    G  K N     ++L AC+       G+ IH QV+++G   N ++ + ++
Sbjct  280  LGLYRKMLNVSGSIKCNAVTLSAILLACAHAGTIQTGKCIHNQVVRMGLEENVYVGTSVV  339

Query  350  DMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDV  529
            DMY K GR+   +  F +  +K+++ WS+MI GYGM+GHG EAL+ F +M   G  PN +
Sbjct  340  DMYSKCGRVEMARKAFQKIKEKNILSWSAMITGYGMHGHGQEALDIFNEMCRSGQNPNYI  399

Query  530  VFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNK  709
             FISVL+ACSH GL  +G  W++AM++++ I P + HY CMVD+L R G ++EA   + +
Sbjct  400  TFISVLAACSHAGLLDKGRYWYNAMKKRFGIEPGVEHYGCMVDLLGRAGCLDEAYGLIKE  459

Query  710  MPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDE  889
            M ++PD  IWGALL+ CR  H + E++E+ AK+L  LD TN  YYV+LSN+YA+ G W +
Sbjct  460  MKVKPDAAIWGALLSACR-IHKNVELAEISAKRLFELDATNCGYYVLLSNIYAEAGMWKD  518

Query  890  VEKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
            VE++R L+  +  +K  GYS VE+    H
Sbjct  519  VERMRVLVKTRGIEKPPGYSSVELKGRTH  547


 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 74/259 (29%), Positives = 121/259 (47%), Gaps = 10/259 (4%)
 Frame = +2

Query  2    KSGFLKCIPV-VTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNAL  178
            +SG     P   +ALL MY +      +R  FD +   + +  +AM S Y +++    +L
Sbjct  117  RSGLFPSDPFSASALLHMYNHCSRPIDARKAFDEIPSPNPVIITAMASGYVRNNLVYPSL  176

Query  179  AVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGET--IHTQVMKLGYTSNAFLASGLID  352
            A+FR++             +L+   +S    D G T  +H  V+K G   +A + + ++D
Sbjct  177  ALFRKLIASGSATAVDEAAALVAFSASARIPDCGITSSLHALVVKTGLDGDAGVVNTMLD  236

Query  353  MYCKFGRIHQG--KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDML--SHGIQP  520
             Y K GR   G  + +FD   +KD++ W+SMI  Y  NG   +AL  +  ML  S  I+ 
Sbjct  237  AYAKGGRRDLGAARKVFD-TMEKDVVSWNSMIALYAQNGMSADALGLYRKMLNVSGSIKC  295

Query  521  NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEF  700
            N V   ++L AC+H G    G    H    +  +   +     +VDM S+ G VE A + 
Sbjct  296  NAVTLSAILLACAHAGTIQTG-KCIHNQVVRMGLEENVYVGTSVVDMYSKCGRVEMARKA  354

Query  701  VNKMPIEPDKRIWGALLAG  757
              K+  E +   W A++ G
Sbjct  355  FQKIK-EKNILSWSAMITG  372



>ref|XP_010258198.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03380, 
mitochondrial [Nelumbo nucifera]
Length=711

 Score =   278 bits (710),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/315 (43%), Positives = 203/315 (64%), Gaps = 3/315 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V  AL+ MYA    I  +R +F ++  KD++AW++MIS Y+Q+     AL++FR+M+ + 
Sbjct  387  VKNALVDMYAKCHMIGGARSIFQTILDKDVVAWNSMISGYSQNGSYCEALSLFRQMR-DI  445

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYT-SNAFLASGLIDMYCKFGRIHQG  385
              P+     S+L AC  + A  VG +IH   +K G   SN ++ + L++ Y K G     
Sbjct  446  VSPDAVTVVSVLSACVCLGALRVGCSIHAYAVKQGLLLSNVYVGTSLVNFYAKCGDTGSA  505

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC  565
            +  FDE   K+ + WS+M+ GYGM+G   E+L  F +MLS  ++PN+V+F S+LSACSH 
Sbjct  506  RRAFDEMALKNTVTWSAMVAGYGMHGDARESLSLFSEMLSESLEPNEVIFTSILSACSHT  565

Query  566  GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGA  745
            G+  EGW +F +M ++Y+ TP + HYACMVD+LSR G +EEAL F+ +MP++PD  ++GA
Sbjct  566  GMVGEGWRYFDSMCQEYNFTPSMKHYACMVDLLSRAGKLEEALAFIERMPVQPDVSVFGA  625

Query  746  LLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKK  925
            LL GCR  H   +I E+  ++++ L P  A YYV++SNLYA  GRW++  +LR+LM  + 
Sbjct  626  LLHGCR-LHSRLDIGEVAIRRMLELQPNGAGYYVLISNLYASDGRWEKANELRELMKERG  684

Query  926  RKKGMGYSVVEVNNS  970
              K  G S+VEV+ S
Sbjct  685  LSKSPGCSLVEVDYS  699


 Score =   135 bits (339),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/276 (29%), Positives = 139/276 (50%), Gaps = 3/276 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V+T L+ MYA  G +E SR +F+ +  +++++W++MI  Y Q+D     L +F +M+ E 
Sbjct  186  VLTGLIDMYAKCGEVECSRSVFEEIPDRNVVSWTSMIMGYVQNDFSIEGLVLFNQMRREX  245

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             + N+F    LL AC  + A   G+ +H  ++K G   N+F+ + L+ MY K G +   +
Sbjct  246  IEANQFTVGGLLTACIKLGALHQGKWVHGYIIKQGIEFNSFVVTTLLXMYTKCGVVKDAR  305

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
            ++FDE    DL+ W++MI GY    + +EAL+ F D     + PN +   SVLSAC+  G
Sbjct  306  SVFDELSTIDLVSWTAMIVGYTQRSYPHEALKLFTDKKXEDLLPNSITIASVLSACAQMG  365

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
                G    H++  K  +       A +VDM ++   +  A      + ++ D   W ++
Sbjct  366  NSNIG-RPVHSLGIKLGLLDGTVKNA-LVDMYAKCHMIGGARSIFQTI-LDKDVVAWNSM  422

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILS  856
            ++G  +     E   L  +    + P   +   +LS
Sbjct  423  ISGYSQNGSYCEALSLFRQMRDIVSPDAVTVVSVLS  458


 Score =   123 bits (309),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 74/275 (27%), Positives = 138/275 (50%), Gaps = 4/275 (1%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
            T L+ +Y +FG++E +R++FD +   D+ +W  MI  Y  +D  S  +  +  M+    +
Sbjct  88   TKLVSLYGSFGDVECARLVFDRIRNPDLYSWKVMIRWYFLNDCYSEIIPFYTCMRQCLRE  147

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
             +   F  +L+ C+ +   D G  +H+ V+K+G   ++F+ +GLIDMY K G +   +++
Sbjct  148  LDNIVFSIVLKTCTELHDIDEGRKLHSHVVKVG-NPDSFVLTGLIDMYAKCGEVECSRSV  206

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            F+E PD++++ W+SMI GY  N    E L  F  M    I+ N      +L+AC   G  
Sbjct  207  FEEIPDRNVVSWTSMIMGYVQNDFSIEGLVLFNQMRREXIEANQFTVGGLLTACIKLGAL  266

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
            ++G  W H    K  I         ++ M ++ G V++A    +++    D   W A++ 
Sbjct  267  HQG-KWVHGYIIKQGIEFNSFVVTTLLXMYTKCGVVKDARSVFDELS-TIDLVSWTAMIV  324

Query  755  G-CRKTHGSSEISELVAKQLISLDPTNASYYVILS  856
            G  ++++    +     K+   L P + +   +LS
Sbjct  325  GYTQRSYPHEALKLFTDKKXEDLLPNSITIASVLS  359


 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 87/185 (47%), Gaps = 10/185 (5%)
 Frame = +2

Query  11   FLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFR  190
             L  + V T+L+  YA  G+  S+R  FD ++ K+ + WSAM++ Y        +L++F 
Sbjct  482  LLSNVYVGTSLVNFYAKCGDTGSARRAFDEMALKNTVTWSAMVAGYGMHGDARESLSLFS  541

Query  191  RMQLEHGKPNEFAFHSLLQACSSMAAQDVG-ETIHTQVMKLGYTSNAFLASGLIDMYCKF  367
             M  E  +PNE  F S+L ACS       G     +   +  +T +    + ++D+  + 
Sbjct  542  EMLSESLEPNEVIFTSILSACSHTGMVGEGWRYFDSMCQEYNFTPSMKHYACMVDLLSRA  601

Query  368  GRIHQGKTIFDENP-DKDLICWSSMINGYGMNGH---GNEALECFLDMLSHGIQPNDVVF  535
            G++ +     +  P   D+  + ++++G  ++     G  A+   L++     QPN   +
Sbjct  602  GKLEEALAFIERMPVQPDVSVFGALLHGCRLHSRLDIGEVAIRRMLEL-----QPNGAGY  656

Query  536  ISVLS  550
              ++S
Sbjct  657  YVLIS  661



>ref|XP_008371807.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Malus domestica]
Length=622

 Score =   276 bits (705),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/336 (38%), Positives = 212/336 (63%), Gaps = 1/336 (0%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             ++GF   + V  ALL +YA  G++ES+  +F+S+S++D++AW+++I+A+A + +P+ AL 
Sbjct  177   RNGFESLVFVKNALLHVYACCGHVESAHKVFESMSERDLVAWNSVINAFALNGRPNEALT  236

Query  182   VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             +FR M LE  +P+ F   SLL AC+ +    +G  IH  ++K+G T N+   + L+D+Y 
Sbjct  237   IFRDMSLEGVEPDGFTMVSLLSACAEIGTLALGRRIHVYMLKVGLTGNSHATNALLDLYA  296

Query  362   KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
             K G I + + +F+   ++ ++ W++++ G  +NG G EALE F ++   G+ P ++ F+ 
Sbjct  297   KCGSIREAQKVFEVMDERSVVSWTALVVGLAVNGFGMEALELFKELKGEGLVPTEITFVG  356

Query  542   VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
             VL ACSHCG+  EG+ +F  M+E Y I P++ HY CMVD+L R G V+ A E++  MP++
Sbjct  357   VLYACSHCGMVDEGFEYFRMMKEGYGIAPRIEHYGCMVDLLGRAGLVKRAYEYIMNMPMK  416

Query  722   PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
             P+  IW  LL  C   HG   + E    ++  L+P ++  YV+LSNLYA + RW +V+K+
Sbjct  417   PNAVIWRTLLGAC-TXHGQLALGETARARIRELEPGHSGDYVLLSNLYASEHRWSDVQKV  475

Query  902   RQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQE  1009
             R+ M  +  +K  GYS+VE+ N ++      RS  +
Sbjct  476   RRTMLSEGVRKTPGYSIVELRNCIYEFTMGDRSHPQ  511


 Score =   115 bits (287),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 111/223 (50%), Gaps = 2/223 (1%)
 Frame = +2

Query  89   LFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAA  268
            +F  +   ++  W+ MI  YA+   P   + ++ +M     +P+   +  LL+A + +  
Sbjct  105  IFSQIKNPNVFTWNTMIRGYAECQNPVPVIQLYHQMHQSSVQPDTHTYPFLLKAVAKLMD  164

Query  269  QDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMING  448
               GE IH+ V++ G+ S  F+ + L+ +Y   G +     +F+   ++DL+ W+S+IN 
Sbjct  165  VGEGEKIHSVVVRNGFESLVFVKNALLHVYACCGHVESAHKVFESMSERDLVAWNSVINA  224

Query  449  YGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITP  628
            + +NG  NEAL  F DM   G++P+    +S+LSAC+  G    G    H    K  +T 
Sbjct  225  FALNGRPNEALTIFRDMSLEGVEPDGFTMVSLLSACAEIGTLALG-RRIHVYMLKVGLTG  283

Query  629  KLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
                   ++D+ ++ G++ EA +    M  E     W AL+ G
Sbjct  284  NSHATNALLDLYAKCGSIREAQKVFEVMD-ERSVVSWTALVVG  325



>ref|XP_008663973.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic [Zea mays]
 tpg|DAA48104.1| TPA: hypothetical protein ZEAMMB73_530850 [Zea mays]
Length=1091

 Score =   283 bits (725),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/350 (38%), Positives = 221/350 (63%), Gaps = 2/350 (1%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             ++G  K +PV  AL++MY    N+E +R++FD ++ KD+I+W+ +I  Y++++ P+ + +
Sbjct  647   RNGMEKLLPVANALMEMYVKCRNVEEARLIFDRVTNKDVISWNTLIGGYSRNNFPNESFS  706

Query  182   VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             +F  M L+  +PN      +L A +S+++ + G  IH   ++ G+  +++ ++ L+DMY 
Sbjct  707   LFSDMLLQF-RPNAVTMTCILPAAASISSLERGREIHAYALRRGFLEDSYASNALVDMYV  765

Query  362   KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
             K G +   + +FD    K+LI W+ MI GYGM+G G  A+  F  M   GI+P+   F +
Sbjct  766   KCGALLVARVLFDRLTKKNLISWTIMIAGYGMHGFGKHAIALFEQMRGSGIEPDAASFSA  825

Query  542   VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
             +L AC H GL  EG  +F AM+++Y I PKL HY C+VD+LSR G+++EALEF+  MPIE
Sbjct  826   ILYACCHSGLAAEGRRFFKAMQKEYKIEPKLKHYTCIVDLLSRTGDLKEALEFIESMPIE  885

Query  722   PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
             PD  IW +LL GCR  H + +++E VA ++  L+P N  YYV+L+N+YA+  RW+ V+KL
Sbjct  886   PDSSIWVSLLHGCR-IHKNVKLAEKVADKVFKLEPENTGYYVLLANIYAEAERWEAVKKL  944

Query  902   RQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRVIIDVLHR  1051
             +  + G+  ++  GYS +EV + +H      R+  ++ + +  + DV  R
Sbjct  945   KNKIGGRGLRENTGYSWIEVRSKVHVFIADNRNHPDWNRIAEFLDDVARR  994


 Score =   108 bits (270),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 140/286 (49%), Gaps = 6/286 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G +    +  ALL MY+N  + +S+  +F S+ QK++++W+AMI++Y ++        
Sbjct  546  KTGLIGETSLANALLDMYSNCSDWQSTNQIFRSMGQKNVVSWTAMITSYMRAGLFDKVAG  605

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            + + M L+  +P+ FA  S L A +   +   G+++H   ++ G      +A+ L++MY 
Sbjct  606  LLQEMVLDGIRPDVFAVTSALHAFAGDESLKQGKSVHGYTIRNGMEKLLPVANALMEMYV  665

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K   + + + IFD   +KD+I W+++I GY  N   NE+   F DML    +PN V    
Sbjct  666  KCRNVEEARLIFDRVTNKDVISWNTLIGGYSRNNFPNESFSLFSDMLLQ-FRPNAVTMTC  724

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L A +      E     HA   +            +VDM  + G +  A    +++  +
Sbjct  725  ILPAAASIS-SLERGREIHAYALRRGFLEDSYASNALVDMYVKCGALLVARVLFDRL-TK  782

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQL--ISLDPTNASYYVIL  853
             +   W  ++AG    HG  + +  + +Q+    ++P  AS+  IL
Sbjct  783  KNLISWTIMIAG-YGMHGFGKHAIALFEQMRGSGIEPDAASFSAIL  827


 Score =   106 bits (265),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 84/336 (25%), Positives = 161/336 (48%), Gaps = 12/336 (4%)
 Frame = +2

Query  35    TALLQMYANFGNIESSRILFDSLSQK-DIIAWSAMISAYAQSDQPSNALAVFRRMQLEHG  211
             + L+ MY   G++ S+R +FD++S K ++  W+ ++  YA+  +   +L++F +M     
Sbjct  354   SKLVFMYVKCGDMASARRVFDAMSSKGNVHVWNLIMGGYAKVGEFEESLSLFVQMHELGI  413

Query  212   KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKT  391
              P+E A   LL+  + ++    G   H  ++KLG+ +   + + LI  Y K   I     
Sbjct  414   APDEHAISCLLKCITCLSCARDGLVAHGYIVKLGFGAQCAVCNALISFYAKSNMIGDAVL  473

Query  392   IFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGL  571
             +F+  P +D I W+S+I+G   NG  +EA+E F+ M + G + + V  +SVL AC+    
Sbjct  474   VFNRMPRQDTISWNSVISGCSSNGLNSEAIELFIRMWTQGQELDSVTLLSVLPACAQSRY  533

Query  572   EYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALL  751
              + G    H    K  +  + +    ++DM S   + +   +    M  + +   W A++
Sbjct  534   WFAG-RVVHGYSVKTGLIGETSLANALLDMYSNCSDWQSTNQIFRSMG-QKNVVSWTAMI  591

Query  752   AGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRK  931
                 +     +++ L+  Q + LD      + + S L+A  G  DE  K  + + G   +
Sbjct  592   TSYMRAGLFDKVAGLL--QEMVLDGIRPDVFAVTSALHAFAG--DESLKQGKSVHGYTIR  647

Query  932   KGMGYSVVEVNNSMHRMEF**RSEQEYIQHSRVIID  1039
              GM   ++ V N++  M    R+ +E    +R+I D
Sbjct  648   NGM-EKLLPVANALMEMYVKCRNVEE----ARLIFD  678


 Score =   105 bits (262),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 96/178 (54%), Gaps = 2/178 (1%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQK--DIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
            L+  Y   G++  +R +FD +  +  D+  W++++SAYA++     A+++FR+MQ     
Sbjct  142  LVLAYLKCGDLGEARTVFDGMPPQAADVRVWTSLMSAYAKAGDFQEAVSLFRQMQCCGVS  201

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
            P+  A   +L+  SS+ +   GE IH  + KLG      +A+ LI +Y + GR+     +
Sbjct  202  PDAHAVSCVLKCVSSLGSLTEGEVIHGLLEKLGLGQACAVANALIAVYSRCGRMEDAARV  261

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
            FD    +D I W+SMI G   NG    A++ F  M S G + + V  +SVL AC+  G
Sbjct  262  FDSMHPRDAISWNSMIGGCFSNGWHGTAVDLFSKMWSQGTEISSVTVLSVLPACAGLG  319


 Score = 90.5 bits (223),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 124/276 (45%), Gaps = 13/276 (5%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G  +   V  AL+ +Y+  G +E +  +FDS+  +D I+W++MI     +     A+ 
Sbjct  232  KLGLGQACAVANALIAVYSRCGRMEDAARVFDSMHPRDAISWNSMIGGCFSNGWHGTAVD  291

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGY----------TSNAF  331
            +F +M  +  + +     S+L AC+ +    +G+ +H   +K G             +A 
Sbjct  292  LFSKMWSQGTEISSVTVLSVLPACAGLGYGLIGKAVHGYSVKSGLLWGLDSVQSGIDDAA  351

Query  332  LASGLIDMYCKFGRIHQGKTIFDENPDK-DLICWSSMINGYGMNGHGNEALECFLDMLSH  508
            L S L+ MY K G +   + +FD    K ++  W+ ++ GY   G   E+L  F+ M   
Sbjct  352  LGSKLVFMYVKCGDMASARRVFDAMSSKGNVHVWNLIMGGYAKVGEFEESLSLFVQMHEL  411

Query  509  GIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEE  688
            GI P++   IS L  C  C          H    K     + A    ++   ++   + +
Sbjct  412  GIAPDEHA-ISCLLKCITCLSCARDGLVAHGYIVKLGFGAQCAVCNALISFYAKSNMIGD  470

Query  689  ALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISEL  796
            A+   N+MP + D   W ++++GC     +SE  EL
Sbjct  471  AVLVFNRMPRQ-DTISWNSVISGCSSNGLNSEAIEL  505


 Score = 88.6 bits (218),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 124/289 (43%), Gaps = 12/289 (4%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     V  AL+  YA    I  + ++F+ + ++D I+W+++IS  + +   S A+ 
Sbjct  445  KLGFGAQCAVCNALISFYAKSNMIGDAVLVFNRMPRQDTISWNSVISGCSSNGLNSEAIE  504

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F RM  +  + +     S+L AC+       G  +H   +K G      LA+ L+DMY 
Sbjct  505  LFIRMWTQGQELDSVTLLSVLPACAQSRYWFAGRVVHGYSVKTGLIGETSLANALLDMYS  564

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
                      IF     K+++ W++MI  Y   G  ++      +M+  GI+P+     S
Sbjct  565  NCSDWQSTNQIFRSMGQKNVVSWTAMITSYMRAGLFDKVAGLLQEMVLDGIRPDVFAVTS  624

Query  542  VLSACS-----HCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVN  706
             L A +       G    G+   + ME+   +   L      ++M  +  NVEEA    +
Sbjct  625  ALHAFAGDESLKQGKSVHGYTIRNGMEKLLPVANAL------MEMYVKCRNVEEARLIFD  678

Query  707  KMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
            ++    D   W  L+ G  + +  +E   L +  L+   P   +   IL
Sbjct  679  RV-TNKDVISWNTLIGGYSRNNFPNESFSLFSDMLLQFRPNAVTMTCIL  726



>ref|XP_010270856.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g56570 [Nelumbo nucifera]
Length=611

 Score =   275 bits (704),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/325 (42%), Positives = 197/325 (61%), Gaps = 2/325 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   +PV  +LL MY    ++  ++  F  + QKD+I W+ +I+ Y +S     +L 
Sbjct  243  KCGFDFNLPVANSLLDMYCRCNSLSEAKRYFHEIPQKDLITWNTLIAGYEKSGS-DWSLN  301

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M  E   PN F F S++ AC+++A  + GE IH  + + G   N  L + LIDMY 
Sbjct  302  LFLHMLSEGLSPNCFTFTSVIAACANLALLNCGEQIHGGIFQRGLQGNLPLDNALIDMYA  361

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +   + IFDE P +DL+ W+SM+ GYG +G+G EA+  F  ML  GI+P+ +VF+ 
Sbjct  362  KCGCVDDSRRIFDEMPQRDLVSWTSMMMGYGTHGYGKEAIGLFNKMLDSGIRPDQIVFMG  421

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VLSACSH GL  EG N+F++M   Y +TP    Y C+VD+L R G ++EA + +  MP +
Sbjct  422  VLSACSHAGLVSEGLNYFNSMATNYHVTPNQEIYGCVVDLLGRAGRIKEAYQLIEAMPFK  481

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD  +W ALL  C K HG S +  L A++++SL P  A  YVILSN+YA  G+W E  K+
Sbjct  482  PDVSVWSALLGAC-KAHGDSNLGRLAAQKILSLRPNGADTYVILSNIYAADGKWGEFAKV  540

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R+LM G   KK  G S +EV N ++
Sbjct  541  RKLMRGIGCKKEAGVSWIEVGNQVY  565


 Score =   135 bits (341),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 90/293 (31%), Positives = 150/293 (51%), Gaps = 17/293 (6%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANF-GNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNAL  178
            K G   CI V   L+ MYA    +++ + ++F  + +K+ ++W+ MI+ Y         L
Sbjct  141  KHGLDGCIYVENTLMDMYATCCPSMDDAYMVFRHIREKNAVSWTTMITGYTHRGDVYGGL  200

Query  179  AVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VFRRM  E    N F+    ++AC+S+     G+ +H  V+K G+  N  +A+ L+DMY
Sbjct  201  QVFRRMIQEGVDLNPFSCSIAIRACASIGIPSFGKQMHVMVIKCGFDFNLPVANSLLDMY  260

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
            C+   + + K  F E P KDLI W+++I GY  +G  + +L  FL MLS G+ PN   F 
Sbjct  261  CRCNSLSEAKRYFHEIPQKDLITWNTLIAGYEKSG-SDWSLNLFLHMLSEGLSPNCFTFT  319

Query  539  SVLSACS-----HCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFV  703
            SV++AC+     +CG +  G  +   ++    +   L      +DM ++ G V+++    
Sbjct  320  SVIAACANLALLNCGEQIHGGIFQRGLQGNLPLDNAL------IDMYAKCGCVDDSRRIF  373

Query  704  NKMPIEPDKRIWGALLAGCRKTHG-SSEISELVAKQLIS-LDPTNASYYVILS  856
            ++MP + D   W +++ G   THG   E   L  K L S + P    +  +LS
Sbjct  374  DEMP-QRDLVSWTSMMMG-YGTHGYGKEAIGLFNKMLDSGIRPDQIVFMGVLS  424


 Score =   117 bits (293),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 118/248 (48%), Gaps = 3/248 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            + T L+  Y + G +E +R LFD +  +D++ W+AMIS Y      SNA AVF +M  + 
Sbjct  49   LATKLVTSYFHRGRLEQARKLFDEIPNRDVVLWTAMISGYTSRGLYSNAWAVFCQMTSQG  108

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK-FGRIHQG  385
              PNEF   S+L+AC  M +   G  +H   +K G     ++ + L+DMY      +   
Sbjct  109  MDPNEFTISSVLKACKGMESCSCGLMVHGLALKHGLDGCIYVENTLMDMYATCCPSMDDA  168

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC  565
              +F    +K+ + W++MI GY   G     L+ F  M+  G+  N       + AC+  
Sbjct  169  YMVFRHIREKNAVSWTTMITGYTHRGDVYGGLQVFRRMIQEGVDLNPFSCSIAIRACASI  228

Query  566  GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGA  745
            G+   G    H M  K      L     ++DM  R  ++ EA  + +++P + D   W  
Sbjct  229  GIPSFG-KQMHVMVIKCGFDFNLPVANSLLDMYCRCNSLSEAKRYFHEIP-QKDLITWNT  286

Query  746  LLAGCRKT  769
            L+AG  K+
Sbjct  287  LIAGYEKS  294


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 55/101 (54%), Gaps = 5/101 (5%)
 Frame = +2

Query  320  SNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDM  499
            +++ LA+ L+  Y   GR+ Q + +FDE P++D++ W++MI+GY   G  + A   F  M
Sbjct  45   ASSILATKLVTSYFHRGRLEQARKLFDEIPNRDVVLWTAMISGYTSRGLYSNAWAVFCQM  104

Query  500  LSHGIQPNDVVFISVLSACS-----HCGLEYEGWNWFHAME  607
             S G+ PN+    SVL AC       CGL   G    H ++
Sbjct  105  TSQGMDPNEFTISSVLKACKGMESCSCGLMVHGLALKHGLD  145



>ref|XP_009768550.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g11460 [Nicotiana sylvestris]
Length=644

 Score =   276 bits (706),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/325 (40%), Positives = 199/325 (61%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G    + +   L+ MY   G++E +R LFD + +K +I W+AMIS YAQ+   +  L 
Sbjct  202  KCGLENDLSIANCLITMYVRCGSMELARRLFDHIPEKGLITWNAMISGYAQNGLAAEVLE  261

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++R M+L    P+   F  +L AC+++ AQ +G  +  ++   G   N FL + LI+MY 
Sbjct  262  LYREMELLQVDPDAVTFVGVLSACANLGAQKIGFEVEQKIRSSGMMCNVFLRNALINMYA  321

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            + G + + + IF+E P+K L+ W+++I GYGM+G GN A+E F  M+  GIQP+  VF+S
Sbjct  322  RCGNLAKARIIFNEMPEKTLVSWTAIIGGYGMHGLGNIAVELFDKMIKTGIQPDGTVFVS  381

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VLSACSH GL  +G N+   M+ +Y + P   HY+C+VD+L R G +EEA + +  M +E
Sbjct  382  VLSACSHAGLTKKGLNYLDVMKREYGLKPGSEHYSCVVDLLGRAGRLEEAHKLIESMEVE  441

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD  +WGALL  C K H + E++EL   +++ L+PTN  YYV+LSN+Y +    + + ++
Sbjct  442  PDGAVWGALLGAC-KIHKNVELAELAFNKVVELEPTNIGYYVLLSNIYTEANDSEGILRV  500

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R +M  +K KK  GYS  E     H
Sbjct  501  RLMMRERKLKKDPGYSYFECKGKTH  525


 Score =   124 bits (311),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 82/282 (29%), Positives = 147/282 (52%), Gaps = 12/282 (4%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDI-IAWSAMISAYAQSDQPSNALAVFRRMQLE  205
            V+TAL+ MY      E ++ +FD ++Q+++ + ++++IS Y Q+D+  N   +F  M+L 
Sbjct  109  VLTALISMYCKCKLAEHAQKVFDEVTQRNLTVCYNSLISGYVQNDKFLNGFYLFSEMRLR  168

Query  206  HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQG  385
              + N      L+  C+      +G  +H   +K G  ++  +A+ LI MY + G +   
Sbjct  169  GLEFNAVTILGLVPGCTVPGHMWLGMCLHCLNVKCGLENDLSIANCLITMYVRCGSMELA  228

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC  565
            + +FD  P+K LI W++MI+GY  NG   E LE + +M    + P+ V F+ VLSAC++ 
Sbjct  229  RRLFDHIPEKGLITWNAMISGYAQNGLAAEVLELYREMELLQVDPDAVTFVGVLSACANL  288

Query  566  GLEYEGWNWFHAMEEKYDITPKLAHY---ACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
            G +  G+     +E+K   +  + +      +++M +R GN+ +A    N+MP E     
Sbjct  289  GAQKIGFE----VEQKIRSSGMMCNVFLRNALINMYARCGNLAKARIIFNEMP-EKTLVS  343

Query  737  WGALLAGCRKTHGSSEIS-ELVAKQL-ISLDPTNASYYVILS  856
            W A++ G    HG   I+ EL  K +   + P    +  +LS
Sbjct  344  WTAIIGG-YGMHGLGNIAVELFDKMIKTGIQPDGTVFVSVLS  384


 Score =   112 bits (281),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 135/265 (51%), Gaps = 7/265 (3%)
 Frame = +2

Query  125  WSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVM  304
            W+  +   ++  Q  NAL ++R+M      PN F F  +L++ +S++    G+ +H  V+
Sbjct  40   WNTQLRDLSKHGQYYNALILYRQMLQFGATPNAFTFPFILKSSASLSLPTTGKQLHCHVV  99

Query  305  KLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDL-ICWSSMINGYGMNGHGNEAL  481
            KLG  S  F+ + LI MYCK       + +FDE   ++L +C++S+I+GY  N       
Sbjct  100  KLGCKSEPFVLTALISMYCKCKLAEHAQKVFDEVTQRNLTVCYNSLISGYVQNDKFLNGF  159

Query  482  ECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDM  661
              F +M   G++ N V  + ++  C+  G  + G    H +  K  +   L+   C++ M
Sbjct  160  YLFSEMRLRGLEFNAVTILGLVPGCTVPGHMWLGM-CLHCLNVKCGLENDLSIANCLITM  218

Query  662  LSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAK-QLISLDPTNAS  838
              R G++E A    + +P E     W A+++G  +   ++E+ EL  + +L+ +DP   +
Sbjct  219  YVRCGSMELARRLFDHIP-EKGLITWNAMISGYAQNGLAAEVLELYREMELLQVDPDAVT  277

Query  839  YYVILS---NLYADQGRWDEVEKLR  904
            +  +LS   NL A +  ++  +K+R
Sbjct  278  FVGVLSACANLGAQKIGFEVEQKIR  302



>ref|XP_008802225.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, 
mitochondrial [Phoenix dactylifera]
Length=788

 Score =   279 bits (714),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 200/313 (64%), Gaps = 3/313 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            + V  AL+ MYA  G +  +R +FD  S +D++ W+A+I+AYA     S+AL +F +M L
Sbjct  478  VSVANALIGMYARCGKLNLARTIFDHTS-RDVVTWNALIAAYAHLGHSSDALPLFDQMLL  536

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            E  KPN     S+L ACS MAA   G+ IH  + ++G  S+  + + L+DMY K G++  
Sbjct  537  EDVKPNSATLVSILSACSHMAALHRGKWIHNYIKEMGLESDVSICTALVDMYAKCGQLEI  596

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + +FD  P++D++ W+ MI+GYG++G+  EAL+ F +M    ++PN V F++VLS CS+
Sbjct  597  SRAVFDSMPERDVVSWNVMISGYGIHGYAKEALDVFREMEKTSLRPNGVTFLAVLSTCSY  656

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             GL  EG   F  M  KY + P L H+AC+VD+L R GN+ EA   V  MP+EPD  IWG
Sbjct  657  AGLVKEGKELFDEM-GKYSVIPTLKHFACIVDLLGRSGNLCEAEAMVLNMPMEPDSGIWG  715

Query  743  ALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGK  922
             LL  CR  H + E+ E +A++ +  DPTN  YY++LSN+Y+  GRW+EVEKLR  M+ K
Sbjct  716  VLLGACR-MHNNMEMGERIARRALESDPTNDGYYILLSNMYSCAGRWEEVEKLRGTMNNK  774

Query  923  KRKKGMGYSVVEV  961
              +K  G+S VE+
Sbjct  775  GVRKRAGWSAVEL  787


 Score = 95.9 bits (237),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/288 (26%), Positives = 132/288 (46%), Gaps = 6/288 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G   C  V ++LL MY+   ++E + I+F  LS +DI++W+A++  YA+       L 
Sbjct  267  KAGMGFCPSVNSSLLSMYSKCESLEEATIVFQELSDRDIVSWTAIVGVYARKGFIFGCLE  326

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F+ MQ    +P+      +L   ++      G+  H  +++  +  N  + + L+ MY 
Sbjct  327  LFQMMQDLGVEPDGVFISCMLTGFANSGNISGGKAFHGVMLRRNFVLNTLVGNSLLSMYY  386

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDM--LSHGIQPNDVVF  535
            K   +   K  FD   ++D   W+ M+ GYG  G   + L+ +  M  L  G   +    
Sbjct  387  KLELLEYAKKAFDVVVERDAESWNLMVFGYGKMGLDVKCLDLYRAMQFLRLGYNSDLNCL  446

Query  536  ISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMP  715
            +SV+S+CS  G    G +  H    KY +   ++    ++ M +R G +  A    +   
Sbjct  447  VSVISSCSRLGALRLGQS-THCCMIKYAVDGDVSVANALIGMYARCGKLNLARTIFDH--  503

Query  716  IEPDKRIWGALLAGCRKTHGSSEISELVAKQLI-SLDPTNASYYVILS  856
               D   W AL+A       SS+   L  + L+  + P +A+   ILS
Sbjct  504  TSRDVVTWNALIAAYAHLGHSSDALPLFDQMLLEDVKPNSATLVSILS  551


 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 113/250 (45%), Gaps = 12/250 (5%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL--  202
            V ++L+ MY+  G I  +  +FD +  +D++AW+A+I    ++ +    L   ++M    
Sbjct  171  VGSSLVYMYSKCGVIGDAYRMFDEIPARDVVAWTALIIGCVRNGEFEEGLVCLKKMHRVG  230

Query  203  --EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
                G+PN       LQAC ++ A   G+ +H  + K G      + S L+ MY K   +
Sbjct  231  GDGGGRPNSRTMEGGLQACGNLGALPEGKCLHGFLFKAGMGFCPSVNSSLLSMYSKCESL  290

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
             +   +F E  D+D++ W++++  Y   G     LE F  M   G++P+ V    +L+  
Sbjct  291  EEATIVFQELSDRDIVSWTAIVGVYARKGFIFGCLELFQMMQDLGVEPDGVFISCMLTGF  350

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNK---MPIEPD  727
            ++ G    G   FH +  + +          ++ M  +     E LE+  K   + +E D
Sbjct  351  ANSG-NISGGKAFHGVMLRRNFVLNTLVGNSLLSMYYKL----ELLEYAKKAFDVVVERD  405

Query  728  KRIWGALLAG  757
               W  ++ G
Sbjct  406  AESWNLMVFG  415


 Score = 71.6 bits (174),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 62/233 (27%), Positives = 104/233 (45%), Gaps = 13/233 (6%)
 Frame = +2

Query  26   PVVTA-LLQMYANFGNIESSRILFDSL---SQKDIIAWSAMISA-YAQSDQPSNALAVFR  190
            P + A L+ +YA     + S  +F +    +  D   W+++I A ++ +D P  A   + 
Sbjct  63   PFLAAKLISLYAALCRPDLSARVFSAAIPSNSGDTFLWNSIIKAHFSNADFPL-AFRAYS  121

Query  191  RMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGY--TSNAFLASGLIDMYCK  364
            +M      PNEF    +  A + +    +G ++H    K G    ++A + S L+ MY K
Sbjct  122  QMLSSGASPNEFTIPMVASASAELLDLGLGSSVHGNATKFGLFNGNSAAVGSSLVYMYSK  181

Query  365  FGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDML----SHGIQPNDVV  532
             G I     +FDE P +D++ W+++I G   NG   E L C   M       G +PN   
Sbjct  182  CGVIGDAYRMFDEIPARDVVAWTALIIGCVRNGEFEEGLVCLKKMHRVGGDGGGRPNSRT  241

Query  533  FISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEA  691
                L AC + G   EG    H    K  +    +  + ++ M S+  ++EEA
Sbjct  242  MEGGLQACGNLGALPEG-KCLHGFLFKAGMGFCPSVNSSLLSMYSKCESLEEA  293



>emb|CAB45902.1| putative protein (fragment) [Arabidopsis thaliana]
 emb|CAB79107.1| putative protein (fragment) [Arabidopsis thaliana]
Length=1495

 Score =   286 bits (731),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/326 (40%), Positives = 215/326 (66%), Gaps = 2/326 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            +SGF   I V  +LL +YAN G++ S+  +FD + +KD++AW+++I+ +A++ +P  ALA
Sbjct  149  RSGFGSLIYVQNSLLHLYANCGDVASAYKVFDKMPEKDLVAWNSVINGFAENGKPEEALA  208

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++  M  +  KP+ F   SLL AC+ + A  +G+ +H  ++K+G T N   ++ L+D+Y 
Sbjct  209  LYTEMNSKGIKPDGFTIVSLLSACAKIGALTLGKRVHVYMIKVGLTRNLHSSNVLLDLYA  268

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLS-HGIQPNDVVFI  538
            + GR+ + KT+FDE  DK+ + W+S+I G  +NG G EA+E F  M S  G+ P ++ F+
Sbjct  269  RCGRVEEAKTLFDEMVDKNSVSWTSLIVGLAVNGFGKEAIELFKYMESTEGLLPCEITFV  328

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
             +L ACSHCG+  EG+ +F  M E+Y I P++ H+ CMVD+L+R G V++A E++  MP+
Sbjct  329  GILYACSHCGMVKEGFEYFRRMREEYKIEPRIEHFGCMVDLLARAGQVKKAYEYIKSMPM  388

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEK  898
            +P+  IW  LL  C   HG S+++E    Q++ L+P ++  YV+LSN+YA + RW +V+K
Sbjct  389  QPNVVIWRTLLGAC-TVHGDSDLAEFARIQILQLEPNHSGDYVLLSNMYASEQRWSDVQK  447

Query  899  LRQLMDGKKRKKGMGYSVVEVNNSMH  976
            +R+ M     KK  G+S+VEV N +H
Sbjct  448  IRKQMLRDGVKKVPGHSLVEVGNRVH  473


 Score =   124 bits (311),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 66/216 (31%), Positives = 121/216 (56%), Gaps = 3/216 (1%)
 Frame = +2

Query  113  DIIAWSAMISAYAQSDQPSNALAVFRRMQLEH-GKPNEFAFHSLLQACSSMAAQDVGETI  289
            ++  W+ +I  YA+     +A +++R M++    +P+   +  L++A ++MA   +GETI
Sbjct  84   NVFIWNTLIRGYAEIGNSISAFSLYREMRVSGLVEPDTHTYPFLIKAVTTMADVRLGETI  143

Query  290  HTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHG  469
            H+ V++ G+ S  ++ + L+ +Y   G +     +FD+ P+KDL+ W+S+ING+  NG  
Sbjct  144  HSVVIRSGFGSLIYVQNSLLHLYANCGDVASAYKVFDKMPEKDLVAWNSVINGFAENGKP  203

Query  470  NEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYAC  649
             EAL  + +M S GI+P+    +S+LSAC+  G    G    H    K  +T  L     
Sbjct  204  EEALALYTEMNSKGIKPDGFTIVSLLSACAKIGALTLG-KRVHVYMIKVGLTRNLHSSNV  262

Query  650  MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            ++D+ +R G VEEA    ++M ++ +   W +L+ G
Sbjct  263  LLDLYARCGRVEEAKTLFDEM-VDKNSVSWTSLIVG  297



>ref|XP_007037265.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOY21766.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma 
cacao]
Length=707

 Score =   277 bits (709),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/317 (40%), Positives = 203/317 (64%), Gaps = 1/317 (0%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V+TA++ M+   G I+ +R  FD +  +D +AWSAMIS YAQ+ +P+ AL +F  M+ E 
Sbjct  265  VLTAIVNMFVKCGAIDEAREEFDWMRTRDTLAWSAMISGYAQNRRPTEALELFECMKKEQ  324

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             +PN+ A  S+L ACS + + + GE +   +      SN ++AS L+DMY KFG I + +
Sbjct  325  IRPNDVALVSVLSACSQLGSVEAGECLAACIETQDLASNVYVASALLDMYSKFGNIAKAR  384

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD+ P++D++ W+SMI G  +NG   +A+  +  M    ++P+ + F+ +L+ACS  G
Sbjct  385  QVFDKMPERDIVSWNSMIVGLAVNGFAEDAILLYEKMKESEVKPDSITFVGLLTACSRTG  444

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L   G  +F +ME  Y I PK+ HYAC+VD+  R G + EA E V +M +EP+  IWG L
Sbjct  445  LVELGLEFFRSMELHYSIEPKIEHYACIVDLFCRTGRLNEAYELVCRMEMEPNVVIWGTL  504

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L+  R TH + E++EL  ++L+ L+P N+ +YV+LSN+YA  GRW    ++R LM  K+ 
Sbjct  505  LSASR-THLNVELAELCVEKLLKLEPENSGHYVLLSNIYASLGRWQAALEVRNLMKNKRV  563

Query  929  KKGMGYSVVEVNNSMHR  979
            +K   YS +E++N++H+
Sbjct  564  QKVAAYSWIELDNTVHK  580


 Score =   132 bits (332),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/251 (31%), Positives = 128/251 (51%), Gaps = 3/251 (1%)
 Frame = +2

Query  8    GFLKCIPVV-TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAV  184
            G L   PV    L+  Y+  G++ ++  LFD + +K + +W++MIS Y  +     AL +
Sbjct  156  GILVKDPVFYNCLISGYSKVGDVMAAECLFDEMKEKTVASWNSMISCYVNNGYHDKALEI  215

Query  185  FRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK  364
            F RMQ  +  P++  + +LL   + +    +G  +   +       N  + + +++M+ K
Sbjct  216  FERMQANNIPPSQITWVTLLSLTAKLRDLKLGLKVKKLIADSNICVNTIVLTAIVNMFVK  275

Query  365  FGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISV  544
             G I + +  FD    +D + WS+MI+GY  N    EALE F  M    I+PNDV  +SV
Sbjct  276  CGAIDEAREEFDWMRTRDTLAWSAMISGYAQNRRPTEALELFECMKKEQIRPNDVALVSV  335

Query  545  LSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEP  724
            LSACS  G   E      A  E  D+   +   + ++DM S+ GN+ +A +  +KMP E 
Sbjct  336  LSACSQLG-SVEAGECLAACIETQDLASNVYVASALLDMYSKFGNIAKARQVFDKMP-ER  393

Query  725  DKRIWGALLAG  757
            D   W +++ G
Sbjct  394  DIVSWNSMIVG  404


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/292 (22%), Positives = 125/292 (43%), Gaps = 33/292 (11%)
 Frame = +2

Query  14   LKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRR  193
            + C  +   L++   +   +  +R +FD +   D   + + IS+Y +      A+ +F  
Sbjct  27   VNCAALTRILVKKLIDSSFLGYAREVFDRIPLPDQALYISFISSYTKLSFNKEAIKLFAS  86

Query  194  MQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGR  373
            M     + +  A  +++++CS  +   VG+ +H  V+  G+  + F+ S L+D Y K G 
Sbjct  87   MHSSRTQMSSRAVLAVIKSCSGFSGVSVGKQVHGLVVNYGFDLDVFVQSALMDFYAKKGD  146

Query  374  IHQGKTI-------------------------------FDENPDKDLICWSSMINGYGMN  460
                + I                               FDE  +K +  W+SMI+ Y  N
Sbjct  147  FFSARKIFDGILVKDPVFYNCLISGYSKVGDVMAAECLFDEMKEKTVASWNSMISCYVNN  206

Query  461  GHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAH  640
            G+ ++ALE F  M ++ I P+ + ++++LS  +       G      + +  +I      
Sbjct  207  GYHDKALEIFERMQANNIPPSQITWVTLLSLTAKLRDLKLGLKVKKLIADS-NICVNTIV  265

Query  641  YACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISEL  796
               +V+M  + G ++EA E  + M    D   W A+++G  +    +E  EL
Sbjct  266  LTAIVNMFVKCGAIDEAREEFDWMRTR-DTLAWSAMISGYAQNRRPTEALEL  316



>gb|KDP46510.1| hypothetical protein JCGZ_08482 [Jatropha curcas]
Length=686

 Score =   277 bits (708),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/315 (43%), Positives = 196/315 (62%), Gaps = 2/315 (1%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL-EHG  211
            T ++  YA  G+ +++R LF+++ +KDI AW+ +ISAY Q+ +P  ALA+F  +QL +  
Sbjct  250  TTMIDGYAKKGDFDAARNLFNAMPRKDISAWNVLISAYEQNGKPKEALAIFHELQLSKAA  309

Query  212  KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKT  391
            KP+E    S L AC+ + A DVG+ I+  + K G   N  L + LIDMY K G + +   
Sbjct  310  KPDEVTLVSTLSACAQLGAIDVGDWINVYIKKQGIKLNCHLTTSLIDMYSKCGDLDKALD  369

Query  392  IFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGL  571
            IF     +D+  WS+MI G  M+G G +A++ F+ M    ++PN V F ++L ACSH GL
Sbjct  370  IFYSAERRDVFVWSAMIAGLAMHGRGTDAIDLFMKMQEAKVKPNVVTFTNLLCACSHTGL  429

Query  572  EYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALL  751
              EG  +F+ ME  YD+ P + HYACMVD L R G +EEA EF+ KMPI P   +WGALL
Sbjct  430  VDEGRMFFNQMESVYDVVPGIKHYACMVDTLGRAGLLEEAFEFIEKMPIAPSASVWGALL  489

Query  752  AGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRK  931
              CR  HG+ +++E+   +L+ +DP N   YV+LSN+YA  G+W+ V +LRQ M     K
Sbjct  490  GACR-IHGNVKLAEMACSRLLEIDPENHGAYVLLSNIYAKTGKWENVSELRQCMKVNGIK  548

Query  932  KGMGYSVVEVNNSMH  976
            K  G S +EV+  +H
Sbjct  549  KEPGCSSIEVDGVIH  563


 Score =   132 bits (333),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 85/338 (25%), Positives = 166/338 (49%), Gaps = 41/338 (12%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            ++ +L+  YA+ G+++SS ++F ++++KD+++W+++I+ +AQ   P  AL +F+RM+ E+
Sbjct  116  ILNSLIHCYASCGDMDSSYLVFMNINEKDVVSWNSVITGFAQGGFPEKALELFQRMKAEN  175

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
              PN+     +L AC+     + G  +   + + G   N  + + ++DMY K G I + +
Sbjct  176  VSPNDVTMVGILSACAKSMDLEFGRWVCQYIERNGINVNLTVTNAMLDMYLKTGSILEAR  235

Query  389  TIFDENPDKDLICWSSMINGYG-------------------------------MNGHGNE  475
             +FD+  +KD+  W++MI+GY                                 NG   E
Sbjct  236  RLFDKMEEKDIFSWTTMIDGYAKKGDFDAARNLFNAMPRKDISAWNVLISAYEQNGKPKE  295

Query  476  ALECFLDM-LSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACM  652
            AL  F ++ LS   +P++V  +S LSAC+  G    G +W +   +K  I         +
Sbjct  296  ALAIFHELQLSKAAKPDEVTLVSTLSACAQLGAIDVG-DWINVYIKKQGIKLNCHLTTSL  354

Query  653  VDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG-CRKTHGSSEISELVAKQLISLDPT  829
            +DM S+ G++++AL+         D  +W A++AG      G+  I   +  Q   + P 
Sbjct  355  IDMYSKCGDLDKALDIFYSAE-RRDVFVWSAMIAGLAMHGRGTDAIDLFMKMQEAKVKPN  413

Query  830  NASYYVILSNL----YADQGR--WDEVEKLRQLMDGKK  925
              ++  +L         D+GR  ++++E +  ++ G K
Sbjct  414  VVTFTNLLCACSHTGLVDEGRMFFNQMESVYDVVPGIK  451


 Score =   123 bits (309),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 71/238 (30%), Positives = 121/238 (51%), Gaps = 3/238 (1%)
 Frame = +2

Query  56   ANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK-PNEFAF  232
            ++F N++ +  +F+ ++Q ++  W+ +I A+A S +P   L +F RM  E    PN+F F
Sbjct  23   SSFSNLDYALKVFEDITQPNLYTWNTLIRAFASSPEPILGLLIFIRMLHESLDFPNKFTF  82

Query  233  HSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPD  412
              +++A   ++   VG+ IH   +K    SN F+ + LI  Y   G +     +F    +
Sbjct  83   PFVIKAAGGISCLPVGKAIHGMAIKASLGSNLFILNSLIHCYASCGDMDSSYLVFMNINE  142

Query  413  KDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNW  592
            KD++ W+S+I G+   G   +ALE F  M +  + PNDV  + +LSAC+   ++ E   W
Sbjct  143  KDVVSWNSVITGFAQGGFPEKALELFQRMKAENVSPNDVTMVGILSACAK-SMDLEFGRW  201

Query  593  FHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRK  766
                 E+  I   L     M+DM  + G++ EA    +KM  E D   W  ++ G  K
Sbjct  202  VCQYIERNGINVNLTVTNAMLDMYLKTGSILEARRLFDKME-EKDIFSWTTMIDGYAK  258



>ref|XP_009600225.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Nicotiana tomentosiformis]
Length=631

 Score =   275 bits (704),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/327 (39%), Positives = 205/327 (63%), Gaps = 1/327 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G    + VV AL+ MY+    I  ++ LFD + ++D++ W+ MI A  +   PS AL 
Sbjct  186  KNGLQSDVFVVAALVDMYSKCKVIGDAKQLFDKMPKRDLVTWTVMIGACTECGDPSEALV  245

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F +M+ E   P++ A  +++ AC+   A    + +H  +++  ++ +  L + ++DMY 
Sbjct  246  LFDQMREEDVVPDKVALVNVVNACAKTGAMHKAKVLHEYIVRNKFSLDVILGTAMVDMYA  305

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +   + +FD   +K++I WS+MI  YG +G G+EA++ F  ML  GI PN + F+S
Sbjct  306  KCGSVDVAREVFDGLREKNVITWSAMIGAYGYHGQGHEAIDMFPMMLRSGILPNKITFVS  365

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L ACSH GL  EG   F++M+ +Y + P + H+ CMVD+L R G ++E+LE ++ M +E
Sbjct  366  LLYACSHSGLVEEGKRLFNSMQNEYGVKPDIKHFTCMVDLLGRAGKIDESLELIDHMAVE  425

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
             D+ +WGALL  CR  HG  E++E  AK LI L P N  +YV+LSN+YA  G+W +V K+
Sbjct  426  KDEGLWGALLGACR-IHGHVELAEKAAKSLIELQPQNPGHYVLLSNIYAKAGKWQDVAKI  484

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMHRM  982
            R+LM  +K KK  G++ +EV+N +HR 
Sbjct  485  RELMTHQKLKKIPGWTWIEVDNKIHRF  511


 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/257 (30%), Positives = 128/257 (50%), Gaps = 3/257 (1%)
 Frame = +2

Query  5    SGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAV  184
            +G +K   V   LL +Y+   +++ +  LF SLS K+ ++WS MI  YA++ +  N+L  
Sbjct  86   NGLIKNQIVANKLLYIYSLHKSLDYAYALFCSLSGKNAVSWSVMIGGYAKAGEFINSLRT  145

Query  185  FRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK  364
            FR       KP+ +    +++AC       +G  IH  V K G  S+ F+ + L+DMY K
Sbjct  146  FREYLRSGDKPDNYTLPFVIRACRDTMDLQMGRKIHNVVYKNGLQSDVFVVAALVDMYSK  205

Query  365  FGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISV  544
               I   K +FD+ P +DL+ W+ MI      G  +EAL  F  M    + P+ V  ++V
Sbjct  206  CKVIGDAKQLFDKMPKRDLVTWTVMIGACTECGDPSEALVLFDQMREEDVVPDKVALVNV  265

Query  545  LSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEP  724
            ++AC+  G  ++     H    +   +  +     MVDM ++ G+V+ A E  + +  E 
Sbjct  266  VNACAKTGAMHKA-KVLHEYIVRNKFSLDVILGTAMVDMYAKCGSVDVAREVFDGLR-EK  323

Query  725  DKRIWGALLAGCRKTHG  775
            +   W A++ G    HG
Sbjct  324  NVITWSAMI-GAYGYHG  339


 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 72/166 (43%), Gaps = 2/166 (1%)
 Frame = +2

Query  287  IHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGH  466
            +H Q+   G   N  +A+ L+ +Y     +     +F     K+ + WS MI GY   G 
Sbjct  79   VHAQITTNGLIKNQIVANKLLYIYSLHKSLDYAYALFCSLSGKNAVSWSVMIGGYAKAGE  138

Query  467  GNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYA  646
               +L  F + L  G +P++     V+ AC    ++ +     H +  K  +   +   A
Sbjct  139  FINSLRTFREYLRSGDKPDNYTLPFVIRACRDT-MDLQMGRKIHNVVYKNGLQSDVFVVA  197

Query  647  CMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSE  784
             +VDM S+   + +A +  +KMP + D   W  ++  C +    SE
Sbjct  198  ALVDMYSKCKVIGDAKQLFDKMP-KRDLVTWTVMIGACTECGDPSE  242



>emb|CDY00184.1| BnaC09g01170D [Brassica napus]
Length=656

 Score =   276 bits (706),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/328 (40%), Positives = 205/328 (63%), Gaps = 4/328 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANF--GNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNA  175
            K GF + + V   LL  YA    G +  +R +FD +  KD +++++++S YAQ+   S A
Sbjct  208  KRGFERGVSVGNTLLDAYAKGREGGVAVARKIFDEIVGKDSVSYNSIMSVYAQNGMSSEA  267

Query  176  LAVFRRMQLEHGKP-NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
              VFR +  + G   N     ++L A S   A  VG+ +H QV+++G   +  + + +ID
Sbjct  268  FDVFRILMNDKGLTFNSITLSTVLLAVSHSGALRVGKCVHDQVVRMGLEDDVVVGTSIID  327

Query  353  MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVV  532
            MYCK GR+   + +FD    K++  W++MI GYGM+GH  +ALE F  M+S G++PN + 
Sbjct  328  MYCKCGRVEAARKVFDRMRKKNVRTWTAMIAGYGMHGHAVKALELFPVMISSGVRPNYIT  387

Query  533  FISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
            F+SVL+ACSH GL  EGW WF+ M+ ++ + P L HY CMVD+L R G +++A + V  M
Sbjct  388  FVSVLAACSHAGLHVEGWRWFNLMKGRFGVEPGLEHYGCMVDLLGRAGYLQKAYDLVLTM  447

Query  713  PIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEV  892
             ++PD  IW +LLA CR  H + E++E+   +L  LD +N  YY++LS++YAD GRW +V
Sbjct  448  KMKPDSVIWSSLLAACR-IHKNVELAEISVARLFELDSSNCGYYMLLSHIYADAGRWKDV  506

Query  893  EKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
            E++R +M  +   K  G+S++E+N  +H
Sbjct  507  ERVRTVMKKRGLVKPPGFSLLELNGEVH  534


 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/256 (29%), Positives = 135/256 (53%), Gaps = 8/256 (3%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G+   + V +AL+ MY+  G +E +R +FD + +++I+ W++MI  Y  +    +A+++F
Sbjct  106  GYHSDVFVSSALIVMYSACGEVEDARKVFDEMPERNIVCWTSMIRGYDLNGNAFDAVSLF  165

Query  188  RRMQL---EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
            + + L   +H   +     S++ ACS +AA+ + E+IH  V+K G+     + + L+D Y
Sbjct  166  KELLLDGRDHEDVDSKGVVSVISACSRVAAKGLTESIHGFVVKRGFERGVSVGNTLLDAY  225

Query  359  CKF--GRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECF-LDMLSHGIQPNDV  529
             K   G +   + IFDE   KD + ++S+++ Y  NG  +EA + F + M   G+  N +
Sbjct  226  AKGREGGVAVARKIFDEIVGKDSVSYNSIMSVYAQNGMSSEAFDVFRILMNDKGLTFNSI  285

Query  530  VFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNK  709
               +VL A SH G    G    H    +  +   +     ++DM  + G VE A +  ++
Sbjct  286  TLSTVLLAVSHSGALRVG-KCVHDQVVRMGLEDDVVVGTSIIDMYCKCGRVEAARKVFDR  344

Query  710  MPIEPDKRIWGALLAG  757
            M  + + R W A++AG
Sbjct  345  MR-KKNVRTWTAMIAG  359


 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 90/157 (57%), Gaps = 3/157 (2%)
 Frame = +2

Query  101  LSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG  280
            + + D+ +W+++I+  A+S+  S AL  F  M+     PN   F   ++ACSS+     G
Sbjct  36   VDKTDVFSWNSVIADLARSNDSSEALRAFSSMRKLSLHPNRSTFPCAIKACSSLLDLFSG  95

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            +  H Q    GY S+ F++S LI MY   G +   + +FDE P+++++CW+SMI GY +N
Sbjct  96   KQTHQQAFVFGYHSDVFVSSALIVMYSACGEVEDARKVFDEMPERNIVCWTSMIRGYDLN  155

Query  461  GHGNEALECFLDMLSHGIQPNDV---VFISVLSACSH  562
            G+  +A+  F ++L  G    DV     +SV+SACS 
Sbjct  156  GNAFDAVSLFKELLLDGRDHEDVDSKGVVSVISACSR  192



>ref|XP_008238575.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, 
chloroplastic [Prunus mume]
Length=620

 Score =   275 bits (703),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/320 (41%), Positives = 197/320 (62%), Gaps = 1/320 (0%)
 Frame = +2

Query  17   KCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM  196
            K +  +TA++  YA  G +E +R+LFD + ++D++ W+ MI  YAQ   P+ AL +FR+M
Sbjct  180  KSLVSLTAMITCYAKRGEVEEARVLFDGMEERDVVCWNVMIDGYAQHGMPNEALLLFRKM  239

Query  197  QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
             +   KPNE    SLL AC  + A + G  +H+ +   G   NA   + LIDMY K G +
Sbjct  240  LVAKIKPNELTVLSLLSACGQLGALESGRWLHSYIENNGIQVNAHAGTALIDMYSKCGSL  299

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
               + +FD   +KD++ W+SMI GY M+G   +AL+ F +M     QP D+ FI VLSAC
Sbjct  300  EDARLVFDMIDEKDVVAWNSMIVGYAMHGFSRDALQLFHEMCRLSCQPTDITFIGVLSAC  359

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
            ++ GL  EG  +F +M+++Y I PK+ HY C+V++LSR G +EEA EFV  M I+PD  +
Sbjct  360  AYAGLVSEGRAFFSSMKDEYGIEPKIEHYGCVVNLLSRAGQLEEAYEFVKNMKIDPDPVL  419

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            WG LL  CR  HG+  + E +A+ L+  +  N+  +++LSN+YA  G WD V ++R LM 
Sbjct  420  WGTLLGACR-LHGNITLGEEIAEFLLGQNLANSGTFILLSNIYAAAGNWDGVARVRTLMK  478

Query  917  GKKRKKGMGYSVVEVNNSMH  976
                +K  G S +EV+N +H
Sbjct  479  HSGIQKEPGCSSIEVDNKVH  498


 Score =   126 bits (317),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 83/311 (27%), Positives = 147/311 (47%), Gaps = 41/311 (13%)
 Frame = +2

Query  26   PVVTALLQM-YANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            P++   LQ  YA+ G ++ +  LF       +  W+++I ++AQ       L  + +M  
Sbjct  54   PILNFKLQRSYASLGRLDYTVALFQRTHNPSVFFWTSIIHSHAQCGLHDLGLMYYTQMLT  113

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
               +PN F   ++++ C        G+ +H+Q +KLG+ S+ ++ +GL+D+Y + G +  
Sbjct  114  NGVEPNCFTLSAVMKTCPLRP----GKALHSQTIKLGFDSDLYVRTGLVDVYARAGDVVS  169

Query  383  GKTIFDENPDK-------------------------------DLICWSSMINGYGMNGHG  469
             + +FD  P+K                               D++CW+ MI+GY  +G  
Sbjct  170  ARQLFDTMPEKSLVSLTAMITCYAKRGEVEEARVLFDGMEERDVVCWNVMIDGYAQHGMP  229

Query  470  NEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYAC  649
            NEAL  F  ML   I+PN++  +S+LSAC   G   E   W H+  E   I         
Sbjct  230  NEALLLFRKMLVAKIKPNELTVLSLLSACGQLG-ALESGRWLHSYIENNGIQVNAHAGTA  288

Query  650  MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQL--ISLD  823
            ++DM S+ G++E+A   V  M  E D   W +++ G    HG S  +  +  ++  +S  
Sbjct  289  LIDMYSKCGSLEDA-RLVFDMIDEKDVVAWNSMIVG-YAMHGFSRDALQLFHEMCRLSCQ  346

Query  824  PTNASYYVILS  856
            PT+ ++  +LS
Sbjct  347  PTDITFIGVLS  357



>ref|XP_009348813.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890 
[Pyrus x bretschneideri]
Length=571

 Score =   273 bits (699),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/322 (43%), Positives = 200/322 (62%), Gaps = 5/322 (2%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQ-  199
            +P   +++  Y+  G I  +R +FD + ++++I+WS MI+ Y        ALA+FR MQ 
Sbjct  129  LPSWNSIMNAYSKAGLIGDAREVFDKMPERNVISWSCMINGYVVCGAYKEALALFREMQK  188

Query  200  LEHG--KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGR  373
            ++ G  +PNEF   S+L AC  + A + G+ +H  + K G   +  L + L+DMY K G 
Sbjct  189  VDTGGVRPNEFTMLSVLLACGRLGALEHGKWVHAYIDKSGMQIDVVLGTALVDMYAKCGS  248

Query  374  IHQGKTIFDE-NPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLS  550
            I + K +FD   P KD++ WSSMI+G  M+GH  E L+ F +M+  G++PN V F+ VL 
Sbjct  249  IEKAKFVFDSMGPYKDVMAWSSMISGLAMHGHATECLKLFSEMIKLGMRPNAVTFVGVLC  308

Query  551  ACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDK  730
            AC H GL  EG  +F  M+E++ I P + H+ C+VD+  R G V EAL+ V  MP+EPD 
Sbjct  309  ACVHGGLVSEGKEYFRRMDEEFGIKPLIQHFGCIVDLYGRAGLVREALKMVQSMPMEPDV  368

Query  731  RIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQL  910
             +WGALL+G R  H   E SE+  K LI LDPTN+  YV+LSN+YA  G+W EV ++R L
Sbjct  369  LVWGALLSGSR-MHRDIETSEIALKNLIQLDPTNSGAYVLLSNVYAKMGKWSEVRRVRDL  427

Query  911  MDGKKRKKGMGYSVVEVNNSMH  976
            M+ K+ KK  G S+VEV   +H
Sbjct  428  MEVKEVKKVPGCSLVEVGGVLH  449


 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 135/281 (48%), Gaps = 38/281 (14%)
 Frame = +2

Query  122  AWSAMISAYAQSDQPSNA--LAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHT  295
             W+ +I A+ QS  PS+   L+VF RM+L   +P++  F  LLQ+C S+     G+ IH 
Sbjct  28   VWNTLIRAHVQSTVPSHPSPLSVFLRMRLHGVEPDDRTFPFLLQSCHSLPHIRPGKQIHA  87

Query  296  QVMKLGYTSNAFLASGLIDM-------------------------------YCKFGRIHQ  382
            QV   G+T + F+ + LI M                               Y K G I  
Sbjct  88   QVFLFGFTHDPFVRTSLIHMYSSCGSLTLARQVFDEITQPDLPSWNSIMNAYSKAGLIGD  147

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDML---SHGIQPNDVVFISVLSA  553
             + +FD+ P++++I WS MINGY + G   EAL  F +M    + G++PN+   +SVL A
Sbjct  148  AREVFDKMPERNVISWSCMINGYVVCGAYKEALALFREMQKVDTGGVRPNEFTMLSVLLA  207

Query  554  CSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKR  733
            C   G    G  W HA  +K  +   +     +VDM ++ G++E+A    + M    D  
Sbjct  208  CGRLGALEHG-KWVHAYIDKSGMQIDVVLGTALVDMYAKCGSIEKAKFVFDSMGPYKDVM  266

Query  734  IWGALLAGCRKTHGSSEISELVAKQL-ISLDPTNASYYVIL  853
             W ++++G      ++E  +L ++ + + + P   ++  +L
Sbjct  267  AWSSMISGLAMHGHATECLKLFSEMIKLGMRPNAVTFVGVL  307


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 75/156 (48%), Gaps = 3/156 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQ-KDIIAWSAMISAYAQSDQPSNAL  178
            KSG    + + TAL+ MYA  G+IE ++ +FDS+   KD++AWS+MIS  A     +  L
Sbjct  226  KSGMQIDVVLGTALVDMYAKCGSIEKAKFVFDSMGPYKDVMAWSSMISGLAMHGHATECL  285

Query  179  AVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG-ETIHTQVMKLGYTSNAFLASGLIDM  355
             +F  M     +PN   F  +L AC        G E       + G          ++D+
Sbjct  286  KLFSEMIKLGMRPNAVTFVGVLCACVHGGLVSEGKEYFRRMDEEFGIKPLIQHFGCIVDL  345

Query  356  YCKFGRIHQGKTIFDENP-DKDLICWSSMINGYGMN  460
            Y + G + +   +    P + D++ W ++++G  M+
Sbjct  346  YGRAGLVREALKMVQSMPMEPDVLVWGALLSGSRMH  381



>ref|XP_007047157.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOX91314.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=684

 Score =   276 bits (707),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/316 (40%), Positives = 198/316 (63%), Gaps = 1/316 (0%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V +AL+ MY   G+IE +R +FD +  +DI++W+AMI  Y +  +      +F  +    
Sbjct  248  VWSALMDMYGKCGSIEEARRVFDKIVDRDIVSWTAMIDRYFEDGRWEEGFELFSELMKSG  307

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             +PNEF F  +L AC+  AA+++G+ +H  + +LG+   +F AS L+ MY K G +   K
Sbjct  308  IRPNEFTFAGVLNACADHAAEEIGKQVHGCMTRLGFNPFSFAASALVHMYSKCGNVENAK  367

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +F+  P  DL+ W+S+I GY  NG   EALE F  +L  G +P+ + F+ VLSAC+H G
Sbjct  368  RVFNGMPLPDLVSWTSLITGYAQNGQPEEALEYFELLLKSGTKPDHITFVGVLSACTHAG  427

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  +G  +FH++++++ +T    HYAC++D+L+R G  +EA   + KMP++PDK +W +L
Sbjct  428  LVDKGLEYFHSIKDRHGLTHTADHYACIIDLLARSGRFQEAENIIVKMPMKPDKFLWASL  487

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L GCR  HG+ E++E  A+ L  ++P N + YV ++N+YA  GRWDEV K+R+ MD K  
Sbjct  488  LGGCR-IHGNLELAEKAAEALFEIEPENPATYVTMANIYATAGRWDEVAKIRKKMDDKGV  546

Query  929  KKGMGYSVVEVNNSMH  976
             K  G S +EV   +H
Sbjct  547  VKKPGLSWIEVKRELH  562


 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/275 (31%), Positives = 141/275 (51%), Gaps = 4/275 (1%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH-GK  214
             L+  YA  G ++ +  LFD + ++D  +W+AMIS Y + D+P  AL ++R  ++    K
Sbjct  149  TLMSGYAKMGMLKEANKLFDEMPERDNFSWTAMISGYVRFDRPKEALELYRMKEMSMVSK  208

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
             N+F   S + A ++M     G+ IH ++ + G   +  + S L+DMY K G I + + +
Sbjct  209  LNKFTVSSAIAASAAMGCLTTGKEIHGRITRAGLDLDEVVWSALMDMYGKCGSIEEARRV  268

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            FD+  D+D++ W++MI+ Y  +G   E  E F +++  GI+PN+  F  VL+AC+    E
Sbjct  269  FDKIVDRDIVSWTAMIDRYFEDGRWEEGFELFSELMKSGIRPNEFTFAGVLNACADHAAE  328

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
              G    H    +    P     + +V M S+ GNVE A    N MP+ PD   W +L+ 
Sbjct  329  EIG-KQVHGCMTRLGFNPFSFAASALVHMYSKCGNVENAKRVFNGMPL-PDLVSWTSLIT  386

Query  755  GCRKTHGSSEISELVAKQLIS-LDPTNASYYVILS  856
            G  +     E  E     L S   P + ++  +LS
Sbjct  387  GYAQNGQPEEALEYFELLLKSGTKPDHITFVGVLS  421


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/254 (22%), Positives = 114/254 (45%), Gaps = 16/254 (6%)
 Frame = +2

Query  212  KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKT  391
            KP    + +L+Q C    A + G+++H  +   G+++   + + L+DMY K G +   + 
Sbjct  75   KPPASLYSTLIQLCCQNRALNEGKSVHQHIKISGFSAGLVICNRLLDMYAKCGSLADAQN  134

Query  392  IFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGL  571
            +FDE  ++DL  W+++++GY   G   EA + F +M     + ++  + +++S       
Sbjct  135  VFDEMSERDLCSWNTLMSGYAKMGMLKEANKLFDEM----PERDNFSWTAMISGYVRFDR  190

Query  572  EYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQ--GNVEEALEF---VNKMPIEPDKRI  736
              E    +   E    +  KL  +     + +    G +    E    + +  ++ D+ +
Sbjct  191  PKEALELYRMKE--MSMVSKLNKFTVSSAIAASAAMGCLTTGKEIHGRITRAGLDLDEVV  248

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDE-VEKLRQLM  913
            W AL+    K  GS E +  V  +++  D  +   +  + + Y + GRW+E  E   +LM
Sbjct  249  WSALMDMYGKC-GSIEEARRVFDKIVDRDIVS---WTAMIDRYFEDGRWEEGFELFSELM  304

Query  914  DGKKRKKGMGYSVV  955
                R     ++ V
Sbjct  305  KSGIRPNEFTFAGV  318



>gb|KFK33599.1| hypothetical protein AALP_AA5G034800 [Arabis alpina]
Length=656

 Score =   276 bits (705),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/328 (39%), Positives = 206/328 (63%), Gaps = 4/328 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYAN--FGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNA  175
            K+GF + + V   LL  YA    G +  +R +FD +  KD +++++++S YAQ+   + A
Sbjct  208  KNGFDRGVSVGNTLLDAYAKGGAGGVAVARRIFDEIVDKDCVSYNSIMSVYAQNGMSNEA  267

Query  176  LAVFRRMQLEHGKP-NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLID  352
              VFR +  +     N     ++L A S   A  +G+ IH QV+++G   +  + + +I+
Sbjct  268  FGVFRVLIKDKVVTFNSITLSTVLLAVSHSGALRIGKCIHDQVIRMGLEDDVIIGTSIIN  327

Query  353  MYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVV  532
            MYCK GR+   +  FD   +K++  W++MI GYGM+GH  +ALE F  M+  G++PN + 
Sbjct  328  MYCKCGRVETARKAFDRMKNKNVRSWTAMIAGYGMHGHAAKALELFPAMIDSGVRPNYIA  387

Query  533  FISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKM  712
            F+SVL+ACSH GL  EGW WF+AM+ ++ + P L HY CMVD+LSR G +++A + +  M
Sbjct  388  FVSVLAACSHAGLHVEGWRWFNAMKGRFGVEPGLEHYGCMVDLLSRAGFLQKAYDLILTM  447

Query  713  PIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEV  892
             ++PD  IW +LLA CR  H + E++E+   +L  LDP+N  YY++LS++YAD GRW +V
Sbjct  448  KMKPDSIIWSSLLAACR-IHKNVELAEISVARLFELDPSNCGYYMLLSHIYADAGRWKDV  506

Query  893  EKLRQLMDGKKRKKGMGYSVVEVNNSMH  976
            E++R +M  +   K  G S++E+N  +H
Sbjct  507  ERVRMVMKNRGLVKPPGVSLLELNGEVH  534


 Score =   111 bits (277),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 72/259 (28%), Positives = 133/259 (51%), Gaps = 11/259 (4%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G+   I V +AL+ MY++ G +E +R +FD +  ++I++W++MI  Y  +    +A+++F
Sbjct  103  GYQSDIFVSSALIVMYSSCGKLEDARKVFDEIPNRNIVSWTSMIRGYDLNGNALDAVSLF  162

Query  188  RRMQLEHGKP------NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLI  349
            + +  E          +     S++ ACS +AA+ + E+IH+ V+K G+     + + L+
Sbjct  163  KDLLAEENDNDAAMLLDSMGMVSVISACSRVAAKGLTESIHSFVIKNGFDRGVSVGNTLL  222

Query  350  DMYCK--FGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQP-  520
            D Y K   G +   + IFDE  DKD + ++S+++ Y  NG  NEA   F  ++   +   
Sbjct  223  DAYAKGGAGGVAVARRIFDEIVDKDCVSYNSIMSVYAQNGMSNEAFGVFRVLIKDKVVTF  282

Query  521  NDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEF  700
            N +   +VL A SH G    G    H    +  +   +     +++M  + G VE A + 
Sbjct  283  NSITLSTVLLAVSHSGALRIG-KCIHDQVIRMGLEDDVIIGTSIINMYCKCGRVETARKA  341

Query  701  VNKMPIEPDKRIWGALLAG  757
             ++M    + R W A++AG
Sbjct  342  FDRMK-NKNVRSWTAMIAG  359


 Score =   102 bits (255),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/193 (31%), Positives = 103/193 (53%), Gaps = 11/193 (6%)
 Frame = +2

Query  14   LKCIPVVTALLQMYANFGNIESSRI--LFDSLSQK-DIIAWSAMISAYAQSDQPSNALAV  184
            +K +P   +L+  ++   + +   +  LF+    K D+ +W+++IS  A+S   + AL  
Sbjct  1    MKKLPSKISLVASFSRLLHTDRQNLTTLFNKYVDKTDVYSWNSVISDLARSGDSAEALRA  60

Query  185  FRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK  364
            F  M+     P   +F   ++ACSS+     G+  H Q    GY S+ F++S LI MY  
Sbjct  61   FASMRKLSLYPTRSSFPCTIKACSSLLDIFSGKQTHQQAFVFGYQSDIFVSSALIVMYSS  120

Query  365  FGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVV----  532
             G++   + +FDE P+++++ W+SMI GY +NG+  +A+  F D+L+     ND      
Sbjct  121  CGKLEDARKVFDEIPNRNIVSWTSMIRGYDLNGNALDAVSLFKDLLAEE-NDNDAAMLLD  179

Query  533  ---FISVLSACSH  562
                +SV+SACS 
Sbjct  180  SMGMVSVISACSR  192



>ref|NP_001043491.2| Os01g0600400 [Oryza sativa Japonica Group]
 dbj|BAD53436.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza 
sativa Japonica Group]
 dbj|BAD52986.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza 
sativa Japonica Group]
 gb|EEE54935.1| hypothetical protein OsJ_02490 [Oryza sativa Japonica Group]
 dbj|BAF05405.2| Os01g0600400 [Oryza sativa Japonica Group]
Length=348

 Score =   266 bits (681),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/325 (39%), Positives = 199/325 (61%), Gaps = 2/325 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            KSGF     V   LL MY   G   ++R++FD L ++D+ +W+ ++S YA++D+   A+ 
Sbjct  15   KSGFQGDYDVSKMLLDMYVQAGCFTNARLVFDRLKERDVFSWTVVMSTYAKTDEGEKAIE  74

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             FR M  E+ +PN+    + L  CS +A    G  +H+  +K G+ S+  ++S L+DMY 
Sbjct  75   CFRSMLRENKRPNDATLATSLSVCSDLACLGSGLQLHSYTIKSGWNSSV-VSSALVDMYV  133

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +   + +FDE+   DL+ W+++I GY  +GHG +ALE F +M+  G  P+++ F+ 
Sbjct  134  KCGNLADAEMLFDESDTHDLVEWNTIICGYAQHGHGYKALEAFQEMIDEGNVPDEITFVG  193

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VLSACSH GL  EG  +F  +   Y ITP L HYACMVD+L++ G + EA   +N+MP+ 
Sbjct  194  VLSACSHAGLLDEGRRYFKLLSSVYGITPTLEHYACMVDILAKAGKLAEAESLINEMPLT  253

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD  +W  +L  CR  HG+ EI+E  A++L    P + S  ++LSN+YAD  RW++V KL
Sbjct  254  PDASLWKTILGACR-MHGNIEIAERAAEKLFESQPDDISSCILLSNIYADLKRWNDVAKL  312

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R ++  +  KK  G S +E+N  +H
Sbjct  313  RSMLVDRGVKKEPGCSWIEINGKLH  337


 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 66/138 (48%), Gaps = 2/138 (1%)
 Frame = +2

Query  278  GETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGM  457
            G  +H  V+K G+  +  ++  L+DMY + G     + +FD   ++D+  W+ +++ Y  
Sbjct  6    GCQVHACVLKSGFQGDYDVSKMLLDMYVQAGCFTNARLVFDRLKERDVFSWTVVMSTYAK  65

Query  458  NGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLA  637
               G +A+ECF  ML    +PND    + LS CS       G    H+   K      + 
Sbjct  66   TDEGEKAIECFRSMLRENKRPNDATLATSLSVCSDLACLGSGLQ-LHSYTIKSGWNSSVV  124

Query  638  HYACMVDMLSRQGNVEEA  691
              A +VDM  + GN+ +A
Sbjct  125  SSA-LVDMYVKCGNLADA  141



>ref|XP_010276178.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g11460 [Nelumbo nucifera]
Length=613

 Score =   275 bits (702),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/316 (41%), Positives = 200/316 (63%), Gaps = 1/316 (0%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V   LL MY   G+++ +R LFD++ +K +I W+AMIS YAQ+   S+ L ++ +M+   
Sbjct  182  VGNCLLTMYVRCGSVDVARKLFDAMPEKGLITWNAMISGYAQNGLASHVLDLYHKMESVG  241

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
              P+   F S+L +C+ + AQ VG  I  +++  G+  N FL + LI+MY + G + + +
Sbjct  242  MDPDPVTFVSVLSSCAHLGAQSVGRDIEWRILSRGFDFNPFLTNALINMYARCGNLARAR  301

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FDE P+K L+ W++++ GYGM+G G  A+  F +M   GIQP+   F+SVLSACSH G
Sbjct  302  MLFDEMPEKTLVSWTAILAGYGMHGQGETAVHLFNEMCGVGIQPDGAAFVSVLSACSHAG  361

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  +G  +F  M+  Y I P   HYAC+VD+L R G +EEA E +  MP++PD  +WGAL
Sbjct  362  LTDKGLEYFSEMKRIYGINPGPEHYACVVDLLGRAGQLEEARELIYSMPVKPDGAVWGAL  421

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L  C K H + E++EL  ++++ L+PTN  YYV+LSN+Y++    + V K+R +M  +  
Sbjct  422  LGAC-KIHRNVELAELAFERVVELEPTNVGYYVLLSNIYSEVENLEGVAKVRIMMRMRNL  480

Query  929  KKGMGYSVVEVNNSMH  976
            +KG G S +E+   +H
Sbjct  481  RKGPGCSYMELKKKVH  496


 Score =   134 bits (336),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/281 (30%), Positives = 148/281 (53%), Gaps = 9/281 (3%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILF--DSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            V T+L+ MY     +E++R LF     S++  + ++A+I+ Y+ + Q S AL +FR M+ 
Sbjct  79   VQTSLISMYCKCSLVENARRLFQQSPQSRRLTVCYNALIAGYSLNSQFSAALLLFRAMRR  138

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
                 N      L+  C+     D G ++H   +K G  ++  + + L+ MY + G +  
Sbjct  139  AGVMFNAITMLGLIPVCTVPLDLDFGMSLHACNVKCGVDADPSVGNCLLTMYVRCGSVDV  198

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + +FD  P+K LI W++MI+GY  NG  +  L+ +  M S G+ P+ V F+SVLS+C+H
Sbjct  199  ARKLFDAMPEKGLITWNAMISGYAQNGLASHVLDLYHKMESVGMDPDPVTFVSVLSSCAH  258

Query  563  CGLEYEGWNW-FHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIW  739
             G +  G +  +  +   +D  P L +   +++M +R GN+  A    ++MP E     W
Sbjct  259  LGAQSVGRDIEWRILSRGFDFNPFLTN--ALINMYARCGNLARARMLFDEMP-EKTLVSW  315

Query  740  GALLAGCRKTHGSSEISELVAKQL--ISLDPTNASYYVILS  856
             A+LAG    HG  E +  +  ++  + + P  A++  +LS
Sbjct  316  TAILAG-YGMHGQGETAVHLFNEMCGVGIQPDGAAFVSVLS  355


 Score =   101 bits (251),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 121/249 (49%), Gaps = 5/249 (2%)
 Frame = +2

Query  122  AWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQV  301
            +W+  +   A+       L ++R+M      PN F+F   L+AC++++    G  +H  V
Sbjct  9    SWNTRLRELAKEGLFKEGLQLYRQMLRSGDSPNAFSFPFALKACAALSLPLSGAQLHCHV  68

Query  302  MKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPD--KDLICWSSMINGYGMNGHGNE  475
            +K G     F+ + LI MYCK   +   + +F ++P   +  +C++++I GY +N   + 
Sbjct  69   VKTGCDPEPFVQTSLISMYCKCSLVENARRLFQQSPQSRRLTVCYNALIAGYSLNSQFSA  128

Query  476  ALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMV  655
            AL  F  M   G+  N +  + ++  C+   L+ +     HA   K  +    +   C++
Sbjct  129  ALLLFRAMRRAGVMFNAITMLGLIPVCT-VPLDLDFGMSLHACNVKCGVDADPSVGNCLL  187

Query  656  DMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAK-QLISLDPTN  832
             M  R G+V+ A +  + MP E     W A+++G  +   +S + +L  K + + +DP  
Sbjct  188  TMYVRCGSVDVARKLFDAMP-EKGLITWNAMISGYAQNGLASHVLDLYHKMESVGMDPDP  246

Query  833  ASYYVILSN  859
             ++  +LS+
Sbjct  247  VTFVSVLSS  255



>ref|XP_004294643.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=870

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/316 (42%), Positives = 205/316 (65%), Gaps = 2/316 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V  +L+ MYA  G++E +  +F  +  KDI++W+ MI  Y+++  P+ AL +F  MQ + 
Sbjct  435  VCNSLMDMYAKCGSMEDADSVFSHMPMKDIVSWNTMIGGYSKNCLPNEALELFSDMQRKF  494

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KP+     S+L AC+S+AA D G+ IH  +++ GY  + ++A+ L+DMY K G +   +
Sbjct  495  -KPDSMTLASVLPACASLAALDRGQEIHGYLLRHGYFLDQYVANALVDMYVKCGVLILAR  553

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +F+  P KDLI ++ +I GYGM+G G EA+  F +M    I+P+ + FIS+L ACSH G
Sbjct  554  VLFEMIPVKDLISYTVIIAGYGMHGFGKEAIAAFNEMTKAEIEPDSISFISILYACSHSG  613

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            L  EGW +F  M   Y I P L HYACMVD+L+R GN+ +A +F+N MPIEPD  +WG+L
Sbjct  614  LVQEGWRFFDIMRNDYKIEPMLEHYACMVDLLARTGNLTKAYKFINMMPIEPDATVWGSL  673

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L GCR  H   +++E VA+ +  L+P N  YY++L+N+YA+  +W+EV+KLR+ +  +  
Sbjct  674  LCGCR-IHHDVKLAEKVAEHVFELEPENTGYYILLANIYAEAEKWEEVKKLRERIGRRSL  732

Query  929  KKGMGYSVVEVNNSMH  976
            KK  G S +E+   ++
Sbjct  733  KKNPGCSWIEIKGKVN  748


 Score =   134 bits (338),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/275 (28%), Positives = 139/275 (51%), Gaps = 2/275 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            VV +L+  Y   G +ES+R +FD+L ++D+++W++MISAY  +  P   + +FR M    
Sbjct  233  VVNSLMAFYFKNGRVESARKVFDALRERDVVSWNSMISAYVSNGAPEKGIEIFREMVWSG  292

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
               +     ++L ACS      +G  +H   MK G+  +  L + ++DMY K G +    
Sbjct  293  IDVDLATIINVLMACSDCGNVVLGRVVHGYAMKGGFDVDVVLCNSVLDMYSKCGDLSDAV  352

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +F++   + ++ W+SMI GY   G  ++A+E F +M + G+ P+     S+L AC+ C 
Sbjct  353  RVFEKMGRRSVVSWTSMIAGYVREGLSDKAIELFCEMETDGVIPDVYTITSILHACA-CS  411

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
               E     H    ++D+   L     ++DM ++ G++E+A    + MP++ D   W  +
Sbjct  412  GSLEKGKDIHKYIREHDMDSSLFVCNSLMDMYAKCGSMEDADSVFSHMPMK-DIVSWNTM  470

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVIL  853
            + G  K    +E  EL +       P + +   +L
Sbjct  471  IGGYSKNCLPNEALELFSDMQRKFKPDSMTLASVL  505


 Score =   115 bits (288),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 142/281 (51%), Gaps = 6/281 (2%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V   L+ MY + G++  +R +FD+LS + +  W+ MI+ YA+       + +F +M    
Sbjct  132  VGAKLVFMYVHCGDLREARRVFDALSDRKVFLWNLMINEYAKVRDFREGVCLFGKMVECG  191

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             + N + F  + +  +++     GE +H  + KL + S++ + + L+  Y K GR+   +
Sbjct  192  VELNSYTFSCVFKCFAALGCVREGEWVHGYLYKLRFGSDSNVVNSLMAFYFKNGRVESAR  251

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD   ++D++ W+SMI+ Y  NG   + +E F +M+  GI  +    I+VL ACS CG
Sbjct  252  KVFDALRERDVVSWNSMISAYVSNGAPEKGIEIFREMVWSGIDVDLATIINVLMACSDCG  311

Query  569  LEYEGWNWF-HAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGA  745
                G     +AM+  +D+   L +   ++DM S+ G++ +A+    KM        W +
Sbjct  312  NVVLGRVVHGYAMKGGFDVDVVLCN--SVLDMYSKCGDLSDAVRVFEKMG-RRSVVSWTS  368

Query  746  LLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYA  868
            ++AG  +   S +  EL  +  +  D      Y I S L+A
Sbjct  369  MIAGYVREGLSDKAIELFCE--METDGVIPDVYTITSILHA  407


 Score =   115 bits (287),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 142/290 (49%), Gaps = 14/290 (5%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   + +  ++L MY+  G++  +  +F+ + ++ +++W++MI+ Y +      A+ 
Sbjct  325  KGGFDVDVVLCNSVLDMYSKCGDLSDAVRVFEKMGRRSVVSWTSMIAGYVREGLSDKAIE  384

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M+ +   P+ +   S+L AC+   + + G+ IH  + +    S+ F+ + L+DMY 
Sbjct  385  LFCEMETDGVIPDVYTITSILHACACSGSLEKGKDIHKYIREHDMDSSLFVCNSLMDMYA  444

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +    ++F   P KD++ W++MI GY  N   NEALE F DM     +P+ +   S
Sbjct  445  KCGSMEDADSVFSHMPMKDIVSWNTMIGGYSKNCLPNEALELFSDM-QRKFKPDSMTLAS  503

Query  542  VLSACSHC-----GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVN  706
            VL AC+       G E  G+   H     Y +   +A+   +VDM  + G +  A     
Sbjct  504  VLPACASLAALDRGQEIHGYLLRHG----YFLDQYVAN--ALVDMYVKCGVLILARVLFE  557

Query  707  KMPIEPDKRIWGALLAGC-RKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             +P++ D   +  ++AG      G   I+         ++P + S+  IL
Sbjct  558  MIPVK-DLISYTVIIAGYGMHGFGKEAIAAFNEMTKAEIEPDSISFISIL  606


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 76/177 (43%), Gaps = 2/177 (1%)
 Frame = +2

Query  227  AFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDEN  406
            A+ S+L+ C+   +   G+ +H+ + + G   + ++ + L+ MY   G + + + +FD  
Sbjct  97   AYCSVLELCAGNKSLKDGKRVHSVLCEHGVNVDGYVGAKLVFMYVHCGDLREARRVFDAL  156

Query  407  PDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGW  586
             D+ +  W+ MIN Y       E +  F  M+  G++ N   F  V    +  G   EG 
Sbjct  157  SDRKVFLWNLMINEYAKVRDFREGVCLFGKMVECGVELNSYTFSCVFKCFAALGCVREG-  215

Query  587  NWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
             W H    K            ++    + G VE A +  + +  E D   W ++++ 
Sbjct  216  EWVHGYLYKLRFGSDSNVVNSLMAFYFKNGRVESARKVFDALR-ERDVVSWNSMISA  271



>emb|CAN62101.1| hypothetical protein VITISV_033310 [Vitis vinifera]
Length=396

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/317 (39%), Positives = 200/317 (63%), Gaps = 1/317 (0%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V TA+L+MY   G ++  R++FD ++++D++ WSAMI+ YAQ+ + + AL +F  M+   
Sbjct  43   VSTAMLEMYVKCGAVDDGRLVFDHMARRDVVXWSAMIAGYAQNGRSNEALELFEXMKSAQ  102

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             KPN+    S+L AC+ + + + GE I + V   G  SN ++AS L+ MY K G I + +
Sbjct  103  IKPNDVTLVSVLSACAQLGSVETGERIGSYVESRGLISNVYVASALLGMYSKCGNIIKAR  162

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             IFD+ P +D + W+SMI G  +NG   +A+  +  M    ++PN++ F+ +L+AC+H G
Sbjct  163  QIFDKLPQRDNVTWNSMIMGLAINGFAEDAIALYNRMKEIEVKPNNITFVGLLTACTHAG  222

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
                G  +F +M   ++I+P + H+AC+VD+  R G + +A EF+ +M +EP+  IWG L
Sbjct  223  HVELGLEFFRSMRSDHNISPNIEHFACIVDLFCRSGRLIDAYEFICRMEVEPNVVIWGTL  282

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L+  R  H + E++EL  K+L+ L+P N+  YVILSN+YA   RW E  K+R+LM  K+ 
Sbjct  283  LSASR-IHLNVELAELAGKKLLELEPDNSGNYVILSNIYASASRWQEALKVRKLMKDKRV  341

Query  929  KKGMGYSVVEVNNSMHR  979
            +K   YS VEV + +H+
Sbjct  342  QKAAAYSWVEVEDRVHK  358


 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/217 (29%), Positives = 113/217 (52%), Gaps = 5/217 (2%)
 Frame = +2

Query  212  KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKT  391
            +P+E    ++L  C+ +   ++G  I          SN  +++ +++MY K G +  G+ 
Sbjct  3    EPBEITLATVLSICAKLGDLEMGLRIKKLXDNKNLGSNMIVSTAMLEMYVKCGAVDDGRL  62

Query  392  IFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGL  571
            +FD    +D++ WS+MI GY  NG  NEALE F  M S  I+PNDV  +SVLSAC+  G 
Sbjct  63   VFDHMARRDVVXWSAMIAGYAQNGRSNEALELFEXMKSAQIKPNDVTLVSVLSACAQLG-  121

Query  572  EYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALL  751
              E      +  E   +   +   + ++ M S+ GN+ +A +  +K+P + D   W +++
Sbjct  122  SVETGERIGSYVESRGLISNVYVASALLGMYSKCGNIIKARQIFDKLP-QRDNVTWNSMI  180

Query  752  AGCRKTHGSSEISELVAKQL--ISLDPTNASYYVILS  856
             G    +G +E +  +  ++  I + P N ++  +L+
Sbjct  181  MGL-AINGFAEDAIALYNRMKEIEVKPNNITFVGLLT  216


 Score = 73.6 bits (179),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 78/149 (52%), Gaps = 2/149 (1%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G +  + V +ALL MY+  GNI  +R +FD L Q+D + W++MI   A +    +A+A++
Sbjct  137  GLISNVYVASALLGMYSKCGNIIKARQIFDKLPQRDNVTWNSMIMGLAINGFAEDAIALY  196

Query  188  RRMQLEHGKPNEFAFHSLLQACSSMAAQDVG-ETIHTQVMKLGYTSNAFLASGLIDMYCK  364
             RM+    KPN   F  LL AC+     ++G E   +       + N    + ++D++C+
Sbjct  197  NRMKEIEVKPNNITFVGLLTACTHAGHVELGLEFFRSMRSDHNISPNIEHFACIVDLFCR  256

Query  365  FGR-IHQGKTIFDENPDKDLICWSSMING  448
             GR I   + I     + +++ W ++++ 
Sbjct  257  SGRLIDAYEFICRMEVEPNVVIWGTLLSA  285



>ref|XP_008804951.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820 
[Phoenix dactylifera]
Length=724

 Score =   277 bits (708),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/314 (41%), Positives = 198/314 (63%), Gaps = 1/314 (0%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
            TA++  YA  G IE +R +FD + ++D+++WSAMIS YA+SDQP+ A+ +F  MQL   +
Sbjct  290  TAMVFGYAKIGKIEIARSIFDQMPERDLVSWSAMISGYAESDQPNEAIKLFNEMQLSGVR  349

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
            P+     S++ AC+ + A D  + +H  V K G++    + + LIDMYCK G +   + I
Sbjct  350  PDRITMLSVISACAHLGALDQAKWVHIFVDKNGFSGILSIKNALIDMYCKCGSLADAQKI  409

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            F+E P +++I W+SMI G  ++G G  AL  F  M + G++PN V F+ +L ACSH GL 
Sbjct  410  FEEMPSRNVITWTSMITGCAVHGDGRSALALFDQMKAEGVEPNRVTFVGLLYACSHTGLV  469

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
             +G   F++M + +++ PK  HY CMVD+L R   ++EA E +  MP  P+  +WG+LL 
Sbjct  470  EDGRRIFNSMIQDHNMEPKHEHYGCMVDLLGRARLLQEAFELIESMPFTPNVVVWGSLLG  529

Query  755  GCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKK  934
             C K HG  E+ EL AK+L+ LDP++   YV+LSN+YA   RWD+V ++R LM  K   K
Sbjct  530  AC-KMHGDVELGELAAKRLLELDPSHDGAYVLLSNIYAKASRWDDVRQVRTLMKCKGVSK  588

Query  935  GMGYSVVEVNNSMH  976
              G S +E++  +H
Sbjct  589  ERGCSWIELDGKVH  602


 Score =   140 bits (354),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/317 (27%), Positives = 156/317 (49%), Gaps = 36/317 (11%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF     V TAL++ YA  G +  +R +FD +SQ+D++AW  M+  Y Q+     AL 
Sbjct  147  KLGFDSDPFVQTALVRSYAACGRVADARGVFDRMSQRDLVAWGVMLDGYCQTGCFGEALQ  206

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM--  355
            +F  M+  +  P++    ++L AC        G+ IH+ ++    + ++ L S LI+M  
Sbjct  207  LFEDMKSCNVVPDQVILATVLSACGRTGNLMAGQAIHSYIVASNISMDSHLQSALINMYS  266

Query  356  -----------------------------YCKFGRIHQGKTIFDENPDKDLICWSSMING  448
                                         Y K G+I   ++IFD+ P++DL+ WS+MI+G
Sbjct  267  SCKSMDNAQKLYDSIYPKNLVSSTAMVFGYAKIGKIEIARSIFDQMPERDLVSWSAMISG  326

Query  449  YGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITP  628
            Y  +   NEA++ F +M   G++P+ +  +SV+SAC+H G   +   W H   +K   + 
Sbjct  327  YAESDQPNEAIKLFNEMQLSGVRPDRITMLSVISACAHLG-ALDQAKWVHIFVDKNGFSG  385

Query  629  KLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQ  808
             L+    ++DM  + G++ +A +   +MP   +   W +++ GC   HG    +  +  Q
Sbjct  386  ILSIKNALIDMYCKCGSLADAQKIFEEMP-SRNVITWTSMITGC-AVHGDGRSALALFDQ  443

Query  809  LIS--LDPTNASYYVIL  853
            + +  ++P   ++  +L
Sbjct  444  MKAEGVEPNRVTFVGLL  460


 Score = 94.7 bits (234),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 76/274 (28%), Positives = 126/274 (46%), Gaps = 37/274 (14%)
 Frame = +2

Query  170  NALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQD-VGETIHTQVMKLGYTSNAFLASGL  346
             ALA + R++      + F+F ++L+  +   A D V    H  V KLG+ S+ F+ + L
Sbjct  101  RALAAYDRIRRAGLPLDRFSFPTVLRVAARAGADDWVAREAHGLVAKLGFDSDPFVQTAL  160

Query  347  IDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPND  526
            +  Y   GR+   + +FD    +DL+ W  M++GY   G   EAL+ F DM S  + P+ 
Sbjct  161  VRSYAACGRVADARGVFDRMSQRDLVAWGVMLDGYCQTGCFGEALQLFEDMKSCNVVPDQ  220

Query  527  VVFISVLSACSHCG----------------------LEYEGWNWFHA------MEEKYD-  619
            V+  +VLSAC   G                      L+    N + +       ++ YD 
Sbjct  221  VILATVLSACGRTGNLMAGQAIHSYIVASNISMDSHLQSALINMYSSCKSMDNAQKLYDS  280

Query  620  ITPK-LAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISEL  796
            I PK L     MV   ++ G +E A    ++MP E D   W A+++G  ++   +E  +L
Sbjct  281  IYPKNLVSSTAMVFGYAKIGKIEIARSIFDQMP-ERDLVSWSAMISGYAESDQPNEAIKL  339

Query  797  VAK-QLISLDPTNASYYVILS---NLYA-DQGRW  883
              + QL  + P   +   ++S   +L A DQ +W
Sbjct  340  FNEMQLSGVRPDRITMLSVISACAHLGALDQAKW  373


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/156 (24%), Positives = 77/156 (49%), Gaps = 2/156 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+GF   + +  AL+ MY   G++  ++ +F+ +  +++I W++MI+  A      +ALA
Sbjct  380  KNGFSGILSIKNALIDMYCKCGSLADAQKIFEEMPSRNVITWTSMITGCAVHGDGRSALA  439

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASG-LIDMY  358
            +F +M+ E  +PN   F  LL ACS     + G  I   +++           G ++D+ 
Sbjct  440  LFDQMKAEGVEPNRVTFVGLLYACSHTGLVEDGRRIFNSMIQDHNMEPKHEHYGCMVDLL  499

Query  359  CKFGRIHQGKTIFDENP-DKDLICWSSMINGYGMNG  463
             +   + +   + +  P   +++ W S++    M+G
Sbjct  500  GRARLLQEAFELIESMPFTPNVVVWGSLLGACKMHG  535



>ref|XP_006469116.1| PREDICTED: uncharacterized protein LOC102612526 [Citrus sinensis]
Length=1508

 Score =   285 bits (729),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/313 (43%), Positives = 199/313 (64%), Gaps = 2/313 (1%)
 Frame = +2

Query  38    ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
             A + M+A  G ++ +R  FD +S KD+++W++MI AYAQ+D P  AL VFR+M L    P
Sbjct  740   AAMVMFARCGRMDMARKFFDGISNKDLVSWTSMIEAYAQADLPLEALEVFRQMILRRVLP  799

Query  218   NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
             +   F  +++ACSS+A+     T+H  ++     +   L + ++D+Y K G +   + +F
Sbjct  800   DSVTFLGVIRACSSLASFQQARTVHGIIIHCFLGNQLALDTAVVDLYVKCGSLMYARKVF  859

Query  398   DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEY  577
             D    K++I WS+MI+GYGM+GHG EAL  F D +   I+P+ + F+SVLSACSH GL  
Sbjct  860   DRMKQKNVISWSTMISGYGMHGHGREALFLF-DQMKALIKPDHITFVSVLSACSHAGLID  918

Query  578   EGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
             EGW  F++M   + + P+  HYACMVDML R G + EA EF+ +MPI PD  +WG+LL  
Sbjct  919   EGWECFNSMLRDFGVAPRPEHYACMVDMLGRAGKLNEAREFIERMPIRPDAGVWGSLLGA  978

Query  758   CRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKKG  937
             CR  H + E++E+ AK L  LD  N   YVILSN+YA  G+  E +++R LM  +  KK 
Sbjct  979   CR-IHSNVELAEMAAKALFDLDAENPGRYVILSNIYASSGKRTEADRIRALMKRRGVKKI  1037

Query  938   MGYSVVEVNNSMH  976
              G++V+E+ N +H
Sbjct  1038  TGHTVIEIKNKVH  1050


 Score =   117 bits (292),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 100/177 (56%), Gaps = 2/177 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQK-DIIAWSAMISAYAQSDQPSNALAVFRRMQLE  205
            +VT L+  YA+ G+I  +  LF S+S   DI  W+ MI A+  + Q   +L ++ +M+  
Sbjct  537  LVTNLVSQYASLGSISHAFSLFSSVSDSCDIFLWNVMIRAFVDNRQFDRSLQLYAQMREL  596

Query  206  HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQG  385
               P+ F F  +L+AC  +   + G  +H   +  GY S+ F+ + LI MY K GR+   
Sbjct  597  DINPDNFTFPFVLKACGYLRDIEFGVKVHKDAVDSGYWSDVFVGNSLIAMYGKCGRVDVC  656

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
            + +FDE P+++++ WSS+   Y  NG   E L  F  M+  GI+PN VV ++V+ AC
Sbjct  657  RQLFDEMPERNVVTWSSLTGAYAQNGCYEEGLLLFKRMMDEGIRPNRVVILNVM-AC  712


 Score =   105 bits (262),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/285 (26%), Positives = 139/285 (49%), Gaps = 7/285 (2%)
 Frame = +2

Query  5    SGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAV  184
            SG+   + V  +L+ MY   G ++  R LFD + +++++ WS++  AYAQ+      L +
Sbjct  631  SGYWSDVFVGNSLIAMYGKCGRVDVCRQLFDEMPERNVVTWSSLTGAYAQNGCYEEGLLL  690

Query  185  FRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK  364
            F+RM  E  +PN     +++ AC    ++   E +   V+  G   +  L +  + M+ +
Sbjct  691  FKRMMDEGIRPNRVVILNVM-ACIRKVSE--AEDVCRVVVDNGLDLDQSLQNAAMVMFAR  747

Query  365  FGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISV  544
             GR+   +  FD   +KDL+ W+SMI  Y       EALE F  M+   + P+ V F+ V
Sbjct  748  CGRMDMARKFFDGISNKDLVSWTSMIEAYAQADLPLEALEVFRQMILRRVLPDSVTFLGV  807

Query  545  LSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEP  724
            + ACS     ++     H +     +  +LA    +VD+  + G++  A +  ++M  + 
Sbjct  808  IRACSSLA-SFQQARTVHGIIIHCFLGNQLALDTAVVDLYVKCGSLMYARKVFDRMK-QK  865

Query  725  DKRIWGALLAGCRKTHGSSEISELVAKQLISL-DPTNASYYVILS  856
            +   W  +++G    HG    +  +  Q+ +L  P + ++  +LS
Sbjct  866  NVISWSTMISG-YGMHGHGREALFLFDQMKALIKPDHITFVSVLS  909



>ref|XP_004955182.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Setaria italica]
Length=548

 Score =   273 bits (697),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/312 (40%), Positives = 194/312 (62%), Gaps = 1/312 (0%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            LL   A  G +  +  LFD + +  + +W+A+++ +AQS +P++AL VFR M+     PN
Sbjct  116  LLTALAARGRVAEALELFDEMPEPSVRSWTALVAGFAQSGRPADALRVFRDMEGAGVAPN  175

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
            E    ++L AC+ +   D+G  +H    + GY+ N  + +  IDMY K G +   + +FD
Sbjct  176  EVTVVAVLAACADVGDLDLGRKVHGYAKRQGYSRNVLVCNAAIDMYVKCGCVDAARGVFD  235

Query  401  ENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYE  580
                + ++ WS+MI G+ M+G G++ALE F  M   G+ PN V F+ +L ACSH GL  E
Sbjct  236  AMDGRTVVSWSAMICGHAMHGEGDKALELFAAMRRRGMLPNGVTFVGLLHACSHMGLVDE  295

Query  581  GWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
            G  +F +ME+ + I P++ H  CMVD+LSR G+++EALEF+N MP+EP+  +WGALL G 
Sbjct  296  GRAFFESMEKDHGIAPEIEHCGCMVDLLSRAGHLQEALEFINGMPVEPNSVVWGALLGGA  355

Query  761  RKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKKGM  940
            R  H + E+ E   ++L  LDP N  YYV+LSN+YA  GRW++V ++R+ M  +  KK  
Sbjct  356  R-LHRNVEVGEEATRRLAVLDPGNDGYYVVLSNIYAAAGRWEDVARVRRAMKLRGVKKTT  414

Query  941  GYSVVEVNNSMH  976
            G+S + V  ++H
Sbjct  415  GWSAISVGGTVH  426


 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/151 (25%), Positives = 71/151 (47%), Gaps = 2/151 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            + G+ + + V  A + MY   G ++++R +FD++  + +++WSAMI  +A   +   AL 
Sbjct  204  RQGYSRNVLVCNAAIDMYVKCGCVDAARGVFDAMDGRTVVSWSAMICGHAMHGEGDKALE  263

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMK-LGYTSNAFLASGLIDMY  358
            +F  M+     PN   F  LL ACS M   D G      + K  G          ++D+ 
Sbjct  264  LFAAMRRRGMLPNGVTFVGLLHACSHMGLVDEGRAFFESMEKDHGIAPEIEHCGCMVDLL  323

Query  359  CKFGRIHQGKTIFDENP-DKDLICWSSMING  448
             + G + +     +  P + + + W +++ G
Sbjct  324  SRAGHLQEALEFINGMPVEPNSVVWGALLGG  354



>ref|XP_009362269.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Pyrus x bretschneideri]
Length=622

 Score =   275 bits (702),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/336 (37%), Positives = 211/336 (63%), Gaps = 1/336 (0%)
 Frame = +2

Query  2     KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
             ++GF   + V  ALL +YA  G++ES+  +F+S+S++D++AW+++I+ +A + +P+ AL 
Sbjct  177   RNGFESLVFVKNALLHVYACCGHVESAHKMFESMSERDLVAWNSVINGFALNGRPNEALT  236

Query  182   VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
             +FR M LE  +P+ F   SLL AC+ +    +G  IH  ++K+G T N+   + L+D+Y 
Sbjct  237   IFRDMNLEGVEPDGFTMVSLLSACAEIGTLALGRRIHVYMLKVGLTGNSHATNALLDLYA  296

Query  362   KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
             K G I + + +F+   ++ ++ W++++ G  +NG G EALE F ++   G+ P ++ F+ 
Sbjct  297   KCGSIREAQKVFEAMDERSVVSWTALVVGLAVNGFGMEALELFKELKGEGLVPTEITFVG  356

Query  542   VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
             VL ACSHCG+  EG+ +F  M E+Y I P++ HY CMVD+L R G  + A E++  MP++
Sbjct  357   VLYACSHCGMVDEGFEYFRMMREEYGIVPRIEHYGCMVDLLGRAGLAKRAYEYIMNMPMK  416

Query  722   PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
             P+  IW  LL  C   HG   + E+   ++  L+P ++  YV+LSNLYA + RW +V+K+
Sbjct  417   PNAVIWRTLLGAC-TIHGQLALGEIARARIRELEPGHSGDYVLLSNLYASEHRWSDVQKV  475

Query  902   RQLMDGKKRKKGMGYSVVEVNNSMHRMEF**RSEQE  1009
             R+ M  +  +K  GYS+VE+ N ++      RS  +
Sbjct  476   RRTMLSEGVRKTPGYSIVELRNCIYEFTMGGRSHPQ  511


 Score =   117 bits (293),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/226 (28%), Positives = 115/226 (51%), Gaps = 8/226 (4%)
 Frame = +2

Query  89   LFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAA  268
            +F  +   ++  W+ MI  YA+   P+  + ++ +M     +P+   +  LL+A + +  
Sbjct  105  IFSQIENPNVFTWNTMIRGYAECQNPAPVIQLYHQMHQSSVQPDTHTYPFLLKAVAKLMD  164

Query  269  QDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMING  448
               GE IH+ V++ G+ S  F+ + L+ +Y   G +     +F+   ++DL+ W+S+ING
Sbjct  165  VGEGEKIHSVVVRNGFESLVFVKNALLHVYACCGHVESAHKMFESMSERDLVAWNSVING  224

Query  449  YGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITP  628
            + +NG  NEAL  F DM   G++P+    +S+LSAC+  G    G    H    K  +T 
Sbjct  225  FALNGRPNEALTIFRDMNLEGVEPDGFTMVSLLSACAEIGTLALG-RRIHVYMLKVGLTG  283

Query  629  KLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKR---IWGALLAG  757
                   ++D+ ++ G++ EA +    M    D+R    W AL+ G
Sbjct  284  NSHATNALLDLYAKCGSIREAQKVFEAM----DERSVVSWTALVVG  325



>ref|XP_006436815.1| hypothetical protein CICLE_v10030936mg [Citrus clementina]
 ref|XP_006485371.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Citrus sinensis]
 gb|ESR50055.1| hypothetical protein CICLE_v10030936mg [Citrus clementina]
Length=641

 Score =   275 bits (703),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/305 (41%), Positives = 198/305 (65%), Gaps = 1/305 (0%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPN  220
            ++  YA  GN+ S+R  FD +S +++++W+ +++ Y +       L +F RM     +PN
Sbjct  291  MIDGYAKIGNVTSARNCFDRMSMRNVVSWNILLALYVRCKDYCECLRLFDRMIRGDARPN  350

Query  221  EFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFD  400
            E +  S+L AC++M A D+G+ IH+ + K     +  L++ L+ MY K G +   + +FD
Sbjct  351  EASLMSVLTACANMGAIDIGQWIHSYIQKCRIKPDVLLSTSLLTMYAKCGVMDLARNVFD  410

Query  401  ENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYE  580
               +K+++ W+SMI GYGM+G G +ALE F++M   G  PND  FI VLSAC+H G+  E
Sbjct  411  NMTEKNVVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPTPNDATFICVLSACTHAGMVLE  470

Query  581  GWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGC  760
            GW +F  M+  Y I PK+ HY CMVD+L R G + ++ E V+K+P+E    +WGALL+ C
Sbjct  471  GWWYFDLMQRIYKIEPKVEHYGCMVDLLGRAGLMRDSEELVSKLPMEAGPALWGALLSAC  530

Query  761  RKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKKGM  940
              TH +SE+ ++VA+ L+ L+P +   YV+LSN+YA +G+WDEVE LR++M  K+ +K +
Sbjct  531  -STHSNSELGKIVAQHLMELEPRDPGPYVLLSNIYASEGKWDEVENLRRIMKEKELEKAV  589

Query  941  GYSVV  955
            G S+V
Sbjct  590  GSSLV  594


 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 68/275 (25%), Positives = 124/275 (45%), Gaps = 24/275 (9%)
 Frame = +2

Query  89   LFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF-RRMQLEHGKPNEFAFHSLLQACSSMA  265
             FD + + D    + ++ ++   + P  AL+ +  +M  +  + N + F  L + C+ + 
Sbjct  112  FFDGIQEPDAFMCNTIMKSFLMLNDPFGALSFYYEKMMAKFVEHNHYTFPLLGKVCAGIR  171

Query  266  AQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMIN  445
            +   G+ +H +++K G+  + F+ +  I MY   G +   +T+FD+ P  DL+ W+SMI+
Sbjct  172  SLREGKKVHARIVKCGFELDLFVRNSFIHMYSVCGEVLDARTVFDDGPVWDLVTWNSMID  231

Query  446  GYGMNGHGNEALECFLDMLSHGIQPNDVVFI--SVLSACSHCGLEYEGWNWFHAMEEKYD  619
            GY  N     A E F         P   +F   S++S     G + E  N        +D
Sbjct  232  GYVKNREVGFARELF------DFMPERDIFTWNSMISGYVDVG-DMEAANGL------FD  278

Query  620  ITP--KLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISE  793
            + P   +  + CM+D  ++ GNV  A    ++M +  +   W  LLA   +     E   
Sbjct  279  LMPFRDVVSWNCMIDGYAKIGNVTSARNCFDRMSMR-NVVSWNILLALYVRCKDYCECLR  337

Query  794  LVAKQLI-SLDPTNASYYVILS---NLYA-DQGRW  883
            L  + +     P  AS   +L+   N+ A D G+W
Sbjct  338  LFDRMIRGDARPNEASLMSVLTACANMGAIDIGQW  372


 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 66/288 (23%), Positives = 130/288 (45%), Gaps = 15/288 (5%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   + V  + + MY+  G +  +R +FD     D++ W++MI  Y ++ +   A  
Sbjct  185  KCGFELDLFVRNSFIHMYSVCGEVLDARTVFDDGPVWDLVTWNSMIDGYVKNREVGFARE  244

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGET-IHTQVMKLGYTSNAFLASGLIDMY  358
            +F  M     + + F ++S++         DVG+      +  L    +    + +ID Y
Sbjct  245  LFDFMP----ERDIFTWNSMIS-----GYVDVGDMEAANGLFDLMPFRDVVSWNCMIDGY  295

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
             K G +   +  FD    ++++ W+ ++  Y       E L  F  M+    +PN+   +
Sbjct  296  AKIGNVTSARNCFDRMSMRNVVSWNILLALYVRCKDYCECLRLFDRMIRGDARPNEASLM  355

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            SVL+AC++ G    G  W H+  +K  I P +     ++ M ++ G ++ A    + M  
Sbjct  356  SVLTACANMGAIDIG-QWIHSYIQKCRIKPDVLLSTSLLTMYAKCGVMDLARNVFDNM-T  413

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPT--NASYYVILS  856
            E +   W +++ G    HG  E +  +  ++    PT  +A++  +LS
Sbjct  414  EKNVVSWNSMIMG-YGMHGQGEKALEMFMEMEKRGPTPNDATFICVLS  460


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
            T+LL MYA  G ++ +R +FD++++K++++W++MI  Y    Q   AL +F  M+     
Sbjct  390  TSLLTMYAKCGVMDLARNVFDNMTEKNVVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPT  449

Query  215  PNEFAFHSLLQACS  256
            PN+  F  +L AC+
Sbjct  450  PNDATFICVLSACT  463



>ref|XP_008235102.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890 
[Prunus mume]
Length=571

 Score =   273 bits (698),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/322 (43%), Positives = 196/322 (61%), Gaps = 5/322 (2%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            +P   +++  Y+  G I ++R +FD +  +++I+WS MI  Y        ALA+FR MQ+
Sbjct  129  LPSWNSIMNAYSKVGLIGNARDVFDKMPHRNVISWSCMIKGYVMCGGYKEALALFREMQM  188

Query  203  ---EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGR  373
               +  +PNEF   S+L AC  + A + G+ +H  + K G   +  L + L+DMY K G 
Sbjct  189  LDADGARPNEFTMSSVLLACGRLGALEHGKWVHAYIDKSGMEIDVILGTALVDMYAKCGS  248

Query  374  IHQGKTIFDE-NPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLS  550
            I + K +FD   P KD++ WSSMI+G  M+G   E LE F +M+  G++PN V F+ VL 
Sbjct  249  IEKAKWVFDNMGPSKDVMAWSSMISGLAMHGLATECLELFSEMVKCGVRPNAVTFVGVLC  308

Query  551  ACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDK  730
            AC H GL  EG  +F  M+E++ + P + HY C+VD+  R G V EAL+ V  MP+EPD 
Sbjct  309  ACVHGGLVGEGKEYFRRMDEEFGVKPLIQHYGCIVDLYGRAGLVREALKVVQSMPMEPDV  368

Query  731  RIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQL  910
             IWGALL+G R      E SE+  K LI LDPTN+  YV+LSN+YA  GRW EV ++R L
Sbjct  369  LIWGALLSGSR-MQKDIETSEIALKNLIHLDPTNSGAYVLLSNVYAKMGRWSEVTRVRDL  427

Query  911  MDGKKRKKGMGYSVVEVNNSMH  976
            M+ ++ KK  G S+VEV   +H
Sbjct  428  MEEREIKKVPGCSLVEVGGVLH  449


 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 86/305 (28%), Positives = 136/305 (45%), Gaps = 38/305 (12%)
 Frame = +2

Query  44   LQMYANFGNIESSR-ILFDSLSQKDIIAWSAMISAYAQSDQPS--NALAVFRRMQLEHGK  214
            +QM A+   I S+   L  S    +   W+ +I A+ Q+  P+  + L+VF RM+L    
Sbjct  1    MQMRASAKLISSTHPTLHLSHPTPESFVWNTLIRAHVQATVPNPYSPLSVFLRMRLHGVV  60

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDM-------------  355
            P+   F  LLQ+  S+     G+ IH QV   G+T + F+ + LI M             
Sbjct  61   PDNRTFPFLLQSFGSLPYLQSGKQIHAQVFLFGFTHDPFVQTSLIHMYSSCGNLMLARQV  120

Query  356  ------------------YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEAL  481
                              Y K G I   + +FD+ P +++I WS MI GY M G   EAL
Sbjct  121  FDEIYEPDLPSWNSIMNAYSKVGLIGNARDVFDKMPHRNVISWSCMIKGYVMCGGYKEAL  180

Query  482  ECFLDML---SHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACM  652
              F +M    + G +PN+    SVL AC   G    G  W HA  +K  +   +     +
Sbjct  181  ALFREMQMLDADGARPNEFTMSSVLLACGRLGALEHG-KWVHAYIDKSGMEIDVILGTAL  239

Query  653  VDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTN  832
            VDM ++ G++E+A    + M    D   W ++++G      ++E  EL ++ +      N
Sbjct  240  VDMYAKCGSIEKAKWVFDNMGPSKDVMAWSSMISGLAMHGLATECLELFSEMVKCGVRPN  299

Query  833  ASYYV  847
            A  +V
Sbjct  300  AVTFV  304


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/156 (28%), Positives = 74/156 (47%), Gaps = 3/156 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSL-SQKDIIAWSAMISAYAQSDQPSNAL  178
            KSG    + + TAL+ MYA  G+IE ++ +FD++   KD++AWS+MIS  A     +  L
Sbjct  226  KSGMEIDVILGTALVDMYAKCGSIEKAKWVFDNMGPSKDVMAWSSMISGLAMHGLATECL  285

Query  179  AVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG-ETIHTQVMKLGYTSNAFLASGLIDM  355
             +F  M     +PN   F  +L AC        G E       + G          ++D+
Sbjct  286  ELFSEMVKCGVRPNAVTFVGVLCACVHGGLVGEGKEYFRRMDEEFGVKPLIQHYGCIVDL  345

Query  356  YCKFGRIHQGKTIFDENP-DKDLICWSSMINGYGMN  460
            Y + G + +   +    P + D++ W ++++G  M 
Sbjct  346  YGRAGLVREALKVVQSMPMEPDVLIWGALLSGSRMQ  381



>emb|CDP08643.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/321 (40%), Positives = 195/321 (61%), Gaps = 3/321 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            +P   AL+  YA  G++  +   F ++  +++I+W+AMIS Y+Q+ + ++ALA++  M+ 
Sbjct  6    VPTWNALIAGYAKSGDMREASRFFSNMPSRNVISWTAMISGYSQNGEYADALALYLEMEK  65

Query  203  EHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIH  379
            E G KPN+    S+L AC+++ A +VG+ I       GY +N F+ + +++MY + GRI 
Sbjct  66   EKGVKPNQVTIASVLPACANLGALEVGQRIEAYAKSNGYLNNMFVCNAILEMYARCGRID  125

Query  380  QGKTIFDE-NPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
                +F E    +DL  W++MI G  ++G   EAL+ F  ML  GI P+DV F+  + AC
Sbjct  126  SAMRLFHEIGRRRDLCSWNTMIMGLAIHGKCCEALDLFNQMLGEGISPDDVTFVGAILAC  185

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
            +H G+  +G   F +ME+K+ +TP+L HY CMVD+L R G ++EA   +  MP+ PD  I
Sbjct  186  THGGMVAKGRELFESMEQKFSVTPRLEHYGCMVDLLGRAGELQEAYHLIRSMPMRPDSVI  245

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            WG +L  C   +G+ E+ E  A+ L  L+P N   YVILSN+YA  GRWD V KLR+LM 
Sbjct  246  WGTMLGAC-SFYGNVELGEKAAESLFELEPCNPGNYVILSNIYASAGRWDGVAKLRKLMK  304

Query  917  GKKRKKGMGYSVVEVNNSMHR  979
              +  K  GYS +E    +HR
Sbjct  305  SSQVTKAAGYSFMEEGGQLHR  325


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 84/189 (44%), Gaps = 8/189 (4%)
 Frame = +2

Query  5    SGFLKCIPVVTALLQMYANFGNIESSRILFDSLS-QKDIIAWSAMISAYAQSDQPSNALA  181
            +G+L  + V  A+L+MYA  G I+S+  LF  +  ++D+ +W+ MI   A   +   AL 
Sbjct  102  NGYLNNMFVCNAILEMYARCGRIDSAMRLFHEIGRRRDLCSWNTMIMGLAIHGKCCEALD  161

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG-ETIHTQVMKLGYTSNAFLASGLIDMY  358
            +F +M  E   P++  F   + AC+       G E   +   K   T        ++D+ 
Sbjct  162  LFNQMLGEGISPDDVTFVGAILACTHGGMVAKGRELFESMEQKFSVTPRLEHYGCMVDLL  221

Query  359  CKFGRIHQGKTIFDENPDK-DLICWSSMING---YGMNGHGNEALECFLDMLSHGIQPND  526
             + G + +   +    P + D + W +M+     YG    G +A E   ++      P +
Sbjct  222  GRAGELQEAYHLIRSMPMRPDSVIWGTMLGACSFYGNVELGEKAAESLFEL--EPCNPGN  279

Query  527  VVFISVLSA  553
             V +S + A
Sbjct  280  YVILSNIYA  288



>gb|EPS64087.1| hypothetical protein M569_10688 [Genlisea aurea]
Length=628

 Score =   274 bits (701),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/323 (39%), Positives = 201/323 (62%), Gaps = 1/323 (0%)
 Frame = +2

Query  8    GFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVF  187
            G +    V  +L  MY   G+++S+R +FD +  K++I W+AMI+ Y+Q+     AL ++
Sbjct  190  GLITDSAVGNSLCSMYLRCGSLDSARKMFDEMPLKNLITWNAMITGYSQNGLGKEALELY  249

Query  188  RRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKF  367
            R+M+     P+E     +L +C+++ AQ +G  I  ++  LG+ SN FL + LI MY + 
Sbjct  250  RKMRSSCFAPDEVTLVGVLSSCANLGAQRIGREIEDEIENLGFGSNPFLKNSLISMYSRC  309

Query  368  GRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVL  547
            G + + + +FD  P+K+L+ W++MI GYG++G G  A E F DM++  I+P+   F+SVL
Sbjct  310  GDLERARAVFDSMPEKNLVSWTAMITGYGIHGRGETAAELFDDMVAAKIEPDGAAFVSVL  369

Query  548  SACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPD  727
            +ACSH GL  +G ++F +ME  Y + P L HYAC+VD+L R G + +A   +  MPI+ D
Sbjct  370  AACSHAGLTRKGLDYFDSMERTYRLKPALEHYACVVDLLGRAGRLSDASRLIESMPIQAD  429

Query  728  KRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQ  907
              +WGALL  C K H +  ++E   K+++ L+P N  YYV+LSNLY++ G  D V ++R 
Sbjct  430  GPVWGALLGAC-KIHKNVSLAEQAFKKVVQLEPRNIGYYVLLSNLYSETGDKDGVLRIRV  488

Query  908  LMDGKKRKKGMGYSVVEVNNSMH  976
            ++  +  KK  GYS VE+   +H
Sbjct  489  MLRKQGLKKDAGYSYVELGRKIH  511


 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/281 (28%), Positives = 138/281 (49%), Gaps = 9/281 (3%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSL--SQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            V TAL+ MY  F +   ++ LFD +  S +  + ++A IS      +   AL + R M  
Sbjct  94   VQTALISMYCRFRSTADAQKLFDEIPKSSRPTVCYNAFISGLVHRKKLIEALVLLREMMF  153

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
                 N      L+  C   +   +G ++H+ +   G  +++ + + L  MY + G +  
Sbjct  154  NRVGINGVTILGLIVGCVLPSHLTLGMSLHSLIQTHGLITDSAVGNSLCSMYLRCGSLDS  213

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + +FDE P K+LI W++MI GY  NG G EALE +  M S    P++V  + VLS+C++
Sbjct  214  ARKMFDEMPLKNLITWNAMITGYSQNGLGKEALELYRKMRSSCFAPDEVTLVGVLSSCAN  273

Query  563  CGLEYEGWNWFHAMEE-KYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIW  739
             G +  G      +E   +   P L +   ++ M SR G++E A    + MP E +   W
Sbjct  274  LGAQRIGREIEDEIENLGFGSNPFLKN--SLISMYSRCGDLERARAVFDSMP-EKNLVSW  330

Query  740  GALLAGCRKTHGSSEISELVAKQLIS--LDPTNASYYVILS  856
             A++ G    HG  E +  +   +++  ++P  A++  +L+
Sbjct  331  TAMITG-YGIHGRGETAAELFDDMVAAKIEPDGAAFVSVLA  370


 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 70/271 (26%), Positives = 126/271 (46%), Gaps = 17/271 (6%)
 Frame = +2

Query  125  WSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVM  304
            W+  +   ++  + + AL ++R M      PN F F  +L++ S++     G++IH  V+
Sbjct  25   WNTKLRELSKQGRCAQALILYREMLRSAAAPNAFTFPFVLKSSSALEIPISGKSIHCHVV  84

Query  305  KLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENP--DKDLICWSSMINGYGMNGHGNEA  478
            K G  S  F+ + LI MYC+F      + +FDE P   +  +C+++ I+G        EA
Sbjct  85   KSGCRSEPFVQTALISMYCRFRSTADAQKLFDEIPKSSRPTVCYNAFISGLVHRKKLIEA  144

Query  479  LECFLDMLSHGIQPNDVVFISVLSAC---SHCGLEYEGWNWFHAMEEKYDITPKLAHYAC  649
            L    +M+ + +  N V  + ++  C   SH  L        H++ + + +    A    
Sbjct  145  LVLLREMMFNRVGINGVTILGLIVGCVLPSHLTLGMS----LHSLIQTHGLITDSAVGNS  200

Query  650  MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSEISELVAKQLIS-LDP  826
            +  M  R G+++ A +  ++MP++ +   W A++ G  +     E  EL  K   S   P
Sbjct  201  LCSMYLRCGSLDSARKMFDEMPLK-NLITWNAMITGYSQNGLGKEALELYRKMRSSCFAP  259

Query  827  TNASYYVILS---NLYADQ-GR--WDEVEKL  901
               +   +LS   NL A + GR   DE+E L
Sbjct  260  DEVTLVGVLSSCANLGAQRIGREIEDEIENL  290



>ref|XP_008454056.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Cucumis melo]
 ref|XP_008454057.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Cucumis melo]
 ref|XP_008454058.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Cucumis melo]
 ref|XP_008454059.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Cucumis melo]
Length=686

 Score =   276 bits (705),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 203/313 (65%), Gaps = 1/313 (0%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
            +LL MY   G+IE +R +FD + +KD+++W+AMI+ Y ++++     A+FR +   + KP
Sbjct  253  SLLDMYGKCGSIEEARYIFDKMEEKDVVSWTAMINTYFENERREEGFALFRHLMNSNIKP  312

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            N+F    +L AC+ +AA+D+G+ IH+ +M++G+ S++  AS L+ MY K G I   K++F
Sbjct  313  NDFTVAGVLNACADLAAEDLGKQIHSYMMRVGFNSSSSAASALVHMYSKCGDIENAKSVF  372

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEY  577
            +  P  DL  W+S++ GY  +G  ++AL  F  +L  G +P+DV F+ VLSAC+H GL  
Sbjct  373  ETLPQPDLFSWTSLLVGYAQHGQHDKALHFFELLLKSGTKPDDVAFVGVLSACTHAGLVV  432

Query  578  EGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            +G  +FH+++EK+ +T    HYAC++D+L+R G   EA   +NKMP++PDK IW ALL G
Sbjct  433  KGLEYFHSIKEKHGLTHTTDHYACIIDLLARAGRFTEAESIINKMPMKPDKYIWSALLGG  492

Query  758  CRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKKG  937
            CR  HG+ E+++  AK L  ++P N + YV L+N+YA  G W E   +R+ M+ +   K 
Sbjct  493  CR-IHGNLELAQRAAKSLFEIEPENPTTYVTLANMYASAGMWAEEANMRETMNNRGIVKE  551

Query  938  MGYSVVEVNNSMH  976
             G S +E+   +H
Sbjct  552  PGLSWIEIKREVH  564


 Score =   126 bits (316),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 127/241 (53%), Gaps = 3/241 (1%)
 Frame = +2

Query  38   ALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL-EHGK  214
             ++  Y   G+ E +R LFD + ++D  +W A+IS   + ++P  AL ++R MQ  E+ +
Sbjct  151  TMISGYVKGGDFEKARNLFDKMPERDTFSWIAIISGCVRRNRPEEALELYRLMQKHENSE  210

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
             N+    S L A +++ +  VG+ IH  +M++G  ++  +   L+DMY K G I + + I
Sbjct  211  SNKLTTSSALAASAAIPSLHVGKEIHGHIMRVGLDTDEVVWCSLLDMYGKCGSIEEARYI  270

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            FD+  +KD++ W++MIN Y  N    E    F  +++  I+PND     VL+AC+    E
Sbjct  271  FDKMEEKDVVSWTAMINTYFENERREEGFALFRHLMNSNIKPNDFTVAGVLNACADLAAE  330

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
              G    H+   +       +  + +V M S+ G++E A      +P +PD   W +LL 
Sbjct  331  DLG-KQIHSYMMRVGFNSSSSAASALVHMYSKCGDIENAKSVFETLP-QPDLFSWTSLLV  388

Query  755  G  757
            G
Sbjct  389  G  389


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 101/207 (49%), Gaps = 5/207 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            + GF       +AL+ MY+  G+IE+++ +F++L Q D+ +W++++  YAQ  Q   AL 
Sbjct  342  RVGFNSSSSAASALVHMYSKCGDIENAKSVFETLPQPDLFSWTSLLVGYAQHGQHDKALH  401

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVG-ETIHTQVMKLGYTSNAFLASGLIDMY  358
             F  +     KP++ AF  +L AC+       G E  H+   K G T      + +ID+ 
Sbjct  402  FFELLLKSGTKPDDVAFVGVLSACTHAGLVVKGLEYFHSIKEKHGLTHTTDHYACIIDLL  461

Query  359  CKFGRIHQGKTIFDENPDK-DLICWSSMINGYGMNGHGNEALECFLDMLSHGIQP-NDVV  532
             + GR  + ++I ++ P K D   WS+++ G  +  HGN  L          I+P N   
Sbjct  462  ARAGRFTEAESIINKMPMKPDKYIWSALLGGCRI--HGNLELAQRAAKSLFEIEPENPTT  519

Query  533  FISVLSACSHCGLEYEGWNWFHAMEEK  613
            ++++ +  +  G+  E  N    M  +
Sbjct  520  YVTLANMYASAGMWAEEANMRETMNNR  546


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 64/133 (48%), Gaps = 4/133 (3%)
 Frame = +2

Query  212  KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKT  391
            KP    + +L++ C    A + G+ +H  +   G+    FL++ L+DMY K G +   + 
Sbjct  77   KPYASIYTTLVEFCLKQRALEEGKKVHAHIKASGFVLGLFLSNRLLDMYAKCGSLVDAEK  136

Query  392  IFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGL  571
            +FDE   +DL  W++MI+GY   G   +A   F  M     + +   +I+++S C     
Sbjct  137  VFDEMVRRDLCSWNTMISGYVKGGDFEKARNLFDKM----PERDTFSWIAIISGCVRRNR  192

Query  572  EYEGWNWFHAMEE  610
              E    +  M++
Sbjct  193  PEEALELYRLMQK  205



>ref|XP_003633947.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 
[Vitis vinifera]
Length=512

 Score =   271 bits (693),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 132/321 (41%), Positives = 199/321 (62%), Gaps = 3/321 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            +P   +++  YA  G++E +  LF  +  +++ +W+AMIS YAQ+ Q + AL++F  M+ 
Sbjct  148  VPTWNSMIAGYARCGDLEGALELFRLMPARNVTSWTAMISGYAQNGQYAKALSMFLMMEE  207

Query  203  E-HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIH  379
            E   +PNE    S+L AC+++ A +VGE I       GY  N ++++ L++MY + GRI 
Sbjct  208  ETEMRPNEVTLASVLPACANLGALEVGERIEVYARGNGYFKNLYVSNALLEMYARCGRID  267

Query  380  QGKTIFDE-NPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
            +   +F+E +  ++L  W+SMI G  ++G  +EA+E F  ML  G  P+DV F+ VL AC
Sbjct  268  KAWGVFEEIDGRRNLCSWNSMIMGLAVHGRCDEAIELFYKMLREGAAPDDVTFVGVLLAC  327

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
            +H G+  EG ++F +ME  + I PKL HY CMVD+L R G + EA + + +MP+EPD  +
Sbjct  328  THGGMVVEGQHFFESMERDFSIAPKLEHYGCMVDLLGRAGELREAHDLILRMPMEPDSVV  387

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            WG LL  C   HG  E++E  A  L  L+P+N   YVILSN+YA  GRWD V +LR+LM 
Sbjct  388  WGTLLGAC-SFHGHVELAEKAAGALFELEPSNPGNYVILSNIYATAGRWDGVARLRKLMK  446

Query  917  GKKRKKGMGYSVVEVNNSMHR  979
            G K  K  GYS +E    +H+
Sbjct  447  GGKITKAAGYSFIEEGGHIHK  467


 Score = 99.4 bits (246),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 134/328 (41%), Gaps = 80/328 (24%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++G      ++ +LLQ+     +I  +  LFD + +  +  ++ +I AY+         +
Sbjct  13   RNGIEHTKQLIVSLLQI----PSIPYAHKLFDFIPKPTVFLYNKLIQAYSSHGPHHQCFS  68

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++ +M L+   PNE +F  L  AC+S+++   G  +HT  +K G+  + F  + L+DMY 
Sbjct  69   LYTQMCLQGCSPNEHSFTFLFSACASLSSHQQGRMLHTHFVKSGFGCDVFALTALVDMYA  128

Query  362  KFGRIHQGKTIFDE-------------------------------NPDKDLICWSSMING  448
            K G +   +  FDE                                P +++  W++MI+G
Sbjct  129  KLGLLSLARKQFDEMTVRDVPTWNSMIAGYARCGDLEGALELFRLMPARNVTSWTAMISG  188

Query  449  YGMNGHGNEALECFLDMLSHG-IQPNDVVFISVLSACSH---------------------  562
            Y  NG   +AL  FL M     ++PN+V   SVL AC++                     
Sbjct  189  YAQNGQYAKALSMFLMMEEETEMRPNEVTLASVLPACANLGALEVGERIEVYARGNGYFK  248

Query  563  --------------CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEF  700
                          CG   + W  F    E+ D    L  +  M+  L+  G  +EA+E 
Sbjct  249  NLYVSNALLEMYARCGRIDKAWGVF----EEIDGRRNLCSWNSMIMGLAVHGRCDEAIEL  304

Query  701  VNKMPIE---PDKRIWGALLAGCRKTHG  775
              KM  E   PD   +  +L  C  THG
Sbjct  305  FYKMLREGAAPDDVTFVGVLLAC--THG  330


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/157 (22%), Positives = 75/157 (48%), Gaps = 3/157 (2%)
 Frame = +2

Query  5    SGFLKCIPVVTALLQMYANFGNIESSRILFDSL-SQKDIIAWSAMISAYAQSDQPSNALA  181
            +G+ K + V  ALL+MYA  G I+ +  +F+ +  ++++ +W++MI   A   +   A+ 
Sbjct  244  NGYFKNLYVSNALLEMYARCGRIDKAWGVFEEIDGRRNLCSWNSMIMGLAVHGRCDEAIE  303

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASG-LIDMY  358
            +F +M  E   P++  F  +L AC+       G+     + +    +      G ++D+ 
Sbjct  304  LFYKMLREGAAPDDVTFVGVLLACTHGGMVVEGQHFFESMERDFSIAPKLEHYGCMVDLL  363

Query  359  CKFGRIHQGKTIFDENP-DKDLICWSSMINGYGMNGH  466
             + G + +   +    P + D + W +++     +GH
Sbjct  364  GRAGELREAHDLILRMPMEPDSVVWGTLLGACSFHGH  400



>ref|XP_009380649.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485 
[Musa acuminata subsp. malaccensis]
 ref|XP_009380650.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485 
[Musa acuminata subsp. malaccensis]
 ref|XP_009380651.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485 
[Musa acuminata subsp. malaccensis]
 ref|XP_009380652.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485 
[Musa acuminata subsp. malaccensis]
 ref|XP_009380653.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485 
[Musa acuminata subsp. malaccensis]
 ref|XP_009380654.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485 
[Musa acuminata subsp. malaccensis]
Length=978

 Score =   281 bits (718),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 131/320 (41%), Positives = 202/320 (63%), Gaps = 1/320 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++G  K   ++ +LL +Y   G  + +R+LFD++  KD ++W+AMI+ Y Q+     +L 
Sbjct  533  RNGLEKDSFILISLLSLYIQCGRSQEARLLFDAMEDKDSVSWNAMIAGYLQNGLAQESLQ  592

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +FR+MQ E  +P+  A  S+  AC+ ++A  +G+  H   +K+G+T++ FL S +IDMY 
Sbjct  593  LFRQMQHEGYEPSIIATTSVFMACAELSALPLGQEAHCYALKVGFTADTFLGSSIIDMYA  652

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G I   +T+FD   DKD + W+ MI GYG+NG+G+EA++ + +M  HG++P+   ++ 
Sbjct  653  KCGSIEHARTLFDNLKDKDAVSWTVMITGYGINGYGSEAIDLYNEMEGHGLKPDAFTYLG  712

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L AC+H GL  EG  +F  M+ K+ + PKL HYAC+ DML R G + EA   +  MP E
Sbjct  713  ILMACNHAGLVEEGLRYFEYMKNKHSLEPKLEHYACVADMLGRVGKLAEAARIIEDMPEE  772

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD RIW  LLA CR THG   + E V ++L+ L+P  A +YV+ SNLYA  GRWD V ++
Sbjct  773  PDGRIWSGLLAACR-THGDICLGERVIEKLLELEPDKAEHYVLASNLYASSGRWDGVRRI  831

Query  902  RQLMDGKKRKKGMGYSVVEV  961
            R  M     +K  G+S ++V
Sbjct  832  RNRMKEIGLQKDPGFSWIDV  851


 Score =   122 bits (305),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 123/243 (51%), Gaps = 2/243 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V  AL+  YA  G ++S+  +F  +  K + AW+A+I  YAQ+  P+ A+ +F RM    
Sbjct  441  VPNALMAAYAKCGLLDSADNIFKDVEIKTVSAWNALIGGYAQNGDPNKAIELFLRMSSSG  500

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             +P+ F+  SLL AC+ +     G ++H  V++ G   ++F+   L+ +Y + GR  + +
Sbjct  501  LEPDWFSVGSLLLACAHLQDLLNGRSLHGYVLRNGLEKDSFILISLLSLYIQCGRSQEAR  560

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             +FD   DKD + W++MI GY  NG   E+L+ F  M   G +P+ +   SV  AC+   
Sbjct  561  LLFDAMEDKDSVSWNAMIAGYLQNGLAQESLQLFRQMQHEGYEPSIIATTSVFMACAELS  620

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
                G    H    K   T      + ++DM ++ G++E A    + +  + D   W  +
Sbjct  621  ALPLGQE-AHCYALKVGFTADTFLGSSIIDMYAKCGSIEHARTLFDNLK-DKDAVSWTVM  678

Query  749  LAG  757
            + G
Sbjct  679  ITG  681


 Score =   119 bits (297),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 120/224 (54%), Gaps = 14/224 (6%)
 Frame = +2

Query  26   PVVTA-LLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRR-MQ  199
            PV+T  LL MY   G+   +R +FD+L ++++  W+AMIS YA+++    A+  F   M 
Sbjct  131  PVLTTRLLTMYFACGSPSDARRVFDALPRRNLFQWNAMISGYARNELFVEAVDTFLLLMS  190

Query  200  LEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIH  379
                +P+ F    +L++C+ ++    GE +H   +KLG  S+ F+ + LI MY K G + 
Sbjct  191  ATELRPDNFTLPCVLKSCAGLSNMSTGEAVHGVAVKLGLGSDTFVNNSLISMYGKCGYVD  250

Query  380  QGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLS---HGIQPNDVVFISVLS  550
            +   +FD  P+++L+ W++M++ +  N    +  + F +MLS     ++P+D   ++VL 
Sbjct  251  EAAHVFDTMPERNLVSWNTMMSAFSDNALLQDGFDLFKEMLSVDEESMRPDDATAVTVLP  310

Query  551  ACSHCGLEYEGW----NWFHAMEEKYDITPKLAHYACMVDMLSR  670
             C+      +GW       H M  K D+  +L     +VDM ++
Sbjct  311  MCA-----VDGWLEMGRVVHGMSVKLDLDHELRVSNALVDMYAK  349


 Score =   105 bits (261),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 122/251 (49%), Gaps = 13/251 (5%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            + V  AL+ MYA    +  +++LF    Q+++++W+AMI   A++     A  + R MQ 
Sbjct  337  LRVSNALVDMYAKCSCLSDAQLLFGHNQQRNVVSWNAMIGGVARNGDVDGAFDLLREMQS  396

Query  203  EHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIH  379
            E G K NE    ++L AC   +     + +H  V++ G  +N  + + L+  Y K G + 
Sbjct  397  EEGIKANEVTVLNVLPACLGPSELQHVKELHAYVIRNGLQTNDLVPNALMAAYAKCGLLD  456

Query  380  QGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACS  559
                IF +   K +  W+++I GY  NG  N+A+E FL M S G++P+     S+L AC+
Sbjct  457  SADNIFKDVEIKTVSAWNALIGGYAQNGDPNKAIELFLRMSSSGLEPDWFSVGSLLLACA  516

Query  560  HC-----GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEP  724
            H      G    G+   + +E+   I   L      + +  + G  +EA    + M  + 
Sbjct  517  HLQDLLNGRSLHGYVLRNGLEKDSFILISL------LSLYIQCGRSQEARLLFDAME-DK  569

Query  725  DKRIWGALLAG  757
            D   W A++AG
Sbjct  570  DSVSWNAMIAG  580


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 94/211 (45%), Gaps = 8/211 (4%)
 Frame = +2

Query  239  LLQACSSMAAQDVGETIHTQVMKL-GYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDK  415
            LLQAC +    ++G  +H  V    G  SN  L + L+ MY   G     + +FD  P +
Sbjct  101  LLQACGARGDLELGRRVHGVVASSEGLMSNPVLTTRLLTMYFACGSPSDARRVFDALPRR  160

Query  416  DLICWSSMINGYGMNGHGNEALECFLDMLSHG-IQPNDVVFISVLSACSHCGLEYEGWNW  592
            +L  W++MI+GY  N    EA++ FL ++S   ++P++     VL +C+       G   
Sbjct  161  NLFQWNAMISGYARNELFVEAVDTFLLLMSATELRPDNFTLPCVLKSCAGLSNMSTG-EA  219

Query  593  FHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKT-  769
             H +  K  +         ++ M  + G V+EA    + MP E +   W  +++      
Sbjct  220  VHGVAVKLGLGSDTFVNNSLISMYGKCGYVDEAAHVFDTMP-ERNLVSWNTMMSAFSDNA  278

Query  770  ---HGSSEISELVAKQLISLDPTNASYYVIL  853
                G     E+++    S+ P +A+   +L
Sbjct  279  LLQDGFDLFKEMLSVDEESMRPDDATAVTVL  309



>ref|XP_004305658.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g11460-like [Fragaria vesca subsp. vesca]
Length=608

 Score =   274 bits (700),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 129/325 (40%), Positives = 204/325 (63%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G    + V   LL MY   G ++++R +FD++ +K +I W+AMIS YAQ+   S+ L 
Sbjct  170  KCGLDSDLSVRNCLLTMYVKCGLVDNARKIFDAMPEKGLITWNAMISGYAQNGLASHVLN  229

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            ++R M+     P+      +L +C+ + A  VG  +  ++   G+ SN +L + LI+MY 
Sbjct  230  LYREMEACGFFPDPVTLVGVLSSCTHLGAHGVGREVERRIESSGFGSNPYLKNALINMYT  289

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            + G + +  +IFD  P+K L+ W+++I GYGM+GHG  ALE F +M+  GI+P+  VF++
Sbjct  290  RCGNLVRAHSIFDVMPEKSLVTWTAIIGGYGMHGHGEVALELFEEMIVSGIRPDKAVFVT  349

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VLSACSH GL  EG  +F AME+ Y + P   HY+CMVD+L R G ++EA E ++ M ++
Sbjct  350  VLSACSHAGLTDEGLEYFAAMEKNYRLQPGPEHYSCMVDLLGRAGRLKEAKELIDSMQVK  409

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD  +WGALL  C K H + E++E+  + +I L+PTN+ YYV++SN+Y+D    + + K+
Sbjct  410  PDGGVWGALLGAC-KIHKNVELAEIAFEHVIELEPTNSGYYVLMSNIYSDAKNLEGILKV  468

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R +M  ++ KK  G S VE    +H
Sbjct  469  RVMMKERQLKKEPGCSYVECKGRVH  493


 Score =   128 bits (321),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 143/280 (51%), Gaps = 8/280 (3%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDI-IAWSAMISAYAQSDQPSNALAVFRRMQLE  205
            V T+L+ MY      + +R +FD   Q+ + + ++A+IS +A + +  +A+ +FRRM+ E
Sbjct  77   VQTSLISMYCKCCLTDDARKVFDESPQRKLTVCYNALISGHASNSKLRDAVLLFRRMREE  136

Query  206  HGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQG  385
                N      L+  C++     +G  +H   +K G  S+  + + L+ MY K G +   
Sbjct  137  GVGVNSVTMLGLIPGCAAPGHLSLGMCLHGSSVKCGLDSDLSVRNCLLTMYVKCGLVDNA  196

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC  565
            + IFD  P+K LI W++MI+GY  NG  +  L  + +M + G  P+ V  + VLS+C+H 
Sbjct  197  RKIFDAMPEKGLITWNAMISGYAQNGLASHVLNLYREMEACGFFPDPVTLVGVLSSCTHL  256

Query  566  GLEYEGWNWFHAMEEK-YDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
            G    G      +E   +   P L +   +++M +R GN+  A    + MP E     W 
Sbjct  257  GAHGVGREVERRIESSGFGSNPYLKN--ALINMYTRCGNLVRAHSIFDVMP-EKSLVTWT  313

Query  743  ALLAGCRKTHGSSEIS-ELVAKQLIS-LDPTNASYYVILS  856
            A++ G    HG  E++ EL  + ++S + P  A +  +LS
Sbjct  314  AIIGG-YGMHGHGEVALELFEEMIVSGIRPDKAVFVTVLS  352


 Score =   100 bits (248),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 105/212 (50%), Gaps = 3/212 (1%)
 Frame = +2

Query  125  WSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVM  304
            W++ +   A+    S AL+++R+M      PN F F   L++C+++A    G  +H+ V+
Sbjct  8    WNSRLRDLAKQSLFSEALSLYRQMLRFGHPPNAFTFPFALKSCAALALPLTGSLLHSHVL  67

Query  305  KLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDL-ICWSSMINGYGMNGHGNEAL  481
            K G     F+ + LI MYCK       + +FDE+P + L +C++++I+G+  N    +A+
Sbjct  68   KTGCDPEPFVQTSLISMYCKCCLTDDARKVFDESPQRKLTVCYNALISGHASNSKLRDAV  127

Query  482  ECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDM  661
              F  M   G+  N V  + ++  C+  G    G    H    K  +   L+   C++ M
Sbjct  128  LLFRRMREEGVGVNSVTMLGLIPGCAAPGHLSLGM-CLHGSSVKCGLDSDLSVRNCLLTM  186

Query  662  LSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
              + G V+ A +  + MP E     W A+++G
Sbjct  187  YVKCGLVDNARKIFDAMP-EKGLITWNAMISG  217



>gb|KDP28448.1| hypothetical protein JCGZ_14219 [Jatropha curcas]
Length=512

 Score =   271 bits (693),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 196/318 (62%), Gaps = 4/318 (1%)
 Frame = +2

Query  14   LKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRR  193
             K IP   AL+  Y+  GN+E +  LF  +  K++++W+AMIS Y+Q+ + + AL +F  
Sbjct  145  FKDIPTWNALIAGYSRCGNMEEALDLFRRMPYKNVVSWTAMISGYSQNGEYAKALEMFLN  204

Query  194  MQLEHG-KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFG  370
            M+ E G  PNE    S+L AC+++ A +VGE I     K G  SN ++++ L+DMY + G
Sbjct  205  MEKEKGLAPNEVTIASVLPACANLGALEVGERIEAYARKNGLLSNMYVSNALLDMYARCG  264

Query  371  RIHQGKTIFDE--NPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISV  544
            +I   + +FDE     K+L  W+SMI G  ++G  ++AL+ +  M+  G  P+DV F+ +
Sbjct  265  KIDVARQVFDEIIGKRKNLCSWNSMIMGLAIHGRSHDALQLYNQMMREGTAPDDVTFVGL  324

Query  545  LSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEP  724
            L AC+H G+  +G   F +ME K+ I+PKL HY CMVD+L R G ++EA E +  MP+ P
Sbjct  325  LLACTHGGMVVKGRQLFQSMERKFRISPKLEHYGCMVDLLGRAGELQEAYEIIKSMPMRP  384

Query  725  DKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLR  904
            D  IWGALL  C   H + E++E+ A+ L  L+P N   YVILSN+YA  GRWD V  LR
Sbjct  385  DSVIWGALLGAC-SFHKNVELAEIAAESLFELEPWNPGNYVILSNIYATAGRWDGVAMLR  443

Query  905  QLMDGKKRKKGMGYSVVE  958
            +LM G    K  GYS +E
Sbjct  444  KLMKGGHITKAAGYSFIE  461


 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 149/324 (46%), Gaps = 43/324 (13%)
 Frame = +2

Query  68   NIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQ  247
            NI  +  LF+ +       ++ +I AY+   QP   L+++ +M+ ++  PNE  F  L  
Sbjct  31   NISYAHNLFNLIPSPTAFLYNKLIQAYSFQSQPYRCLSLYSQMRFKNCLPNEHTFTFLFA  90

Query  248  ACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDE--------  403
            AC   ++   G+ +HT ++K G+  + F  + L+DMY K G++   + +FDE        
Sbjct  91   ACICFSSDLHGQILHTHLLKSGFNFDIFALTALVDMYAKLGKLRSARHVFDEITFKDIPT  150

Query  404  -----------------------NPDKDLICWSSMINGYGMNGHGNEALECFLDMLSH-G  511
                                    P K+++ W++MI+GY  NG   +ALE FL+M    G
Sbjct  151  WNALIAGYSRCGNMEEALDLFRRMPYKNVVSWTAMISGYSQNGEYAKALEMFLNMEKEKG  210

Query  512  IQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEA  691
            + PN+V   SVL AC++ G   E      A   K  +   +     ++DM +R G ++ A
Sbjct  211  LAPNEVTIASVLPACANLG-ALEVGERIEAYARKNGLLSNMYVSNALLDMYARCGKIDVA  269

Query  692  LEFVNKMPIEPDKRI--WGALLAGCRKTHGSSEISELVAKQLI--SLDPTNASYYVILSN  859
             +  +++ I   K +  W +++ G    HG S  +  +  Q++     P + ++  +L  
Sbjct  270  RQVFDEI-IGKRKNLCSWNSMIMGL-AIHGRSHDALQLYNQMMREGTAPDDVTFVGLL--  325

Query  860  LYADQGRWDEVEKLRQLMDGKKRK  931
            L    G    V K RQL    +RK
Sbjct  326  LACTHG--GMVVKGRQLFQSMERK  347


 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/151 (26%), Positives = 73/151 (48%), Gaps = 4/151 (3%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSL--SQKDIIAWSAMISAYAQSDQPSNA  175
            K+G L  + V  ALL MYA  G I+ +R +FD +   +K++ +W++MI   A   +  +A
Sbjct  243  KNGLLSNMYVSNALLDMYARCGKIDVARQVFDEIIGKRKNLCSWNSMIMGLAIHGRSHDA  302

Query  176  LAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASG-LID  352
            L ++ +M  E   P++  F  LL AC+       G  +   + +    S      G ++D
Sbjct  303  LQLYNQMMREGTAPDDVTFVGLLLACTHGGMVVKGRQLFQSMERKFRISPKLEHYGCMVD  362

Query  353  MYCKFGRIHQGKTIFDENPDK-DLICWSSMI  442
            +  + G + +   I    P + D + W +++
Sbjct  363  LLGRAGELQEAYEIIKSMPMRPDSVIWGALL  393



>ref|XP_009372472.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At4g37380, chloroplastic-like [Pyrus x bretschneideri]
Length=635

 Score =   274 bits (701),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 130/320 (41%), Positives = 198/320 (62%), Gaps = 1/320 (0%)
 Frame = +2

Query  17   KCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRM  196
            K +  +TA++  Y   G IE++R LFD + ++D++ W+ MI  YAQ   P+ AL +FR+M
Sbjct  195  KSLVSLTAMITSYVKRGAIEAARKLFDGMQERDVVCWNVMIDGYAQHGMPNEALFLFRKM  254

Query  197  QLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRI  376
                 KPNE    SLL AC  + A + G  +H+ +       NA + + LIDMY K G +
Sbjct  255  LAAKFKPNELTVLSLLSACGQLGALESGRWLHSYIENNRILVNAHVGTALIDMYSKCGSL  314

Query  377  HQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC  556
               + +FD   +KD++ W+SM+ GY M+G   +AL+ F++M   G +P D+ FI VLSAC
Sbjct  315  EDARLVFDRIEEKDVVVWNSMVVGYAMHGFSQDALQLFVEMRRIGYRPTDITFIGVLSAC  374

Query  557  SHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
            ++ GL  +G  +F +M+++Y I PK+ HY CMV++LSR G +EEA EFV K+ I+PD  +
Sbjct  375  AYAGLVNKGRAFFSSMKDEYGIEPKIEHYGCMVNLLSRAGQLEEAYEFVKKIKIDPDPVL  434

Query  737  WGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMD  916
            WG LL  CR  HG+  + E +A+ L+  +  N+  Y++LSN+YA  G WD V ++R LM 
Sbjct  435  WGTLLGACR-LHGNIALGEEIAEFLLGQNLANSGTYILLSNIYATVGNWDGVARVRALMK  493

Query  917  GKKRKKGMGYSVVEVNNSMH  976
                +K  G S +EV+N +H
Sbjct  494  SSGIQKEPGCSSIEVDNKVH  513


 Score =   136 bits (342),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 86/311 (28%), Positives = 152/311 (49%), Gaps = 41/311 (13%)
 Frame = +2

Query  26   PVVTALLQM-YANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            P++   LQ  YA+FG ++ S  LF       +  W+++I ++AQ    + AL  F  M  
Sbjct  69   PILNFKLQRSYASFGRLDHSVALFHRTDNPTVYFWTSIIHSHAQLGLQNLALMYFTEMLT  128

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
               +PN F F ++++ C      + G+ +H+Q +KLG+ S+ ++ +GL+D+Y + G +  
Sbjct  129  NGVEPNCFTFSAVMKTCP----LEPGKALHSQTIKLGFDSDLYVRTGLVDVYARAGDVVS  184

Query  383  GKTIFDENPDK-------------------------------DLICWSSMINGYGMNGHG  469
             + +FD  P+K                               D++CW+ MI+GY  +G  
Sbjct  185  ARQLFDTMPEKSLVSLTAMITSYVKRGAIEAARKLFDGMQERDVVCWNVMIDGYAQHGMP  244

Query  470  NEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYAC  649
            NEAL  F  ML+   +PN++  +S+LSAC   G   E   W H+  E   I         
Sbjct  245  NEALFLFRKMLAAKFKPNELTVLSLLSACGQLG-ALESGRWLHSYIENNRILVNAHVGTA  303

Query  650  MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAGCRKTHGSSE--ISELVAKQLISLD  823
            ++DM S+ G++E+A    +++  E D  +W +++ G    HG S+  +   V  + I   
Sbjct  304  LIDMYSKCGSLEDARLVFDRIE-EKDVVVWNSMVVG-YAMHGFSQDALQLFVEMRRIGYR  361

Query  824  PTNASYYVILS  856
            PT+ ++  +LS
Sbjct  362  PTDITFIGVLS  372



>ref|XP_007208505.1| hypothetical protein PRUPE_ppa026465mg, partial [Prunus persica]
 gb|EMJ09704.1| hypothetical protein PRUPE_ppa026465mg, partial [Prunus persica]
Length=588

 Score =   273 bits (698),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 131/325 (40%), Positives = 197/325 (61%), Gaps = 2/325 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K GF   +PV+ ++L MY  FG +  +   F  + Q+D+I W+ +IS Y + D    +L 
Sbjct  224  KHGFESNLPVMNSILDMYCRFGCLSEANQYFHEMPQRDLITWNTLISGYERFDS-KESLL  282

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M  E   PN F F S++ AC+++A  + GE +H ++++ G   N  LA+ L+DMY 
Sbjct  283  IFSHMDTEGFSPNSFTFCSVISACANLAVLNYGEQVHGRIIRGGLNKNLALANALVDMYA  342

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G I     IF +   ++L+ W+SM+ GYG +G+G EA+E F +M+  GI+P+ +VF++
Sbjct  343  KCGSITDAHKIFSQMSHRNLVSWTSMMIGYGAHGYGKEAVELFDEMVKSGIRPDQIVFMA  402

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VLSACSH GL  EG  +F +M   Y ITP    Y C+VD+L R G VEEA E +  MP +
Sbjct  403  VLSACSHAGLVDEGLRYFKSMINDYKITPDQDIYGCVVDLLGRAGRVEEAYELIESMPFK  462

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD+ +WGALL  C K H    + ++ A++++ L P     YV+LSN+YA +G W E    
Sbjct  463  PDESVWGALLGAC-KEHELPHLGKVAARRMLDLRPNMVGTYVMLSNIYAAEGEWGEFANT  521

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R+LM G + KK  G S +EV N ++
Sbjct  522  RKLMRGMENKKEAGRSWIEVRNQVY  546


 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/287 (29%), Positives = 150/287 (52%), Gaps = 5/287 (2%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANF-GNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNAL  178
            K G    I V  AL+ MYA    +++ + ++F+ + +K+ ++W+ +I+ +       + L
Sbjct  122  KQGMQGSIYVENALMDMYATCCASMDDACMVFNDIHEKNDVSWTTLITGFTHRGNGYSGL  181

Query  179  AVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMY  358
             VFR+M LE  + N F+F   ++AC+S+ +   G+ IH+ V+K G+ SN  + + ++DMY
Sbjct  182  QVFRQMLLEGAELNPFSFSIAIRACASIGSHTFGKQIHSAVIKHGFESNLPVMNSILDMY  241

Query  359  CKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFI  538
            C+FG + +    F E P +DLI W+++I+GY       E+L  F  M + G  PN   F 
Sbjct  242  CRFGCLSEANQYFHEMPQRDLITWNTLISGYE-RFDSKESLLIFSHMDTEGFSPNSFTFC  300

Query  539  SVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPI  718
            SV+SAC++  +   G    H    +  +   LA    +VDM ++ G++ +A +  ++M  
Sbjct  301  SVISACANLAVLNYG-EQVHGRIIRGGLNKNLALANALVDMYAKCGSITDAHKIFSQMS-  358

Query  719  EPDKRIWGALLAGCRKTHGSSEISELVAKQLIS-LDPTNASYYVILS  856
              +   W +++ G        E  EL  + + S + P    +  +LS
Sbjct  359  HRNLVSWTSMMIGYGAHGYGKEAVELFDEMVKSGIRPDQIVFMAVLS  405


 Score =   120 bits (302),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/244 (29%), Positives = 123/244 (50%), Gaps = 3/244 (1%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            + T L++     G I+ +R LFD + ++D++AW+A+I+ Y      S+A A+F  M    
Sbjct  30   IATNLIKSCFERGLIKEARKLFDEMPERDVVAWTAIIAGYTSCSHHSHAWALFCEMVRNE  89

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK-FGRIHQG  385
             +PN F F S+L+AC  M A   G  +H   +K G   + ++ + L+DMY      +   
Sbjct  90   MEPNAFTFSSVLKACKGMKALSCGALVHGGAIKQGMQGSIYVENALMDMYATCCASMDDA  149

Query  386  KTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHC  565
              +F++  +K+ + W+++I G+   G+G   L+ F  ML  G + N   F   + AC+  
Sbjct  150  CMVFNDIHEKNDVSWTTLITGFTHRGNGYSGLQVFRQMLLEGAELNPFSFSIAIRACASI  209

Query  566  GLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGA  745
            G    G    H+   K+     L     ++DM  R G + EA ++ ++MP + D   W  
Sbjct  210  GSHTFG-KQIHSAVIKHGFESNLPVMNSILDMYCRFGCLSEANQYFHEMP-QRDLITWNT  267

Query  746  LLAG  757
            L++G
Sbjct  268  LISG  271



>emb|CDP00394.1| unnamed protein product [Coffea canephora]
Length=708

 Score =   276 bits (705),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/312 (40%), Positives = 198/312 (63%), Gaps = 1/312 (0%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V+ AL+ MY   G    +R LF+++S KD+IAW+++IS Y+ +D   +A+A+F +M+ E 
Sbjct  384  VINALVHMYGKCGMKRDARYLFENVSHKDVIAWNSIISGYSSNDSAHDAIALFHQMRSEC  443

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             +P+     S+L AC+S  A  +G ++H   +K G  S+ ++ + L++ Y K G     +
Sbjct  444  LQPDATTMVSVLTACASHGALIIGSSLHAYSIKGGLLSSTYIGTALLNFYAKCGDAKSAR  503

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCG  568
             IFD   +K  + WS+MI GYGM G  N +L    DM+   ++PND++F ++LSACSH G
Sbjct  504  AIFDGMVEKSRVTWSAMIGGYGMQGDFNNSLAILNDMMGENLEPNDIIFTAILSACSHTG  563

Query  569  LEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGAL  748
            +  EGW++F  M E Y   P + HYACM+D+L+R G +EEA +F+NKMPI+PD  ++GA 
Sbjct  564  MILEGWSFFANMCENYKFVPTIKHYACMIDLLARAGRLEEAFDFMNKMPIQPDVSLFGAF  623

Query  749  LAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKR  928
            L GC   +   ++ EL  ++++ L P +A YYV+++NLYA  GRW++  ++R +M  K  
Sbjct  624  LNGC-SIYSRFDLGELAVRRMLELHPRDACYYVLMANLYASDGRWNQAHQMRNMMRIKGV  682

Query  929  KKGMGYSVVEVN  964
            KK  G+S   VN
Sbjct  683  KKSPGFSNFNVN  694


 Score =   123 bits (308),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 107/178 (60%), Gaps = 0/178 (0%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            V+T L+ MYA  G +ESSR +F+ ++Q++++ W++MI  Y Q+     AL +F RM+   
Sbjct  183  VLTGLVDMYAKCGEVESSREVFEGIAQRNVVCWTSMIVGYMQNGCAEEALVLFNRMRDGV  242

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
             + NE+   S++ AC+ +AA   G+  H  ++K     N++L S L+DMY K G +   +
Sbjct  243  VEGNEYTLGSIVTACAKLAALHQGKWFHGYIIKKQGEFNSYLVSALVDMYVKCGALTDAR  302

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
            +I  E  + DL+ W++MI GY  NG+ +EAL+ F+      + PN V   SV+SAC+ 
Sbjct  303  SILFEFSEADLVSWTAMIVGYTQNGYPDEALDLFVHKKWEAVLPNSVTVSSVVSACAQ  360


 Score =   119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 130/247 (53%), Gaps = 7/247 (3%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            I V T LL +Y  FG + ++R+LFD +   D+ +   MI  Y  +D+ ++ +  F  ++ 
Sbjct  81   ILVKTKLLGLYGLFGQVTTARVLFDDIPNPDLSSCKVMIRWYFMNDKYADVIGFFNCLRK  140

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
                 +   F  +L+ACS +     G  +H  ++K+G T ++F+ +GL+DMY K G +  
Sbjct  141  TVNIFDNVVFSIVLKACSGLHDFVEGRKVHCHIVKVGNT-DSFVLTGLVDMYAKCGEVES  199

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + +F+    ++++CW+SMI GY  NG   EAL  F  M    ++ N+    S+++AC+ 
Sbjct  200  SREVFEGIAQRNVVCWTSMIVGYMQNGCAEEALVLFNRMRDGVVEGNEYTLGSIVTACAK  259

Query  563  CGLEYEGWNWFHA--MEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRI  736
                ++G  WFH   ++++ +    L   + +VDM  + G + +A   + +   E D   
Sbjct  260  LAALHQG-KWFHGYIIKKQGEFNSYLV--SALVDMYVKCGALTDARSILFEFS-EADLVS  315

Query  737  WGALLAG  757
            W A++ G
Sbjct  316  WTAMIVG  322


 Score =   112 bits (281),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 89/327 (27%), Positives = 145/327 (44%), Gaps = 47/327 (14%)
 Frame = +2

Query  29   VVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEH  208
            +V+AL+ MY   G +  +R +    S+ D+++W+AMI  Y Q+  P  AL +F   + E 
Sbjct  284  LVSALVDMYVKCGALTDARSILFEFSEADLVSWTAMIVGYTQNGYPDEALDLFVHKKWEA  343

Query  209  GKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGK  388
              PN     S++ AC+ +   ++G +IH   +KL    +A + + L+ MY K G     +
Sbjct  344  VLPNSVTVSSVVSACAQLDNLNLGTSIHGLGIKL-RLDDAAVINALVHMYGKCGMKRDAR  402

Query  389  TIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSAC-SH-  562
             +F+    KD+I W+S+I+GY  N   ++A+  F  M S  +QP+    +SVL+AC SH 
Sbjct  403  YLFENVSHKDVIAWNSIISGYSSNDSAHDAIALFHQMRSECLQPDATTMVSVLTACASHG  462

Query  563  ---------------------------------CGLEYEGWNWFHAMEEKYDITPKLAHY  643
                                             CG        F  M EK  +T     +
Sbjct  463  ALIIGSSLHAYSIKGGLLSSTYIGTALLNFYAKCGDAKSARAIFDGMVEKSRVT-----W  517

Query  644  ACMVDMLSRQGNVEEALEFVNKM---PIEPDKRIWGALLAGCRKTHGSSEISELVAKQL-  811
            + M+     QG+   +L  +N M    +EP+  I+ A+L+ C  T    E     A    
Sbjct  518  SAMIGGYGMQGDFNNSLAILNDMMGENLEPNDIIFTAILSACSHTGMILEGWSFFANMCE  577

Query  812  -ISLDPTNASYYVILSNLYADQGRWDE  889
                 PT   +Y  + +L A  GR +E
Sbjct  578  NYKFVPT-IKHYACMIDLLARAGRLEE  603


 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 74/151 (49%), Gaps = 2/151 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K G L    + TALL  YA  G+ +S+R +FD + +K  + WSAMI  Y      +N+LA
Sbjct  476  KGGLLSSTYIGTALLNFYAKCGDAKSARAIFDGMVEKSRVTWSAMIGGYGMQGDFNNSLA  535

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMK-LGYTSNAFLASGLIDMY  358
            +   M  E+ +PN+  F ++L ACS       G +    + +   +       + +ID+ 
Sbjct  536  ILNDMMGENLEPNDIIFTAILSACSHTGMILEGWSFFANMCENYKFVPTIKHYACMIDLL  595

Query  359  CKFGRIHQGKTIFDENP-DKDLICWSSMING  448
             + GR+ +     ++ P   D+  + + +NG
Sbjct  596  ARAGRLEEAFDFMNKMPIQPDVSLFGAFLNG  626


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 100/234 (43%), Gaps = 26/234 (11%)
 Frame = +2

Query  68   NIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFA---FHS  238
            NI+SSR+L               IS      +  ++   +R+++      N  +   F  
Sbjct  10   NIKSSRLL---------------ISKTHLKPRTVSSTPTYRQLESNFASLNSISSDPFFP  54

Query  239  LLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKD  418
            LL  C ++++    + IH  V+  G+T N  + + L+ +Y  FG++   + +FD+ P+ D
Sbjct  55   LLGFCKTISSL---KKIHALVITYGHTDNILVKTKLLGLYGLFGQVTTARVLFDDIPNPD  111

Query  419  LICWSSMINGYGMNGHGNEALECFLDMLSHGIQPND-VVFISVLSACSHCGLEYEGWNWF  595
            L     MI  Y MN    + +  F + L   +   D VVF  VL ACS      EG    
Sbjct  112  LSSCKVMIRWYFMNDKYADVIG-FFNCLRKTVNIFDNVVFSIVLKACSGLHDFVEGRK-V  169

Query  596  HAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            H    K   T        +VDM ++ G VE + E    +  + +   W +++ G
Sbjct  170  HCHIVKVGNTDSFV-LTGLVDMYAKCGEVESSREVFEGIA-QRNVVCWTSMIVG  221



>ref|XP_008781334.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Phoenix dactylifera]
Length=492

 Score =   270 bits (691),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/315 (40%), Positives = 196/315 (62%), Gaps = 1/315 (0%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGK  214
             A++  YA  G IE SR  FD + Q+D ++WSAMI  Y       +ALAVF++M +E  K
Sbjct  58   NAMISGYARHGMIEESRGFFDRMPQRDEVSWSAMIDGYVHWGHFVDALAVFQKMLMEGVK  117

Query  215  PNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTI  394
            P  F F S+L A +++ A + G  +H  + +     +A L + L+DMY K GR+     +
Sbjct  118  PKRFVFSSVLAASANVGALEQGRWVHAYIERNSVQVDAVLGTSLVDMYAKCGRVDLASEV  177

Query  395  FDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLE  574
            F++   K++  W++MI G+ M+GH  EA+E F  M     +P+ + F++VLSACSH GL 
Sbjct  178  FEKTASKEIFSWNAMIGGFAMHGHAREAIELFFRMEREKFRPDMITFVNVLSACSHGGLV  237

Query  575  YEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLA  754
             EG  +F+ M+++Y ITP+  HY CMVD+L R G   EA E ++ MP+ P+  +WGALL 
Sbjct  238  KEGKRFFNLMKQEYGITPRAEHYGCMVDLLGRAGLFWEAEEMIDSMPMMPNAAVWGALLN  297

Query  755  GCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKLRQLMDGKKRKK  934
             CR  HG+++++E V   L+ L+P N+  Y +LSN+YA  GRWD+V K+R+LM  +  K 
Sbjct  298  ACR-IHGNAQLAEKVGNILLQLEPENSGRYALLSNIYAKAGRWDDVSKVRKLMKDRGVKT  356

Query  935  GMGYSVVEVNNSMHR  979
              G S++E++  +H+
Sbjct  357  IPGSSLIELDGMIHK  371



>ref|XP_011038529.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial-like [Populus euphratica]
Length=805

 Score =   278 bits (710),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 135/325 (42%), Positives = 199/325 (61%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++GF   + + TAL+ MY   G   S+R +FDS+  KD++ W+AMISAYAQ++    A  
Sbjct  360  RNGFGMSLALATALVDMYGKCGETRSARAIFDSMKIKDVMTWTAMISAYAQANCIDYAFQ  419

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F +M     +PNE    SLL  C+   A D+G+  H  + K G   +  L + LIDMY 
Sbjct  420  LFAQMMDNGVRPNELTMVSLLSLCAENGALDMGKWFHAYIDKQGVEVDVILKTALIDMYA  479

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G I   + +F E  D+D+  W+ M+ GYGM+G+G +AL+ F +M + G++PND+ FI 
Sbjct  480  KCGDISGAQRLFSEAIDRDICTWNVMMAGYGMHGYGEKALKLFTEMETLGVKPNDITFIG  539

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            VL ACSH GL  EG   F  M   Y + PK+ HY CMVD+L R G ++EA + +  MP++
Sbjct  540  VLHACSHAGLVMEGKGLFEKMIHDYGLVPKVEHYGCMVDLLGRAGLLDEAYKMIESMPVK  599

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            P+  IWGA+LA C K H +S + EL A +L++L+P N  Y V++SN+YA   RW++V  +
Sbjct  600  PNIAIWGAMLAAC-KIHKNSNMGELAAGELLALEPQNCGYKVLMSNIYAAANRWNDVAGM  658

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R+ +     KK  G S +EVN  +H
Sbjct  659  RKAVKDTGIKKEPGMSSIEVNGLVH  683


 Score =   150 bits (380),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 146/278 (53%), Gaps = 3/278 (1%)
 Frame = +2

Query  23   IPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAVFRRMQL  202
            +P+ T L+ MYA  GN++++  LFD  SQ+ I++W+AMI+ Y +         +F RM  
Sbjct  266  VPLTTCLIDMYAKCGNLDAATTLFDGFSQRSIVSWTAMIAGYIRCKDLEEGERLFVRMIE  325

Query  203  EHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQ  382
            E+  PN+    SL+  C  + A  +G+ +H  +++ G+  +  LA+ L+DMY K G    
Sbjct  326  ENVFPNDITMLSLIIPCGFVGAVQLGKRLHAYILRNGFGMSLALATALVDMYGKCGETRS  385

Query  383  GKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSH  562
             + IFD    KD++ W++MI+ Y      + A + F  M+ +G++PN++  +S+LS C+ 
Sbjct  386  ARAIFDSMKIKDVMTWTAMISAYAQANCIDYAFQLFAQMMDNGVRPNELTMVSLLSLCAE  445

Query  563  CGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEPDKRIWG  742
             G    G  WFHA  +K  +   +     ++DM ++ G++  A    ++  I+ D   W 
Sbjct  446  NGALDMG-KWFHAYIDKQGVEVDVILKTALIDMYAKCGDISGAQRLFSE-AIDRDICTWN  503

Query  743  ALLAGC-RKTHGSSEISELVAKQLISLDPTNASYYVIL  853
             ++AG     +G   +      + + + P + ++  +L
Sbjct  504  VMMAGYGMHGYGEKALKLFTEMETLGVKPNDITFIGVL  541


 Score =   132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 146/297 (49%), Gaps = 4/297 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G +  + VV AL+QMY+  G++ S+R LFD +S++D+++WS MI AY++S   +  L 
Sbjct  156  KNGLVSDVFVVNALMQMYSECGSLVSARFLFDKMSERDVVSWSTMIRAYSRSKLFNEGLK  215

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAF--LASGLIDM  355
            +   M+  + KP+E A  S++   S +   ++G+ +H  V++   +      L + LIDM
Sbjct  216  IIENMRFSNVKPSEVAMISMVNLFSDLENVEMGKAMHGYVIRNSNSEKMVVPLTTCLIDM  275

Query  356  YCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVF  535
            Y K G +    T+FD    + ++ W++MI GY       E    F+ M+   + PND+  
Sbjct  276  YAKCGNLDAATTLFDGFSQRSIVSWTAMIAGYIRCKDLEEGERLFVRMIEENVFPNDITM  335

Query  536  ISVLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMP  715
            +S++  C   G    G    HA   +      LA    +VDM  + G    A    + M 
Sbjct  336  LSLIIPCGFVGAVQLG-KRLHAYILRNGFGMSLALATALVDMYGKCGETRSARAIFDSMK  394

Query  716  IEPDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWD  886
            I+ D   W A+++   + +      +L A+ + +    N    V L +L A+ G  D
Sbjct  395  IK-DVMTWTAMISAYAQANCIDYAFQLFAQMMDNGVRPNELTMVSLLSLCAENGALD  450


 Score = 90.5 bits (223),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 113/216 (52%), Gaps = 10/216 (5%)
 Frame = +2

Query  125  WSAMISAYAQSDQPSNALAVFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVM  304
            ++ +I++Y ++++P  AL  +  M+    + + F   S+L+ACS ++   +G+ IH   +
Sbjct  96   YNLLITSYIKNNKPRYALNTYTYMRKLDIEVDSFIIPSVLKACSQISVAQMGKEIHGFSV  155

Query  305  KLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALE  484
            K G  S+ F+ + L+ MY + G +   + +FD+  ++D++ WS+MI  Y  +   NE L+
Sbjct  156  KNGLVSDVFVVNALMQMYSECGSLVSARFLFDKMSERDVVSWSTMIRAYSRSKLFNEGLK  215

Query  485  CFLDMLSHGIQPNDVVFISVLSACS-----HCGLEYEGWNWFHAMEEKYDITPKLAHYAC  649
               +M    ++P++V  IS+++  S       G    G+   ++  EK  + P      C
Sbjct  216  IIENMRFSNVKPSEVAMISMVNLFSDLENVEMGKAMHGYVIRNSNSEKM-VVPLT---TC  271

Query  650  MVDMLSRQGNVEEALEFVNKMPIEPDKRIWGALLAG  757
            ++DM ++ GN++ A    +    +     W A++AG
Sbjct  272  LIDMYAKCGNLDAATTLFDGFS-QRSIVSWTAMIAG  306



>ref|XP_010247889.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Nelumbo nucifera]
Length=633

 Score =   274 bits (700),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 129/326 (40%), Positives = 201/326 (62%), Gaps = 1/326 (0%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            KSG      V  AL+ MYA  G IE +R+LFD + +KD++ W+ MI A+A       +L 
Sbjct  188  KSGLHSDPFVSAALVDMYAKCGVIEDARLLFDRIPKKDLVTWTVMIDAHANCGNAEESLV  247

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F RM+ E   P++    +++ AC+ + A    E +H  + +  ++ +  L + +IDMY 
Sbjct  248  LFDRMREEGIIPDKVTMVTVVFACAKLGAMHKAELVHDYISRNKFSLDVILGTAMIDMYA  307

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G ++  + IFD   +K+++ WS+MI  YG +G G +AL+ F  ML  GI PN + F+S
Sbjct  308  KCGSVNAARNIFDHMKEKNVVSWSAMIAAYGYHGQGKKALDMFPMMLRSGISPNRITFVS  367

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L ACSH GL  EG  +F++M E Y + P + HY CMVD+L R G ++EALE +  M +E
Sbjct  368  LLYACSHAGLVDEGLRFFYSMWEDYSVKPDVKHYTCMVDLLGRAGRLDEALELIKNMTVE  427

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
             D+ +WGA+L  CR  HG+ E++   AK L+     N  YYV+LSN+YA+ GRW++V K+
Sbjct  428  KDEGLWGAILGACR-IHGNIELAGKAAKSLLEFQSRNPGYYVLLSNIYANAGRWEDVAKV  486

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMHR  979
            R+LM  ++ KK  G++ +EV N  ++
Sbjct  487  RELMTHRRLKKIPGWTWIEVGNKRYQ  512


 Score =   137 bits (346),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 74/251 (29%), Positives = 126/251 (50%), Gaps = 2/251 (1%)
 Frame = +2

Query  5    SGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALAV  184
            +G L  + V   LL MYA F  +E +   FD++ ++D+++WS M+  +A++    N L  
Sbjct  88   TGMLHNLTVANKLLYMYARFKALEDASTFFDAMQERDLVSWSVMVGGFAKAGLYPNCLGT  147

Query  185  FRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCK  364
            FR +      P+ F+    ++AC   +    G  IH  V K G  S+ F+++ L+DMY K
Sbjct  148  FREIIRSGILPDNFSLPFAVRACRDTSDLQTGRMIHHLVYKSGLHSDPFVSAALVDMYAK  207

Query  365  FGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISV  544
             G I   + +FD  P KDL+ W+ MI+ +   G+  E+L  F  M   GI P+ V  ++V
Sbjct  208  CGVIEDARLLFDRIPKKDLVTWTVMIDAHANCGNAEESLVLFDRMREEGIIPDKVTMVTV  267

Query  545  LSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIEP  724
            + AC+  G  ++     H    +   +  +     M+DM ++ G+V  A    + M  E 
Sbjct  268  VFACAKLGAMHKA-ELVHDYISRNKFSLDVILGTAMIDMYAKCGSVNAARNIFDHMK-EK  325

Query  725  DKRIWGALLAG  757
            +   W A++A 
Sbjct  326  NVVSWSAMIAA  336


 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 59/261 (23%), Positives = 101/261 (39%), Gaps = 42/261 (16%)
 Frame = +2

Query  281  ETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMN  460
            + IH      G   N  +A+ L+ MY +F  +    T FD   ++DL+ WS M+ G+   
Sbjct  79   KKIHAHATITGMLHNLTVANKLLYMYARFKALEDASTFFDAMQERDLVSWSVMVGGFAKA  138

Query  461  GHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEYEGWNWFHAMEEK---------  613
            G     L  F +++  GI P++      + AC        G    H + +          
Sbjct  139  GLYPNCLGTFREIIRSGILPDNFSLPFAVRACRDTSDLQTGRMIHHLVYKSGLHSDPFVS  198

Query  614  -------------------YDITPK--LAHYACMVDMLSRQGNVEEALEFVNKMPIE---  721
                               +D  PK  L  +  M+D  +  GN EE+L   ++M  E   
Sbjct  199  AALVDMYAKCGVIEDARLLFDRIPKKDLVTWTVMIDAHANCGNAEESLVLFDRMREEGII  258

Query  722  PDKRIWGALLAGCRK---THGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEV  892
            PDK     ++  C K    H +  + + +++   SLD    +  +   ++YA  G    V
Sbjct  259  PDKVTMVTVVFACAKLGAMHKAELVHDYISRNKFSLDVILGTAMI---DMYAKCG---SV  312

Query  893  EKLRQLMDGKKRKKGMGYSVV  955
               R + D  K K  + +S +
Sbjct  313  NAARNIFDHMKEKNVVSWSAM  333



>gb|EMT00538.1| hypothetical protein F775_11073 [Aegilops tauschii]
Length=1172

 Score =   282 bits (721),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 130/325 (40%), Positives = 206/325 (63%), Gaps = 2/325 (1%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            ++G  K +PVV AL++MYA  GN+E +R++FD +  KD+I+W+ +I  Y++++  + A +
Sbjct  658  RNGMEKVLPVVNALMEMYAKCGNMEEARLIFDGVMSKDVISWNTLIGGYSRNNLANEAFS  717

Query  182  VFRRMQLEHGKPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYC  361
            +F  M L+  +PN      +L A +S+++ + G  +HT  ++ GY  + F+A+ L+DMY 
Sbjct  718  LFTEMLLQF-RPNAVTMSCILPAAASLSSLERGREMHTYALRRGYLEDDFVANALMDMYV  776

Query  362  KFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFIS  541
            K G +   + +FD    K+LI W+ M+ GYGM+G G +A+  F  M + GI P+   F +
Sbjct  777  KCGALLLARRLFDRLSSKNLISWTIMVAGYGMHGRGRDAIALFEQMRTSGIMPDAASFSA  836

Query  542  VLSACSHCGLEYEGWNWFHAMEEKYDITPKLAHYACMVDMLSRQGNVEEALEFVNKMPIE  721
            +L ACSH GL  EGW +F AM  ++ I P+L HY CMVD+L+  GN+ EA EF+  MPIE
Sbjct  837  ILYACSHSGLRDEGWRFFDAMCHEHRIEPRLKHYTCMVDLLTNTGNLREAYEFIESMPIE  896

Query  722  PDKRIWGALLAGCRKTHGSSEISELVAKQLISLDPTNASYYVILSNLYADQGRWDEVEKL  901
            PD  IW +LL GCR  H   +++E VA+++  L+P N  YYV+L+N+YA+  RW+ V KL
Sbjct  897  PDSSIWVSLLNGCR-IHRDIKLAEEVAERVFELEPENTGYYVLLANIYAEAERWEAVRKL  955

Query  902  RQLMDGKKRKKGMGYSVVEVNNSMH  976
            R  + G+  ++  G S +E    + 
Sbjct  956  RNKIGGRGLREKSGCSWIEARGRVQ  980


 Score =   101 bits (251),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 119/253 (47%), Gaps = 11/253 (4%)
 Frame = +2

Query  41   LLQMYANFGNIESSRILFDSLSQ-KDIIAWSAMISAYAQSDQPSNALAVFRRMQLEHGKP  217
            L+ MY   G++ S+R +FD + Q  D+  W+A++S YA++      + +FR+M     +P
Sbjct  135  LVLMYLKCGDLGSARRVFDEMPQVSDVRVWTALMSGYAKAGDLREGVLLFRKMHCCGVRP  194

Query  218  NEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKTIF  397
            + +    +L+  + + +   GE +H  + KLG+ S   + + L+ +Y + G       +F
Sbjct  195  DAYTISCVLKCIAGLGSIADGEVVHGYLEKLGFGSQCAVGNALMALYSRCGCNEDALRVF  254

Query  398  DENPDKDLICWSSMINGYGMNGHGNEALECFLDMLSHGIQPNDVVFISVLSACSHCGLEY  577
            +  P +D I W+S+I+G   NG    A+E   +M   G++ + V  +SVL AC+  G E 
Sbjct  255  EGMPQRDAISWNSVISGCFSNGWHGRAVEHLSEMWFEGLEIDSVTMLSVLPACAELGYEL  314

Query  578  EGWNWFHAMEEKYDITPKLAHYACMVD---------MLSRQGNVEEALEFVNKMPIEPDK  730
             G    H    K  +  +L      VD         M  + G +  A +  + M  +   
Sbjct  315  VG-RVIHGYSVKTGLLWELESLERGVDENLGSKLVFMYVKCGELGYARKVFDAMSSKSSI  373

Query  731  RIWGALLAGCRKT  769
             +W  L+ G  K 
Sbjct  374  HVWNLLMGGYAKV  386


 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 101/206 (49%), Gaps = 21/206 (10%)
 Frame = +2

Query  2    KSGFLKCIPVVTALLQMYANFGNIESSRILFDSLSQKDIIAWSAMISAYAQSDQPSNALA  181
            K+G +    +   LL MY+N  +  S+  +F ++ QK++++W+A+I++Y ++        
Sbjct  537  KTGLIGETSLANVLLDMYSNCSDWRSTNKIFRNMDQKNVVSWTAIITSYTRAGLFDKVAG  596

Query  182  VFRRMQLEHGKPNEFAFHSLLQACS-----------------SMAAQDV---GETIHTQV  301
            V + M LE  +P+ FA  S L A +                 + A  +    G+++H   
Sbjct  597  VLQEMALEGIRPDTFAITSALHAFAGNESLITPRNGIRSALHAFAGNESLKEGKSVHAYA  656

Query  302  MKLGYTSNAFLASGLIDMYCKFGRIHQGKTIFDENPDKDLICWSSMINGYGMNGHGNEAL  481
            ++ G      + + L++MY K G + + + IFD    KD+I W+++I GY  N   NEA 
Sbjct  657  IRNGMEKVLPVVNALMEMYAKCGNMEEARLIFDGVMSKDVISWNTLIGGYSRNNLANEAF  716

Query  482  ECFLDMLSHGIQPNDVVFISVLSACS  559
              F +ML    +PN V    +L A +
Sbjct  717  SLFTEMLLQ-FRPNAVTMSCILPAAA  741


 Score = 92.0 bits (227),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/177 (28%), Positives = 92/177 (52%), Gaps = 1/177 (1%)
 Frame = +2

Query  35   TALLQMYANFGNIESSRILFDSLSQKDII-AWSAMISAYAQSDQPSNALAVFRRMQLEHG  211
            + L+ MY   G +  +R +FD++S K  I  W+ ++  YA+  +   +L +F +M     
Sbjct  345  SKLVFMYVKCGELGYARKVFDAMSSKSSIHVWNLLMGGYAKVGEFQESLFLFEKMHDSGI  404

Query  212  KPNEFAFHSLLQACSSMAAQDVGETIHTQVMKLGYTSNAFLASGLIDMYCKFGRIHQGKT  391
             P+E     L++  +S+ +   G  +H  ++KLG+ +   + + +I  Y K         
Sbjct  405  A