BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14677_g2_i1 len=619 path=[1951:0-65 1334:66-618]

Length=619
                                                                      Score     E

ref|XP_009781860.1|  PREDICTED: inositol oxygenase 1-like               256   4e-83   
ref|NP_001234593.1|  myo-inositol oxygenase                             260   8e-83   
ref|XP_009616364.1|  PREDICTED: inositol oxygenase 2-like               260   1e-82   
ref|XP_006353509.1|  PREDICTED: inositol oxygenase 4-like               259   1e-82   
ref|XP_010086904.1|  Inositol oxygenase 2                               250   9e-79   
ref|XP_011025349.1|  PREDICTED: inositol oxygenase 1                    248   3e-78   
ref|XP_002311571.2|  oxygenase-related family protein                   248   7e-78   Populus trichocarpa [western balsam poplar]
ref|XP_011093669.1|  PREDICTED: inositol oxygenase 2-like               247   1e-77   
ref|XP_006451360.1|  hypothetical protein CICLE_v10008962mg             246   2e-77   
gb|EYU30675.1|  hypothetical protein MIMGU_mgv1a010745mg                246   2e-77   
gb|KDO55903.1|  hypothetical protein CISIN_1g021203mg                   246   2e-77   
ref|XP_011078222.1|  PREDICTED: inositol oxygenase 1-like               245   4e-77   
ref|XP_008337619.1|  PREDICTED: inositol oxygenase 1-like               246   6e-77   
ref|XP_009630876.1|  PREDICTED: uncharacterized protein LOC104120755    245   8e-77   
ref|XP_004248391.1|  PREDICTED: inositol oxygenase 1-like               246   1e-76   
ref|XP_009775832.1|  PREDICTED: inositol oxygenase 1-like               244   1e-76   
emb|CDP03219.1|  unnamed protein product                                243   4e-76   
ref|XP_008361306.1|  PREDICTED: inositol oxygenase 2-like               244   4e-76   
gb|EYU27240.1|  hypothetical protein MIMGU_mgv1a008959mg                244   8e-76   
gb|EYU27241.1|  hypothetical protein MIMGU_mgv1a008959mg                243   9e-76   
ref|XP_011078224.1|  PREDICTED: inositol oxygenase 2-like               241   1e-75   
gb|EPS71086.1|  hypothetical protein M569_03673                         236   1e-75   
ref|XP_010066969.1|  PREDICTED: inositol oxygenase 1-like               241   2e-75   
gb|KCW65035.1|  hypothetical protein EUGRSUZ_G02560                     241   2e-75   
gb|KDP40824.1|  hypothetical protein JCGZ_24823                         241   3e-75   
ref|XP_007203887.1|  hypothetical protein PRUPE_ppa008804mg             241   3e-75   
gb|EYU27242.1|  hypothetical protein MIMGU_mgv1a008813mg                242   4e-75   
ref|XP_007135612.1|  hypothetical protein PHAVU_010G143500g             240   4e-75   
ref|XP_006357365.1|  PREDICTED: inositol oxygenase 1-like               239   6e-75   
ref|XP_010322859.1|  PREDICTED: inositol oxygenase 1                    240   6e-75   
emb|CDY65374.1|  BnaC05g49660D                                          239   7e-75   
ref|XP_008221002.1|  PREDICTED: inositol oxygenase 1-like isoform X2    240   7e-75   
ref|XP_009590754.1|  PREDICTED: inositol oxygenase 1-like               239   7e-75   
ref|XP_009351657.1|  PREDICTED: inositol oxygenase 1-like               239   7e-75   
ref|NP_001289646.1|  inositol oxygenase                                 239   1e-74   
ref|XP_008387454.1|  PREDICTED: inositol oxygenase 4-like               240   1e-74   
gb|KHN39268.1|  Inositol oxygenase 1                                    239   1e-74   
ref|XP_008340501.1|  PREDICTED: inositol oxygenase 1                    239   1e-74   
ref|XP_007039459.1|  Myo-inositol oxygenase 5 isoform 5                 236   2e-74   
gb|KEH18252.1|  myo-inositol oxygenase                                  238   3e-74   
ref|XP_010915343.1|  PREDICTED: probable inositol oxygenase             238   3e-74   
gb|ACU18263.1|  unknown                                                 239   3e-74   Glycine max [soybeans]
ref|XP_007039455.1|  Myo-inositol oxygenase 4 isoform 1                 238   4e-74   
ref|XP_007039456.1|  Myo-inositol oxygenase 4 isoform 2                 238   4e-74   
ref|XP_010688397.1|  PREDICTED: inositol oxygenase 4                    238   5e-74   
gb|KHN05317.1|  Inositol oxygenase 1                                    236   5e-74   
gb|AFK49356.1|  unknown                                                 237   5e-74   
ref|XP_002515913.1|  myoinositol oxygenase, putative                    234   6e-74   Ricinus communis
ref|XP_007012956.1|  Myo-inositol oxygenase 2 isoform 2                 234   6e-74   
ref|XP_006470903.1|  PREDICTED: inositol oxygenase 1-like isoform X1    236   9e-74   
ref|XP_011072454.1|  PREDICTED: inositol oxygenase 1-like isoform X1    236   9e-74   
ref|XP_011072455.1|  PREDICTED: inositol oxygenase 1-like isoform X2    236   1e-73   
emb|CDY66453.1|  BnaAnng22250D                                          236   1e-73   
gb|EYU21436.1|  hypothetical protein MIMGU_mgv1a010728mg                234   1e-73   
ref|XP_003630676.1|  Inositol oxygenase                                 236   2e-73   
ref|XP_007012955.1|  Myo-inositol oxygenase 2 isoform 1                 236   2e-73   
ref|XP_008242455.1|  PREDICTED: inositol oxygenase 1-like               237   2e-73   
gb|ACJ84274.1|  unknown                                                 236   2e-73   Medicago truncatula
ref|XP_010267091.1|  PREDICTED: probable inositol oxygenase             236   2e-73   
gb|AFK34985.1|  unknown                                                 236   2e-73   
ref|XP_009352587.1|  PREDICTED: inositol oxygenase 2                    236   2e-73   
ref|XP_007024365.1|  Myo-inositol oxygenase 1 isoform 5                 233   2e-73   
ref|XP_002283119.1|  PREDICTED: probable inositol oxygenase             236   2e-73   Vitis vinifera
gb|KFK43696.1|  hypothetical protein AALP_AA1G161300                    236   3e-73   
gb|KFK43697.1|  hypothetical protein AALP_AA1G161300                    235   3e-73   
gb|EYU21435.1|  hypothetical protein MIMGU_mgv1a010728mg                235   4e-73   
ref|XP_006420666.1|  hypothetical protein CICLE_v10005543mg             234   4e-73   
ref|XP_007024362.1|  Myo-inositol oxygenase 1 isoform 2                 234   7e-73   
ref|XP_010244380.1|  PREDICTED: probable inositol oxygenase             234   7e-73   
gb|KFK40347.1|  hypothetical protein AALP_AA3G362200                    234   8e-73   
ref|XP_007045580.1|  Myo-inositol oxygenase 1 isoform 1                 234   8e-73   
ref|XP_007024361.1|  Myo-inositol oxygenase 1 isoform 1                 234   8e-73   
ref|XP_007045581.1|  Myo-inositol oxygenase 1 isoform 2                 234   9e-73   
ref|XP_010527856.1|  PREDICTED: inositol oxygenase 1                    234   9e-73   
ref|XP_010062560.1|  PREDICTED: inositol oxygenase 1-like isoform X2    234   9e-73   
ref|XP_004301722.1|  PREDICTED: inositol oxygenase 4-like               234   1e-72   
ref|XP_010062558.1|  PREDICTED: inositol oxygenase 1-like isoform X1    234   1e-72   
ref|XP_004510326.1|  PREDICTED: inositol oxygenase 1-like               234   1e-72   
ref|XP_008798609.1|  PREDICTED: probable inositol oxygenase             234   1e-72   
ref|XP_010098174.1|  Inositol oxygenase 1                               235   1e-72   
gb|KDO53719.1|  hypothetical protein CISIN_1g021944mg                   232   1e-72   
gb|KHF98793.1|  Inositol oxygenase 1 -like protein                      233   2e-72   
ref|XP_010924624.1|  PREDICTED: inositol oxygenase 1-like               233   2e-72   
ref|XP_010540994.1|  PREDICTED: inositol oxygenase 2                    233   2e-72   
ref|XP_009148831.1|  PREDICTED: inositol oxygenase 1 isoform X2         233   3e-72   
ref|XP_009148830.1|  PREDICTED: inositol oxygenase 1 isoform X1         233   3e-72   
ref|XP_008244494.1|  PREDICTED: inositol oxygenase 4-like               232   3e-72   
emb|CDO97955.1|  unnamed protein product                                233   3e-72   
ref|XP_006305417.1|  hypothetical protein CARUB_v10009817mg             233   3e-72   
ref|XP_007210179.1|  hypothetical protein PRUPE_ppa020229mg             232   3e-72   
ref|NP_172904.2|  inositol oxygenase 1                                  233   3e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006465721.1|  PREDICTED: inositol oxygenase 1-like isoform X1    233   3e-72   
dbj|BAF01953.1|  hypothetical protein                                   232   3e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408899.1|  hypothetical protein EUTSA_v10002046mg             233   4e-72   
ref|XP_010925498.1|  PREDICTED: probable inositol oxygenase isofo...    232   4e-72   
dbj|BAC42925.1|  unknown protein                                        233   4e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006583567.1|  PREDICTED: inositol oxygenase 2-like isoform X2    232   4e-72   
ref|NP_001154337.1|  inositol oxygenase 1                               232   5e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458951.1|  PREDICTED: inositol oxygenase 1 isoform X1         232   6e-72   
ref|XP_010458952.1|  PREDICTED: inositol oxygenase 1 isoform X2         232   7e-72   
gb|KDO57808.1|  hypothetical protein CISIN_1g046235mg                   231   7e-72   
ref|XP_006417002.1|  hypothetical protein EUTSA_v10009301mg             232   7e-72   
ref|XP_003529067.1|  PREDICTED: inositol oxygenase 2-like isoform X1    232   8e-72   
emb|CDO99934.1|  unnamed protein product                                231   8e-72   
ref|XP_009112634.1|  PREDICTED: inositol oxygenase 2-like               232   1e-71   
emb|CDY48730.1|  BnaA09g10050D                                          232   1e-71   
ref|XP_002892814.1|  myo-inisitol oxygenase                             231   1e-71   
ref|XP_010496186.1|  PREDICTED: inositol oxygenase 1-like isoform X1    231   1e-71   
gb|KHM99828.1|  Inositol oxygenase 4                                    231   1e-71   
ref|XP_010496191.1|  PREDICTED: inositol oxygenase 1-like isoform X2    231   1e-71   
gb|KHG20649.1|  Inositol oxygenase 5                                    231   1e-71   
ref|XP_010938965.1|  PREDICTED: probable inositol oxygenase             231   2e-71   
ref|XP_004297776.1|  PREDICTED: inositol oxygenase 1-like               231   2e-71   
ref|XP_006426835.1|  hypothetical protein CICLE_v10026154mg             228   2e-71   
ref|XP_002883969.1|  myo-inositol oxygenase 2                           231   2e-71   
emb|CDX82723.1|  BnaC07g01430D                                          231   2e-71   
ref|XP_009102135.1|  PREDICTED: inositol oxygenase 2                    231   3e-71   
ref|XP_009343020.1|  PREDICTED: inositol oxygenase 1-like               230   4e-71   
ref|XP_002282395.1|  PREDICTED: inositol oxygenase 1                    230   4e-71   Vitis vinifera
ref|XP_009337920.1|  PREDICTED: inositol oxygenase 1-like isoform X1    230   5e-71   
ref|XP_006426838.1|  hypothetical protein CICLE_v10026154mg             228   5e-71   
ref|XP_009337921.1|  PREDICTED: inositol oxygenase 1-like isoform X2    230   5e-71   
ref|XP_006373403.1|  hypothetical protein POPTR_0017s13450g             229   6e-71   
ref|NP_001242635.1|  uncharacterized protein LOC100788665               229   6e-71   
ref|NP_200475.1|  myo-inositol oxygenase 5                              229   7e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61190.1|  unknown                                                 229   7e-71   Arabidopsis thaliana [mouse-ear cress]
gb|EMT27791.1|  Putative inositol oxygenase                             232   7e-71   
ref|XP_008244738.1|  PREDICTED: inositol oxygenase 1-like               229   7e-71   
emb|CDY03334.1|  BnaC09g10140D                                          229   8e-71   
ref|XP_004135682.1|  PREDICTED: inositol oxygenase 2-like               229   8e-71   
ref|XP_008450805.1|  PREDICTED: inositol oxygenase 2-like               229   9e-71   
gb|KGN66197.1|  hypothetical protein Csa_1G575130                       229   9e-71   
ref|XP_006426836.1|  hypothetical protein CICLE_v10026154mg             229   9e-71   
ref|XP_008375854.1|  PREDICTED: inositol oxygenase 1-like               229   9e-71   
ref|XP_002866159.1|  hypothetical protein ARALYDRAFT_495755             229   1e-70   
emb|CDY35889.1|  BnaA07g00980D                                          229   1e-70   
ref|XP_004503513.1|  PREDICTED: inositol oxygenase 2-like isoform X2    229   1e-70   
ref|XP_006401300.1|  hypothetical protein EUTSA_v10014148mg             229   1e-70   
ref|XP_006465722.1|  PREDICTED: inositol oxygenase 1-like isoform X2    228   2e-70   
gb|KDP33765.1|  hypothetical protein JCGZ_07336                         228   2e-70   
ref|XP_006349939.1|  PREDICTED: inositol oxygenase 4-like               228   2e-70   
ref|XP_008805675.1|  PREDICTED: probable inositol oxygenase             228   3e-70   
ref|XP_008221001.1|  PREDICTED: inositol oxygenase 1-like isoform X1    229   3e-70   
ref|XP_011021080.1|  PREDICTED: inositol oxygenase 2-like               228   3e-70   
ref|XP_010476506.1|  PREDICTED: inositol oxygenase 1-like               228   3e-70   
ref|XP_004149177.1|  PREDICTED: inositol oxygenase 1-like               225   3e-70   
ref|XP_010489128.1|  PREDICTED: inositol oxygenase 2-like               228   3e-70   
ref|XP_007215726.1|  hypothetical protein PRUPE_ppa009023mg             228   3e-70   
ref|XP_007160262.1|  hypothetical protein PHAVU_002G306400g             226   4e-70   
ref|XP_004141036.1|  PREDICTED: inositol oxygenase 2-like               228   4e-70   
ref|XP_007160260.1|  hypothetical protein PHAVU_002G306200g             228   5e-70   
ref|XP_010243881.1|  PREDICTED: probable inositol oxygenase             232   5e-70   
ref|XP_008447570.1|  PREDICTED: inositol oxygenase 1-like isoform X2    227   5e-70   
ref|XP_004157903.1|  PREDICTED: inositol oxygenase 2-like               228   5e-70   
ref|XP_008447569.1|  PREDICTED: inositol oxygenase 1-like isoform X1    227   5e-70   
gb|AAC05150.1|  PRE87 gene product                                      224   5e-70   Pinus radiata
ref|XP_009767150.1|  PREDICTED: inositol oxygenase 2-like               226   6e-70   
ref|XP_004253007.1|  PREDICTED: inositol oxygenase 5-like               226   7e-70   
ref|NP_001190844.1|  myo-inositol oxygenase 4                           227   7e-70   
ref|XP_010451346.1|  PREDICTED: inositol oxygenase 5-like               227   8e-70   
ref|NP_194356.2|  myo-inositol oxygenase 4                              227   8e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CDX92758.1|  BnaC07g40160D                                          226   9e-70   
ref|XP_004966088.1|  PREDICTED: probable inositol oxygenase-like        226   9e-70   
ref|XP_010483142.1|  PREDICTED: inositol oxygenase 5                    227   1e-69   
emb|CDY42748.1|  BnaA03g47910D                                          226   1e-69   
ref|XP_006298168.1|  hypothetical protein CARUB_v10014217mg             224   1e-69   
ref|XP_009124813.1|  PREDICTED: inositol oxygenase 4                    226   1e-69   
ref|XP_006365685.1|  PREDICTED: inositol oxygenase 2-like               224   1e-69   
ref|XP_009381183.1|  PREDICTED: probable inositol oxygenase             226   1e-69   
gb|AAK43906.1|AF370587_1  Unknown protein                               224   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279854.1|  hypothetical protein CARUB_v10028439mg             226   1e-69   
gb|KHG27947.1|  Inositol oxygenase 2 -like protein                      226   1e-69   
gb|KGN58015.1|  hypothetical protein Csa_3G434960                       225   2e-69   
ref|XP_002514185.1|  myoinositol oxygenase, putative                    226   3e-69   Ricinus communis
gb|AAP59548.1|  myo-inositol oxygenase                                  225   3e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009126928.1|  PREDICTED: inositol oxygenase 5                    225   4e-69   
emb|CDY20714.1|  BnaA02g08540D                                          225   4e-69   
ref|XP_010416640.1|  PREDICTED: inositol oxygenase 2                    225   4e-69   
ref|NP_565459.1|  myo-inositol oxygenase 2                              225   5e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63498.1|  unknown                                                 225   5e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007160263.1|  hypothetical protein PHAVU_002G306500g             224   5e-69   
ref|XP_010443316.1|  PREDICTED: inositol oxygenase 5-like               224   6e-69   
ref|XP_009402940.1|  PREDICTED: probable inositol oxygenase             224   7e-69   
ref|XP_004297627.1|  PREDICTED: inositol oxygenase 1-like               224   1e-68   
ref|NP_001141330.1|  uncharacterized protein LOC100273421               223   1e-68   Zea mays [maize]
ref|XP_002869617.1|  myo-inositol oxygenase 4                           224   1e-68   
ref|XP_007039457.1|  Myo-inositol oxygenase 4 isoform 3                 223   2e-68   
gb|AFW86646.1|  hypothetical protein ZEAMMB73_073834                    223   2e-68   
gb|ACR38420.1|  unknown                                                 223   2e-68   Zea mays [maize]
ref|XP_009758702.1|  PREDICTED: inositol oxygenase 2-like               223   2e-68   
ref|XP_010467925.1|  PREDICTED: inositol oxygenase 2-like               223   2e-68   
ref|XP_010312511.1|  PREDICTED: probable inositol oxygenase isofo...    223   2e-68   
ref|NP_001057871.1|  Os06g0561000                                       223   2e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006285955.1|  hypothetical protein CARUB_v10007474mg             218   2e-68   
gb|KFK29141.1|  hypothetical protein AALP_AA7G093700                    223   3e-68   
ref|XP_011076857.1|  PREDICTED: probable inositol oxygenase             223   3e-68   
emb|CDY41799.1|  BnaC02g12100D                                          223   3e-68   
ref|XP_007221110.1|  hypothetical protein PRUPE_ppa017891mg             222   3e-68   
ref|XP_011008897.1|  PREDICTED: inositol oxygenase 2                    223   4e-68   
ref|XP_006284128.1|  hypothetical protein CARUB_v10005260mg             223   4e-68   
ref|XP_009590853.1|  PREDICTED: inositol oxygenase 2-like               223   4e-68   
ref|XP_006656167.1|  PREDICTED: probable inositol oxygenase-like        222   4e-68   
ref|XP_008459136.1|  PREDICTED: inositol oxygenase 2-like               226   4e-68   
gb|EAZ37359.1|  hypothetical protein OsJ_21699                          224   6e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003563752.1|  PREDICTED: probable inositol oxygenase             221   7e-68   
ref|XP_007158875.1|  hypothetical protein PHAVU_002G189100g             220   1e-67   
ref|XP_010536842.1|  PREDICTED: inositol oxygenase 4-like isoform X2    221   1e-67   
ref|XP_007160261.1|  hypothetical protein PHAVU_002G306300g             219   2e-67   
ref|XP_007039458.1|  Myo-inositol oxygenase 4 isoform 4                 219   2e-67   
ref|XP_010448298.1|  PREDICTED: inositol oxygenase 4-like isoform X3    221   2e-67   
ref|XP_010536841.1|  PREDICTED: inositol oxygenase 4-like isoform X1    221   2e-67   
ref|XP_010448299.1|  PREDICTED: inositol oxygenase 4-like isoform X4    220   3e-67   
emb|CAN78063.1|  hypothetical protein VITISV_036400                     219   4e-67   Vitis vinifera
ref|XP_006371960.1|  hypothetical protein POPTR_0018s06700g             219   7e-67   
ref|XP_004298756.1|  PREDICTED: inositol oxygenase 1-like               219   1e-66   
ref|XP_010438782.1|  PREDICTED: inositol oxygenase 4 isoform X3         217   2e-66   
ref|XP_010924477.1|  PREDICTED: probable inositol oxygenase             218   3e-66   
gb|KHG19184.1|  Inositol oxygenase 1 -like protein                      218   3e-66   
ref|XP_006413210.1|  hypothetical protein EUTSA_v10025773mg             218   3e-66   
ref|XP_010448296.1|  PREDICTED: inositol oxygenase 4-like isoform X1    220   4e-66   
ref|XP_010438781.1|  PREDICTED: inositol oxygenase 4 isoform X2         218   4e-66   
ref|XP_010448297.1|  PREDICTED: inositol oxygenase 4-like isoform X2    220   4e-66   
ref|XP_010438780.1|  PREDICTED: inositol oxygenase 4 isoform X1         217   5e-66   
ref|XP_009408907.1|  PREDICTED: probable inositol oxygenase             217   5e-66   
gb|KDO53720.1|  hypothetical protein CISIN_1g021944mg                   217   5e-66   
ref|XP_010433529.1|  PREDICTED: inositol oxygenase 4-like isoform X5    216   5e-66   
ref|XP_004287501.1|  PREDICTED: inositol oxygenase 4-like               218   8e-66   
gb|ABK24160.1|  unknown                                                 216   8e-66   Picea sitchensis
ref|XP_010433528.1|  PREDICTED: inositol oxygenase 4-like isoform X4    216   1e-65   
ref|XP_006853782.1|  hypothetical protein AMTR_s00056p00209200          213   2e-65   
ref|XP_010909937.1|  PREDICTED: probable inositol oxygenase             215   2e-65   
ref|XP_009395731.1|  PREDICTED: inositol oxygenase 1-like               214   4e-65   
gb|AAF43953.1|AC012188_30  Strong similarity to an unknown protei...    218   5e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433527.1|  PREDICTED: inositol oxygenase 4-like isoform X3    216   2e-64   
ref|XP_010433526.1|  PREDICTED: inositol oxygenase 4-like isoform X2    216   2e-64   
ref|XP_010433525.1|  PREDICTED: inositol oxygenase 4-like isoform X1    216   3e-64   
ref|XP_004503512.1|  PREDICTED: inositol oxygenase 2-like isoform X1    212   7e-64   
ref|XP_010244377.1|  PREDICTED: probable inositol oxygenase isofo...    214   8e-64   
ref|XP_010244376.1|  PREDICTED: probable inositol oxygenase isofo...    214   9e-64   
ref|XP_011093670.1|  PREDICTED: inositol oxygenase 1-like               211   1e-63   
emb|CDP11052.1|  unnamed protein product                                209   1e-63   
ref|XP_007158873.1|  hypothetical protein PHAVU_002G1889000g            209   2e-63   
ref|XP_006451361.1|  hypothetical protein CICLE_v10010267mg             207   5e-62   
gb|ACU19277.1|  unknown                                                 206   6e-62   Glycine max [soybeans]
ref|XP_006298167.1|  hypothetical protein CARUB_v10014217mg             207   6e-62   
gb|EMS59186.1|  putative inositol oxygenase                             211   4e-61   
ref|XP_006853784.1|  hypothetical protein AMTR_s00056p00210540          204   6e-61   
ref|NP_001241072.1|  uncharacterized protein LOC100794523               203   9e-61   
ref|XP_010092932.1|  Inositol oxygenase 1                               209   4e-60   
gb|AAF63180.1|AC010657_16  T5E21.2                                      202   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001767567.1|  predicted protein                                  192   1e-57   
ref|XP_007158874.1|  hypothetical protein PHAVU_002G189000g             198   3e-57   
ref|XP_002966344.1|  hypothetical protein SELMODRAFT_230879             183   3e-53   
ref|XP_002978216.1|  hypothetical protein SELMODRAFT_176725             184   5e-53   
gb|AFK33557.1|  unknown                                                 179   1e-51   
ref|XP_006379810.1|  hypothetical protein POPTR_0008s14360g             179   1e-51   
gb|AFW90597.1|  Myo-inositol oxygenase                                  179   2e-51   
ref|XP_007222714.1|  hypothetical protein PRUPE_ppa009901mg             175   4e-50   
gb|KEH18253.1|  myo-inositol oxygenase                                  172   5e-49   
ref|XP_007024359.1|  Myo-inositol oxygenase 1                           172   6e-49   
gb|KDO55906.1|  hypothetical protein CISIN_1g035614mg                   171   9e-49   
gb|AGO64479.1|  myo-inositol oxidase                                    166   4e-48   
ref|XP_007024364.1|  Myo-inositol oxygenase 1 isoform 4                 166   4e-47   
gb|EYU27239.1|  hypothetical protein MIMGU_mgv1a025976mg                162   9e-47   
gb|KGK38787.1|  hypothetical protein JL09_g2057                         166   6e-46   
dbj|GAM22974.1|  hypothetical protein SAMD00019534_061490               162   3e-45   
ref|XP_571356.1|  myo-inositol oxygenase                                163   4e-45   Cryptococcus neoformans var. neoformans JEC21
gb|AAN85573.1|  myo-inositol oxygenase                                  161   2e-44   Cryptococcus neoformans var. neoformans
ref|XP_002605655.1|  hypothetical protein BRAFLDRAFT_279934             158   4e-44   Branchiostoma floridae
ref|XP_004341248.1|  inositol oxygenase 1, putative                     160   5e-44   
gb|ESA12097.1|  hypothetical protein GLOINDRAFT_27524                   160   7e-44   
gb|ESW96611.1|  Inositol oxygenase 1                                    160   1e-43   
ref|WP_020737816.1|  hypothetical protein                               158   1e-43   
ref|XP_003290910.1|  hypothetical protein DICPUDRAFT_49534              157   2e-43   
gb|KGB76104.1|  myo-inositol oxygenase                                  158   3e-43   
ref|WP_007416147.1|  inositol oxygenase                                 157   3e-43   
gb|AHG93271.1|  protein of unknown function DUF706                      157   4e-43   
ref|XP_002420677.1|  inositol oxygenase, putative                       158   7e-43   Candida dubliniensis CD36
gb|KGQ84652.1|  inositol oxygenase                                      157   8e-43   
ref|XP_721965.1|  likely inositol oxygenase                             157   8e-43   
gb|KHC48754.1|  inositol oxygenase                                      157   8e-43   
gb|KGR11265.1|  inositol oxygenase                                      157   8e-43   
ref|XP_721806.1|  likely inositol oxygenase                             157   8e-43   
gb|KHC58763.1|  inositol oxygenase                                      157   9e-43   
gb|KGQ86812.1|  inositol oxygenase                                      157   9e-43   
ref|XP_002123012.1|  PREDICTED: inositol oxygenase-like                 156   1e-42   
gb|KDQ71560.1|  Inositol oxygenase                                      157   1e-42   
ref|WP_010517443.1|  inositol oxygenase                                 156   1e-42   
gb|EMG46428.1|  Inositol oxygenase, putative                            157   2e-42   
ref|XP_003194621.1|  myo-inositol oxygenase                             156   2e-42   
ref|XP_006463566.1|  hypothetical protein AGABI2DRAFT_194354            155   2e-42   
ref|XP_002551159.1|  hypothetical protein CTRG_05457                    156   2e-42   
ref|XP_004195744.1|  Piso0_005155                                       156   3e-42   
ref|XP_001384805.2|  hypothetical protein PICST_60142                   156   3e-42   
ref|XP_001832131.1|  myo-inositol oxygenase                             155   3e-42   
gb|KHC64841.1|  inositol oxygenase                                      155   5e-42   
gb|KGQ90300.1|  inositol oxygenase                                      155   5e-42   
ref|XP_797991.2|  PREDICTED: inositol oxygenase-like                    155   5e-42   
ref|XP_635854.1|  inositol oxygenase                                    154   6e-42   
ref|XP_004194648.1|  Piso0_005155                                       155   7e-42   
ref|WP_028376267.1|  inositol oxygenase                                 154   7e-42   
ref|WP_035644309.1|  inositol oxygenase                                 154   9e-42   
ref|XP_006684539.1|  hypothetical protein CANTEDRAFT_133394             154   9e-42   
dbj|BAJ98201.1|  predicted protein                                      153   1e-41   
ref|XP_004343748.1|  myo-inositol oxygenase                             154   1e-41   
ref|XP_006695400.1|  inositol oxygenase-like protein                    154   1e-41   
ref|WP_035638026.1|  inositol oxygenase                                 153   1e-41   
emb|CDK27086.1|  unnamed protein product                                154   2e-41   
dbj|GAL79942.1|  inositol oxygenase                                     153   2e-41   
ref|WP_020148821.1|  hypothetical protein                               153   2e-41   
ref|WP_018474202.1|  inositol oxygenase                                 153   2e-41   
ref|XP_007375450.1|  hypothetical protein SPAPADRAFT_138355             154   2e-41   
ref|WP_010855021.1|  Inositol oxygenase                                 153   2e-41   
gb|EFX83725.1|  hypothetical protein DAPPUDRAFT_100432                  152   2e-41   
ref|XP_007368924.1|  myo-inositol oxygenase                             153   2e-41   
gb|EIE91805.1|  hypothetical protein RO3G_16516                         152   2e-41   
emb|CDO71022.1|  hypothetical protein BN946_scf184844.g26               152   2e-41   
ref|XP_002162268.2|  PREDICTED: inositol oxygenase-like                 149   3e-41   
ref|XP_002432003.1|  Inositol oxygenase, putative                       152   3e-41   
ref|NP_001025437.1|  inositol oxygenase                                 152   3e-41   
ref|WP_026984264.1|  inositol oxygenase                                 152   3e-41   
ref|WP_013663514.1|  inositol oxygenase                                 152   3e-41   
emb|CDH60836.1|  inositol oxygenase                                     152   4e-41   
ref|XP_008728090.1|  hypothetical protein G647_05540                    153   4e-41   
gb|AIE86728.1|  Inositol oxygenase                                      152   4e-41   
ref|WP_035689964.1|  inositol oxygenase                                 152   4e-41   
ref|WP_008469272.1|  inositol oxygenase                                 152   4e-41   
ref|XP_001524881.1|  hypothetical protein LELG_03913                    153   4e-41   
ref|WP_038126931.1|  inositol oxygenase                                 151   4e-41   
ref|XP_003644471.1|  hypothetical protein Ecym_1426                     153   5e-41   
ref|XP_663589.1|  hypothetical protein AN5985.2                         149   5e-41   
emb|CDX84025.1|  BnaC08g16200D                                          148   5e-41   
dbj|GAL64325.1|  inositol oxygenase                                     151   6e-41   
ref|WP_022908961.1|  inositol oxygenase                                 151   6e-41   
ref|WP_035658530.1|  inositol oxygenase                                 151   6e-41   
ref|XP_007829449.1|  hypothetical protein PFICI_02677                   152   6e-41   
ref|XP_313400.3|  AGAP003636-PA                                         151   6e-41   
emb|CAE46441.1|  inositol oxygenase                                     152   7e-41   
ref|XP_007755054.1|  inositol oxygenase                                 152   7e-41   
ref|WP_038121250.1|  inositol oxygenase                                 151   8e-41   
ref|WP_012025106.1|  inositol oxygenase                                 151   8e-41   
gb|KFB42133.1|  AGAP003635-PA-like protein                              159   8e-41   
ref|WP_027302724.1|  inositol oxygenase                                 151   9e-41   
ref|WP_026712270.1|  inositol oxygenase                                 151   9e-41   
ref|XP_001826221.1|  Inositol oxygenase 1                               152   9e-41   
ref|XP_008410660.1|  PREDICTED: inositol oxygenase                      150   9e-41   
ref|WP_019600568.1|  inositol oxygenase                                 151   1e-40   
ref|WP_020150877.1|  inositol oxygenase                                 150   1e-40   
ref|WP_035176387.1|  inositol oxygenase                                 150   2e-40   
ref|XP_009549793.1|  hypothetical protein HETIRDRAFT_325916             150   2e-40   
gb|KFY31528.1|  hypothetical protein V493_01022                         150   2e-40   
ref|XP_002553795.1|  KLTH0E07260p                                       151   2e-40   
ref|WP_009035890.1|  inositol oxygenase                                 150   2e-40   
gb|KEF61322.1|  inositol oxygenase                                      150   2e-40   
ref|WP_007806626.1|  inositol oxygenase                                 150   2e-40   
tpe|CBF70416.1|  TPA: inositol oxygenase, putative (AFU_orthologu...    150   2e-40   
ref|XP_460275.2|  DEHA2E22418p                                          151   2e-40   
emb|CCE43990.1|  hypothetical protein CPAR2_502150                      152   3e-40   
ref|XP_572486.1|  Inositol oxygenase                                    150   3e-40   
ref|WP_031453606.1|  inositol oxygenase                                 149   3e-40   
ref|WP_020532625.1|  inositol oxygenase                                 149   3e-40   
gb|KFZ07861.1|  hypothetical protein V502_09694                         150   3e-40   
ref|XP_001213634.1|  inositol oxygenase 1                               150   3e-40   
ref|WP_011685791.1|  inositol oxygenase                                 149   4e-40   
ref|XP_007293197.1|  myo-inositol oxygenase                             150   4e-40   
dbj|GAD93750.1|  inositol oxygenase, putative                           150   4e-40   
gb|AFR94578.1|  inositol oxygenase                                      150   4e-40   
ref|XP_007870786.1|  DUF706-domain-containing protein                   149   4e-40   
ref|WP_031499261.1|  inositol oxygenase                                 149   5e-40   
ref|XP_009058718.1|  hypothetical protein LOTGIDRAFT_123081             145   6e-40   
dbj|BAP70058.1|  inositol oxygenase 1                                   150   6e-40   
ref|XP_005177285.1|  PREDICTED: inositol oxygenase-like                 149   7e-40   
gb|KDR79887.1|  hypothetical protein GALMADRAFT_136471                  149   7e-40   
ref|WP_008865701.1|  inositol oxygenase                                 149   7e-40   
ref|XP_007848744.1|  myo-inositol oxygenase                             149   7e-40   
ref|WP_014021187.1|  inositol oxygenase                                 149   7e-40   
ref|XP_005802062.1|  PREDICTED: inositol oxygenase-like                 148   7e-40   
ref|XP_774194.1|  hypothetical protein CNBG1760                         149   8e-40   
ref|XP_008042150.1|  myo-inositol oxygenase                             149   8e-40   
ref|WP_038073583.1|  inositol oxygenase                                 149   9e-40   
ref|XP_003867386.1|  inositol oxygenase                                 150   9e-40   
ref|XP_007722853.1|  inositol oxygenase                                 149   9e-40   
ref|XP_002850117.1|  inositol oxygenase 1                               149   1e-39   
ref|XP_003041063.1|  predicted protein                                  149   1e-39   
ref|XP_002565933.1|  Pc22g20330                                         149   1e-39   
ref|XP_003196274.1|  inositol oxygenase                                 149   1e-39   
ref|WP_020893274.1|  Inositol oxygenase                                 148   1e-39   
ref|XP_003230071.2|  PREDICTED: inositol oxygenase                      148   1e-39   
ref|XP_007545759.1|  PREDICTED: inositol oxygenase isoform X2           148   1e-39   
ref|XP_007795700.1|  putative inositol oxygenase 1 protein              150   1e-39   
ref|XP_002796397.1|  inositol oxygenase                                 148   1e-39   
ref|XP_007908804.1|  PREDICTED: inositol oxygenase isoform X4           147   2e-39   
gb|EFQ33804.1|  hypothetical protein GLRG_08948                         148   2e-39   
ref|WP_015249458.1|  inositol oxygenase                                 147   2e-39   
ref|XP_006463542.1|  hypothetical protein AGABI2DRAFT_208395            148   2e-39   
emb|CEG71774.1|  Putative Inositol oxygenase                            147   2e-39   
ref|XP_571994.1|  Inositol oxygenase                                    149   2e-39   
ref|XP_006013482.1|  PREDICTED: inositol oxygenase                      148   2e-39   
emb|CEJ83097.1|  Putative Myo-inositol oxygenase                        148   2e-39   
dbj|BAO38508.1|  inositol oxygenase 1                                   149   2e-39   
ref|WP_013767952.1|  inositol oxygenase                                 147   2e-39   
ref|NP_001279956.1|  myo-inositol oxygenase                             147   3e-39   
ref|XP_001242229.1|  hypothetical protein CIMG_06125                    147   3e-39   
ref|XP_007846371.1|  myo-inositol oxygenase                             147   3e-39   
ref|XP_007735490.1|  inositol oxygenase                                 148   3e-39   
gb|KDQ31701.1|  hypothetical protein PLEOSDRAFT_1035103                 147   3e-39   
ref|WP_027064609.1|  inositol oxygenase                                 147   3e-39   
ref|WP_025497404.1|  inositol oxygenase                                 147   3e-39   
gb|KEP54146.1|  myo-inositol oxygenase                                  147   3e-39   
gb|EUC53666.1|  myo-inositol oxygenase                                  147   3e-39   
ref|XP_007908801.1|  PREDICTED: inositol oxygenase isoform X1           147   3e-39   
ref|XP_007908802.1|  PREDICTED: inositol oxygenase isoform X2           147   3e-39   
ref|XP_007749518.1|  inositol oxygenase                                 147   4e-39   
ref|WP_018629268.1|  inositol oxygenase                                 147   4e-39   
ref|WP_020719475.1|  hypothetical protein                               147   4e-39   
ref|XP_003069493.1|  Inositol oxygenase, putative                       147   4e-39   
gb|EJL90967.1|  serine protease, S9A family peptidase                   146   4e-39   
ref|WP_013931001.1|  inositol oxygenase                                 147   4e-39   
gb|EPS28841.1|  hypothetical protein PDE_03787                          147   4e-39   
ref|WP_036837044.1|  inositol oxygenase                                 145   4e-39   
ref|WP_020529230.1|  inositol oxygenase                                 146   5e-39   
gb|EPB85863.1|  inositol oxygenase                                      146   5e-39   
gb|KDN71055.1|  hypothetical protein CSUB01_07907                       147   5e-39   
gb|AFR96498.1|  inositol oxygenase                                      147   5e-39   
ref|XP_008310113.1|  PREDICTED: inositol oxygenase                      143   5e-39   
ref|XP_007592489.1|  hypothetical protein CFIO01_03925                  147   5e-39   
ref|XP_005108934.1|  PREDICTED: inositol oxygenase-like                 145   5e-39   
gb|KGB79900.1|  inositol oxygenase                                      147   6e-39   
ref|XP_009159592.1|  inositol oxygenase                                 147   6e-39   
gb|KID74626.1|  myo-inositol oxygenase                                  147   6e-39   
ref|XP_007814647.1|  myo-inositol oxygenase                             147   6e-39   
ref|XP_001275322.1|  inositol oxygenase, putative                       147   6e-39   
ref|WP_009284868.1|  inositol oxygenase                                 146   6e-39   
gb|KFM59302.1|  Inositol oxygenase                                      146   6e-39   
ref|WP_012929714.1|  inositol oxygenase                                 146   6e-39   
ref|WP_036386272.1|  inositol oxygenase                                 145   6e-39   
ref|WP_012792331.1|  inositol oxygenase                                 146   7e-39   
emb|CDM27698.1|  Inositol oxygenase 1                                   147   7e-39   
ref|WP_018614196.1|  inositol oxygenase                                 146   7e-39   
gb|KGO76869.1|  Inositol oxygenase                                      147   8e-39   
gb|KFZ06651.1|  hypothetical protein V501_07214                         146   8e-39   
gb|EER39143.1|  myo-inositol oxygenase                                  144   8e-39   
ref|XP_002617172.1|  hypothetical protein CLUG_02616                    147   9e-39   
emb|CAC27324.1|  aldehyde reductase 6                                   144   9e-39   
emb|CCF41530.1|  hypothetical protein CH063_02614                       146   1e-38   
emb|CCE28378.1|  probable aldehyde reductase 6                          146   1e-38   
ref|WP_013070508.1|  inositol oxygenase                                 145   1e-38   
ref|XP_007816483.1|  myo-inositol oxygenase                             146   1e-38   
gb|KFG86656.1|  myo-inositol oxygenase                                  146   1e-38   
gb|ESZ98338.1|  inositol oxygenase                                      146   1e-38   
ref|WP_026969235.1|  inositol oxygenase                                 145   1e-38   
ref|XP_002490932.1|  hypothetical protein                               147   1e-38   
ref|WP_025146018.1|  inositol oxygenase                                 145   1e-38   
ref|XP_010756317.1|  hypothetical protein PADG_00361                    146   1e-38   
ref|XP_007393070.1|  hypothetical protein PHACADRAFT_251534             145   1e-38   
emb|CAG13050.1|  unnamed protein product                                145   1e-38   
gb|EEH19718.1|  hypothetical protein PABG_01977                         145   1e-38   
ref|WP_020605800.1|  inositol oxygenase                                 145   1e-38   
ref|WP_015331340.1|  Inositol oxygenase                                 145   1e-38   
gb|KEQ81633.1|  inositol oxygenase 1                                    145   2e-38   
ref|XP_003195172.1|  inositol oxygenase                                 145   2e-38   
ref|XP_001260505.1|  inositol oxygenase, putative                       145   2e-38   
gb|EYE95690.1|  DUF706-domain-containing protein                        146   2e-38   
gb|KID99494.1|  myo-inositol oxygenase                                  145   2e-38   
gb|KID86403.1|  myo-inositol oxygenase                                  145   2e-38   
ref|XP_755356.1|  inositol oxygenase                                    145   2e-38   
emb|CDS14110.1|  hypothetical protein LRAMOSA06280                      145   2e-38   
ref|XP_001586102.1|  hypothetical protein SS1G_12677                    144   2e-38   
emb|CDS06841.1|  hypothetical protein LRAMOSA09366                      145   2e-38   
ref|XP_006958725.1|  DUF706-domain-containing protein                   145   2e-38   
gb|ACQ58391.1|  Inositol oxygenase                                      145   2e-38   
ref|WP_013567380.1|  inositol oxygenase                                 145   2e-38   
ref|NP_001261748.1|  CG6910, isoform C                                  144   2e-38   
dbj|GAA85049.1|  inositol oxygenase                                     145   2e-38   
gb|AAW83329.1|  myo-inositol oxygenase                                  145   2e-38   
ref|NP_648556.3|  CG6910, isoform B                                     145   2e-38   
ref|XP_004069715.1|  PREDICTED: inositol oxygenase-like                 144   2e-38   
ref|WP_022842995.1|  inositol oxygenase                                 144   2e-38   
gb|EKG17920.1|  Inositol oxygenase                                      145   3e-38   
ref|XP_003384127.1|  PREDICTED: inositol oxygenase-like                 145   3e-38   
gb|EKV09480.1|  Inositol oxygenase, putative                            145   3e-38   
ref|XP_001972509.1|  GG15566                                            144   3e-38   
ref|XP_009267269.1|  Inositol oxygenase 1                               145   3e-38   
emb|CDO94670.1|  unnamed protein product                                145   3e-38   
dbj|GAD91795.1|  inositol oxygenase 1                                   145   3e-38   
ref|XP_008172383.1|  PREDICTED: inositol oxygenase                      145   3e-38   
ref|WP_015028145.1|  inositol oxygenase                                 145   3e-38   
ref|XP_006633805.1|  PREDICTED: inositol oxygenase-like                 144   4e-38   
ref|XP_002084614.1|  GD14365                                            144   4e-38   
ref|XP_002068297.1|  GK13270                                            144   4e-38   
gb|KFY80106.1|  hypothetical protein V499_00995                         144   4e-38   
gb|KFA70764.1|  hypothetical protein S40288_09352                       145   4e-38   
gb|KEY71940.1|  hypothetical protein S7711_07089                        145   4e-38   
ref|WP_029445519.1|  inositol oxygenase                                 144   4e-38   
ref|WP_036152688.1|  inositol oxygenase                                 144   5e-38   
ref|XP_002094557.1|  GE21891                                            144   5e-38   
ref|WP_026774887.1|  inositol oxygenase                                 144   5e-38   
ref|XP_007285175.1|  inositol oxygenase                                 144   5e-38   
emb|CCA38931.1|  hypothetical protein PP7435_Chr2-1256                  146   5e-38   
ref|XP_001956021.1|  GF24808                                            144   5e-38   



>ref|XP_009781860.1| PREDICTED: inositol oxygenase 1-like, partial [Nicotiana sylvestris]
Length=169

 Score =   256 bits (654),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD  N L+NTKNGVY+EGCGLD V+MSWGHDDYMYLVAKENGTTLPSA
Sbjct  37   ESIVHHKYFKENPDTKNPLFNTKNGVYKEGCGLDNVVMSWGHDDYMYLVAKENGTTLPSA  96

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALF+IRYHSFYALHR G YTHLMNEED+ENMKWLKIFNKYDLYSKSKVRIDVE+VKPYY+
Sbjct  97   ALFVIRYHSFYALHRAGVYTHLMNEEDRENMKWLKIFNKYDLYSKSKVRIDVEKVKPYYI  156

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  157  SLIEKYFPAKLRW  169



>ref|NP_001234593.1| myo-inositol oxygenase [Solanum lycopersicum]
 gb|ACS45396.1| myo-inositol oxygenase [Solanum lycopersicum]
Length=317

 Score =   260 bits (665),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN +YNTKNGVYEEGCGLDKV+MSWGHDDYMYL+AKEN TTLPSA
Sbjct  185  ESIVHHKYFKENPDINNNIYNTKNGVYEEGCGLDKVVMSWGHDDYMYLIAKENKTTLPSA  244

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALF+IRYHSFYALHR GAYTHLMNEEDKENMKWL IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  245  ALFVIRYHSFYALHRSGAYTHLMNEEDKENMKWLNIFNKYDLYSKSKVRIDVEKVKPYYL  304

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP KLRW
Sbjct  305  SLIEKYFPTKLRW  317



>ref|XP_009616364.1| PREDICTED: inositol oxygenase 2-like [Nicotiana tomentosiformis]
Length=316

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN LYNTKNGVY+EGCGLD V+MSWGHDDYMYLVAKENGTTLPSA
Sbjct  184  ESIVHHKYFKENPDTNNPLYNTKNGVYKEGCGLDNVVMSWGHDDYMYLVAKENGTTLPSA  243

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALF+IRYHSFYALHR G YTHLMNEED+ENMKWLKIFNKYDLYSKSKVRIDVE+VKPYY+
Sbjct  244  ALFVIRYHSFYALHRAGVYTHLMNEEDRENMKWLKIFNKYDLYSKSKVRIDVEKVKPYYI  303

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPA+LRW
Sbjct  304  SLIEKYFPARLRW  316



>ref|XP_006353509.1| PREDICTED: inositol oxygenase 4-like [Solanum tuberosum]
Length=317

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN +YNTKNGVYEEGCGLDKV+MSWGHDDYMYLV+KEN TTLPSA
Sbjct  185  ESIVHHKYFKENPDINNNIYNTKNGVYEEGCGLDKVVMSWGHDDYMYLVSKENETTLPSA  244

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALF+IRYHSFYALHR GAYTHLMNEEDKENMKWL IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  245  ALFVIRYHSFYALHRSGAYTHLMNEEDKENMKWLNIFNKYDLYSKSKVRIDVEKVKPYYL  304

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP KLRW
Sbjct  305  SLIEKYFPTKLRW  317



>ref|XP_010086904.1| Inositol oxygenase 2 [Morus notabilis]
 gb|EXB24695.1| Inositol oxygenase 2 [Morus notabilis]
Length=327

 Score =   250 bits (639),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPDCNN  YNTKNGVY EGCGLD V++SWGHDDYMYLVAKEN TTLPSA
Sbjct  195  ESIVHHKYFKENPDCNNPAYNTKNGVYTEGCGLDNVVISWGHDDYMYLVAKENRTTLPSA  254

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LHR GAY HLMN+ED+EN+KWLKIFNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  255  ALFIIRYHSFYPLHRSGAYKHLMNKEDEENLKWLKIFNKYDLYSKSKVRVDVEKVKPYYL  314

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  315  SLIEKYFPAKLKW  327



>ref|XP_011025349.1| PREDICTED: inositol oxygenase 1 [Populus euphratica]
Length=309

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYF ENPDCNN+ YN+K GVY EGCGLD+V MSWGHDDYMYLVAKEN TTLPSA
Sbjct  177  ESIVHHKYFTENPDCNNSAYNSKYGVYSEGCGLDRVSMSWGHDDYMYLVAKENKTTLPSA  236

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALHR GAY HLMNEED EN+KWLKIFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  237  GLFIIRYHSFYALHRAGAYRHLMNEEDVENLKWLKIFNKYDLYSKSKVRIDVEKVKPYYL  296

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  297  SLIEKYFPAKLRW  309



>ref|XP_002311571.2| oxygenase-related family protein [Populus trichocarpa]
 gb|EEE88938.2| oxygenase-related family protein [Populus trichocarpa]
Length=310

 Score =   248 bits (632),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYF ENPDCNN+ YN+K GVY EGCGLD+V MSWGHDDYMYLVAKEN TTLPSA
Sbjct  178  ESIVHHKYFTENPDCNNSAYNSKYGVYSEGCGLDRVFMSWGHDDYMYLVAKENKTTLPSA  237

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LHR GAY HLMNEED EN+KWLKIFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  238  GLFIIRYHSFYTLHRTGAYRHLMNEEDVENLKWLKIFNKYDLYSKSKVRIDVEKVKPYYL  297

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  298  SLIEKYFPAKLRW  310



>ref|XP_011093669.1| PREDICTED: inositol oxygenase 2-like [Sesamum indicum]
Length=315

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFK+N D +N  YNTKNG+YEEGCGL+ V+MSWGHDDYMYLVAKENGTTLPSA
Sbjct  183  ESIVHHKYFKDNSDTHNPAYNTKNGIYEEGCGLENVVMSWGHDDYMYLVAKENGTTLPSA  242

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFI+RYHSFY LHR GAYTHLMNEEDKEN+KWL+IFNKYDLYSKSKVR+DV++VKPYYL
Sbjct  243  ALFIVRYHSFYPLHRAGAYTHLMNEEDKENLKWLQIFNKYDLYSKSKVRVDVDKVKPYYL  302

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  303  SLIEKYFPAKLKW  315



>ref|XP_006451360.1| hypothetical protein CICLE_v10008962mg [Citrus clementina]
 ref|XP_006475366.1| PREDICTED: inositol oxygenase 2-like [Citrus sinensis]
 gb|ESR64600.1| hypothetical protein CICLE_v10008962mg [Citrus clementina]
Length=316

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYFKENPD NN  YNTKNG+Y EGCGLD V++SWGHDDYMYLVAKENGTTLPSA
Sbjct  184  ESNVHHKYFKENPDSNNPAYNTKNGIYTEGCGLDNVMISWGHDDYMYLVAKENGTTLPSA  243

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFI+RYHSFY LH+EGAY HLMNEEDKEN+KWL++FNKYDLYSKSKV +DVE+VKPYYL
Sbjct  244  GLFIVRYHSFYPLHKEGAYAHLMNEEDKENLKWLQVFNKYDLYSKSKVLVDVEKVKPYYL  303

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  304  SLIEKYFPAKLRW  316



>gb|EYU30675.1| hypothetical protein MIMGU_mgv1a010745mg [Erythranthe guttata]
Length=303

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFK+NPD NN  YNTKNG+YEEGCGLDKV+MSWGHDDYMY+VA++NG+TLPS 
Sbjct  171  ESIVHHKYFKDNPDINNPAYNTKNGIYEEGCGLDKVVMSWGHDDYMYMVARKNGSTLPSP  230

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIR+HSFY LH+ GAYTHLMN+ED+EN+ WLKIFNKYDLYSKSK+R+DVE++KPYYL
Sbjct  231  ALFIIRFHSFYPLHKAGAYTHLMNDEDRENLNWLKIFNKYDLYSKSKIRVDVEQLKPYYL  290

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKLRW
Sbjct  291  SLIDKYFPAKLRW  303



>gb|KDO55903.1| hypothetical protein CISIN_1g021203mg [Citrus sinensis]
Length=316

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYFKENPD NN  YNTKNG+Y EGCGLD V++SWGHDDYMYLVAKENGTTLPSA
Sbjct  184  ESNVHHKYFKENPDSNNPAYNTKNGIYTEGCGLDNVMISWGHDDYMYLVAKENGTTLPSA  243

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFI+RYHSFY LH+EGAY HLMNEEDKEN+KWL++FNKYDLYSKSKV +DVE+VKPYYL
Sbjct  244  GLFIVRYHSFYPLHKEGAYAHLMNEEDKENLKWLQVFNKYDLYSKSKVLVDVEKVKPYYL  303

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  304  SLIEKYFPAKLRW  316



>ref|XP_011078222.1| PREDICTED: inositol oxygenase 1-like [Sesamum indicum]
Length=298

 Score =   245 bits (625),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFK+N D NN  Y TKNG+Y+EGCGLDKVLMSWGHD+YMYLVAKENGTTLPSA
Sbjct  166  ESIVHHKYFKDNSDINNPAYKTKNGIYQEGCGLDKVLMSWGHDEYMYLVAKENGTTLPSA  225

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIR+HSFY +H+ GAYTHLMNEED++N++WLKIFNKYDLYSKSKVRIDV++VKPYYL
Sbjct  226  ALFIIRFHSFYPMHKAGAYTHLMNEEDRKNLEWLKIFNKYDLYSKSKVRIDVDKVKPYYL  285

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  286  SLIEKYFPAKLKW  298



>ref|XP_008337619.1| PREDICTED: inositol oxygenase 1-like [Malus domestica]
Length=333

 Score =   246 bits (627),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN  YNTKNG+Y EGCGLD V++SWGHDDYMYLVAKENGTTLP A
Sbjct  201  ESIVHHKYFKENPDYNNPSYNTKNGIYSEGCGLDNVMISWGHDDYMYLVAKENGTTLPKA  260

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LHR GAY HLMN+ED+EN+KWL++FNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  261  GLFIIRYHSFYPLHRAGAYRHLMNKEDEENLKWLQVFNKYDLYSKSKVRVDVEKVKPYYL  320

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  321  SLIEKYFPAKLRW  333



>ref|XP_009630876.1| PREDICTED: uncharacterized protein LOC104120755 [Nicotiana tomentosiformis]
Length=311

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            + ++ + YFKENPD NN L NTKNGVY+EGCGLD V+MSWGHDDYMYLVAKENGTTLPSA
Sbjct  179  KPLLQNPYFKENPDTNNPLNNTKNGVYKEGCGLDNVVMSWGHDDYMYLVAKENGTTLPSA  238

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALF+IRYHSFYALHR G YTHLMNEED+ENMKWLKIFNKYDLYSKSKVRIDVE+VKP Y+
Sbjct  239  ALFVIRYHSFYALHRAGVYTHLMNEEDRENMKWLKIFNKYDLYSKSKVRIDVEKVKPNYI  298

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPA+LRW
Sbjct  299  SLIEKYFPARLRW  311



>ref|XP_004248391.1| PREDICTED: inositol oxygenase 1-like [Solanum lycopersicum]
Length=350

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKEN D NN +YNTKNGVYEEGCGL+KV+MSWGHDDYMYLVAKENGTTLP A
Sbjct  218  ESIVHHKYFKENQDINNMIYNTKNGVYEEGCGLNKVVMSWGHDDYMYLVAKENGTTLPYA  277

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALF+IRYHSFYALH+ GAY HLMNEEDKEN+KWL IFNKYDLYSKS VRIDVE VKPYYL
Sbjct  278  ALFVIRYHSFYALHKSGAYKHLMNEEDKENIKWLNIFNKYDLYSKSSVRIDVENVKPYYL  337

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  338  SLIQKYFPKILRW  350



>ref|XP_009775832.1| PREDICTED: inositol oxygenase 1-like [Nicotiana sylvestris]
Length=304

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +SIVH KYFKENPD NN+ YN+K GVY EGCGLDKV+MSWGHDDYMYLVAKENGTTLPSA
Sbjct  172  DSIVHSKYFKENPDYNNSAYNSKYGVYSEGCGLDKVMMSWGHDDYMYLVAKENGTTLPSA  231

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALHR GAY HLMNEEDKEN+KWL IFNKYDLYSKSKV +DVEEVKPYY+
Sbjct  232  GLFIIRYHSFYALHRSGAYKHLMNEEDKENLKWLHIFNKYDLYSKSKVLVDVEEVKPYYM  291

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  292  SLIEKYFPAKLKW  304



>emb|CDP03219.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFK+NPD +N  Y+TKNG+YEEGCGL+ V+MSWGHDDYMYLVAKENGTTLP A
Sbjct  184  ESIVHHKYFKDNPDHSNPSYSTKNGIYEEGCGLENVVMSWGHDDYMYLVAKENGTTLPPA  243

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALF IRYHSFY LHR GAYTHLMNEED E+++WLK+FNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  244  ALFTIRYHSFYPLHRAGAYTHLMNEEDHESLRWLKVFNKYDLYSKSKVRIDVEKVKPYYL  303

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  304  SLIEKYFPAKLRW  316



>ref|XP_008361306.1| PREDICTED: inositol oxygenase 2-like [Malus domestica]
Length=333

 Score =   244 bits (622),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYFKENPD NN  YNTKNG+Y EGCGLD V++SWGHDDYMYLVAKENGTTLP A
Sbjct  201  ESXVHHKYFKENPDYNNPSYNTKNGIYSEGCGLDNVMISWGHDDYMYLVAKENGTTLPKA  260

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LHR GAY HLMN+ED+EN+KWL++FNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  261  GLFIIRYHSFYPLHRAGAYRHLMNKEDEENLKWLQVFNKYDLYSKSKVRVDVEKVKPYYL  320

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  321  SLIEKYFPAKLRW  333



>gb|EYU27240.1| hypothetical protein MIMGU_mgv1a008959mg [Erythranthe guttata]
Length=357

 Score =   244 bits (622),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +SIVHHKYFK+N D  N+ YNTKNGVYE+GCGL+ V+MSWGHDDYMYLVAKENGTTLPSA
Sbjct  225  QSIVHHKYFKDNSDTYNSSYNTKNGVYEQGCGLENVVMSWGHDDYMYLVAKENGTTLPSA  284

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFI+RYHSFY LH+ GAYTHLMNEEDKEN+KWL+IFNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  285  ALFIVRYHSFYPLHKAGAYTHLMNEEDKENLKWLQIFNKYDLYSKSKVRVDVEKVKPYYL  344

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKL+W
Sbjct  345  SLIDKYFPAKLKW  357



>gb|EYU27241.1| hypothetical protein MIMGU_mgv1a008959mg [Erythranthe guttata]
Length=356

 Score =   243 bits (621),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +SIVHHKYFK+N D  N+ YNTKNGVYE+GCGL+ V+MSWGHDDYMYLVAKENGTTLPSA
Sbjct  224  QSIVHHKYFKDNSDTYNSSYNTKNGVYEQGCGLENVVMSWGHDDYMYLVAKENGTTLPSA  283

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFI+RYHSFY LH+ GAYTHLMNEEDKEN+KWL+IFNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  284  ALFIVRYHSFYPLHKAGAYTHLMNEEDKENLKWLQIFNKYDLYSKSKVRVDVEKVKPYYL  343

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKL+W
Sbjct  344  SLIDKYFPAKLKW  356



>ref|XP_011078224.1| PREDICTED: inositol oxygenase 2-like [Sesamum indicum]
Length=295

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFK+N D NN  YNTKNG+Y+EGCGLDKVLMSWGHD+YMYLVAK+NGTTLPSA
Sbjct  163  ESIVHHKYFKDNSDFNNPAYNTKNGIYQEGCGLDKVLMSWGHDEYMYLVAKKNGTTLPSA  222

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            A+FIIR+HSFY +H+ GAYTHLMN+EDK+N++WLK FNKYDLYSKSKVRIDV++VKPYY+
Sbjct  223  AMFIIRFHSFYPMHKAGAYTHLMNDEDKQNLEWLKKFNKYDLYSKSKVRIDVDKVKPYYI  282

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  283  SLIEKYFPAKLKW  295



>gb|EPS71086.1| hypothetical protein M569_03673, partial [Genlisea aurea]
Length=164

 Score =   236 bits (603),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYF ENPD  N+ YNTK GVYEEGCGL+ VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  32   ESIVHHKYFDENPDHKNSTYNTKLGVYEEGCGLNNVLMSWGHDDYMYLVAKENKTTLPSA  91

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAY+HLMNEED+EN+KWL IFNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  92   GLFIIRYHSFYPLHKSGAYSHLMNEEDRENLKWLHIFNKYDLYSKSKVRVDVEKVKPYYL  151

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP+KLRW
Sbjct  152  SLINKYFPSKLRW  164



>ref|XP_010066969.1| PREDICTED: inositol oxygenase 1-like [Eucalyptus grandis]
 gb|KCW65033.1| hypothetical protein EUGRSUZ_G02560 [Eucalyptus grandis]
Length=304

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES+VHHKYFKENPD NN  YNTK GVY EGCGL+ VLMSWGHDDYMYLVAKEN +TLPSA
Sbjct  172  ESVVHHKYFKENPDYNNPAYNTKFGVYSEGCGLNNVLMSWGHDDYMYLVAKENKSTLPSA  231

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALHR GAY HLMNEED EN+KWLKIFNKYDLYSKSKVRIDVEEVKPYYL
Sbjct  232  GLFIIRYHSFYALHRAGAYEHLMNEEDVENLKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  291

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP KL+W
Sbjct  292  SLIKKYFPEKLKW  304



>gb|KCW65035.1| hypothetical protein EUGRSUZ_G02560 [Eucalyptus grandis]
Length=293

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES+VHHKYFKENPD NN  YNTK GVY EGCGL+ VLMSWGHDDYMYLVAKEN +TLPSA
Sbjct  161  ESVVHHKYFKENPDYNNPAYNTKFGVYSEGCGLNNVLMSWGHDDYMYLVAKENKSTLPSA  220

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALHR GAY HLMNEED EN+KWLKIFNKYDLYSKSKVRIDVEEVKPYYL
Sbjct  221  GLFIIRYHSFYALHRAGAYEHLMNEEDVENLKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  280

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP KL+W
Sbjct  281  SLIKKYFPEKLKW  293



>gb|KDP40824.1| hypothetical protein JCGZ_24823 [Jatropha curcas]
Length=307

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN  YNTK GVY EGCGL+ V+MSWGHDDYMYLVAK+N T+LPSA
Sbjct  175  ESIVHHKYFKENPDFNNPAYNTKYGVYSEGCGLNNVMMSWGHDDYMYLVAKQNKTSLPSA  234

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALHR GAY HLMNEED EN+KWL+IFNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  235  ALFIIRYHSFYALHRSGAYKHLMNEEDIENLKWLQIFNKYDLYSKSKVRVDVEKVKPYYL  294

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKL+W
Sbjct  295  SLIDKYFPAKLKW  307



>ref|XP_007203887.1| hypothetical protein PRUPE_ppa008804mg [Prunus persica]
 gb|EMJ05086.1| hypothetical protein PRUPE_ppa008804mg [Prunus persica]
Length=318

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN  +NTK G+Y EGCGLD V++SWGHDDYMYLVAKENGTTLP A
Sbjct  186  ESIVHHKYFKENPDYNNASFNTKYGIYSEGCGLDNVMISWGHDDYMYLVAKENGTTLPQA  245

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFI+RYHSFY LHR GAY HLMN+ED+EN+KWL++FNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  246  GLFIVRYHSFYPLHRAGAYRHLMNKEDEENLKWLQVFNKYDLYSKSKVRVDVEKVKPYYL  305

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  306  SLIEKYFPAKLRW  318



>gb|EYU27242.1| hypothetical protein MIMGU_mgv1a008813mg [Erythranthe guttata]
Length=361

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +SIVHHKYFK+N D  N+ YNTKNGVYE+GCGL+ V+MSWGHDDYMYLVAKENGTTLPSA
Sbjct  229  QSIVHHKYFKDNSDTYNSSYNTKNGVYEQGCGLENVVMSWGHDDYMYLVAKENGTTLPSA  288

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFI+RYHSFY LH+ GAYTHLMNEEDKEN+KWL+IFNKYDLYSKSKVR+DV++VKPYY+
Sbjct  289  ALFIVRYHSFYPLHKSGAYTHLMNEEDKENLKWLQIFNKYDLYSKSKVRVDVDKVKPYYI  348

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKL+W
Sbjct  349  SLIDKYFPAKLKW  361



>ref|XP_007135612.1| hypothetical protein PHAVU_010G143500g [Phaseolus vulgaris]
 gb|ESW07606.1| hypothetical protein PHAVU_010G143500g [Phaseolus vulgaris]
Length=306

 Score =   240 bits (613),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN  YNTK G+Y + CGLD V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  174  ESIVHHKYFKENPDYNNPSYNTKYGIYSDKCGLDSVMMSWGHDDYMYLVAKENNTTLPSA  233

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALHREGAY HLMN+ED EN+KWL IFNKYDLYSKSK+RIDVE+VKPYYL
Sbjct  234  ALFIIRYHSFYALHREGAYKHLMNDEDVENLKWLHIFNKYDLYSKSKIRIDVEKVKPYYL  293

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  294  SLIEKYFPAKLKW  306



>ref|XP_006357365.1| PREDICTED: inositol oxygenase 1-like [Solanum tuberosum]
Length=302

 Score =   239 bits (611),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +SIVH KYFKENPD NN  YN+K GVY EGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA
Sbjct  170  DSIVHSKYFKENPDYNNPAYNSKFGVYSEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  229

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+ GAY  LMNEEDKEN+KWL IFNKYDLYSKSKV+++VEEVKPYY+
Sbjct  230  GLFIIRYHSFYALHKSGAYKELMNEEDKENLKWLHIFNKYDLYSKSKVQVNVEEVKPYYM  289

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  290  SLIEKYFPAKLKW  302



>ref|XP_010322859.1| PREDICTED: inositol oxygenase 1 [Solanum lycopersicum]
Length=305

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +SIVH KYFKENPD NNT Y +K GVY EGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA
Sbjct  173  DSIVHSKYFKENPDYNNTAYKSKFGVYSEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  232

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+ GAY  LMNEEDKEN+KWL IFNKYDLYSKSKV+++VEEVKPYY+
Sbjct  233  GLFIIRYHSFYALHKSGAYKELMNEEDKENLKWLHIFNKYDLYSKSKVQVNVEEVKPYYM  292

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  293  SLIEKYFPAKLKW  305



>emb|CDY65374.1| BnaC05g49660D [Brassica napus]
Length=306

 Score =   239 bits (611),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN  YNTK G+Y EGCGLD V MSWGHDDYMYLVAKEN TTLPSA
Sbjct  174  ESIVHHKYFKENPDFNNPSYNTKFGIYTEGCGLDNVFMSWGHDDYMYLVAKENKTTLPSA  233

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY HLMNEED+ENMKWLK+FNKYDLYSKSKVRI+VEEVKPYYL
Sbjct  234  GLFIIRYHSFYALHKSEAYKHLMNEEDRENMKWLKVFNKYDLYSKSKVRINVEEVKPYYL  293

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL+W
Sbjct  294  SLINKYFPAKLKW  306



>ref|XP_008221002.1| PREDICTED: inositol oxygenase 1-like isoform X2 [Prunus mume]
Length=331

 Score =   240 bits (613),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHK+FK+NPD NN  YNTK G+Y EGCGLD VLMSWGHDDYMYLVAKEN +TLPSA
Sbjct  199  ESTVHHKHFKKNPDYNNPAYNTKYGIYSEGCGLDNVLMSWGHDDYMYLVAKENKSTLPSA  258

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFI+RYHSFYALHR GAY HLMNEED EN+KWLKIFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  259  GLFIVRYHSFYALHRAGAYKHLMNEEDIENLKWLKIFNKYDLYSKSKVRIDVEKVKPYYL  318

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  319  SLIEKYFPAKLRW  331



>ref|XP_009590754.1| PREDICTED: inositol oxygenase 1-like [Nicotiana tomentosiformis]
Length=304

 Score =   239 bits (611),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +SIVH KYFKENPD NN  YN+K GVY EGCGLDKV+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  172  DSIVHSKYFKENPDYNNPAYNSKYGVYSEGCGLDKVMMSWGHDDYMYLVAKENETTLPSA  231

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALHR GAY HLMNEEDKEN+KWL IFNKYDLYSKSKV +DVEEVKPYY+
Sbjct  232  GLFIIRYHSFYALHRSGAYKHLMNEEDKENLKWLHIFNKYDLYSKSKVLVDVEEVKPYYM  291

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  292  SLIEKYFPAKLKW  304



>ref|XP_009351657.1| PREDICTED: inositol oxygenase 1-like [Pyrus x bretschneideri]
Length=306

 Score =   239 bits (611),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHK+FKENPD NN  YNTK G+Y EGCGLD VLMSWGHDDYMYLVAKEN +TLPSA
Sbjct  174  ESIVHHKHFKENPDYNNPAYNTKYGIYSEGCGLDNVLMSWGHDDYMYLVAKENKSTLPSA  233

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+ GAY HLMNEED EN+KWLK+FNKYDLYSKSKVRI VE+VKPYYL
Sbjct  234  GLFIIRYHSFYALHKAGAYKHLMNEEDIENLKWLKVFNKYDLYSKSKVRIGVEKVKPYYL  293

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  294  SLIEKYFPAKLRW  306



>ref|NP_001289646.1| inositol oxygenase [Eucalyptus grandis]
 gb|ACF04280.1| myo-inositol oxygenase [Eucalyptus grandis]
 gb|KCW79589.1| hypothetical protein EUGRSUZ_C00949 [Eucalyptus grandis]
Length=315

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYF+ NPD +N  YNTK G+Y EGCGLD V+++WGHDDYMYLVAKEN TTLP A
Sbjct  183  ESIVHHKYFEGNPDYHNPAYNTKCGIYSEGCGLDNVMITWGHDDYMYLVAKENKTTLPPA  242

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LHR GAYTHLMNE+DKE+MKWLKIFNKYDLYSKSKVRIDVEEVKPYY+
Sbjct  243  ALFIIRYHSFYPLHRCGAYTHLMNEQDKESMKWLKIFNKYDLYSKSKVRIDVEEVKPYYM  302

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  303  SLIEKYFPAKLRW  315



>ref|XP_008387454.1| PREDICTED: inositol oxygenase 4-like [Malus domestica]
Length=332

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 123/133 (92%), Gaps = 1/133 (1%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN  YNTKNG+Y +GCGLD V++SWGHDDYMYLVAKENGTTLP A
Sbjct  201  ESIVHHKYFKENPDYNNPSYNTKNGIYSKGCGLDNVMISWGHDDYMYLVAKENGTTLPQA  260

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LHR GAYTHLMN+ED+EN+KWL++F KYDLYSKSKVR+DVE+VKPYYL
Sbjct  261  GLFIIRYHSFYPLHRAGAYTHLMNKEDEENLKWLQVF-KYDLYSKSKVRVDVEKVKPYYL  319

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  320  SLIEKYFPAKLRW  332



>gb|KHN39268.1| Inositol oxygenase 1 [Glycine soja]
Length=306

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN  YNTK G+Y E CGL+ V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  174  ESIVHHKYFKENPDYNNPAYNTKYGIYSERCGLNNVMMSWGHDDYMYLVAKENSTTLPSA  233

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALHREGAY HL+N+ED EN+KWL IFNKYDLYSKSKVRIDVE VKPYYL
Sbjct  234  ALFIIRYHSFYALHREGAYKHLLNDEDVENLKWLHIFNKYDLYSKSKVRIDVERVKPYYL  293

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  294  SLIEKYFPAKLKW  306



>ref|XP_008340501.1| PREDICTED: inositol oxygenase 1 [Malus domestica]
Length=306

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHK+FKENPD NN  YNTK G+Y EGCGLD VLMSWGHDDYMYLVAKEN +TLPSA
Sbjct  174  ESIVHHKHFKENPDYNNPAYNTKYGIYSEGCGLDNVLMSWGHDDYMYLVAKENKSTLPSA  233

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+ GAY HLMNEED EN+KWLK+FNKYDLYSKSKVRIDVE+VK YYL
Sbjct  234  GLFIIRYHSFYALHKAGAYKHLMNEEDIENLKWLKVFNKYDLYSKSKVRIDVEKVKAYYL  293

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  294  SLIEKYFPAKLRW  306



>ref|XP_007039459.1| Myo-inositol oxygenase 5 isoform 5 [Theobroma cacao]
 gb|EOY23960.1| Myo-inositol oxygenase 5 isoform 5 [Theobroma cacao]
Length=229

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +S VHHKYFKENPD NN  YNTKNGVY EGCGLD VLMSWGHDDYMY+VAKENGTTLPSA
Sbjct  97   DSNVHHKYFKENPDFNNPNYNTKNGVYSEGCGLDNVLMSWGHDDYMYMVAKENGTTLPSA  156

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH+ GAYT LMNEEDKENMKWLKIFNKYDLYSKSKV +DVEEVKPYY 
Sbjct  157  GSFIIRYHSFYPLHKHGAYTQLMNEEDKENMKWLKIFNKYDLYSKSKVLVDVEEVKPYYE  216

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL W
Sbjct  217  SLIAKYFPAKLNW  229



>gb|KEH18252.1| myo-inositol oxygenase [Medicago truncatula]
Length=305

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN+ YNT+ G+Y E CGL+ V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  173  ESIVHHKYFKENPDYNNSAYNTRYGIYSEKCGLNNVMMSWGHDDYMYLVAKENKTTLPSA  232

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            A+FIIRYHSFYALHREGAY HLMN+ED EN+KWL IFNKYDLYSKSKVR+DVE+VKPYY+
Sbjct  233  AMFIIRYHSFYALHREGAYKHLMNDEDVENLKWLHIFNKYDLYSKSKVRVDVEKVKPYYI  292

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  293  SLIEKYFPAKLKW  305



>ref|XP_010915343.1| PREDICTED: probable inositol oxygenase [Elaeis guineensis]
Length=305

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E  VHHKYFKENP+ +N +Y+TK GVY EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  173  ECNVHHKYFKENPEYSNPIYSTKLGVYSEGCGLDNVLMSWGHDDYMYLVAKENKTTLPSA  232

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LHR GAY HLMN+EDKENMKWL IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  233  ALFIIRYHSFYPLHRHGAYQHLMNDEDKENMKWLHIFNKYDLYSKSKVRIDVEKVKPYYL  292

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  293  SLIEKYFPAKLKW  305



>gb|ACU18263.1| unknown [Glycine max]
Length=335

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN  YNTK G+Y E CGL+ V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  174  ESIVHHKYFKENPDYNNPAYNTKYGIYSERCGLNNVMMSWGHDDYMYLVAKENSTTLPSA  233

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALHREGAY HL+N+ED EN+KWL IFNKYDLYSKSKVRIDVE VKPYYL
Sbjct  234  ALFIIRYHSFYALHREGAYKHLLNDEDVENLKWLHIFNKYDLYSKSKVRIDVERVKPYYL  293

Query  362  SLIEKYFPAKLRW  400
            SL+EKYFPAKL+W
Sbjct  294  SLVEKYFPAKLKW  306



>ref|XP_007039455.1| Myo-inositol oxygenase 4 isoform 1 [Theobroma cacao]
 gb|EOY23956.1| Myo-inositol oxygenase 4 isoform 1 [Theobroma cacao]
Length=306

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +S VHHKYFKENPD NN  YNTKNGVY EGCGLD VLMSWGHDDYMY+VAKENGTTLPSA
Sbjct  174  DSNVHHKYFKENPDFNNPNYNTKNGVYSEGCGLDNVLMSWGHDDYMYMVAKENGTTLPSA  233

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH+ GAYT LMNEEDKENMKWLKIFNKYDLYSKSKV +DVEEVKPYY 
Sbjct  234  GSFIIRYHSFYPLHKHGAYTQLMNEEDKENMKWLKIFNKYDLYSKSKVLVDVEEVKPYYE  293

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL W
Sbjct  294  SLIAKYFPAKLNW  306



>ref|XP_007039456.1| Myo-inositol oxygenase 4 isoform 2 [Theobroma cacao]
 gb|EOY23957.1| Myo-inositol oxygenase 4 isoform 2 [Theobroma cacao]
Length=320

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +S VHHKYFKENPD NN  YNTKNGVY EGCGLD VLMSWGHDDYMY+VAKENGTTLPSA
Sbjct  188  DSNVHHKYFKENPDFNNPNYNTKNGVYSEGCGLDNVLMSWGHDDYMYMVAKENGTTLPSA  247

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH+ GAYT LMNEEDKENMKWLKIFNKYDLYSKSKV +DVEEVKPYY 
Sbjct  248  GSFIIRYHSFYPLHKHGAYTQLMNEEDKENMKWLKIFNKYDLYSKSKVLVDVEEVKPYYE  307

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL W
Sbjct  308  SLIAKYFPAKLNW  320



>ref|XP_010688397.1| PREDICTED: inositol oxygenase 4 [Beta vulgaris subsp. vulgaris]
Length=318

 Score =   238 bits (607),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFK+NPD  N+ YNTK+G+Y EGCGL+ VL+SWGHDDYMYLVAKENGTTLP A
Sbjct  186  ESIVHHKYFKQNPDHYNSAYNTKSGIYSEGCGLENVLISWGHDDYMYLVAKENGTTLPPA  245

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFI+R+HSFYALHR GAY HL+NEEDKEN+KWL +FNKYDLYSKSKVR+DVE+VKPYY+
Sbjct  246  ALFIVRFHSFYALHRSGAYMHLLNEEDKENLKWLHVFNKYDLYSKSKVRVDVEKVKPYYI  305

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP+KLRW
Sbjct  306  SLINKYFPSKLRW  318



>gb|KHN05317.1| Inositol oxygenase 1, partial [Glycine soja]
Length=257

 Score =   236 bits (601),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN  YNTK G+Y E CGL+ V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  125  ESIVHHKYFKENPDYNNPAYNTKYGIYSERCGLNNVMMSWGHDDYMYLVAKENDTTLPSA  184

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALH+EGAY HLMN+ED EN+KWL IFNKYDLYSKSK+RIDVE V+PYYL
Sbjct  185  ALFIIRYHSFYALHKEGAYKHLMNDEDFENLKWLHIFNKYDLYSKSKIRIDVERVRPYYL  244

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  245  SLIEKYFPAKLKW  257



>gb|AFK49356.1| unknown [Medicago truncatula]
Length=305

 Score =   237 bits (605),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN+ YNT+ G+Y E CGL+ V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  173  ESIVHHKYFKENPDYNNSAYNTRYGIYSEKCGLNNVMMSWGHDDYMYLVAKENKTTLPSA  232

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            A+FIIRYHSFYALHREGAY HLMN+ED EN+KWL IFNKYDLYSKSKVR+DVE+VKPYY+
Sbjct  233  AMFIIRYHSFYALHREGAYKHLMNDEDVENLKWLHIFNKYDLYSKSKVRVDVEKVKPYYI  292

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL W
Sbjct  293  SLIEKYFPAKLEW  305



>ref|XP_002515913.1| myoinositol oxygenase, putative [Ricinus communis]
 gb|EEF46333.1| myoinositol oxygenase, putative [Ricinus communis]
Length=229

 Score =   234 bits (598),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN  YN K G Y EGCGL+ V+MSWGHDDYMYLVAK N TTLPSA
Sbjct  97   ESIVHHKYFKENPDYNNPAYNNKYGAYSEGCGLNNVMMSWGHDDYMYLVAKRNKTTLPSA  156

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALHR GAY HLM+EED EN+KWL+IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  157  ALFIIRYHSFYALHRSGAYKHLMHEEDIENLKWLEIFNKYDLYSKSKVRIDVEKVKPYYL  216

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  217  SLIEKYFPAKLKW  229



>ref|XP_007012956.1| Myo-inositol oxygenase 2 isoform 2 [Theobroma cacao]
 gb|EOY30575.1| Myo-inositol oxygenase 2 isoform 2 [Theobroma cacao]
Length=229

 Score =   234 bits (598),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E+ +HHKYFKENPDCNN  YNTKNG+Y +GCGLD V +SWGHDDYMYLVAKENGTTLPSA
Sbjct  97   EANIHHKYFKENPDCNNPAYNTKNGIYSDGCGLDNVTISWGHDDYMYLVAKENGTTLPSA  156

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHS Y LH+E AY HL+N+EDKEN+KWL+IFNKYDLYSKSKV +DVE+VKPYYL
Sbjct  157  GLFIIRYHSLYPLHKEEAYMHLLNDEDKENLKWLRIFNKYDLYSKSKVLVDVEKVKPYYL  216

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP+KL+W
Sbjct  217  SLIEKYFPSKLKW  229



>ref|XP_006470903.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Citrus sinensis]
Length=294

 Score =   236 bits (603),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN  +N K G Y EGCGLD V MSWGHDDYMYLVAKEN TTLPSA
Sbjct  162  ESIVHHKYFKENPDYNNPAFNAKYGAYSEGCGLDNVFMSWGHDDYMYLVAKENKTTLPSA  221

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALHR  AY HLMNEED EN+KWLKIFNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  222  GLFIIRYHSFYALHRADAYKHLMNEEDIENLKWLKIFNKYDLYSKSKVRVDVEKVKPYYL  281

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP KLRW
Sbjct  282  SLIEKYFPEKLRW  294



>ref|XP_011072454.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Sesamum indicum]
Length=303

 Score =   236 bits (603),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYF+ENPD NN  YNTK GVY+ GCGLD VLMSWGHDDYMYLVAKEN +TLPSA
Sbjct  171  ESIVHHKYFEENPDYNNPAYNTKFGVYKAGCGLDNVLMSWGHDDYMYLVAKENKSTLPSA  230

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LF+IRYHSFYALHR GAY +LMNEED+EN+KWLKIFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  231  GLFVIRYHSFYALHRTGAYKYLMNEEDEENIKWLKIFNKYDLYSKSKVRIDVEKVKPYYL  290

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP KLRW
Sbjct  291  SLIHKYFPEKLRW  303



>ref|XP_011072455.1| PREDICTED: inositol oxygenase 1-like isoform X2 [Sesamum indicum]
Length=302

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYF+ENPD NN  YNTK GVY+ GCGLD VLMSWGHDDYMYLVAKEN +TLPSA
Sbjct  170  ESIVHHKYFEENPDYNNPAYNTKFGVYKAGCGLDNVLMSWGHDDYMYLVAKENKSTLPSA  229

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LF+IRYHSFYALHR GAY +LMNEED+EN+KWLKIFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  230  GLFVIRYHSFYALHRTGAYKYLMNEEDEENIKWLKIFNKYDLYSKSKVRIDVEKVKPYYL  289

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP KLRW
Sbjct  290  SLIHKYFPEKLRW  302



>emb|CDY66453.1| BnaAnng22250D [Brassica napus]
Length=306

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN  Y+TK G+Y EGCGLD V MSWGHDDYMYLVAKEN TTLPSA
Sbjct  174  ESIVHHKYFKENPDFNNPSYSTKYGIYNEGCGLDNVFMSWGHDDYMYLVAKENKTTLPSA  233

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY HLMN+ED+ENMKWLK+FNKYDLYSKSKVRI+VEEVKPYYL
Sbjct  234  GLFIIRYHSFYALHKSEAYKHLMNDEDRENMKWLKVFNKYDLYSKSKVRINVEEVKPYYL  293

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL+W
Sbjct  294  SLINKYFPAKLKW  306



>gb|EYU21436.1| hypothetical protein MIMGU_mgv1a010728mg [Erythranthe guttata]
Length=229

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYF ENPD +N  YNTK GVYE+GCGLDKV MSWGHDDYMYLVAKEN +TLPSA
Sbjct  97   ESIVHHKYFNENPDYSNHAYNTKLGVYEKGCGLDKVSMSWGHDDYMYLVAKENKSTLPSA  156

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+ GAY HLMNEED+EN+KWL +FNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  157  GLFIIRYHSFYALHKSGAYKHLMNEEDEENLKWLHVFNKYDLYSKSKVRVDVEKVKPYYL  216

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP KLRW
Sbjct  217  SLIQKYFPEKLRW  229



>ref|XP_003630676.1| Inositol oxygenase [Medicago truncatula]
 gb|AET05152.1| myo-inositol oxygenase [Medicago truncatula]
Length=316

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYFKENPD  +  YNTKNG+Y EGCGLD V+MSWGHDDYM +VAKENG+TLP+A
Sbjct  184  ESNVHHKYFKENPDIKSPAYNTKNGIYNEGCGLDNVMMSWGHDDYMTMVAKENGSTLPNA  243

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+EGAYTHLMNEED EN+KWL IFNKYDLYSKSKV +DVEEV+PYYL
Sbjct  244  GLFIIRYHSFYPLHKEGAYTHLMNEEDFENLKWLHIFNKYDLYSKSKVLVDVEEVRPYYL  303

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  304  SLIEKYFPAKLRW  316



>ref|XP_007012955.1| Myo-inositol oxygenase 2 isoform 1 [Theobroma cacao]
 gb|EOY30574.1| Myo-inositol oxygenase 2 isoform 1 [Theobroma cacao]
Length=315

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E+ +HHKYFKENPDCNN  YNTKNG+Y +GCGLD V +SWGHDDYMYLVAKENGTTLPSA
Sbjct  183  EANIHHKYFKENPDCNNPAYNTKNGIYSDGCGLDNVTISWGHDDYMYLVAKENGTTLPSA  242

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHS Y LH+E AY HL+N+EDKEN+KWL+IFNKYDLYSKSKV +DVE+VKPYYL
Sbjct  243  GLFIIRYHSLYPLHKEEAYMHLLNDEDKENLKWLRIFNKYDLYSKSKVLVDVEKVKPYYL  302

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP+KL+W
Sbjct  303  SLIEKYFPSKLKW  315



>ref|XP_008242455.1| PREDICTED: inositol oxygenase 1-like [Prunus mume]
Length=333

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYF+ENPD NN  +NT  G+Y EGCGLD V++SWGHDDYMYLVAKENGTTLP A
Sbjct  201  ESIVHHKYFEENPDYNNASFNTMYGIYSEGCGLDNVMVSWGHDDYMYLVAKENGTTLPQA  260

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LHR GAY HLMN+ED++N+KWL++FNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  261  GLFIIRYHSFYPLHRAGAYRHLMNKEDEDNLKWLQVFNKYDLYSKSKVRVDVEKVKPYYL  320

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  321  SLIEKYFPAKLRW  333



>gb|ACJ84274.1| unknown [Medicago truncatula]
 gb|AFK39420.1| unknown [Medicago truncatula]
 gb|AFK41680.1| unknown [Medicago truncatula]
Length=316

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYFKENPD  +  YNTKNG+Y EGCGLD V+MSWGHDDYM +VAKENG+TLP+A
Sbjct  184  ESNVHHKYFKENPDIKSPAYNTKNGIYNEGCGLDNVMMSWGHDDYMTMVAKENGSTLPNA  243

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+EGAYTHLMNEED EN+KWL IFNKYDLYSKSKV +DVEEV+PYYL
Sbjct  244  GLFIIRYHSFYPLHKEGAYTHLMNEEDFENLKWLHIFNKYDLYSKSKVLVDVEEVRPYYL  303

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  304  SLIEKYFPAKLRW  316



>ref|XP_010267091.1| PREDICTED: probable inositol oxygenase [Nelumbo nucifera]
Length=305

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VH+KYFK+NPD NN  YNTK GVY EGCGLD V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  173  ESNVHYKYFKDNPDYNNPAYNTKYGVYSEGCGLDNVMMSWGHDDYMYLVAKENKTTLPSA  232

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LHR  AY HLMNEED EN+KWLKIFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  233  ALFIIRYHSFYPLHRCDAYKHLMNEEDVENLKWLKIFNKYDLYSKSKVRIDVEKVKPYYL  292

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  293  SLIEKYFPAKLRW  305



>gb|AFK34985.1| unknown [Lotus japonicus]
Length=305

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESI+HHK+FKENPD NN  YNT+ G+Y E CGL+ VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  173  ESIIHHKHFKENPDYNNPAYNTRYGMYSEKCGLNNVLMSWGHDDYMYLVAKENKTTLPSA  232

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALHREGAY HLMNEED EN++WL IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  233  ALFIIRYHSFYALHREGAYKHLMNEEDFENLEWLHIFNKYDLYSKSKVRIDVEKVKPYYL  292

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  293  SLIEKYFPAKLKW  305



>ref|XP_009352587.1| PREDICTED: inositol oxygenase 2 [Pyrus x bretschneideri]
Length=333

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKEN D NN  YNTKNG+Y EGCGLD V++SWGHDDYMYLVAKEN  TLP A
Sbjct  201  ESIVHHKYFKENLDYNNPSYNTKNGIYSEGCGLDNVMISWGHDDYMYLVAKENRATLPKA  260

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LHR GAY HLMN+ED+EN+KWL++FNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  261  GLFIIRYHSFYPLHRAGAYRHLMNKEDEENLKWLQVFNKYDLYSKSKVRVDVEKVKPYYL  320

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  321  SLIEKYFPAKLRW  333



>ref|XP_007024365.1| Myo-inositol oxygenase 1 isoform 5 [Theobroma cacao]
 gb|EOY26987.1| Myo-inositol oxygenase 1 isoform 5 [Theobroma cacao]
Length=229

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ++IVHHKYF+ENPD  N+ YNTK+GVY EGCGL+ V+MSWGHDDYMYLVAKEN TTLP A
Sbjct  97   KTIVHHKYFEENPDFYNSAYNTKHGVYSEGCGLNNVMMSWGHDDYMYLVAKENNTTLPPA  156

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALHR  AY HLM+EED EN+KWL+IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  157  ALFIIRYHSFYALHRSEAYKHLMSEEDVENLKWLQIFNKYDLYSKSKVRIDVEKVKPYYL  216

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  217  SLIEKYFPAKLRW  229



>ref|XP_002283119.1| PREDICTED: probable inositol oxygenase [Vitis vinifera]
 emb|CBI27969.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E+ VHHKYFKENPD NN  Y+TKNG+Y EGCGLD V++SWGHDDYMYLVAKEN +TLP A
Sbjct  177  EANVHHKYFKENPDYNNPHYSTKNGIYSEGCGLDNVMISWGHDDYMYLVAKENKSTLPPA  236

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LHR GAY HLMNEED EN+KWL IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  237  ALFIIRYHSFYPLHRHGAYKHLMNEEDVENLKWLHIFNKYDLYSKSKVRIDVEKVKPYYL  296

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  297  SLIEKYFPAKLRW  309



>gb|KFK43696.1| hypothetical protein AALP_AA1G161300 [Arabis alpina]
Length=307

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN  YN+K G+Y EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  175  ESIVHHKYFKENPDYNNPSYNSKYGMYTEGCGLDNVLMSWGHDDYMYLVAKENQTTLPSA  234

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY HLMN+EDKENM+WLK+FNKYDLYSKSKVRI+VEEVKPYYL
Sbjct  235  GLFIIRYHSFYALHKSEAYKHLMNDEDKENMEWLKVFNKYDLYSKSKVRINVEEVKPYYL  294

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP KL+W
Sbjct  295  SLINKYFPVKLKW  307



>gb|KFK43697.1| hypothetical protein AALP_AA1G161300 [Arabis alpina]
Length=305

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN  YN+K G+Y EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  173  ESIVHHKYFKENPDYNNPSYNSKYGMYTEGCGLDNVLMSWGHDDYMYLVAKENQTTLPSA  232

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY HLMN+EDKENM+WLK+FNKYDLYSKSKVRI+VEEVKPYYL
Sbjct  233  GLFIIRYHSFYALHKSEAYKHLMNDEDKENMEWLKVFNKYDLYSKSKVRINVEEVKPYYL  292

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP KL+W
Sbjct  293  SLINKYFPVKLKW  305



>gb|EYU21435.1| hypothetical protein MIMGU_mgv1a010728mg [Erythranthe guttata]
Length=304

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYF ENPD +N  YNTK GVYE+GCGLDKV MSWGHDDYMYLVAKEN +TLPSA
Sbjct  172  ESIVHHKYFNENPDYSNHAYNTKLGVYEKGCGLDKVSMSWGHDDYMYLVAKENKSTLPSA  231

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+ GAY HLMNEED+EN+KWL +FNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  232  GLFIIRYHSFYALHKSGAYKHLMNEEDEENLKWLHVFNKYDLYSKSKVRVDVEKVKPYYL  291

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP KLRW
Sbjct  292  SLIQKYFPEKLRW  304



>ref|XP_006420666.1| hypothetical protein CICLE_v10005543mg [Citrus clementina]
 gb|ESR33906.1| hypothetical protein CICLE_v10005543mg [Citrus clementina]
Length=294

 Score =   234 bits (598),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN  +NTK G Y EG GLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  162  ESIVHHKYFKENPDYNNPAFNTKYGAYSEGRGLDNVLMSWGHDDYMYLVAKENKTTLPSA  221

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALHR  AY HLMNEED EN+KWLKIFNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  222  GLFIIRYHSFYALHRADAYKHLMNEEDIENLKWLKIFNKYDLYSKSKVRVDVEKVKPYYL  281

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP KLRW
Sbjct  282  SLIEKYFPEKLRW  294



>ref|XP_007024362.1| Myo-inositol oxygenase 1 isoform 2 [Theobroma cacao]
 gb|EOY26984.1| Myo-inositol oxygenase 1 isoform 2 [Theobroma cacao]
Length=286

 Score =   234 bits (596),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ++IVHHKYF+ENPD  N+ YNTK+GVY EGCGL+ V+MSWGHDDYMYLVAKEN TTLP A
Sbjct  154  KTIVHHKYFEENPDFYNSAYNTKHGVYSEGCGLNNVMMSWGHDDYMYLVAKENNTTLPPA  213

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALHR  AY HLM+EED EN+KWL+IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  214  ALFIIRYHSFYALHRSEAYKHLMSEEDVENLKWLQIFNKYDLYSKSKVRIDVEKVKPYYL  273

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  274  SLIEKYFPAKLRW  286



>ref|XP_010244380.1| PREDICTED: probable inositol oxygenase [Nelumbo nucifera]
Length=308

 Score =   234 bits (598),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYFK+NPD NN  YNTK G+Y +GCGLD V+MSWGHDDYMYLVAKEN TTLP A
Sbjct  176  ESNVHHKYFKDNPDYNNPSYNTKYGIYSKGCGLDNVMMSWGHDDYMYLVAKENKTTLPPA  235

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LHR GAY HLMNEED EN+KWL IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  236  ALFIIRYHSFYPLHRCGAYRHLMNEEDVENLKWLHIFNKYDLYSKSKVRIDVEKVKPYYL  295

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  296  SLIEKYFPAKLRW  308



>gb|KFK40347.1| hypothetical protein AALP_AA3G362200 [Arabis alpina]
Length=317

 Score =   234 bits (598),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +2

Query  5    SIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAA  184
            S +HHKYFKENPD NN  YNTKNGVY EGCGLD VLMSWGHDDYMYLVAKENGTTLP A 
Sbjct  186  SNIHHKYFKENPDKNNPKYNTKNGVYREGCGLDNVLMSWGHDDYMYLVAKENGTTLPHAG  245

Query  185  LFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLS  364
            LFIIRYHSFY LH+ GAYTHLMN EDKE++KWL +FNKYDLYSKSKV +DVE+VKPYY+S
Sbjct  246  LFIIRYHSFYPLHKAGAYTHLMNNEDKEDLKWLHVFNKYDLYSKSKVHVDVEQVKPYYIS  305

Query  365  LIEKYFPAKLRW  400
            LI KYFPAKL+W
Sbjct  306  LINKYFPAKLKW  317



>ref|XP_007045580.1| Myo-inositol oxygenase 1 isoform 1 [Theobroma cacao]
 gb|EOY01412.1| Myo-inositol oxygenase 1 isoform 1 [Theobroma cacao]
Length=316

 Score =   234 bits (598),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYF ENPD  N +YNTK G+Y EGCGLD VLMSWGHDDYMYLVAKEN +TLPSA
Sbjct  184  ESIVHHKYFLENPDYKNPVYNTKYGLYSEGCGLDNVLMSWGHDDYMYLVAKENKSTLPSA  243

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALHR  AY HLMNEED EN+KWLKIFNKYDLYSKSKVRIDVEEVKPYYL
Sbjct  244  GLFIIRYHSFYALHRADAYKHLMNEEDIENLKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  303

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP KL+W
Sbjct  304  SLIKKYFPTKLKW  316



>ref|XP_007024361.1| Myo-inositol oxygenase 1 isoform 1 [Theobroma cacao]
 gb|EOY26983.1| Myo-inositol oxygenase 1 isoform 1 [Theobroma cacao]
Length=304

 Score =   234 bits (597),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ++IVHHKYF+ENPD  N+ YNTK+GVY EGCGL+ V+MSWGHDDYMYLVAKEN TTLP A
Sbjct  172  KTIVHHKYFEENPDFYNSAYNTKHGVYSEGCGLNNVMMSWGHDDYMYLVAKENNTTLPPA  231

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALHR  AY HLM+EED EN+KWL+IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  232  ALFIIRYHSFYALHRSEAYKHLMSEEDVENLKWLQIFNKYDLYSKSKVRIDVEKVKPYYL  291

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  292  SLIEKYFPAKLRW  304



>ref|XP_007045581.1| Myo-inositol oxygenase 1 isoform 2 [Theobroma cacao]
 gb|EOY01413.1| Myo-inositol oxygenase 1 isoform 2 [Theobroma cacao]
Length=317

 Score =   234 bits (598),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYF ENPD  N +YNTK G+Y EGCGLD VLMSWGHDDYMYLVAKEN +TLPSA
Sbjct  185  ESIVHHKYFLENPDYKNPVYNTKYGLYSEGCGLDNVLMSWGHDDYMYLVAKENKSTLPSA  244

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALHR  AY HLMNEED EN+KWLKIFNKYDLYSKSKVRIDVEEVKPYYL
Sbjct  245  GLFIIRYHSFYALHRADAYKHLMNEEDIENLKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  304

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP KL+W
Sbjct  305  SLIKKYFPTKLKW  317



>ref|XP_010527856.1| PREDICTED: inositol oxygenase 1 [Tarenaya hassleriana]
Length=309

 Score =   234 bits (597),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHK+FKENPD  N  YNTK G+Y E CGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  177  ESIVHHKHFKENPDYYNPAYNTKYGIYSESCGLDNVLMSWGHDDYMYLVAKENETTLPSA  236

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALHR GAY HLMN+ED+EN+KWL++FNKYDLYSKSKVRI+VEEVKPYYL
Sbjct  237  GLFIIRYHSFYALHRSGAYKHLMNDEDRENLKWLEVFNKYDLYSKSKVRINVEEVKPYYL  296

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL+W
Sbjct  297  SLINKYFPAKLKW  309



>ref|XP_010062560.1| PREDICTED: inositol oxygenase 1-like isoform X2 [Eucalyptus grandis]
 gb|KCW69697.1| hypothetical protein EUGRSUZ_F03092 [Eucalyptus grandis]
 gb|KCW69698.1| hypothetical protein EUGRSUZ_F03092 [Eucalyptus grandis]
Length=296

 Score =   234 bits (596),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD +N  YNTK GVY E CGL+ +LMSWGHDDYMYLVAKEN TTLPSA
Sbjct  164  ESIVHHKYFKENPDYHNPAYNTKYGVYSERCGLNNILMSWGHDDYMYLVAKENKTTLPSA  223

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY+LH+  AY HLMNEED EN+KWL+IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  224  ALFIIRYHSFYSLHKSEAYKHLMNEEDDENLKWLQIFNKYDLYSKSKVRIDVEKVKPYYL  283

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKLRW
Sbjct  284  SLIKKYFPAKLRW  296



>ref|XP_004301722.1| PREDICTED: inositol oxygenase 4-like [Fragaria vesca subsp. vesca]
Length=292

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFK+NPD  N  YNTKNG+Y EGCGL+ V++SWGHDDYMY+VAKENGTTLP A
Sbjct  160  ESIVHHKYFKDNPDSKNPAYNTKNGIYTEGCGLENVMISWGHDDYMYMVAKENGTTLPEA  219

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LF+IRYHSFY LH+EGAY HLMN++D+ENMKWL IFNKYDLYSKSKV++DV++VKPYYL
Sbjct  220  GLFVIRYHSFYPLHKEGAYKHLMNKQDEENMKWLHIFNKYDLYSKSKVQVDVDKVKPYYL  279

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL+W
Sbjct  280  SLINKYFPAKLKW  292



>ref|XP_010062558.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Eucalyptus grandis]
Length=304

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD +N  YNTK GVY E CGL+ +LMSWGHDDYMYLVAKEN TTLPSA
Sbjct  172  ESIVHHKYFKENPDYHNPAYNTKYGVYSERCGLNNILMSWGHDDYMYLVAKENKTTLPSA  231

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY+LH+  AY HLMNEED EN+KWL+IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  232  ALFIIRYHSFYSLHKSEAYKHLMNEEDDENLKWLQIFNKYDLYSKSKVRIDVEKVKPYYL  291

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKLRW
Sbjct  292  SLIKKYFPAKLRW  304



>ref|XP_004510326.1| PREDICTED: inositol oxygenase 1-like [Cicer arietinum]
Length=305

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVH+KYFKENPD  N+ YNT+ G+Y E CGL+ V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  173  ESIVHNKYFKENPDYYNSAYNTRYGIYSEKCGLNNVMMSWGHDDYMYLVAKENNTTLPSA  232

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALHREGAY HLMN+ED EN+KWL +FNK+DLYSKSKVR+DVEEVKPYYL
Sbjct  233  ALFIIRYHSFYALHREGAYKHLMNDEDVENLKWLHVFNKFDLYSKSKVRVDVEEVKPYYL  292

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  293  SLIEKYFPAKLKW  305



>ref|XP_008798609.1| PREDICTED: probable inositol oxygenase [Phoenix dactylifera]
Length=305

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E  VHHKYFKENPD +N  YNTK G Y EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  173  ECNVHHKYFKENPDYSNPKYNTKLGAYSEGCGLDNVLMSWGHDDYMYLVAKENKTTLPSA  232

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LHR GAY +LMN+EDKEN+KWL IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  233  ALFIIRYHSFYPLHRHGAYQYLMNDEDKENLKWLHIFNKYDLYSKSKVRIDVEKVKPYYL  292

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  293  SLIEKYFPAKLKW  305



>ref|XP_010098174.1| Inositol oxygenase 1 [Morus notabilis]
 gb|EXB74611.1| Inositol oxygenase 1 [Morus notabilis]
Length=336

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD  N  YNTK G Y  GCGL+ VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  204  ESIVHHKYFKENPDYENPAYNTKYGAYSPGCGLNNVLMSWGHDDYMYLVAKENNTTLPSA  263

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALH+ GAY HLMNEED EN+KWL+IFNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  264  ALFIIRYHSFYALHKSGAYKHLMNEEDFENLKWLQIFNKYDLYSKSKVRVDVEKVKPYYL  323

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKL W
Sbjct  324  SLIDKYFPAKLNW  336



>gb|KDO53719.1| hypothetical protein CISIN_1g021944mg [Citrus sinensis]
Length=262

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD +N  +NT+ GVY EGCGLD V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  130  ESIVHHKYFKENPDYSNPAFNTEYGVYSEGCGLDNVMMSWGHDDYMYLVAKENKTTLPSA  189

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALH+  AY HLMNEED EN+KWL+ F+KYDLYSKSKVRIDVE+VKPYYL
Sbjct  190  ALFIIRYHSFYALHKSEAYKHLMNEEDVENLKWLETFSKYDLYSKSKVRIDVEKVKPYYL  249

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  250  SLIEKYFPAKLKW  262



>gb|KHF98793.1| Inositol oxygenase 1 -like protein [Gossypium arboreum]
Length=304

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +SIVHHKYF+ENPD +N  YNTK GVY EGCGL+ V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  172  KSIVHHKYFEENPDYHNPAYNTKYGVYSEGCGLNNVMMSWGHDDYMYLVAKENNTTLPSA  231

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALHR G+Y  LMN ED EN+KWL++FNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  232  ALFIIRYHSFYALHRSGSYKQLMNGEDVENLKWLEVFNKYDLYSKSKVRIDVEKVKPYYL  291

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  292  SLIEKYFPAKLRW  304



>ref|XP_010924624.1| PREDICTED: inositol oxygenase 1-like [Elaeis guineensis]
Length=301

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHK+F+ENPD +N  YNTK+G+Y EGCGLD VLMSWGHD YM++VAKEN TTLPSA
Sbjct  169  ESNVHHKFFQENPDNDNPKYNTKHGIYSEGCGLDNVLMSWGHDGYMHMVAKENKTTLPSA  228

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LH+E AY HLMNEED+EN+KWLKIFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  229  ALFIIRYHSFYPLHKERAYKHLMNEEDEENLKWLKIFNKYDLYSKSKVRIDVEKVKPYYL  288

Query  362  SLIEKYFPAKLRW  400
            SL EKYFPAKLRW
Sbjct  289  SLTEKYFPAKLRW  301



>ref|XP_010540994.1| PREDICTED: inositol oxygenase 2 [Tarenaya hassleriana]
Length=316

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES +HHKYFKENPD  N  YNTKNGVY+EGCGLD V+MSWGHDDYMYLVAKENGTTLP A
Sbjct  184  ESNIHHKYFKENPDYYNAAYNTKNGVYKEGCGLDNVMMSWGHDDYMYLVAKENGTTLPHA  243

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LH+ GAYTHLMN+ED+E+ +WLK+FNKYDLYSKSKV +DVEEVKPYYL
Sbjct  244  ALFIIRYHSFYPLHKAGAYTHLMNDEDRESFEWLKVFNKYDLYSKSKVLVDVEEVKPYYL  303

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP KL+W
Sbjct  304  SLINKYFPEKLKW  316



>ref|XP_009148831.1| PREDICTED: inositol oxygenase 1 isoform X2 [Brassica rapa]
Length=306

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD N+  YNTK G+Y EGCGLD V MSWGHDDYMYLVAK+N TTLPSA
Sbjct  174  ESIVHHKYFKENPDFNSPSYNTKYGIYNEGCGLDNVFMSWGHDDYMYLVAKKNKTTLPSA  233

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY HLMN+ED+ENMKWLK+FNK+DLYSKSKVRI VEEVKPYYL
Sbjct  234  GLFIIRYHSFYALHKSEAYKHLMNDEDRENMKWLKVFNKFDLYSKSKVRIKVEEVKPYYL  293

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL+W
Sbjct  294  SLINKYFPAKLKW  306



>ref|XP_009148830.1| PREDICTED: inositol oxygenase 1 isoform X1 [Brassica rapa]
Length=308

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD N+  YNTK G+Y EGCGLD V MSWGHDDYMYLVAK+N TTLPSA
Sbjct  176  ESIVHHKYFKENPDFNSPSYNTKYGIYNEGCGLDNVFMSWGHDDYMYLVAKKNKTTLPSA  235

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY HLMN+ED+ENMKWLK+FNK+DLYSKSKVRI VEEVKPYYL
Sbjct  236  GLFIIRYHSFYALHKSEAYKHLMNDEDRENMKWLKVFNKFDLYSKSKVRIKVEEVKPYYL  295

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL+W
Sbjct  296  SLINKYFPAKLKW  308



>ref|XP_008244494.1| PREDICTED: inositol oxygenase 4-like [Prunus mume]
Length=282

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E+IVHHKYFKENPD NN  YN+K G+Y  GCGL+ V+MSWGHDDYMYLVAKENG+TLP A
Sbjct  150  EAIVHHKYFKENPDHNNPSYNSKYGIYSHGCGLENVMMSWGHDDYMYLVAKENGSTLPQA  209

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAY HLMN+ED+EN+KWL+IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  210  GLFIIRYHSFYPLHKSGAYEHLMNKEDEENLKWLQIFNKYDLYSKSKVRIDVEKVKPYYL  269

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP KLRW
Sbjct  270  SLIDKYFPEKLRW  282



>emb|CDO97955.1| unnamed protein product [Coffea canephora]
Length=305

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD  +  YNTK GVY EGCGLD VLMSWGHDDYMYLVA+ N TTLPSA
Sbjct  173  ESIVHHKYFKENPDYADPAYNTKCGVYSEGCGLDNVLMSWGHDDYMYLVARGNNTTLPSA  232

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIR+HSF+ALHR GAY HL NEED++N+KWL+IFNKYDLYSKSKVRID E VKPYYL
Sbjct  233  GLFIIRFHSFHALHRSGAYKHLTNEEDEQNLKWLQIFNKYDLYSKSKVRIDAERVKPYYL  292

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKLRW
Sbjct  293  SLIDKYFPAKLRW  305



>ref|XP_006305417.1| hypothetical protein CARUB_v10009817mg [Capsella rubella]
 gb|EOA38315.1| hypothetical protein CARUB_v10009817mg [Capsella rubella]
Length=311

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKEN D +N  YNTK G+Y EGCGLD V MSWGHDDYMYLVAKEN TTLPSA
Sbjct  179  ESIVHHKYFKENQDYDNPSYNTKYGIYTEGCGLDNVFMSWGHDDYMYLVAKENQTTLPSA  238

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            +LFIIRYHSFYALH+  AY HLMN+ED+ENMKWLK+FNKYDLYSKSKVR++VEEVKPYYL
Sbjct  239  SLFIIRYHSFYALHKSEAYKHLMNKEDRENMKWLKVFNKYDLYSKSKVRVNVEEVKPYYL  298

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL+W
Sbjct  299  SLINKYFPAKLKW  311



>ref|XP_007210179.1| hypothetical protein PRUPE_ppa020229mg [Prunus persica]
 ref|XP_007210788.1| hypothetical protein PRUPE_ppa018672mg [Prunus persica]
 gb|EMJ11378.1| hypothetical protein PRUPE_ppa020229mg [Prunus persica]
 gb|EMJ11987.1| hypothetical protein PRUPE_ppa018672mg [Prunus persica]
Length=282

 Score =   232 bits (591),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E+IVHHKYFKENPD NN  YN+K G+Y  GCGL+ V+MSWGHDDYMYLVAKENG+TLP A
Sbjct  150  EAIVHHKYFKENPDHNNPSYNSKYGIYSHGCGLENVMMSWGHDDYMYLVAKENGSTLPQA  209

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAY HLMN+ED+EN+KWL+IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  210  GLFIIRYHSFYPLHKSGAYEHLMNKEDEENLKWLQIFNKYDLYSKSKVRIDVEKVKPYYL  269

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP KLRW
Sbjct  270  SLIDKYFPEKLRW  282



>ref|NP_172904.2| inositol oxygenase 1 [Arabidopsis thaliana]
 sp|Q8L799.1|MIOX1_ARATH RecName: Full=Inositol oxygenase 1; AltName: Full=Myo-inositol 
oxygenase 1; Short=AtMIOX1; Short=MI oxygenase 1 [Arabidopsis 
thaliana]
 gb|AAM97054.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15506.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD42878.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44453.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29174.1| inositol oxygenase 1 [Arabidopsis thaliana]
Length=311

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD +N  YN+K G+Y EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  179  ESIVHHKYFKENPDYDNPSYNSKYGIYTEGCGLDNVLMSWGHDDYMYLVAKENQTTLPSA  238

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY HLMN ED+ENMKWLK+FNKYDLYSKSKVR++VEEVKPYYL
Sbjct  239  GLFIIRYHSFYALHKSEAYKHLMNNEDRENMKWLKVFNKYDLYSKSKVRVNVEEVKPYYL  298

Query  362  SLIEKYFPAKLRW  400
            SL  KYFP+KL+W
Sbjct  299  SLTNKYFPSKLKW  311



>ref|XP_006465721.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Citrus sinensis]
 gb|KDO53718.1| hypothetical protein CISIN_1g021944mg [Citrus sinensis]
Length=304

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD +N  +NT+ GVY EGCGLD V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  172  ESIVHHKYFKENPDYSNPAFNTEYGVYSEGCGLDNVMMSWGHDDYMYLVAKENKTTLPSA  231

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALH+  AY HLMNEED EN+KWL+ F+KYDLYSKSKVRIDVE+VKPYYL
Sbjct  232  ALFIIRYHSFYALHKSEAYKHLMNEEDVENLKWLETFSKYDLYSKSKVRIDVEKVKPYYL  291

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  292  SLIEKYFPAKLKW  304



>dbj|BAF01953.1| hypothetical protein [Arabidopsis thaliana]
Length=294

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD +N  YN+K G+Y EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  162  ESIVHHKYFKENPDYDNPSYNSKYGIYTEGCGLDNVLMSWGHDDYMYLVAKENQTTLPSA  221

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY HLMN ED+ENMKWLK+FNKYDLYSKSKVR++VEEVKPYYL
Sbjct  222  GLFIIRYHSFYALHKSEAYKHLMNNEDRENMKWLKVFNKYDLYSKSKVRVNVEEVKPYYL  281

Query  362  SLIEKYFPAKLRW  400
            SL  KYFP+KL+W
Sbjct  282  SLTNKYFPSKLKW  294



>ref|XP_006408899.1| hypothetical protein EUTSA_v10002046mg [Eutrema salsugineum]
 gb|ESQ50352.1| hypothetical protein EUTSA_v10002046mg [Eutrema salsugineum]
Length=314

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            +HHKYFKENPD NNT Y+TKNGVY EGCGLD VLMSWGHDDYMYLVAKENG+TLP A LF
Sbjct  185  IHHKYFKENPDTNNTKYSTKNGVYSEGCGLDNVLMSWGHDDYMYLVAKENGSTLPHAGLF  244

Query  191  IIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLI  370
            IIRYHSFY LH+ G YTHLMN+EDKE++KWL +FNKYDLYSKSKV +DVE+VKPYY+SLI
Sbjct  245  IIRYHSFYPLHKAGTYTHLMNDEDKEDLKWLHVFNKYDLYSKSKVHVDVEQVKPYYISLI  304

Query  371  EKYFPAKLRW  400
             KYFP KLRW
Sbjct  305  NKYFPEKLRW  314



>ref|XP_010925498.1| PREDICTED: probable inositol oxygenase isoform X1 [Elaeis guineensis]
Length=301

 Score =   232 bits (592),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E  VHHKYFKENPD +N  YNTK G Y EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  169  ECNVHHKYFKENPDHSNPKYNTKLGAYSEGCGLDNVLMSWGHDDYMYLVAKENKTTLPSA  228

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LH+ GAY +LMN+EDKEN+KWL IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  229  ALFIIRYHSFYPLHKHGAYQYLMNDEDKENLKWLHIFNKYDLYSKSKVRIDVEKVKPYYL  288

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP KLRW
Sbjct  289  SLIEKYFPVKLRW  301



>dbj|BAC42925.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43581.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43596.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD94364.1| hypothetical protein [Arabidopsis thaliana]
Length=311

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD +N  YN+K G+Y EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  179  ESIVHHKYFKENPDYDNPSYNSKYGIYTEGCGLDNVLMSWGHDDYMYLVAKENQTTLPSA  238

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY HLMN ED+ENMKWLK+FNKYDLYSKSKVR++VEEVKPYYL
Sbjct  239  GLFIIRYHSFYALHKSEAYKHLMNNEDRENMKWLKVFNKYDLYSKSKVRVNVEEVKPYYL  298

Query  362  SLIEKYFPAKLRW  400
            SL  KYFP+KL+W
Sbjct  299  SLTNKYFPSKLKW  311



>ref|XP_006583567.1| PREDICTED: inositol oxygenase 2-like isoform X2 [Glycine max]
Length=296

 Score =   232 bits (592),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHK+FK+NPD  N  YNTKNG+Y+EG GLD V+MSWGHD+YMYLVAKENGTTLP  
Sbjct  164  ESNVHHKHFKDNPDNTNPTYNTKNGIYKEGIGLDNVVMSWGHDEYMYLVAKENGTTLPPV  223

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFII+YHSFYALHR GAYTHLMNEED EN+KWLKIF+KYDLYSKSKV +D+E+VKPYY+
Sbjct  224  ALFIIKYHSFYALHRAGAYTHLMNEEDIENLKWLKIFSKYDLYSKSKVLVDIEKVKPYYM  283

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  284  SLIEKYFPAKLRW  296



>ref|NP_001154337.1| inositol oxygenase 1 [Arabidopsis thaliana]
 gb|AEE29175.1| inositol oxygenase 1 [Arabidopsis thaliana]
Length=309

 Score =   232 bits (592),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD +N  YN+K G+Y EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  177  ESIVHHKYFKENPDYDNPSYNSKYGIYTEGCGLDNVLMSWGHDDYMYLVAKENQTTLPSA  236

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY HLMN ED+ENMKWLK+FNKYDLYSKSKVR++VEEVKPYYL
Sbjct  237  GLFIIRYHSFYALHKSEAYKHLMNNEDRENMKWLKVFNKYDLYSKSKVRVNVEEVKPYYL  296

Query  362  SLIEKYFPAKLRW  400
            SL  KYFP+KL+W
Sbjct  297  SLTNKYFPSKLKW  309



>ref|XP_010458951.1| PREDICTED: inositol oxygenase 1 isoform X1 [Camelina sativa]
Length=312

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKEN D +N  YNTK G+Y EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  180  ESIVHHKYFKENQDYDNPSYNTKYGIYTEGCGLDNVLMSWGHDDYMYLVAKENQTTLPSA  239

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY HLMN+ED ENMKWLK+FNKYDLYSKSKVR++V+EVKPYYL
Sbjct  240  GLFIIRYHSFYALHKSEAYKHLMNDEDTENMKWLKVFNKYDLYSKSKVRVNVDEVKPYYL  299

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL+W
Sbjct  300  SLINKYFPAKLKW  312



>ref|XP_010458952.1| PREDICTED: inositol oxygenase 1 isoform X2 [Camelina sativa]
Length=310

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKEN D +N  YNTK G+Y EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  178  ESIVHHKYFKENQDYDNPSYNTKYGIYTEGCGLDNVLMSWGHDDYMYLVAKENQTTLPSA  237

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY HLMN+ED ENMKWLK+FNKYDLYSKSKVR++V+EVKPYYL
Sbjct  238  GLFIIRYHSFYALHKSEAYKHLMNDEDTENMKWLKVFNKYDLYSKSKVRVNVDEVKPYYL  297

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL+W
Sbjct  298  SLINKYFPAKLKW  310



>gb|KDO57808.1| hypothetical protein CISIN_1g046235mg [Citrus sinensis]
Length=294

 Score =   231 bits (590),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD NN  +N K G Y EG GLD V MSWGHDDYMYLVAKEN TTLPSA
Sbjct  162  ESIVHHKYFKENPDYNNPAFNAKYGAYSEGRGLDNVFMSWGHDDYMYLVAKENKTTLPSA  221

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALHR  AY HLMNEED EN+KWLKIFNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  222  GLFIIRYHSFYALHRADAYKHLMNEEDIENLKWLKIFNKYDLYSKSKVRVDVEKVKPYYL  281

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP KLRW
Sbjct  282  SLIEKYFPEKLRW  294



>ref|XP_006417002.1| hypothetical protein EUTSA_v10009301mg [Eutrema salsugineum]
 gb|ESQ35355.1| hypothetical protein EUTSA_v10009301mg [Eutrema salsugineum]
Length=311

 Score =   232 bits (591),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD +N  YNTK G+Y EGCGLD V MSWGHDDYMYLVAKEN TTLPSA
Sbjct  179  ESIVHHKYFKENPDYDNPSYNTKYGIYTEGCGLDNVFMSWGHDDYMYLVAKENETTLPSA  238

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            +LFIIRYHSFYALH+  AY HLMN ED+ENMKWLK+FNKYDLYSKSK RI+VEEVKPYYL
Sbjct  239  SLFIIRYHSFYALHKSEAYKHLMNNEDRENMKWLKVFNKYDLYSKSKFRINVEEVKPYYL  298

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP KL+W
Sbjct  299  SLINKYFPGKLKW  311



>ref|XP_003529067.1| PREDICTED: inositol oxygenase 2-like isoform X1 [Glycine max]
 gb|KHN40357.1| Inositol oxygenase 2 [Glycine soja]
Length=316

 Score =   232 bits (592),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHK+FK+NPD  N  YNTKNG+Y+EG GLD V+MSWGHD+YMYLVAKENGTTLP  
Sbjct  184  ESNVHHKHFKDNPDNTNPTYNTKNGIYKEGIGLDNVVMSWGHDEYMYLVAKENGTTLPPV  243

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFII+YHSFYALHR GAYTHLMNEED EN+KWLKIF+KYDLYSKSKV +D+E+VKPYY+
Sbjct  244  ALFIIKYHSFYALHRAGAYTHLMNEEDIENLKWLKIFSKYDLYSKSKVLVDIEKVKPYYM  303

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  304  SLIEKYFPAKLRW  316



>emb|CDO99934.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   231 bits (590),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHH++FK++PD NN  YNTK+GVY EGCGL+ VLMSWGHDDYMYLVAKEN TTLP A
Sbjct  164  ESIVHHEFFKDSPDYNNPAYNTKHGVYTEGCGLESVLMSWGHDDYMYLVAKENKTTLPPA  223

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALH+  AY HLMNEED EN+KWL+IFNKYDLYSKSKVRIDVE+VKPYY 
Sbjct  224  ALFIIRYHSFYALHKADAYKHLMNEEDVENLKWLQIFNKYDLYSKSKVRIDVEKVKPYYQ  283

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP+KL+W
Sbjct  284  SLIEKYFPSKLKW  296



>ref|XP_009112634.1| PREDICTED: inositol oxygenase 2-like [Brassica rapa]
Length=317

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            +HHKYFKENPD +N  YNTKNGVY EGCGLD VLMSWGHDDYMYLVAKENGTTLP A LF
Sbjct  188  IHHKYFKENPDNSNPKYNTKNGVYSEGCGLDNVLMSWGHDDYMYLVAKENGTTLPHAGLF  247

Query  191  IIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLI  370
            IIRYHSFY LH+ G YTHLM+EEDKE++KWL +FNKYDLYSKSKV++DVE+VKPYY+SLI
Sbjct  248  IIRYHSFYPLHKAGTYTHLMSEEDKEDLKWLHVFNKYDLYSKSKVQVDVEQVKPYYISLI  307

Query  371  EKYFPAKLRW  400
             KYFPAKL+W
Sbjct  308  NKYFPAKLKW  317



>emb|CDY48730.1| BnaA09g10050D [Brassica napus]
Length=317

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            +HHKYFKENPD +N  YNTKNGVY EGCGLD VLMSWGHDDYMYLVAKENGTTLP A LF
Sbjct  188  IHHKYFKENPDNSNPKYNTKNGVYSEGCGLDNVLMSWGHDDYMYLVAKENGTTLPHAGLF  247

Query  191  IIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLI  370
            IIRYHSFY LH+ G YTHLM+EEDKE++KWL +FNKYDLYSKSKV++DVE+VKPYY+SLI
Sbjct  248  IIRYHSFYPLHKAGTYTHLMSEEDKEDLKWLHVFNKYDLYSKSKVQVDVEQVKPYYISLI  307

Query  371  EKYFPAKLRW  400
             KYFPAKL+W
Sbjct  308  NKYFPAKLKW  317



>ref|XP_002892814.1| myo-inisitol oxygenase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69073.1| myo-inisitol oxygenase [Arabidopsis lyrata subsp. lyrata]
Length=311

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD +N  YNTK G+Y E CGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  179  ESIVHHKYFKENPDYDNLSYNTKYGIYTEDCGLDNVLMSWGHDDYMYLVAKENQTTLPSA  238

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY HLMN ED+ENM WLK+FNKYDLYSKSKVRI+VE+VKPYYL
Sbjct  239  GLFIIRYHSFYALHKSEAYKHLMNNEDRENMNWLKVFNKYDLYSKSKVRINVEDVKPYYL  298

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL+W
Sbjct  299  SLINKYFPAKLKW  311



>ref|XP_010496186.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Camelina sativa]
Length=312

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKEN D +N  YNTK G+Y EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  180  ESIVHHKYFKENQDYDNPSYNTKYGIYTEGCGLDNVLMSWGHDDYMYLVAKENQTTLPSA  239

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY +LMN+ED ENMKWLK+FNKYDLYSKSKVRI+VEEVKPYYL
Sbjct  240  GLFIIRYHSFYALHKSEAYKYLMNDEDTENMKWLKVFNKYDLYSKSKVRINVEEVKPYYL  299

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL+W
Sbjct  300  SLINKYFPAKLKW  312



>gb|KHM99828.1| Inositol oxygenase 4 [Glycine soja]
Length=312

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYFK+NPD     Y+TKNG+Y EGCGLD ++MSWGHDDYMY+VAK NGTTLPSA
Sbjct  180  ESNVHHKYFKDNPDYKCPAYSTKNGIYTEGCGLDNIVMSWGHDDYMYMVAKANGTTLPSA  239

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+EGAYTH MNEED EN+KWLKIFNKYDLYSKSKV +DVE+VKPYY+
Sbjct  240  GLFIIRYHSFYPLHKEGAYTHFMNEEDVENLKWLKIFNKYDLYSKSKVLVDVEKVKPYYV  299

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAK+RW
Sbjct  300  SLIEKYFPAKVRW  312



>ref|XP_010496191.1| PREDICTED: inositol oxygenase 1-like isoform X2 [Camelina sativa]
Length=310

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKEN D +N  YNTK G+Y EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  178  ESIVHHKYFKENQDYDNPSYNTKYGIYTEGCGLDNVLMSWGHDDYMYLVAKENQTTLPSA  237

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY +LMN+ED ENMKWLK+FNKYDLYSKSKVRI+VEEVKPYYL
Sbjct  238  GLFIIRYHSFYALHKSEAYKYLMNDEDTENMKWLKVFNKYDLYSKSKVRINVEEVKPYYL  297

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL+W
Sbjct  298  SLINKYFPAKLKW  310



>gb|KHG20649.1| Inositol oxygenase 5 [Gossypium arboreum]
Length=294

 Score =   231 bits (588),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYFKENPD NN  YNT+NGVY EGCGLD VLMSWGHDDYMY+VAKENGTTLPSA
Sbjct  162  ESNVHHKYFKENPDFNNPKYNTRNGVYIEGCGLDNVLMSWGHDDYMYMVAKENGTTLPSA  221

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFI+RYHSFY LH+ GAY+  MNEEDKEN KWLK+FNKYDLYSKSK+ +DVE+VKPYY 
Sbjct  222  GLFIVRYHSFYPLHKYGAYSQFMNEEDKENFKWLKVFNKYDLYSKSKLLVDVEKVKPYYE  281

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL+W
Sbjct  282  SLIAKYFPAKLKW  294



>ref|XP_010938965.1| PREDICTED: probable inositol oxygenase [Elaeis guineensis]
Length=303

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVH+K+ KENPDCNN  YNTK GVY EGCGLD ++MSWGHDDYMY+VAKEN TTLP A
Sbjct  171  ESIVHYKHLKENPDCNNPQYNTKFGVYAEGCGLDNLMMSWGHDDYMYMVAKENKTTLPPA  230

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LHR GAY + +N+ED+EN+KWL+IFNKYDLYSKSKVR+D E+VKPYYL
Sbjct  231  ALFIIRYHSFYPLHRSGAYKYFINKEDEENLKWLQIFNKYDLYSKSKVRVDAEKVKPYYL  290

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP KLRW
Sbjct  291  SLIEKYFPPKLRW  303



>ref|XP_004297776.1| PREDICTED: inositol oxygenase 1-like [Fragaria vesca subsp. vesca]
Length=305

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +2

Query  5    SIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAA  184
            SIVHHK+F+ NPD +N  YNT+ G+Y EGCGL+ VLMSWGHDDYMYLVAK N +TLPSA 
Sbjct  174  SIVHHKHFQGNPDYSNPAYNTEYGIYSEGCGLNNVLMSWGHDDYMYLVAKGNNSTLPSAG  233

Query  185  LFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLS  364
            LFIIRYHSFYALHR GAY HLMNEED EN+KWLK+FNKYDLYSKSKVRIDVE+VKPYYLS
Sbjct  234  LFIIRYHSFYALHRAGAYKHLMNEEDIENLKWLKVFNKYDLYSKSKVRIDVEKVKPYYLS  293

Query  365  LIEKYFPAKLRW  400
            LIEKYFPAKLRW
Sbjct  294  LIEKYFPAKLRW  305



>ref|XP_006426835.1| hypothetical protein CICLE_v10026154mg [Citrus clementina]
 gb|ESR40075.1| hypothetical protein CICLE_v10026154mg [Citrus clementina]
Length=229

 Score =   228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD +N  +NT+ GVY EGCGLD V+MSWGHDDYMYLVA EN TTLPSA
Sbjct  97   ESIVHHKYFKENPDYSNPAFNTEYGVYSEGCGLDNVMMSWGHDDYMYLVANENKTTLPSA  156

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSF+ALH+  AY +LMNEED EN+KWL+IF+KYDLYSKSKVRIDVE+VKPYYL
Sbjct  157  ALFIIRYHSFHALHKSEAYKNLMNEEDVENLKWLQIFSKYDLYSKSKVRIDVEKVKPYYL  216

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  217  SLIEKYFPAKLKW  229



>ref|XP_002883969.1| myo-inositol oxygenase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60228.1| myo-inositol oxygenase 2 [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            +HHKYFK NPD NN  YNTKNGVY EGCGLD VLMSWGHDDYMYLVAKENGTTLP A LF
Sbjct  188  IHHKYFKGNPDINNPKYNTKNGVYSEGCGLDNVLMSWGHDDYMYLVAKENGTTLPHAGLF  247

Query  191  IIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLI  370
            IIRYHSFY LH+ GAYTHLMN+ED++++KWL +FNKYDLYSKSKV +DVE+VKPYY+SLI
Sbjct  248  IIRYHSFYPLHKAGAYTHLMNDEDRDDLKWLHVFNKYDLYSKSKVLVDVEQVKPYYISLI  307

Query  371  EKYFPAKLRW  400
             KYFPAKL+W
Sbjct  308  NKYFPAKLKW  317



>emb|CDX82723.1| BnaC07g01430D [Brassica napus]
Length=312

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            +HHKYFKENPD N   YNTKNGVY EGCGLD VLMSWGHDDYMYLVAKENGTTLP A LF
Sbjct  183  IHHKYFKENPDNNTPKYNTKNGVYSEGCGLDNVLMSWGHDDYMYLVAKENGTTLPHAGLF  242

Query  191  IIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLI  370
            IIRYHSFY LH+ G YTHLMN+ED+E++KWL +FNKYDLYSKSKV +DVE+VKPYY+SLI
Sbjct  243  IIRYHSFYPLHKAGTYTHLMNDEDREDLKWLHVFNKYDLYSKSKVHVDVEQVKPYYISLI  302

Query  371  EKYFPAKLRW  400
             KYFPAKL+W
Sbjct  303  NKYFPAKLKW  312



>ref|XP_009102135.1| PREDICTED: inositol oxygenase 2 [Brassica rapa]
Length=312

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            +HHKYFKENPD N   YNTKNGVY EGCGLD VLMSWGHDDYMYLVAKENGTTLP A LF
Sbjct  183  IHHKYFKENPDNNTPKYNTKNGVYSEGCGLDNVLMSWGHDDYMYLVAKENGTTLPHAGLF  242

Query  191  IIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLI  370
            IIRYHSFY LH+ G YTHLMN+ED+E++KWL +FNKYDLYSKSKV +DVE+VKPYY+SLI
Sbjct  243  IIRYHSFYPLHKAGTYTHLMNDEDREDLKWLHVFNKYDLYSKSKVHVDVEQVKPYYISLI  302

Query  371  EKYFPAKLRW  400
             KYFPAKL+W
Sbjct  303  NKYFPAKLKW  312



>ref|XP_009343020.1| PREDICTED: inositol oxygenase 1-like [Pyrus x bretschneideri]
Length=308

 Score =   230 bits (587),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +S VHHKYF ENPD  N  YNTK+GVY EGCGL+  +MSWGHDDYMYLVAKEN +TLPSA
Sbjct  176  QSNVHHKYFAENPDYYNPTYNTKHGVYSEGCGLENAMMSWGHDDYMYLVAKENKSTLPSA  235

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALH  GAY HLMNEED EN+KWL++FNKYDLYSKSKVR+DVE+VKPYY+
Sbjct  236  ALFIIRYHSFYALHTAGAYKHLMNEEDVENLKWLRVFNKYDLYSKSKVRVDVEKVKPYYI  295

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP+KLRW
Sbjct  296  SLIEKYFPSKLRW  308



>ref|XP_002282395.1| PREDICTED: inositol oxygenase 1 [Vitis vinifera]
 emb|CBI36013.3| unnamed protein product [Vitis vinifera]
Length=304

 Score =   230 bits (586),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHK+FKE+PD  N  YNTK GVY EGCGL+ V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  172  ESIVHHKHFKESPDYYNPAYNTKYGVYSEGCGLENVMMSWGHDDYMYLVAKENKTTLPSA  231

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LF+IRYHSFYALHR  AY +LMNEED EN+KWLKIFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  232  GLFVIRYHSFYALHRSDAYKYLMNEEDIENLKWLKIFNKYDLYSKSKVRIDVEKVKPYYL  291

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL W
Sbjct  292  SLIEKYFPAKLNW  304



>ref|XP_009337920.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Pyrus x bretschneideri]
Length=310

 Score =   230 bits (586),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +S VHHKYF ENPD  N  YNTK GVY EGCGL+  +MSWGHDDYMYLVAKEN +TLPSA
Sbjct  178  QSNVHHKYFAENPDYYNPTYNTKYGVYSEGCGLENAMMSWGHDDYMYLVAKENKSTLPSA  237

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALH+ GAY HLMNEED EN+KWL++FNKYDLYSKSKVR+DVE+VKPYY+
Sbjct  238  ALFIIRYHSFYALHKAGAYKHLMNEEDVENLKWLRVFNKYDLYSKSKVRVDVEKVKPYYI  297

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP+KLRW
Sbjct  298  SLIEKYFPSKLRW  310



>ref|XP_006426838.1| hypothetical protein CICLE_v10026154mg [Citrus clementina]
 gb|ESR40078.1| hypothetical protein CICLE_v10026154mg [Citrus clementina]
Length=262

 Score =   228 bits (582),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD +N  +NT+ GVY EGCGLD V+MSWGHDDYMYLVA EN TTLPSA
Sbjct  130  ESIVHHKYFKENPDYSNPAFNTEYGVYSEGCGLDNVMMSWGHDDYMYLVANENKTTLPSA  189

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSF+ALH+  AY +LMNEED EN+KWL+IF+KYDLYSKSKVRIDVE+VKPYYL
Sbjct  190  ALFIIRYHSFHALHKSEAYKNLMNEEDVENLKWLQIFSKYDLYSKSKVRIDVEKVKPYYL  249

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  250  SLIEKYFPAKLKW  262



>ref|XP_009337921.1| PREDICTED: inositol oxygenase 1-like isoform X2 [Pyrus x bretschneideri]
Length=308

 Score =   230 bits (586),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +S VHHKYF ENPD  N  YNTK GVY EGCGL+  +MSWGHDDYMYLVAKEN +TLPSA
Sbjct  176  QSNVHHKYFAENPDYYNPTYNTKYGVYSEGCGLENAMMSWGHDDYMYLVAKENKSTLPSA  235

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALH+ GAY HLMNEED EN+KWL++FNKYDLYSKSKVR+DVE+VKPYY+
Sbjct  236  ALFIIRYHSFYALHKAGAYKHLMNEEDVENLKWLRVFNKYDLYSKSKVRVDVEKVKPYYI  295

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP+KLRW
Sbjct  296  SLIEKYFPSKLRW  308



>ref|XP_006373403.1| hypothetical protein POPTR_0017s13450g [Populus trichocarpa]
 gb|ERP51200.1| hypothetical protein POPTR_0017s13450g [Populus trichocarpa]
Length=308

 Score =   229 bits (585),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VH+++FKENPD NN  YNTKNGVY EGCGL  VLMS+GHDDYMYLVAKENGTTLPSA
Sbjct  176  ESNVHYQFFKENPDFNNPKYNTKNGVYSEGCGLSNVLMSFGHDDYMYLVAKENGTTLPSA  235

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALF+IRYHSFY LH  GAY HLMNEED EN+KWL+IFNKYDLYSKSKV IDVE+VKPYYL
Sbjct  236  ALFVIRYHSFYPLHSCGAYKHLMNEEDVENLKWLQIFNKYDLYSKSKVPIDVEKVKPYYL  295

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAK++W
Sbjct  296  SLIDKYFPAKVKW  308



>ref|NP_001242635.1| uncharacterized protein LOC100788665 [Glycine max]
 gb|ACU22894.1| unknown [Glycine max]
Length=312

 Score =   229 bits (585),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYFK+NPD     Y+ KNG+Y EGCGLD ++MSWGHDDYMY+VAK NGTTLPSA
Sbjct  180  ESNVHHKYFKDNPDYKCPAYSAKNGIYTEGCGLDNIVMSWGHDDYMYMVAKANGTTLPSA  239

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+EGAYTH MNEED EN+KWLKIFNKYDLYSKSKV +DVE+VKPYY+
Sbjct  240  GLFIIRYHSFYPLHKEGAYTHFMNEEDVENLKWLKIFNKYDLYSKSKVLVDVEKVKPYYV  299

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAK+RW
Sbjct  300  SLIEKYFPAKVRW  312



>ref|NP_200475.1| myo-inositol oxygenase 5 [Arabidopsis thaliana]
 sp|Q9FJU4.1|MIOX5_ARATH RecName: Full=Inositol oxygenase 5; AltName: Full=Myo-inositol 
oxygenase 5; Short=AtMIOX5; Short=MI oxygenase 5 [Arabidopsis 
thaliana]
 dbj|BAB09882.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96791.1| myo-inositol oxygenase 5 [Arabidopsis thaliana]
Length=314

 Score =   229 bits (585),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF ENPD NN  YNTK G+Y EGCGL+ VLMSWGHDDYMYLVAKENG+TLPS 
Sbjct  182  ESNVHHKYFMENPDFNNPKYNTKAGIYSEGCGLENVLMSWGHDDYMYLVAKENGSTLPSP  241

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAYTHLMNEEDKEN+KWL +FNKYDLYSKSKV ++VE+VKPYY+
Sbjct  242  GLFIIRYHSFYPLHKAGAYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHVNVEKVKPYYM  301

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  302  SLIKKYFPENLRW  314



>gb|AAM61190.1| unknown [Arabidopsis thaliana]
Length=314

 Score =   229 bits (585),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF ENPD NN  YNTK G+Y EGCGL+ VLMSWGHDDYMYLVAKENG+TLPS 
Sbjct  182  ESNVHHKYFMENPDFNNPKYNTKAGIYSEGCGLENVLMSWGHDDYMYLVAKENGSTLPSP  241

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAYTHLMNEEDKEN+KWL +FNKYDLYSKSKV ++VE+VKPYY+
Sbjct  242  GLFIIRYHSFYPLHKAGAYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHVNVEKVKPYYM  301

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  302  SLIKKYFPENLRW  314



>gb|EMT27791.1| Putative inositol oxygenase [Aegilops tauschii]
Length=392

 Score =   232 bits (592),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E  VH KYFKENPD +N  +NTK G Y EGCGLDKVLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  260  ECNVHSKYFKENPDYHNPEFNTKFGAYSEGCGLDKVLMSWGHDDYMYLVAKENKTTLPSA  319

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAYTHLMNEEDKEN+KWL +FNKYDLYSKS +RIDVEEVKPYY+
Sbjct  320  GLFIIRYHSFYPLHKHGAYTHLMNEEDKENLKWLHVFNKYDLYSKSSIRIDVEEVKPYYM  379

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP KLRW
Sbjct  380  SLIDKYFPGKLRW  392



>ref|XP_008244738.1| PREDICTED: inositol oxygenase 1-like [Prunus mume]
Length=309

 Score =   229 bits (585),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            VHHKYFKENPD  N  YNTK GVY EGCGL+ V+MSWGHDDYMYLVAKEN  TLPSAALF
Sbjct  180  VHHKYFKENPDYYNPAYNTKFGVYSEGCGLENVMMSWGHDDYMYLVAKENNCTLPSAALF  239

Query  191  IIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLI  370
            IIRYHSFYALH+ GAY HLMNEED EN+ WL++FNKYDLYSKS VRIDVE+VKPYYLSLI
Sbjct  240  IIRYHSFYALHKAGAYKHLMNEEDVENLNWLQVFNKYDLYSKSTVRIDVEKVKPYYLSLI  299

Query  371  EKYFPAKLRW  400
            EKYFP+KLRW
Sbjct  300  EKYFPSKLRW  309



>emb|CDY03334.1| BnaC09g10140D [Brassica napus]
Length=317

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            +HHKYFKENPD +N  YNTKNGVY EGCGLD VLMSWGHDDYMYLVAKENGTTLP A LF
Sbjct  188  IHHKYFKENPDNSNPKYNTKNGVYSEGCGLDNVLMSWGHDDYMYLVAKENGTTLPHAGLF  247

Query  191  IIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLI  370
            IIRYHSFY LH+ G YTHLM+EED+E++KWL +FNKYDLYSKSKV++DVE+VKPYY+SL 
Sbjct  248  IIRYHSFYPLHKAGTYTHLMSEEDREDLKWLHVFNKYDLYSKSKVQVDVEQVKPYYISLT  307

Query  371  EKYFPAKLRW  400
             KYFPAKL+W
Sbjct  308  NKYFPAKLKW  317



>ref|XP_004135682.1| PREDICTED: inositol oxygenase 2-like [Cucumis sativus]
 ref|XP_004158428.1| PREDICTED: inositol oxygenase 2-like [Cucumis sativus]
Length=313

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD  N  Y+TKNG+Y EGCGLD V +SWGHDDYMYLVAKENG+TLPSA
Sbjct  181  ESIVHHKYFKENPDWENPTYSTKNGIYSEGCGLDNVKISWGHDDYMYLVAKENGSTLPSA  240

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LHR GAY HLMNEED +N+KWL IFNKYDLYSKSK  IDVE+VKPYY+
Sbjct  241  GLFIIRYHSFYPLHRAGAYKHLMNEEDAQNLKWLHIFNKYDLYSKSKELIDVEKVKPYYI  300

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP KLRW
Sbjct  301  SLINKYFPEKLRW  313



>ref|XP_008450805.1| PREDICTED: inositol oxygenase 2-like [Cucumis melo]
Length=315

 Score =   229 bits (585),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD  N  Y+TKNG+Y EGCGL+ V++SWGHDDYMYLVAKENG+TLPSA
Sbjct  183  ESIVHHKYFKENPDWENPTYSTKNGIYSEGCGLNNVMISWGHDDYMYLVAKENGSTLPSA  242

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LHR GAY HLMNEED +N+KWL IFNKYDLYSKSK  IDVE+VKPYY+
Sbjct  243  GLFIIRYHSFYPLHRAGAYKHLMNEEDAQNLKWLHIFNKYDLYSKSKELIDVEKVKPYYI  302

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP KLRW
Sbjct  303  SLINKYFPEKLRW  315



>gb|KGN66197.1| hypothetical protein Csa_1G575130 [Cucumis sativus]
Length=314

 Score =   229 bits (585),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD  N  Y+TKNG+Y EGCGLD V +SWGHDDYMYLVAKENG+TLPSA
Sbjct  182  ESIVHHKYFKENPDWENPTYSTKNGIYSEGCGLDNVKISWGHDDYMYLVAKENGSTLPSA  241

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LHR GAY HLMNEED +N+KWL IFNKYDLYSKSK  IDVE+VKPYY+
Sbjct  242  GLFIIRYHSFYPLHRAGAYKHLMNEEDAQNLKWLHIFNKYDLYSKSKELIDVEKVKPYYI  301

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP KLRW
Sbjct  302  SLINKYFPEKLRW  314



>ref|XP_006426836.1| hypothetical protein CICLE_v10026154mg [Citrus clementina]
 gb|ESR40076.1| hypothetical protein CICLE_v10026154mg [Citrus clementina]
Length=304

 Score =   229 bits (584),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD +N  +NT+ GVY EGCGLD V+MSWGHDDYMYLVA EN TTLPSA
Sbjct  172  ESIVHHKYFKENPDYSNPAFNTEYGVYSEGCGLDNVMMSWGHDDYMYLVANENKTTLPSA  231

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSF+ALH+  AY +LMNEED EN+KWL+IF+KYDLYSKSKVRIDVE+VKPYYL
Sbjct  232  ALFIIRYHSFHALHKSEAYKNLMNEEDVENLKWLQIFSKYDLYSKSKVRIDVEKVKPYYL  291

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  292  SLIEKYFPAKLKW  304



>ref|XP_008375854.1| PREDICTED: inositol oxygenase 1-like [Malus domestica]
Length=293

 Score =   229 bits (583),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +S VHHKYF ENPD  N  YNTK GVY EGCGL+ V+MSWGHDDYMYLVA EN +TLPSA
Sbjct  161  QSNVHHKYFAENPDYYNPXYNTKYGVYSEGCGLENVMMSWGHDDYMYLVATENKSTLPSA  220

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALH+ GAY HLMNEED EN+KWL++FNKYDLYSKSK+R+DVE+VKPYY+
Sbjct  221  ALFIIRYHSFYALHKAGAYKHLMNEEDVENLKWLRVFNKYDLYSKSKIRVDVEKVKPYYI  280

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP+KLRW
Sbjct  281  SLIEKYFPSKLRW  293



>ref|XP_002866159.1| hypothetical protein ARALYDRAFT_495755 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42418.1| hypothetical protein ARALYDRAFT_495755 [Arabidopsis lyrata subsp. 
lyrata]
Length=315

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF EN D NN  YNTK G+Y EGCGL+ VLMSWGHDDYMYLVAKENG+TLPS+
Sbjct  183  ESNVHHKYFMENADFNNPKYNTKTGIYSEGCGLENVLMSWGHDDYMYLVAKENGSTLPSS  242

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAYTHLMNEEDKEN+KWL +FNKYDLYSKSKV +DVE+VKPYY+
Sbjct  243  GLFIIRYHSFYPLHKAGAYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHVDVEKVKPYYM  302

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  303  SLIKKYFPENLRW  315



>emb|CDY35889.1| BnaA07g00980D [Brassica napus]
Length=312

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            +HHKYFKENPD N   YNTKNGVY EGCGLD VLMSWGHDDYMYLVAKENG TLP A LF
Sbjct  183  IHHKYFKENPDNNTPKYNTKNGVYSEGCGLDNVLMSWGHDDYMYLVAKENGATLPHAGLF  242

Query  191  IIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLI  370
            IIRYHSFY LH+ G YTHLMN+ED+E++KWL +FNKYDLYSKSKV +DVE+VKPYY+SLI
Sbjct  243  IIRYHSFYPLHKAGTYTHLMNDEDREDLKWLHVFNKYDLYSKSKVHVDVEQVKPYYISLI  302

Query  371  EKYFPAKLRW  400
             KYFPAKL+W
Sbjct  303  NKYFPAKLKW  312



>ref|XP_004503513.1| PREDICTED: inositol oxygenase 2-like isoform X2 [Cicer arietinum]
Length=313

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES V HKYFK+N D     Y+TKNG+Y EGCGLD V MSWGHDDYMY VAKENGTTLP A
Sbjct  181  ESNVLHKYFKDNLDTKCPAYSTKNGIYTEGCGLDNVTMSWGHDDYMYWVAKENGTTLPPA  240

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LHREGAYTHLMNEED+EN+KWL +FNKYDLYSKSKV IDVEEVKPYYL
Sbjct  241  GLFIIRYHSFYPLHREGAYTHLMNEEDRENLKWLHVFNKYDLYSKSKVLIDVEEVKPYYL  300

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  301  SLIEKYFPAKLRW  313



>ref|XP_006401300.1| hypothetical protein EUTSA_v10014148mg [Eutrema salsugineum]
 gb|ESQ42753.1| hypothetical protein EUTSA_v10014148mg [Eutrema salsugineum]
Length=315

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VH KYF ENPD +N LYNTKNG+Y EGCGL+ V MSWGHDDYMYLVAKENG+TLPSA
Sbjct  183  ESNVHRKYFMENPDFDNPLYNTKNGIYSEGCGLENVCMSWGHDDYMYLVAKENGSTLPSA  242

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             +FIIRYHSFY LH+ GAYTHLMNEEDKEN+KWL +FN YDLYSKSKV +DVE+VKPYY+
Sbjct  243  GMFIIRYHSFYPLHKAGAYTHLMNEEDKENLKWLHVFNNYDLYSKSKVHVDVEKVKPYYM  302

Query  362  SLIEKYFPAKLRW  400
            S+I+KYFP  LRW
Sbjct  303  SIIKKYFPENLRW  315



>ref|XP_006465722.1| PREDICTED: inositol oxygenase 1-like isoform X2 [Citrus sinensis]
Length=304

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD +N  +NT+ GVY EGCGLD V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  172  ESIVHHKYFKENPDYSNPAFNTEYGVYSEGCGLDNVMMSWGHDDYMYLVAKENKTTLPSA  231

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALH+  AY HLMNEED EN+KWL+ F+KYDLYSKSKVRID E+VKPYYL
Sbjct  232  ALFIIRYHSFYALHKSEAYKHLMNEEDVENLKWLETFSKYDLYSKSKVRIDGEKVKPYYL  291

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP KL+W
Sbjct  292  SLIEKYFPVKLKW  304



>gb|KDP33765.1| hypothetical protein JCGZ_07336 [Jatropha curcas]
Length=315

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VH+KYFKENPD     Y+TKNG+YEEGCGL+ V++SWGHDDYMYLVAKENGTTLP A
Sbjct  183  ESNVHYKYFKENPDSKIPEYSTKNGIYEEGCGLENVMISWGHDDYMYLVAKENGTTLPPA  242

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIR+HSFY  H+ GAYTHLMN+ED+EN+KWLKIFNKYDLYSKSKV +DV+ VKPYY 
Sbjct  243  ALFIIRFHSFYPFHKAGAYTHLMNKEDEENLKWLKIFNKYDLYSKSKVLVDVDAVKPYYQ  302

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  303  SLIEKYFPAKLRW  315



>ref|XP_006349939.1| PREDICTED: inositol oxygenase 4-like [Solanum tuberosum]
Length=289

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES +HHKYFKEN D NN++YNTKNG+Y +  GL+ V+MSWGHDDYMY+VAKENGTTLPSA
Sbjct  157  ESNIHHKYFKENQDFNNSIYNTKNGIYNDFIGLENVMMSWGHDDYMYMVAKENGTTLPSA  216

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAY HLMN+ED+EN+KWL +FNKYDLYSKSKV ++VEEVKPYY+
Sbjct  217  GLFIIRYHSFYPLHKNGAYKHLMNDEDEENLKWLHVFNKYDLYSKSKVHVNVEEVKPYYM  276

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  277  SLIEKYFPAKLRW  289



>ref|XP_008805675.1| PREDICTED: probable inositol oxygenase [Phoenix dactylifera]
Length=303

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVH+KY K+NPD NN  YNTK GVY EGCGLD ++MSWGHDDYMY+VAKEN TTLPSA
Sbjct  171  ESIVHYKYLKDNPDFNNPQYNTKFGVYSEGCGLDNLMMSWGHDDYMYMVAKENKTTLPSA  230

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            A+FIIRYHSFY LH+ G Y + MN+ED+EN+KWL+IFNKYDLYSKSKVR+DVE+VKPYYL
Sbjct  231  AMFIIRYHSFYPLHQSGTYKYFMNKEDEENLKWLQIFNKYDLYSKSKVRVDVEKVKPYYL  290

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP KLRW
Sbjct  291  SLIEKYFPPKLRW  303



>ref|XP_008221001.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Prunus mume]
Length=347

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 121/149 (81%), Gaps = 16/149 (11%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHK+FK+NPD NN  YNTK G+Y EGCGLD VLMSWGHDDYMYLVAKEN +TLPSA
Sbjct  199  ESTVHHKHFKKNPDYNNPAYNTKYGIYSEGCGLDNVLMSWGHDDYMYLVAKENKSTLPSA  258

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFI+RYHSFYALHR GAY HLMNEED EN+KWLKIFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  259  GLFIVRYHSFYALHRAGAYKHLMNEEDIENLKWLKIFNKYDLYSKSKVRIDVEKVKPYYL  318

Query  362  SLIEK----------------YFPAKLRW  400
            SLIEK                YFPAKLRW
Sbjct  319  SLIEKVKTNCSCYWSWMEGNFYFPAKLRW  347



>ref|XP_011021080.1| PREDICTED: inositol oxygenase 2-like [Populus euphratica]
Length=318

 Score =   228 bits (582),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VH+++FKENPD NN  YNTK GVY EGCGL  VLMS+GHDDYMYLVAKENGTTLPSA
Sbjct  186  ESNVHYQFFKENPDFNNPKYNTKTGVYSEGCGLSNVLMSFGHDDYMYLVAKENGTTLPSA  245

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LF+IRYHSFY LH  GAY HLMNEED EN+KWL+IFNKYDLYSKSKV IDVE+VKPYYL
Sbjct  246  GLFVIRYHSFYPLHSRGAYKHLMNEEDVENLKWLQIFNKYDLYSKSKVPIDVEKVKPYYL  305

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAK++W
Sbjct  306  SLIEKYFPAKVKW  318



>ref|XP_010476506.1| PREDICTED: inositol oxygenase 1-like [Camelina sativa]
Length=308

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKEN D +N  YNTK G+Y EGCGLD VLMSWGHDDYMYLVA EN TTLPSA
Sbjct  176  ESIVHHKYFKENQDYDNPSYNTKYGIYTEGCGLDNVLMSWGHDDYMYLVAMENQTTLPSA  235

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY HLMN+ED++N+KWLK+FNKYDLYSKSKVR++V+EVKPYYL
Sbjct  236  GLFIIRYHSFYALHKSEAYKHLMNDEDRDNIKWLKVFNKYDLYSKSKVRVNVDEVKPYYL  295

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL+W
Sbjct  296  SLINKYFPAKLKW  308



>ref|XP_004149177.1| PREDICTED: inositol oxygenase 1-like [Cucumis sativus]
 ref|XP_004170193.1| PREDICTED: inositol oxygenase 1-like [Cucumis sativus]
Length=229

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +SIVHHKYF ENPD  N  YNTK GVY   CGLD V+MSWGHDDYMYLVAKEN T LPSA
Sbjct  97   KSIVHHKYFMENPDYYNPAYNTKYGVYSPNCGLDNVMMSWGHDDYMYLVAKENNTILPSA  156

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALF+IRYHSFY+LHR  AY HLMNEED EN+KWL+IFNKYDLYSKSKVR++VE+VKPYYL
Sbjct  157  ALFVIRYHSFYSLHRSDAYKHLMNEEDVENLKWLRIFNKYDLYSKSKVRVNVEKVKPYYL  216

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  217  SLIEKYFPAKLQW  229



>ref|XP_010489128.1| PREDICTED: inositol oxygenase 2-like [Camelina sativa]
Length=317

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            +HHKYFK N D NN  YNTKNGVY EGCGLD VLMSWGHDDYMYLVAKENGTTLP A LF
Sbjct  188  IHHKYFKGNSDNNNPKYNTKNGVYNEGCGLDNVLMSWGHDDYMYLVAKENGTTLPHAGLF  247

Query  191  IIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLI  370
            IIRYHSFY LH+ GAYTHLMN+ED++++KWL +FNKYDLYSKSKV++DVE+VKPYY+SLI
Sbjct  248  IIRYHSFYPLHKAGAYTHLMNDEDRDDLKWLHVFNKYDLYSKSKVQVDVEQVKPYYVSLI  307

Query  371  EKYFPAKLRW  400
             KYFPAKL+W
Sbjct  308  NKYFPAKLKW  317



>ref|XP_007215726.1| hypothetical protein PRUPE_ppa009023mg [Prunus persica]
 gb|EMJ16925.1| hypothetical protein PRUPE_ppa009023mg [Prunus persica]
Length=309

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ++ VHHKYFKENPD  N  YNTK GVY EGCGL+ V+MSWGHDDYMYLVAKEN  TLPSA
Sbjct  177  QANVHHKYFKENPDYYNPAYNTKFGVYSEGCGLENVMMSWGHDDYMYLVAKENNCTLPSA  236

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALH+ GAY HLMNEED +N+ WL +FNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  237  ALFIIRYHSFYALHKAGAYKHLMNEEDVKNLNWLHVFNKYDLYSKSKVRIDVEKVKPYYL  296

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP+KLRW
Sbjct  297  SLIEKYFPSKLRW  309



>ref|XP_007160262.1| hypothetical protein PHAVU_002G306400g [Phaseolus vulgaris]
 gb|ESW32256.1| hypothetical protein PHAVU_002G306400g [Phaseolus vulgaris]
Length=272

 Score =   226 bits (577),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES +HHKYFK NPD     Y TKNG+Y EGCGL  V+MSWGHD+YMYLVAK+NG+TLPSA
Sbjct  140  ESNIHHKYFKNNPDYQCPAYKTKNGIYTEGCGLQNVMMSWGHDEYMYLVAKKNGSTLPSA  199

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIR+HSFY LH+EGAYTHLMNEED EN+KWL++FNKYDLYSKSKV +DVE+VKPYY+
Sbjct  200  GLFIIRFHSFYPLHKEGAYTHLMNEEDVENLKWLEVFNKYDLYSKSKVLVDVEKVKPYYM  259

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  260  SLIEKYFPAKLRW  272



>ref|XP_004141036.1| PREDICTED: inositol oxygenase 2-like [Cucumis sativus]
 gb|KGN60556.1| hypothetical protein Csa_2G000640 [Cucumis sativus]
Length=317

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +SIVHHKYFK+N D NN  YNTK GVY  GCGLD V++SWGHDDYMYLVAKENGTTLP A
Sbjct  185  KSIVHHKYFKDNIDNNNPAYNTKYGVYSPGCGLDNVVISWGHDDYMYLVAKENGTTLPDA  244

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFI+RYHSFY +H+EGAY HLMNEED ENMKWL IFNKYDLYSKSKV +DVE+VKPYY 
Sbjct  245  GLFIVRYHSFYPMHKEGAYQHLMNEEDAENMKWLHIFNKYDLYSKSKVLVDVEKVKPYYQ  304

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKL+W
Sbjct  305  SLIQKYFPAKLKW  317



>ref|XP_007160260.1| hypothetical protein PHAVU_002G306200g [Phaseolus vulgaris]
 gb|ESW32254.1| hypothetical protein PHAVU_002G306200g [Phaseolus vulgaris]
Length=317

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +S +HHKYFK+NPD   + Y+TK G+Y EGCGLD V MSWGHDDYMY+VAKENGTTLPSA
Sbjct  185  KSNIHHKYFKDNPDYKCSAYSTKTGIYTEGCGLDNVAMSWGHDDYMYMVAKENGTTLPSA  244

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+EGAYTHLMNEED EN+KWL +FNKYDLYSKSKV +DVE+VKPYY+
Sbjct  245  GLFIIRYHSFYPLHKEGAYTHLMNEEDFENLKWLNVFNKYDLYSKSKVLVDVEKVKPYYI  304

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP+KL+W
Sbjct  305  SLIEKYFPSKLKW  317



>ref|XP_010243881.1| PREDICTED: probable inositol oxygenase [Nelumbo nucifera]
Length=454

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYFK+NPD NN  YNTKNG+Y E CGLD V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  322  ESNVHHKYFKDNPDYNNPDYNTKNGIYSEECGLDNVMMSWGHDDYMYLVAKENKTTLPSA  381

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LH  GAY HLMNE+D EN+KWL IFNKYDLYSKSKVR DVE+VKPYYL
Sbjct  382  ALFIIRYHSFYPLHTYGAYRHLMNEQDVENLKWLHIFNKYDLYSKSKVRTDVEKVKPYYL  441

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKLRW
Sbjct  442  SLIDKYFPAKLRW  454



>ref|XP_008447570.1| PREDICTED: inositol oxygenase 1-like isoform X2 [Cucumis melo]
Length=302

 Score =   227 bits (578),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +SIVHHKYF ENPD  N  YNTK GVY   CGLD V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  170  KSIVHHKYFVENPDYYNPAYNTKYGVYSPNCGLDNVMMSWGHDDYMYLVAKENKTTLPSA  229

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALF+IRYHSFY+LHR  AY HLMNEED EN+KWL+IFNKYDLYSKSKVR++VE+VKPYYL
Sbjct  230  ALFVIRYHSFYSLHRSDAYKHLMNEEDVENLKWLRIFNKYDLYSKSKVRVNVEKVKPYYL  289

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  290  SLIEKYFPAKLQW  302



>ref|XP_004157903.1| PREDICTED: inositol oxygenase 2-like [Cucumis sativus]
Length=317

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +SIVHHKYFK+N D NN  YNTK GVY  GCGLD V++SWGHDDYMYLVAKENGTTLP A
Sbjct  185  KSIVHHKYFKDNIDNNNPAYNTKYGVYSPGCGLDNVVISWGHDDYMYLVAKENGTTLPDA  244

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFI+RYHSFY +H+EGAY HLMNEED ENMKWL IFNKYDLYSKSKV +DVE+VKPYY 
Sbjct  245  GLFIVRYHSFYPMHKEGAYQHLMNEEDGENMKWLHIFNKYDLYSKSKVLVDVEKVKPYYQ  304

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKL+W
Sbjct  305  SLIQKYFPAKLKW  317



>ref|XP_008447569.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Cucumis melo]
Length=305

 Score =   227 bits (579),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +SIVHHKYF ENPD  N  YNTK GVY   CGLD V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  173  KSIVHHKYFVENPDYYNPAYNTKYGVYSPNCGLDNVMMSWGHDDYMYLVAKENKTTLPSA  232

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALF+IRYHSFY+LHR  AY HLMNEED EN+KWL+IFNKYDLYSKSKVR++VE+VKPYYL
Sbjct  233  ALFVIRYHSFYSLHRSDAYKHLMNEEDVENLKWLRIFNKYDLYSKSKVRVNVEKVKPYYL  292

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  293  SLIEKYFPAKLQW  305



>gb|AAC05150.1| PRE87 gene product [Pinus radiata]
Length=217

 Score =   224 bits (571),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E+IVHH++FK+NPD +N  YNTK GVY E CGLD VLMSWGHD+YMYLVAK N TTLP A
Sbjct  85   ETIVHHEFFKDNPDFHNPKYNTKYGVYSEKCGLDNVLMSWGHDEYMYLVAKMNNTTLPPA  144

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIR+HSFY LHREGAY HL+N+EDKE ++WLKIFNKYDLYSKSKVRIDVEEVKPYY 
Sbjct  145  ALFIIRFHSFYPLHREGAYMHLLNDEDKEMLEWLKIFNKYDLYSKSKVRIDVEEVKPYYQ  204

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP KLRW
Sbjct  205  SLIDKYFPPKLRW  217



>ref|XP_009767150.1| PREDICTED: inositol oxygenase 2-like [Nicotiana sylvestris]
Length=281

 Score =   226 bits (576),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESI+HHKYFKEN D  N +YNTKNGVY EGCGL+ V+M WGHDDYMY+VAKENG TLPSA
Sbjct  149  ESIIHHKYFKENQDFKNPIYNTKNGVYFEGCGLENVMMPWGHDDYMYMVAKENGITLPSA  208

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH+ GAY HLMNEEDKEN+KWL IFNKY LYSKSKVR++VEEVKPYYL
Sbjct  209  GFFIIRYHSFYPLHKSGAYKHLMNEEDKENLKWLHIFNKYVLYSKSKVRVNVEEVKPYYL  268

Query  362  SLIEKYFPAKLRW  400
            SLI KYF AKLRW
Sbjct  269  SLIGKYFLAKLRW  281



>ref|XP_004253007.1| PREDICTED: inositol oxygenase 5-like [Solanum lycopersicum]
Length=289

 Score =   226 bits (577),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES +HHKYFKEN D NN +YNTKNG+Y +  GL+ V+MSWGHDDYMY+VAKENGTTLPSA
Sbjct  157  ESNIHHKYFKENQDFNNPIYNTKNGIYNDSIGLENVMMSWGHDDYMYMVAKENGTTLPSA  216

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ G Y HLMN+ED+EN+KWL +FNKYDLYSKSKV ++VEEVKPYY+
Sbjct  217  GLFIIRYHSFYPLHKNGGYKHLMNDEDEENLKWLHVFNKYDLYSKSKVHVNVEEVKPYYM  276

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  277  SLIEKYFPAKLRW  289



>ref|NP_001190844.1| myo-inositol oxygenase 4 [Arabidopsis thaliana]
 emb|CAB38955.1| putative protein [Arabidopsis thaliana]
 emb|CAB79481.1| putative protein [Arabidopsis thaliana]
 gb|AEE85177.1| myo-inositol oxygenase 4 [Arabidopsis thaliana]
Length=318

 Score =   227 bits (579),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF ENPD +N  YNTKNG+Y EGCGL+ V+MSWGHDDYMYLVAKENG+TLPSA
Sbjct  186  ESNVHHKYFVENPDFHNETYNTKNGIYSEGCGLNNVMMSWGHDDYMYLVAKENGSTLPSA  245

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEEDKEN+KWL +FNKYDLYSKSKV +DVE+VKPYY+
Sbjct  246  GQFIIRYHSFYPLHTAGEYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHVDVEKVKPYYM  305

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  306  SLIKKYFPENLRW  318



>ref|XP_010451346.1| PREDICTED: inositol oxygenase 5-like [Camelina sativa]
Length=315

 Score =   227 bits (578),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF ENPD NN  YNTK G+Y EGCGL+ V MSWGHDDYMY+VAKEN +TLPSA
Sbjct  183  ESNVHHKYFMENPDINNPKYNTKAGIYSEGCGLENVNMSWGHDDYMYMVAKENESTLPSA  242

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH  GAYTHLMNEEDKEN+KWL +FNKYDLYSKSKV++DVE+VKPYY+
Sbjct  243  GLFIIRYHSFYPLHTAGAYTHLMNEEDKENLKWLHVFNKYDLYSKSKVQVDVEKVKPYYM  302

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  303  SLIKKYFPENLRW  315



>ref|NP_194356.2| myo-inositol oxygenase 4 [Arabidopsis thaliana]
 sp|Q8H1S0.1|MIOX4_ARATH RecName: Full=Inositol oxygenase 4; AltName: Full=Myo-inositol 
oxygenase 4; Short=AtMIOX4; Short=MI oxygenase 4 [Arabidopsis 
thaliana]
 gb|AAN13052.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85176.1| myo-inositol oxygenase 4 [Arabidopsis thaliana]
Length=317

 Score =   227 bits (578),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF ENPD +N  YNTKNG+Y EGCGL+ V+MSWGHDDYMYLVAKENG+TLPSA
Sbjct  185  ESNVHHKYFVENPDFHNETYNTKNGIYSEGCGLNNVMMSWGHDDYMYLVAKENGSTLPSA  244

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEEDKEN+KWL +FNKYDLYSKSKV +DVE+VKPYY+
Sbjct  245  GQFIIRYHSFYPLHTAGEYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHVDVEKVKPYYM  304

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  305  SLIKKYFPENLRW  317



>emb|CDX92758.1| BnaC07g40160D [Brassica napus]
Length=310

 Score =   226 bits (577),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF ENPD +N  YNTK+G+Y EGCGL+ V+MSWGHDDYMYLVAKENG+TLPSA
Sbjct  178  ESNVHHKYFSENPDFHNQAYNTKSGIYTEGCGLNNVMMSWGHDDYMYLVAKENGSTLPSA  237

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEEDKEN+KWL +FNKYDLYSKSKV +DVE+VKPYY+
Sbjct  238  GQFIIRYHSFYPLHTAGEYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHVDVEKVKPYYM  297

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP  LRW
Sbjct  298  SLIRKYFPENLRW  310



>ref|XP_004966088.1| PREDICTED: probable inositol oxygenase-like [Setaria italica]
Length=305

 Score =   226 bits (577),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E  VH KYFKENPD +N  +NTK GVY EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  173  ECNVHFKYFKENPDYHNPKFNTKFGVYSEGCGLDNVLMSWGHDDYMYLVAKENKTTLPSA  232

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAYTHLMN+EDKEN+KWL +FNKYDLYSKS VRIDVE+VKPYY+
Sbjct  233  GLFIIRYHSFYPLHKHGAYTHLMNDEDKENLKWLHVFNKYDLYSKSNVRIDVEKVKPYYM  292

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP KLRW
Sbjct  293  SLINKYFPEKLRW  305



>ref|XP_010483142.1| PREDICTED: inositol oxygenase 5 [Camelina sativa]
Length=315

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF ENPD NN  YNTK G+Y EGCGL+ V MSWGHDDYMY+VAKENG+TLP A
Sbjct  183  ESNVHHKYFMENPDINNPKYNTKAGIYSEGCGLENVNMSWGHDDYMYMVAKENGSTLPFA  242

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH  GAYTHLMNEEDKEN+KWL +FNKYDLYSKSKV IDVE+VKPYY+
Sbjct  243  GLFIIRYHSFYPLHTAGAYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHIDVEKVKPYYM  302

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP  LRW
Sbjct  303  SLINKYFPENLRW  315



>emb|CDY42748.1| BnaA03g47910D [Brassica napus]
Length=310

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF ENPD +N  YNTK+G+Y EGCGL+ V+MSWGHDDYMYLVAKENG+TLPSA
Sbjct  178  ESNVHHKYFSENPDFHNQAYNTKSGIYTEGCGLNNVMMSWGHDDYMYLVAKENGSTLPSA  237

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEEDKEN+KWL +FNKYDLYSKSKV +DVE+VKPYY+
Sbjct  238  GQFIIRYHSFYPLHTAGEYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHVDVEKVKPYYM  297

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP  LRW
Sbjct  298  SLIRKYFPENLRW  310



>ref|XP_006298168.1| hypothetical protein CARUB_v10014217mg [Capsella rubella]
 gb|EOA31066.1| hypothetical protein CARUB_v10014217mg [Capsella rubella]
Length=229

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            +HHKYFK N D NN  YNTKNGVY EGCGLD VLMSWGHDDYMYLVAKENGTTLP AALF
Sbjct  100  IHHKYFKGNSDNNNPKYNTKNGVYSEGCGLDNVLMSWGHDDYMYLVAKENGTTLPHAALF  159

Query  191  IIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLI  370
            IIRYHSFY LH   AYT LMN+ED++++KWL +FNKYDLYSKSKV +DVE+VKPYY+SLI
Sbjct  160  IIRYHSFYPLHTAAAYTQLMNDEDRDDLKWLHVFNKYDLYSKSKVHVDVEQVKPYYISLI  219

Query  371  EKYFPAKLRW  400
             KYFPAKLRW
Sbjct  220  NKYFPAKLRW  229



>ref|XP_009124813.1| PREDICTED: inositol oxygenase 4 [Brassica rapa]
Length=309

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF ENPD +N  YNTK+G+Y EGCGL+ V+MSWGHDDYMYLVAKENG+TLPSA
Sbjct  177  ESNVHHKYFSENPDFHNQAYNTKSGIYTEGCGLNNVMMSWGHDDYMYLVAKENGSTLPSA  236

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEEDKEN+KWL +FNKYDLYSKSKV +DVE+VKPYY+
Sbjct  237  GQFIIRYHSFYPLHTAGEYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHVDVEKVKPYYM  296

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP  LRW
Sbjct  297  SLIRKYFPENLRW  309



>ref|XP_006365685.1| PREDICTED: inositol oxygenase 2-like [Solanum tuberosum]
Length=229

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIV H+  K NPD NN  YNTK GVY EGCGL+ V+MSWGHDDYMYLVAK N TTLPSA
Sbjct  97   ESIVLHEQLKGNPDNNNPTYNTKYGVYSEGCGLNNVVMSWGHDDYMYLVAKANKTTLPSA  156

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LH+ GAYTHLMNEED EN+KWL+IF+KYDLYSKS VRIDVE+VKPYY+
Sbjct  157  ALFIIRYHSFYPLHKSGAYTHLMNEEDHENLKWLQIFSKYDLYSKSNVRIDVEKVKPYYM  216

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  217  SLIEKYFPAKLKW  229



>ref|XP_009381183.1| PREDICTED: probable inositol oxygenase [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381184.1| PREDICTED: probable inositol oxygenase [Musa acuminata subsp. 
malaccensis]
Length=294

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E  VHHK+FKENPD +N  +NTK GVY EGCGL+ VLMSWGHDDYMYLVAKEN +TLPSA
Sbjct  162  ECNVHHKHFKENPDGHNPKFNTKFGVYSEGCGLNNVLMSWGHDDYMYLVAKENKSTLPSA  221

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAY +LMNEEDKEN+KWL IFNKYDLYSKSKVRIDV++VKPYY+
Sbjct  222  GLFIIRYHSFYPLHKHGAYQYLMNEEDKENLKWLHIFNKYDLYSKSKVRIDVDKVKPYYM  281

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  282  SLIEKYFPAKLKW  294



>gb|AAK43906.1|AF370587_1 Unknown protein [Arabidopsis thaliana]
Length=242

 Score =   224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            +HHKYFK N D NN  YNTKNGVY EGCGLD VLMSWGHDDYMYLVAK+NGTTLP A LF
Sbjct  113  IHHKYFKGNHDINNPKYNTKNGVYTEGCGLDNVLMSWGHDDYMYLVAKKNGTTLPHAGLF  172

Query  191  IIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLI  370
            IIRYHSFY LH+ GAYTHLMN+ED++++KWL +FNKYDLYSKSKV +DVE+VKPYY+SLI
Sbjct  173  IIRYHSFYPLHKAGAYTHLMNDEDRDDLKWLHVFNKYDLYSKSKVLVDVEQVKPYYISLI  232

Query  371  EKYFPAKLRW  400
             KYFPAKL+W
Sbjct  233  NKYFPAKLKW  242



>ref|XP_006279854.1| hypothetical protein CARUB_v10028439mg [Capsella rubella]
 gb|EOA12752.1| hypothetical protein CARUB_v10028439mg [Capsella rubella]
Length=315

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF ENPD NN +YNTK G+Y  GCGL+ V MSWGHDDYMY+VAKENG+TLPSA
Sbjct  183  ESNVHHKYFVENPDFNNPMYNTKAGIYSVGCGLENVSMSWGHDDYMYMVAKENGSTLPSA  242

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH  GAYTHLMNEEDK N+KWL +FNKYDLYSKSKV IDVE+VKPYY+
Sbjct  243  GLFIIRYHSFYPLHTAGAYTHLMNEEDKANLKWLHVFNKYDLYSKSKVHIDVEKVKPYYM  302

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  303  SLIKKYFPENLRW  315



>gb|KHG27947.1| Inositol oxygenase 2 -like protein [Gossypium arboreum]
Length=315

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E+ +HH+YFKENPD NN  YNTKNG+Y +GCGLD V +SWGHDDYMYLVAKENGTTLPSA
Sbjct  183  EANIHHRYFKENPDYNNPSYNTKNGIYWDGCGLDNVTISWGHDDYMYLVAKENGTTLPSA  242

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHS Y LH+E AY   +N+EDKEN+KWL+IFNKYDLYSKSKV +DVE+VKPYYL
Sbjct  243  GLFIIRYHSLYPLHKEEAYMQFLNDEDKENLKWLRIFNKYDLYSKSKVAVDVEKVKPYYL  302

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  303  SLIEKYFPAKLKW  315



>gb|KGN58015.1| hypothetical protein Csa_3G434960 [Cucumis sativus]
Length=305

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +SIVHHKYF ENPD  N  YNTK GVY   CGLD V+MSWGHDDYMYLVAKEN T LPSA
Sbjct  173  KSIVHHKYFMENPDYYNPAYNTKYGVYSPNCGLDNVMMSWGHDDYMYLVAKENNTILPSA  232

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALF+IRYHSFY+LHR  AY HLMNEED EN+KWL+IFNKYDLYSKSKVR++VE+VKPYYL
Sbjct  233  ALFVIRYHSFYSLHRSDAYKHLMNEEDVENLKWLRIFNKYDLYSKSKVRVNVEKVKPYYL  292

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  293  SLIEKYFPAKLQW  305



>ref|XP_002514185.1| myoinositol oxygenase, putative [Ricinus communis]
 gb|EEF48139.1| myoinositol oxygenase, putative [Ricinus communis]
Length=315

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES +HH YFKENPD  N  Y+TKNG+YEEGCGL+ V++SWGHDDYMYLVAKENGTTLP A
Sbjct  183  ESNIHHTYFKENPDSKNPTYSTKNGIYEEGCGLENVMISWGHDDYMYLVAKENGTTLPPA  242

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFI+R+HSFY LHR GAY HLMNE DKE++KWL IFNKYDLYSKSKV +DV+ VKPYY 
Sbjct  243  ALFIVRFHSFYPLHRAGAYMHLMNEGDKESLKWLHIFNKYDLYSKSKVLVDVDAVKPYYQ  302

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP KLRW
Sbjct  303  SLIKKYFPEKLRW  315



>gb|AAP59548.1| myo-inositol oxygenase [Arabidopsis thaliana]
Length=317

 Score =   225 bits (574),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF ENPD +N  YNTKNG+Y EGCGL+ V+MSWGHDDYMYLVAKENG+TLPSA
Sbjct  185  ESNVHHKYFVENPDFHNETYNTKNGIYSEGCGLNNVMMSWGHDDYMYLVAKENGSTLPSA  244

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEEDKEN+KWL +FNKYDLYSKSKV +DVE+V+PYY+
Sbjct  245  GQFIIRYHSFYPLHTAGEYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHVDVEKVEPYYM  304

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  305  SLIKKYFPENLRW  317



>ref|XP_009126928.1| PREDICTED: inositol oxygenase 5 [Brassica rapa]
Length=315

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES +HHKYF ENPD NN  YNTK G+Y EGCGL+ V MSWGHDDYMYLVAKENG+TLPSA
Sbjct  183  ESNIHHKYFMENPDFNNPNYNTKTGIYSEGCGLENVFMSWGHDDYMYLVAKENGSTLPSA  242

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ G YTHL+NE DK+N+KWL +FNKYDLYSKSKV++DVE+VKPYY+
Sbjct  243  GLFIIRYHSFYPLHKAGGYTHLLNEGDKDNLKWLHVFNKYDLYSKSKVQVDVEKVKPYYM  302

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  303  SLIKKYFPEDLRW  315



>emb|CDY20714.1| BnaA02g08540D [Brassica napus]
Length=316

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES +HHKYF ENPD NN  YNTK G+Y EGCGL+ V MSWGHDDYMYLVAKENG+TLPSA
Sbjct  184  ESNIHHKYFMENPDFNNPNYNTKTGIYSEGCGLENVFMSWGHDDYMYLVAKENGSTLPSA  243

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ G YTHL+NE DK+N+KWL +FNKYDLYSKSKV++DVE+VKPYY+
Sbjct  244  GLFIIRYHSFYPLHKAGGYTHLLNEGDKDNLKWLHVFNKYDLYSKSKVQVDVEKVKPYYM  303

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  304  SLIKKYFPEDLRW  316



>ref|XP_010416640.1| PREDICTED: inositol oxygenase 2 [Camelina sativa]
Length=317

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            +HHKYFK N D NN  YNTKNGVY EGCGLD VLMSWGHDDYMYLVAKEN TTLP A LF
Sbjct  188  IHHKYFKGNSDNNNPKYNTKNGVYNEGCGLDNVLMSWGHDDYMYLVAKENDTTLPHAGLF  247

Query  191  IIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLI  370
            IIRYHSFY LH+ GAYTHLMN+ED++++KWL +FNKYDLYSKSKV++DVE+VKPYY+SLI
Sbjct  248  IIRYHSFYPLHKAGAYTHLMNDEDRDDLKWLHVFNKYDLYSKSKVQVDVEQVKPYYVSLI  307

Query  371  EKYFPAKLRW  400
             KYFPAKL+W
Sbjct  308  NKYFPAKLKW  317



>ref|NP_565459.1| myo-inositol oxygenase 2 [Arabidopsis thaliana]
 sp|O82200.2|MIOX2_ARATH RecName: Full=Inositol oxygenase 2; AltName: Full=Myo-inositol 
oxygenase 2; Short=AtMIOX2; Short=MI oxygenase 2 [Arabidopsis 
thaliana]
 gb|AAC62136.2| expressed protein [Arabidopsis thaliana]
 gb|ACF28396.1| At2g19800 [Arabidopsis thaliana]
 gb|AEC06927.1| myo-inositol oxygenase 2 [Arabidopsis thaliana]
Length=317

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            +HHKYFK N D NN  YNTKNGVY EGCGLD VLMSWGHDDYMYLVAK+NGTTLP A LF
Sbjct  188  IHHKYFKGNHDINNPKYNTKNGVYTEGCGLDNVLMSWGHDDYMYLVAKKNGTTLPHAGLF  247

Query  191  IIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLI  370
            IIRYHSFY LH+ GAYTHLMN+ED++++KWL +FNKYDLYSKSKV +DVE+VKPYY+SLI
Sbjct  248  IIRYHSFYPLHKAGAYTHLMNDEDRDDLKWLHVFNKYDLYSKSKVLVDVEQVKPYYISLI  307

Query  371  EKYFPAKLRW  400
             KYFPAKL+W
Sbjct  308  NKYFPAKLKW  317



>gb|AAM63498.1| unknown [Arabidopsis thaliana]
Length=317

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            +HHKYFK N D NN  YNTKNGVY EGCGLD VLMSWGHDDYMYLVAK+NGTTLP A LF
Sbjct  188  IHHKYFKGNHDINNPKYNTKNGVYTEGCGLDNVLMSWGHDDYMYLVAKKNGTTLPHAGLF  247

Query  191  IIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLI  370
            IIRYHSFY LH+ GAYTHLMN+ED++++KWL +FNKYDLYSKSKV +DVE+VKPYY+SLI
Sbjct  248  IIRYHSFYPLHKAGAYTHLMNDEDRDDLKWLHVFNKYDLYSKSKVLVDVEQVKPYYISLI  307

Query  371  EKYFPAKLRW  400
             KYFPAKL+W
Sbjct  308  NKYFPAKLKW  317



>ref|XP_007160263.1| hypothetical protein PHAVU_002G306500g [Phaseolus vulgaris]
 gb|ESW32257.1| hypothetical protein PHAVU_002G306500g [Phaseolus vulgaris]
Length=297

 Score =   224 bits (571),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES +HHKYFK NPD     Y TKNG+Y EGCGL  V+MSWGHD+YMYLVAK+NG+TLPSA
Sbjct  165  ESNIHHKYFKNNPDYQCPAYKTKNGIYTEGCGLQNVMMSWGHDEYMYLVAKKNGSTLPSA  224

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIR+HSFY LH+EGAYTHLMNEED EN+KWL++FNKYDLYSKSKV +DVE+VKPYY+
Sbjct  225  GLFIIRFHSFYPLHKEGAYTHLMNEEDFENLKWLEVFNKYDLYSKSKVLVDVEKVKPYYM  284

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP KLRW
Sbjct  285  SLIEKYFPVKLRW  297



>ref|XP_010443316.1| PREDICTED: inositol oxygenase 5-like [Camelina sativa]
Length=315

 Score =   224 bits (572),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF EN D NN  YNTK G+Y EGCGL+ V MSWGHDDYMY+VAKENG+TLPSA
Sbjct  183  ESNVHHKYFMENLDINNPKYNTKAGIYSEGCGLENVNMSWGHDDYMYMVAKENGSTLPSA  242

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH  GAYTHLMNEEDKEN+KWL +FNKYDLYSKSKV +DVE+VKPYY+
Sbjct  243  GLFIIRYHSFYPLHTAGAYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHVDVEKVKPYYM  302

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  303  SLIKKYFPENLRW  315



>ref|XP_009402940.1| PREDICTED: probable inositol oxygenase [Musa acuminata subsp. 
malaccensis]
Length=289

 Score =   224 bits (570),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VH K+FKENPD +N  YNTK GVY EGCGL+ VLMS+GHDDYMYLVAKEN TTLPSA
Sbjct  157  ESNVHFKHFKENPDYDNPKYNTKLGVYSEGCGLENVLMSFGHDDYMYLVAKENNTTLPSA  216

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALF IRYHSFY LH+ GAY +L+N+ED+EN+KWL IFNKYDLYSKSKVRIDVEEVKPYYL
Sbjct  217  ALFAIRYHSFYPLHKHGAYQYLLNKEDRENLKWLHIFNKYDLYSKSKVRIDVEEVKPYYL  276

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  277  SLIEKYFPAKLKW  289



>ref|XP_004297627.1| PREDICTED: inositol oxygenase 1-like [Fragaria vesca subsp. vesca]
Length=312

 Score =   224 bits (571),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 120/135 (89%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVY-EEGCGLDKVLMSWGHDDYMYLVAKENGTTLPS  178
            ES VHHKYFKENPD NN  YNTK+GVY +E CGL+ VLMSWGHDDYMYLVAKEN TTLPS
Sbjct  178  ESNVHHKYFKENPDYNNPAYNTKHGVYSDERCGLNNVLMSWGHDDYMYLVAKENKTTLPS  237

Query  179  AALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYY  358
            A LF+IRYHSFYALH  GAY HLMNEED +N+KWL +FNKYDLYSKSKVR+DVE+VKPYY
Sbjct  238  AGLFVIRYHSFYALHTAGAYKHLMNEEDVDNLKWLHVFNKYDLYSKSKVRVDVEKVKPYY  297

Query  359  LSLIEKYFP-AKLRW  400
            LSLIEKYFP AKLRW
Sbjct  298  LSLIEKYFPTAKLRW  312



>ref|NP_001141330.1| uncharacterized protein LOC100273421 [Zea mays]
 gb|ACF78953.1| unknown [Zea mays]
 gb|ACF86090.1| unknown [Zea mays]
 gb|ACR37619.1| unknown [Zea mays]
 gb|ACR38135.1| unknown [Zea mays]
 gb|AFW86643.1| hypothetical protein ZEAMMB73_073834 [Zea mays]
Length=305

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E  VH KYFKENPD +N   NTK GVY EGCGL+KVLMSWGHDDYMYLVAKEN  TLPSA
Sbjct  173  ECNVHFKYFKENPDYHNPKLNTKLGVYSEGCGLNKVLMSWGHDDYMYLVAKENKCTLPSA  232

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAYTHLM++EDKEN+KWL +FNKYDLYSKS  RIDVEEVKPYY+
Sbjct  233  GLFIIRYHSFYPLHKHGAYTHLMDDEDKENLKWLHVFNKYDLYSKSNSRIDVEEVKPYYM  292

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKLRW
Sbjct  293  SLIDKYFPAKLRW  305



>ref|XP_002869617.1| myo-inositol oxygenase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45876.1| myo-inositol oxygenase 4 [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF +NPD +N  YNTKNG+Y EGCGL+ V+MSWGHDDYMYLVAKENG+TLPS 
Sbjct  185  ESNVHHKYFIDNPDFHNKAYNTKNGIYSEGCGLNNVMMSWGHDDYMYLVAKENGSTLPSP  244

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEEDKEN+KWL +FNKYDLYSKSKV +DVE+VKPYY+
Sbjct  245  GQFIIRYHSFYPLHTAGEYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHVDVEKVKPYYM  304

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  305  SLIKKYFPENLRW  317



>ref|XP_007039457.1| Myo-inositol oxygenase 4 isoform 3 [Theobroma cacao]
 gb|EOY23958.1| Myo-inositol oxygenase 4 isoform 3 [Theobroma cacao]
Length=280

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +S VHHKYFKENPD NN  YNTKNGVY EGCGLD VLMSWGHDDYMY+VAKENGTTLPSA
Sbjct  154  DSNVHHKYFKENPDFNNPNYNTKNGVYSEGCGLDNVLMSWGHDDYMYMVAKENGTTLPSA  213

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH+ GAYT LMNEEDKENMKWLKIFNKYDLYSKSKV +DVEEVKPYY 
Sbjct  214  GSFIIRYHSFYPLHKHGAYTQLMNEEDKENMKWLKIFNKYDLYSKSKVLVDVEEVKPYYE  273

Query  362  SLIEK  376
            SLI K
Sbjct  274  SLIAK  278



>gb|AFW86646.1| hypothetical protein ZEAMMB73_073834 [Zea mays]
Length=304

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E  VH KYFKENPD +N   NTK GVY EGCGL+KVLMSWGHDDYMYLVAKEN  TLPSA
Sbjct  172  ECNVHFKYFKENPDYHNPKLNTKLGVYSEGCGLNKVLMSWGHDDYMYLVAKENKCTLPSA  231

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAYTHLM++EDKEN+KWL +FNKYDLYSKS  RIDVEEVKPYY+
Sbjct  232  GLFIIRYHSFYPLHKHGAYTHLMDDEDKENLKWLHVFNKYDLYSKSNSRIDVEEVKPYYM  291

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKLRW
Sbjct  292  SLIDKYFPAKLRW  304



>gb|ACR38420.1| unknown [Zea mays]
Length=302

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E  VH KYFKENPD +N   NTK GVY EGCGL+KVLMSWGHDDYMYLVAKEN  TLPSA
Sbjct  170  ECNVHFKYFKENPDYHNPKLNTKLGVYSEGCGLNKVLMSWGHDDYMYLVAKENKCTLPSA  229

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAYTHLM++EDKEN+KWL +FNKYDLYSKS  RIDVEEVKPYY+
Sbjct  230  GLFIIRYHSFYPLHKHGAYTHLMDDEDKENLKWLHVFNKYDLYSKSNSRIDVEEVKPYYM  289

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKLRW
Sbjct  290  SLIDKYFPAKLRW  302



>ref|XP_009758702.1| PREDICTED: inositol oxygenase 2-like [Nicotiana sylvestris]
Length=315

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES V ++ FK NPD NN  YNTKNGVY  GCGLD V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  183  ESNVLYEQFKGNPDYNNPSYNTKNGVYSVGCGLDNVVMSWGHDDYMYLVAKENKTTLPSA  242

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LHR GAY HLMNEED EN+KWL IFNKYDLYSKS+V IDVE+VKPYY+
Sbjct  243  ALFIIRYHSFYPLHRAGAYKHLMNEEDHENLKWLHIFNKYDLYSKSRVLIDVEKVKPYYI  302

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  303  SLIEKYFPAKLKW  315



>ref|XP_010467925.1| PREDICTED: inositol oxygenase 2-like [Camelina sativa]
Length=318

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            +HHKYFK N D NN  YNTKNGVY EGCGLD VLMSWGHDDYMYLVAKENGTTLP A LF
Sbjct  188  IHHKYFKGNSDNNNPKYNTKNGVYNEGCGLDNVLMSWGHDDYMYLVAKENGTTLPHAGLF  247

Query  191  IIRYHSFYALHREGAYTHLMNEEDK-ENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSL  367
            IIRYHSFY LH+ GAYTHLMN+ED+ +++KWL +FNKYDLYSKSKV++DVE+VKPYY+SL
Sbjct  248  IIRYHSFYPLHKAGAYTHLMNDEDRDDDLKWLHVFNKYDLYSKSKVQVDVEQVKPYYVSL  307

Query  368  IEKYFPAKLRW  400
            I KYFPAKL+W
Sbjct  308  INKYFPAKLKW  318



>ref|XP_010312511.1| PREDICTED: probable inositol oxygenase isoform X2 [Solanum lycopersicum]
Length=296

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIV H+  K NPD NN  YNTK GVY EGCGL+ V+MSWGHDDYMYLVAK N TTLPSA
Sbjct  164  ESIVLHEQLKGNPDNNNPTYNTKYGVYSEGCGLNNVVMSWGHDDYMYLVAKANKTTLPSA  223

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LH+ GAY+HLMNEED EN+KWL+IF+KYDLYSKS VRIDVE+VKPYY+
Sbjct  224  ALFIIRYHSFYPLHKSGAYSHLMNEEDHENLKWLQIFSKYDLYSKSNVRIDVEKVKPYYM  283

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP+KL+W
Sbjct  284  SLIEKYFPSKLKW  296



>ref|NP_001057871.1| Os06g0561000 [Oryza sativa Japonica Group]
 sp|Q5Z8T3.1|MIOX_ORYSJ RecName: Full=Probable inositol oxygenase; AltName: Full=Myo-inositol 
oxygenase; Short=MI oxygenase [Oryza sativa Japonica 
Group]
 dbj|BAD53740.1| putative myo-inositol oxygenase [Oryza sativa Japonica Group]
 dbj|BAD53821.1| putative myo-inositol oxygenase [Oryza sativa Japonica Group]
 dbj|BAF19785.1| Os06g0561000 [Oryza sativa Japonica Group]
 gb|EAZ01345.1| hypothetical protein OsI_23379 [Oryza sativa Indica Group]
 dbj|BAG96353.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91132.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACU78065.1| myo-inositol oxygenase [Oryza sativa Japonica Group]
Length=308

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E  VH KYFKENPD  N   NTK G Y EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  176  ECNVHFKYFKENPDYLNPKLNTKFGAYSEGCGLDNVLMSWGHDDYMYLVAKENKTTLPSA  235

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAY HLMN+EDKEN+KWL++FNKYDLYSKS  RIDVE+VKPYY+
Sbjct  236  GLFIIRYHSFYPLHKHGAYMHLMNDEDKENLKWLRVFNKYDLYSKSNERIDVEKVKPYYM  295

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  296  SLIEKYFPAKLRW  308



>ref|XP_006285955.1| hypothetical protein CARUB_v10007474mg, partial [Capsella rubella]
 gb|EOA18853.1| hypothetical protein CARUB_v10007474mg, partial [Capsella rubella]
Length=163

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF ENPD +N  YNTK G+Y +GCGL+ V+MSWGHDDYMY+VAKENG+TLPSA
Sbjct  31   ESNVHHKYFLENPDFHNKAYNTKTGIYSQGCGLNNVMMSWGHDDYMYMVAKENGSTLPSA  90

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G Y HLMNEEDKEN+KWL +FNKY+L+SKSKV+I++E+VKPYY+
Sbjct  91   GQFIIRYHSFYPLHTAGEYAHLMNEEDKENLKWLHVFNKYNLHSKSKVQINIEKVKPYYM  150

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP  LRW
Sbjct  151  SLIEKYFPENLRW  163



>gb|KFK29141.1| hypothetical protein AALP_AA7G093700 [Arabis alpina]
Length=319

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF ENPD  N  YNTK G+Y EGCGL+ V+MSWGHDDYMYLVAKENG+TLPSA
Sbjct  187  ESNVHHKYFLENPDFQNQAYNTKTGIYTEGCGLNNVMMSWGHDDYMYLVAKENGSTLPSA  246

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMN+EDKEN+KWL +FNKYDLYSKSKV +DVE VKPYY+
Sbjct  247  GKFIIRYHSFYPLHTAGEYTHLMNDEDKENLKWLHVFNKYDLYSKSKVHVDVEMVKPYYM  306

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP  L+W
Sbjct  307  SLIEKYFPETLKW  319



>ref|XP_011076857.1| PREDICTED: probable inositol oxygenase [Sesamum indicum]
Length=304

 Score =   223 bits (567),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +2

Query  5    SIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAA  184
            S+VH+++FK NPD NN  YNTK GVY+EGCGL+ +LMSWGHDDYMYLVAKEN TTLPSAA
Sbjct  173  SVVHYEHFKSNPDHNNPAYNTKLGVYKEGCGLENILMSWGHDDYMYLVAKENKTTLPSAA  232

Query  185  LFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLS  364
            LFIIRYHSFYALH  GAY +LMNEED EN+KWL+IFNKYDLYSKS +R+DV++VKPYY S
Sbjct  233  LFIIRYHSFYALHTSGAYKYLMNEEDAENLKWLQIFNKYDLYSKSTIRVDVDKVKPYYTS  292

Query  365  LIEKYFPAKLRW  400
            LI+KYFP KL+W
Sbjct  293  LIQKYFPPKLKW  304



>emb|CDY41799.1| BnaC02g12100D [Brassica napus]
Length=316

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES +HHKYF ENPD N+  Y TKNG+Y EGCGL+ V MSWGHDDYMYLVAKENG+TLPSA
Sbjct  184  ESNIHHKYFMENPDFNDPNYKTKNGIYSEGCGLENVFMSWGHDDYMYLVAKENGSTLPSA  243

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ G YTHLM+EEDK+N+KWL +FN YDLYSKSKV +DVE+VKPYY+
Sbjct  244  GLFIIRYHSFYPLHKAGGYTHLMDEEDKDNLKWLHVFNNYDLYSKSKVHVDVEKVKPYYM  303

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  304  SLIKKYFPENLRW  316



>ref|XP_007221110.1| hypothetical protein PRUPE_ppa017891mg, partial [Prunus persica]
 gb|EMJ22309.1| hypothetical protein PRUPE_ppa017891mg, partial [Prunus persica]
Length=280

 Score =   222 bits (565),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E IVHHKYFKEN D NN  YNTK G+Y +GCGL+ V+MSWGH +YMYLVAKENGTTLP A
Sbjct  148  EYIVHHKYFKENLDYNNPSYNTKYGIYSQGCGLENVVMSWGHHEYMYLVAKENGTTLPQA  207

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LH+ GAY HLMN+ED+EN+KWLKI NKYDLYSKSKVR+DVE+VK YYL
Sbjct  208  ALFIIRYHSFYPLHKAGAYEHLMNKEDQENLKWLKIINKYDLYSKSKVRVDVEKVKTYYL  267

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP KLRW
Sbjct  268  SLIDKYFPTKLRW  280



>ref|XP_011008897.1| PREDICTED: inositol oxygenase 2 [Populus euphratica]
Length=310

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF +NPD  N  Y+TKNG+YEEGCGLD V++SWGHDDYMYLVAKENGTTLP A
Sbjct  178  ESNVHHKYFTDNPDFKNPAYSTKNGIYEEGCGLDNVVISWGHDDYMYLVAKENGTTLPHA  237

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHS Y LH+ GAY HLMNEED+E++KWL IFNKYDLYSKSKV +DV+EVKPYY 
Sbjct  238  ALFIIRYHSLYPLHKAGAYKHLMNEEDEEDLKWLNIFNKYDLYSKSKVLVDVDEVKPYYQ  297

Query  362  SLIEKYFPAKLRW  400
            SLI+KYF  KLRW
Sbjct  298  SLIKKYFTEKLRW  310



>ref|XP_006284128.1| hypothetical protein CARUB_v10005260mg [Capsella rubella]
 gb|EOA17026.1| hypothetical protein CARUB_v10005260mg [Capsella rubella]
Length=321

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF ENPD +N  YNTK G+Y EGCGL+ V+MSWGHDDYMY+VAKENG+TLPSA
Sbjct  189  ESNVHHKYFMENPDFHNKAYNTKTGIYSEGCGLNNVMMSWGHDDYMYMVAKENGSTLPSA  248

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G Y HLMNEEDKEN+KWL +FNKYDLYSKSKV +DVE+VKPYY+
Sbjct  249  GQFIIRYHSFYPLHTAGEYKHLMNEEDKENLKWLHVFNKYDLYSKSKVHVDVEKVKPYYM  308

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  309  SLIKKYFPENLRW  321



>ref|XP_009590853.1| PREDICTED: inositol oxygenase 2-like [Nicotiana tomentosiformis]
Length=315

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES V ++ FK NPD NN  YNTKNGVY EGCGLD V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  183  ESNVLYEQFKGNPDYNNPAYNTKNGVYSEGCGLDNVVMSWGHDDYMYLVAKENKTTLPSA  242

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LHR GAY +LMNE+D EN+KWL IFNKYDLYSKS+V IDVE+VKPYY+
Sbjct  243  ALFIIRYHSFYPLHRAGAYKYLMNEDDHENLKWLHIFNKYDLYSKSRVLIDVEKVKPYYI  302

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKL+W
Sbjct  303  SLIEKYFPAKLKW  315



>ref|XP_006656167.1| PREDICTED: probable inositol oxygenase-like [Oryza brachyantha]
Length=304

 Score =   222 bits (566),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E  VH KYFK+NPD +N  +NTK G Y EGCGL+ VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  172  ECNVHFKYFKDNPDYHNPKFNTKFGAYSEGCGLENVLMSWGHDDYMYLVAKENKTTLPSA  231

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAY HLMN+EDKEN+KWL +FNKYDLYSKS VRIDVE+VKPYY+
Sbjct  232  GLFIIRYHSFYPLHKHGAYMHLMNDEDKENLKWLHVFNKYDLYSKSNVRIDVEKVKPYYM  291

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKLRW
Sbjct  292  SLIDKYFPAKLRW  304



>ref|XP_008459136.1| PREDICTED: inositol oxygenase 2-like [Cucumis melo]
Length=428

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +SIVHHKYFK+N D  N  YNTK G+Y  GCGLD V++SWGHDDYMYLVAKENGTTLP A
Sbjct  296  KSIVHHKYFKDNIDSYNPAYNTKYGIYSPGCGLDNVVISWGHDDYMYLVAKENGTTLPDA  355

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+EGAY HLMN+ED ENMKWL IFNKYDLYSKSKV +DVE+VKPYY 
Sbjct  356  GLFIIRYHSFYPLHKEGAYQHLMNKEDAENMKWLHIFNKYDLYSKSKVLVDVEKVKPYYQ  415

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKL+W
Sbjct  416  SLIQKYFPAKLKW  428



>gb|EAZ37359.1| hypothetical protein OsJ_21699 [Oryza sativa Japonica Group]
Length=379

 Score =   224 bits (571),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E  VH KYFKENPD  N   NTK G Y EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  247  ECNVHFKYFKENPDYLNPKLNTKFGAYSEGCGLDNVLMSWGHDDYMYLVAKENKTTLPSA  306

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAY HLMN+EDKEN+KWL++FNKYDLYSKS  RIDVE+VKPYY+
Sbjct  307  GLFIIRYHSFYPLHKHGAYMHLMNDEDKENLKWLRVFNKYDLYSKSNERIDVEKVKPYYM  366

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  367  SLIEKYFPAKLRW  379



>ref|XP_003563752.1| PREDICTED: probable inositol oxygenase [Brachypodium distachyon]
Length=303

 Score =   221 bits (564),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E  VH KY KENPD +N  +NTK G Y EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  171  ECNVHFKYLKENPDYHNPEFNTKFGAYSEGCGLDNVLMSWGHDDYMYLVAKENKTTLPSA  230

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAY HLMNEED EN+KWL +FNKYDLYSKS VRIDVE+VKPYY+
Sbjct  231  GLFIIRYHSFYPLHKHGAYMHLMNEEDNENLKWLHVFNKYDLYSKSSVRIDVEKVKPYYM  290

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP KLRW
Sbjct  291  SLIEKYFPDKLRW  303



>ref|XP_007158875.1| hypothetical protein PHAVU_002G189100g, partial [Phaseolus vulgaris]
 gb|ESW30869.1| hypothetical protein PHAVU_002G189100g, partial [Phaseolus vulgaris]
Length=272

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES +HHKYFK NPD     Y TKNG+Y EGC L  V+MSWGHD+YMYLVAK+NG+TLPSA
Sbjct  140  ESNIHHKYFKNNPDYQCPAYKTKNGIYNEGCRLQNVMMSWGHDEYMYLVAKKNGSTLPSA  199

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIR+HSFY LH+EGAYTHLMNEED EN+KWL++FNKYDLYSKSKV +DVE+VKPYY+
Sbjct  200  GLFIIRFHSFYPLHKEGAYTHLMNEEDVENLKWLEVFNKYDLYSKSKVLVDVEKVKPYYM  259

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFP KL+W
Sbjct  260  SLIEKYFPVKLKW  272



>ref|XP_010536842.1| PREDICTED: inositol oxygenase 4-like isoform X2 [Tarenaya hassleriana]
Length=296

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +S VH+KYFK NPD  N  YNTK G+Y +GCGLD V MSWGHDDYMYLVAKENG+TLPS 
Sbjct  164  DSNVHNKYFKGNPDYKNPSYNTKCGIYTQGCGLDNVRMSWGHDDYMYLVAKENGSTLPSP  223

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH  GAYTHLMNE+D+EN+KWL +FNKYDLYSKSKV IDVE+VKPYY+
Sbjct  224  GLFIIRYHSFYPLHTAGAYTHLMNEQDRENLKWLHVFNKYDLYSKSKVLIDVEKVKPYYI  283

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP KLRW
Sbjct  284  SLINKYFPEKLRW  296



>ref|XP_007160261.1| hypothetical protein PHAVU_002G306300g [Phaseolus vulgaris]
 gb|ESW32255.1| hypothetical protein PHAVU_002G306300g [Phaseolus vulgaris]
Length=256

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES +HHKYFK NPD     YNTKN +Y EGCGL  V+MSWGHD+YMYLVAK+NG+TLPSA
Sbjct  124  ESNIHHKYFKNNPDYQCPAYNTKNEIYTEGCGLQNVMMSWGHDEYMYLVAKKNGSTLPSA  183

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIR+HSFY LH+EGAYTHLMNEED +++KWL++FNKYDLYSKSKV +DVE+VK YY+
Sbjct  184  GLFIIRFHSFYPLHKEGAYTHLMNEEDVKDLKWLEVFNKYDLYSKSKVLVDVEKVKSYYM  243

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  244  SLIEKYFPAKLRW  256



>ref|XP_007039458.1| Myo-inositol oxygenase 4 isoform 4 [Theobroma cacao]
 gb|EOY23959.1| Myo-inositol oxygenase 4 isoform 4 [Theobroma cacao]
Length=280

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 112/133 (84%), Gaps = 6/133 (5%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +S VHHKYFKENPD NN  YNTKNGVY EGCGLD VLMSWGHDDYMY+VAKENGTTLPSA
Sbjct  154  DSNVHHKYFKENPDFNNPNYNTKNGVYSEGCGLDNVLMSWGHDDYMYMVAKENGTTLPSA  213

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH+ GAYT LMNEEDKENMKWLKIFN      KSKV +DVEEVKPYY 
Sbjct  214  GSFIIRYHSFYPLHKHGAYTQLMNEEDKENMKWLKIFN------KSKVLVDVEEVKPYYE  267

Query  362  SLIEKYFPAKLRW  400
            SLI KYFPAKL W
Sbjct  268  SLIAKYFPAKLNW  280



>ref|XP_010448298.1| PREDICTED: inositol oxygenase 4-like isoform X3 [Camelina sativa]
Length=319

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF EN D +N  YNTKNG+Y +GCGL+ V+MSWGHDDYMY+V KENG+TLPSA
Sbjct  187  ESNVHHKYFMENQDFHNKNYNTKNGIYSQGCGLNNVMMSWGHDDYMYMVVKENGSTLPSA  246

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEEDKEN+KWL +FNKYDLYSKSKV IDVE+VKPYY+
Sbjct  247  GQFIIRYHSFYPLHTAGEYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHIDVEKVKPYYM  306

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  307  SLIKKYFPENLRW  319



>ref|XP_010536841.1| PREDICTED: inositol oxygenase 4-like isoform X1 [Tarenaya hassleriana]
Length=316

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +S VH+KYFK NPD  N  YNTK G+Y +GCGLD V MSWGHDDYMYLVAKENG+TLPS 
Sbjct  184  DSNVHNKYFKGNPDYKNPSYNTKCGIYTQGCGLDNVRMSWGHDDYMYLVAKENGSTLPSP  243

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH  GAYTHLMNE+D+EN+KWL +FNKYDLYSKSKV IDVE+VKPYY+
Sbjct  244  GLFIIRYHSFYPLHTAGAYTHLMNEQDRENLKWLHVFNKYDLYSKSKVLIDVEKVKPYYI  303

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP KLRW
Sbjct  304  SLINKYFPEKLRW  316



>ref|XP_010448299.1| PREDICTED: inositol oxygenase 4-like isoform X4 [Camelina sativa]
Length=318

 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF EN D +N  YNTKNG+Y +GCGL+ V+MSWGHDDYMY+V KENG+TLPSA
Sbjct  186  ESNVHHKYFMENQDFHNKNYNTKNGIYSQGCGLNNVMMSWGHDDYMYMVVKENGSTLPSA  245

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEEDKEN+KWL +FNKYDLYSKSKV IDVE+VKPYY+
Sbjct  246  GQFIIRYHSFYPLHTAGEYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHIDVEKVKPYYM  305

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  306  SLIKKYFPENLRW  318



>emb|CAN78063.1| hypothetical protein VITISV_036400 [Vitis vinifera]
Length=309

 Score =   219 bits (559),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E+ VHHKYFKENPD NN  Y+TKNG+Y EGCGLD V++SWGHDDYMYLVAKEN +TLP A
Sbjct  177  EANVHHKYFKENPDYNNPHYSTKNGIYSEGCGLDNVMISWGHDDYMYLVAKENKSTLPPA  236

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LHR GAY HLMNEED EN+KWL IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  237  ALFIIRYHSFYPLHRHGAYKHLMNEEDVENLKWLHIFNKYDLYSKSKVRIDVEKVKPYYL  296

Query  362  SLIEKYFPAKL  394
            SLIEK  P  L
Sbjct  297  SLIEKVKPPLL  307



>ref|XP_006371960.1| hypothetical protein POPTR_0018s06700g [Populus trichocarpa]
 gb|ERP49757.1| hypothetical protein POPTR_0018s06700g [Populus trichocarpa]
Length=310

 Score =   219 bits (558),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF +NPD  N  Y+TKNG+Y+EGCGLD V++SWGHDDYMYLVAKENGTTLP A
Sbjct  178  ESNVHHKYFTDNPDFKNPAYSTKNGIYKEGCGLDNVVISWGHDDYMYLVAKENGTTLPHA  237

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHS Y LH+ GAY HLMN+ED+E++KWL IFNKYDLYSKSKV +DV+EVKPYY 
Sbjct  238  ALFIIRYHSLYPLHKAGAYKHLMNKEDEEDLKWLNIFNKYDLYSKSKVLVDVDEVKPYYQ  297

Query  362  SLIEKYFPAKLRW  400
            SLI+KYF  KLRW
Sbjct  298  SLIKKYFTEKLRW  310



>ref|XP_004298756.1| PREDICTED: inositol oxygenase 1-like [Fragaria vesca subsp. vesca]
Length=326

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 119/134 (89%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYN-TKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPS  178
            +SIVHH+YFK+NPD N+  YN T+ G+Y  G GL  VLMSWGHDDYMYLVAKENGTTLP 
Sbjct  193  DSIVHHRYFKDNPDYNSPEYNSTQYGIYAHGIGLKNVLMSWGHDDYMYLVAKENGTTLPE  252

Query  179  AALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYY  358
            A LFIIRYHSFY LH+ GAY HLM++ED+EN+KWLKIFNKYDLYSKSKVRIDVE+VKPYY
Sbjct  253  AGLFIIRYHSFYPLHKCGAYKHLMSKEDEENLKWLKIFNKYDLYSKSKVRIDVEKVKPYY  312

Query  359  LSLIEKYFPAKLRW  400
            +SL+EKYFPAKL+W
Sbjct  313  MSLVEKYFPAKLKW  326



>ref|XP_010438782.1| PREDICTED: inositol oxygenase 4 isoform X3 [Camelina sativa]
Length=281

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF EN D +N  YNTKNG+Y + CGL+ V+MSWGHDDYMYLVAKENG+TLPSA
Sbjct  149  ESNVHHKYFMENQDFHNKAYNTKNGIYSQRCGLNNVMMSWGHDDYMYLVAKENGSTLPSA  208

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH    YTHLMNEEDKEN+KWL +FNKYDLYSKSKV IDVE+VKPYY+
Sbjct  209  GQFIIRYHSFYPLHTAREYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHIDVEKVKPYYM  268

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  269  SLIKKYFPENLRW  281



>ref|XP_010924477.1| PREDICTED: probable inositol oxygenase [Elaeis guineensis]
Length=310

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHH+YFK NPD NN L+ T+ G+Y+E CGLD V MSWGHD+YMYLV K NGT+LP A
Sbjct  178  ESIVHHQYFKNNPDYNNPLFRTRLGIYKENCGLDNVTMSWGHDEYMYLVMKGNGTSLPPA  237

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            A FI+R+HSFY LHR GAYT+LMN+EDK+ +KWL +FNKYDLY+KSKVR+DVEEVKPYY+
Sbjct  238  AFFIVRFHSFYPLHRAGAYTYLMNDEDKDMLKWLHVFNKYDLYTKSKVRVDVEEVKPYYM  297

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP KLRW
Sbjct  298  SLIKKYFPEKLRW  310



>gb|KHG19184.1| Inositol oxygenase 1 -like protein [Gossypium arboreum]
Length=327

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            +SIVHHKYF+ENPD +N+ YNTK GVY EGCGL+ V+MSWGHDDYMYLVAK N TTLP A
Sbjct  172  KSIVHHKYFEENPDYHNSDYNTKYGVYSEGCGLNNVMMSWGHDDYMYLVAKGNNTTLPPA  231

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALH+ GAY HLMNEED ENMKWL+IFNKYDLYSKSKVRIDVE+VKPYYL
Sbjct  232  ALFIIRYHSFYALHKSGAYRHLMNEEDTENMKWLQIFNKYDLYSKSKVRIDVEKVKPYYL  291

Query  362  SLIEK  376
            SLI+K
Sbjct  292  SLIKK  296



>ref|XP_006413210.1| hypothetical protein EUTSA_v10025773mg [Eutrema salsugineum]
 gb|ESQ54663.1| hypothetical protein EUTSA_v10025773mg [Eutrema salsugineum]
Length=313

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF ENPD +N  YNTKNG+Y EGCGL+ V+MSWGHDDYMY+V KEN +TLPSA
Sbjct  181  ESNVHHKYFLENPDFHNQAYNTKNGIYTEGCGLNNVMMSWGHDDYMYMVVKENRSTLPSA  240

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEEDK N+KWL +FN+YDLYSKSKV +DVE+VKPYY+
Sbjct  241  GQFIIRYHSFYPLHTAGEYTHLMNEEDKRNLKWLHVFNQYDLYSKSKVHVDVEKVKPYYM  300

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  L+W
Sbjct  301  SLIKKYFPESLKW  313



>ref|XP_010448296.1| PREDICTED: inositol oxygenase 4-like isoform X1 [Camelina sativa]
Length=400

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF EN D +N  YNTKNG+Y +GCGL+ V+MSWGHDDYMY+V KENG+TLPSA
Sbjct  268  ESNVHHKYFMENQDFHNKNYNTKNGIYSQGCGLNNVMMSWGHDDYMYMVVKENGSTLPSA  327

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEEDKEN+KWL +FNKYDLYSKSKV IDVE+VKPYY+
Sbjct  328  GQFIIRYHSFYPLHTAGEYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHIDVEKVKPYYM  387

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  388  SLIKKYFPENLRW  400



>ref|XP_010438781.1| PREDICTED: inositol oxygenase 4 isoform X2 [Camelina sativa]
Length=318

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF EN D +N  YNTKNG+Y + CGL+ V+MSWGHDDYMYLVAKENG+TLPSA
Sbjct  186  ESNVHHKYFMENQDFHNKAYNTKNGIYSQRCGLNNVMMSWGHDDYMYLVAKENGSTLPSA  245

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH    YTHLMNEEDKEN+KWL +FNKYDLYSKSKV IDVE+VKPYY+
Sbjct  246  GQFIIRYHSFYPLHTAREYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHIDVEKVKPYYM  305

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  306  SLIKKYFPENLRW  318



>ref|XP_010448297.1| PREDICTED: inositol oxygenase 4-like isoform X2 [Camelina sativa]
Length=397

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF EN D +N  YNTKNG+Y +GCGL+ V+MSWGHDDYMY+V KENG+TLPSA
Sbjct  265  ESNVHHKYFMENQDFHNKNYNTKNGIYSQGCGLNNVMMSWGHDDYMYMVVKENGSTLPSA  324

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEEDKEN+KWL +FNKYDLYSKSKV IDVE+VKPYY+
Sbjct  325  GQFIIRYHSFYPLHTAGEYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHIDVEKVKPYYM  384

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  385  SLIKKYFPENLRW  397



>ref|XP_010438780.1| PREDICTED: inositol oxygenase 4 isoform X1 [Camelina sativa]
Length=319

 Score =   217 bits (553),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYF EN D +N  YNTKNG+Y + CGL+ V+MSWGHDDYMYLVAKENG+TLPSA
Sbjct  187  ESNVHHKYFMENQDFHNKAYNTKNGIYSQRCGLNNVMMSWGHDDYMYLVAKENGSTLPSA  246

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH    YTHLMNEEDKEN+KWL +FNKYDLYSKSKV IDVE+VKPYY+
Sbjct  247  GQFIIRYHSFYPLHTAREYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHIDVEKVKPYYM  306

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  307  SLIKKYFPENLRW  319



>ref|XP_009408907.1| PREDICTED: probable inositol oxygenase [Musa acuminata subsp. 
malaccensis]
Length=305

 Score =   217 bits (552),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    ESIVHHK--YFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLP  175
            E  VHHK  YF ENPD  N  YNTK GVY EGCGLD VLMSWGHDD+MYLVAKEN T+LP
Sbjct  171  ECNVHHKELYFAENPDHLNPKYNTKLGVYSEGCGLDNVLMSWGHDDFMYLVAKENKTSLP  230

Query  176  SAALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPY  355
             A LFIIRYHSFY LH+ GAY +LMNEEDKEN+KWL +FNKYDLYSKSKVRI VE+VKPY
Sbjct  231  LAGLFIIRYHSFYPLHKHGAYQYLMNEEDKENLKWLHVFNKYDLYSKSKVRIHVEKVKPY  290

Query  356  YLSLIEKYFPAKLRW  400
            YLSLIEKYFPAKL+W
Sbjct  291  YLSLIEKYFPAKLKW  305



>gb|KDO53720.1| hypothetical protein CISIN_1g021944mg [Citrus sinensis]
Length=305

 Score =   217 bits (552),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD +N  +NT+ GVY EGCGLD V+MSWGHDDYMYLVAKEN TTLPSA
Sbjct  172  ESIVHHKYFKENPDYSNPAFNTEYGVYSEGCGLDNVMMSWGHDDYMYLVAKENKTTLPSA  231

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALH+  AY HLMNEED EN+KWL+ F+KYDLYSKSKVRIDVE+VKPYYL
Sbjct  232  ALFIIRYHSFYALHKSEAYKHLMNEEDVENLKWLETFSKYDLYSKSKVRIDVEKVKPYYL  291

Query  362  SLIEK  376
            SLIEK
Sbjct  292  SLIEK  296



>ref|XP_010433529.1| PREDICTED: inositol oxygenase 4-like isoform X5 [Camelina sativa]
 ref|XP_010433530.1| PREDICTED: inositol oxygenase 4-like isoform X5 [Camelina sativa]
Length=281

 Score =   216 bits (550),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHH YF +N D +N  YNTKNG+Y +GCGL+ V+MSWGHDDYMYLVAKENG+TLPSA
Sbjct  149  ESNVHHMYFMKNQDFHNKAYNTKNGIYSQGCGLNNVMMSWGHDDYMYLVAKENGSTLPSA  208

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEED EN+KWL +FNKY+LYSKSKV IDVE+VKPYY+
Sbjct  209  GQFIIRYHSFYPLHTAGEYTHLMNEEDTENLKWLHVFNKYELYSKSKVHIDVEKVKPYYM  268

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  269  SLIKKYFPENLRW  281



>ref|XP_004287501.1| PREDICTED: inositol oxygenase 4-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   218 bits (554),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYF+ NPD NN LYNTKNG+Y EGCGL+ V++SWGHDDYMYLVAKENGTTLP A
Sbjct  209  ESIVHHKYFEGNPDHNNPLYNTKNGIYSEGCGLENVMISWGHDDYMYLVAKENGTTLPEA  268

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LF+IRYHSFY LH+ GAY HLMNEEDKEN+KWL IFNKYDLYSKSKVR+DV++VKPYYL
Sbjct  269  GLFVIRYHSFYPLHKSGAYKHLMNEEDKENLKWLNIFNKYDLYSKSKVRVDVKKVKPYYL  328

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFPAKLRW
Sbjct  329  SLIDKYFPAKLRW  341



>gb|ABK24160.1| unknown [Picea sitchensis]
Length=316

 Score =   216 bits (551),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVH++YF ENPD  N  YNTK GVY E CGL+ V++SWGHD+YM++VAK N TTLP A
Sbjct  184  ESIVHYEYFNENPDFYNPKYNTKYGVYSEKCGLENVIISWGHDEYMHMVAKMNKTTLPPA  243

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIR+HSFYA+HR GAYTHLMN+EDKE ++W+KIFNKYDLYSKSKVR+DVEEVKPYY 
Sbjct  244  ALFIIRFHSFYAMHRAGAYTHLMNDEDKEMLEWVKIFNKYDLYSKSKVRVDVEEVKPYYQ  303

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP+KLRW
Sbjct  304  SLIDKYFPSKLRW  316



>ref|XP_010433528.1| PREDICTED: inositol oxygenase 4-like isoform X4 [Camelina sativa]
Length=319

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHH YF +N D +N  YNTKNG+Y +GCGL+ V+MSWGHDDYMYLVAKENG+TLPSA
Sbjct  187  ESNVHHMYFMKNQDFHNKAYNTKNGIYSQGCGLNNVMMSWGHDDYMYLVAKENGSTLPSA  246

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEED EN+KWL +FNKY+LYSKSKV IDVE+VKPYY+
Sbjct  247  GQFIIRYHSFYPLHTAGEYTHLMNEEDTENLKWLHVFNKYELYSKSKVHIDVEKVKPYYM  306

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  307  SLIKKYFPENLRW  319



>ref|XP_006853782.1| hypothetical protein AMTR_s00056p00209200 [Amborella trichopoda]
 gb|ERN15249.1| hypothetical protein AMTR_s00056p00209200 [Amborella trichopoda]
Length=217

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E+IVH++YFK+NPD  + +YNTK GVY E CGLDKV MSWGHD+YMY VAKEN TTLP+A
Sbjct  85   EAIVHNQYFKDNPDSKHLVYNTKLGVYTENCGLDKVTMSWGHDEYMYRVAKENCTTLPAA  144

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIR+HSFYA+HR  +Y +LMNEED+E +KWL+IFNKYDLYSKSKVRI+ EEVKPYYL
Sbjct  145  GLFIIRFHSFYAMHRSDSYKYLMNEEDEEMLKWLRIFNKYDLYSKSKVRINQEEVKPYYL  204

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP KLRW
Sbjct  205  SLIKKYFPEKLRW  217



>ref|XP_010909937.1| PREDICTED: probable inositol oxygenase [Elaeis guineensis]
Length=301

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVH++YFKENPD +N L+ T+ GVY E CGL+ V +SWGHD+YMYLV K NG TLP A
Sbjct  169  ESIVHYQYFKENPDYDNPLFRTRLGVYNENCGLENVTISWGHDEYMYLVMKGNGATLPPA  228

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            A FI+R+HSFY+LHR GAYT+LMN+EDK+ +KWL++FNKYDLYSKSKVRIDVEEVKPYY+
Sbjct  229  AFFIVRFHSFYSLHRAGAYTYLMNDEDKDMLKWLRVFNKYDLYSKSKVRIDVEEVKPYYM  288

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP KLRW
Sbjct  289  SLINKYFPEKLRW  301



>ref|XP_009395731.1| PREDICTED: inositol oxygenase 1-like [Musa acuminata subsp. malaccensis]
Length=305

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHH+YFKENPD NN+L+ T+ GVY E CGLDKV MSWGHD+YMYLV K N T LP A
Sbjct  173  ESIVHHRYFKENPDYNNSLFRTRLGVYTENCGLDKVTMSWGHDEYMYLVMKGNETKLPPA  232

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFI+R+HSFYALH   AYT+LMNE+D+E +KWL +FNKYDLYSKSKV+ID+EEVKPYYL
Sbjct  233  ALFIVRFHSFYALHHSVAYTYLMNEDDREMLKWLLVFNKYDLYSKSKVKIDLEEVKPYYL  292

Query  362  SLIEKYFPAKLRW  400
            SLI KYFP KLRW
Sbjct  293  SLIGKYFPEKLRW  305



>gb|AAF43953.1|AC012188_30 Strong similarity to an unknown protein from Arabidopsis thaliana 
gb|AL049171.1 [Arabidopsis thaliana]
Length=422

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ESIVHHKYFKENPD +N  YN+K G+Y EGCGLD VLMSWGHDDYMYLVAKEN TTLPSA
Sbjct  177  ESIVHHKYFKENPDYDNPSYNSKYGIYTEGCGLDNVLMSWGHDDYMYLVAKENQTTLPSA  236

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFYALH+  AY HLMN ED+ENMKWLK+FNKYDLYSKSKVR++VEEVKPYYL
Sbjct  237  GLFIIRYHSFYALHKSEAYKHLMNNEDRENMKWLKVFNKYDLYSKSKVRVNVEEVKPYYL  296

Query  362  SLIEKYFPAKL  394
            SL  K   + +
Sbjct  297  SLTNKVMESTV  307



>ref|XP_010433527.1| PREDICTED: inositol oxygenase 4-like isoform X3 [Camelina sativa]
Length=422

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHH YF +N D +N  YNTKNG+Y +GCGL+ V+MSWGHDDYMYLVAKENG+TLPSA
Sbjct  290  ESNVHHMYFMKNQDFHNKAYNTKNGIYSQGCGLNNVMMSWGHDDYMYLVAKENGSTLPSA  349

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEED EN+KWL +FNKY+LYSKSKV IDVE+VKPYY+
Sbjct  350  GQFIIRYHSFYPLHTAGEYTHLMNEEDTENLKWLHVFNKYELYSKSKVHIDVEKVKPYYM  409

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  410  SLIKKYFPENLRW  422



>ref|XP_010433526.1| PREDICTED: inositol oxygenase 4-like isoform X2 [Camelina sativa]
Length=423

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHH YF +N D +N  YNTKNG+Y +GCGL+ V+MSWGHDDYMYLVAKENG+TLPSA
Sbjct  291  ESNVHHMYFMKNQDFHNKAYNTKNGIYSQGCGLNNVMMSWGHDDYMYLVAKENGSTLPSA  350

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEED EN+KWL +FNKY+LYSKSKV IDVE+VKPYY+
Sbjct  351  GQFIIRYHSFYPLHTAGEYTHLMNEEDTENLKWLHVFNKYELYSKSKVHIDVEKVKPYYM  410

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  411  SLIKKYFPENLRW  423



>ref|XP_010433525.1| PREDICTED: inositol oxygenase 4-like isoform X1 [Camelina sativa]
Length=424

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHH YF +N D +N  YNTKNG+Y +GCGL+ V+MSWGHDDYMYLVAKENG+TLPSA
Sbjct  292  ESNVHHMYFMKNQDFHNKAYNTKNGIYSQGCGLNNVMMSWGHDDYMYLVAKENGSTLPSA  351

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
              FIIRYHSFY LH  G YTHLMNEED EN+KWL +FNKY+LYSKSKV IDVE+VKPYY+
Sbjct  352  GQFIIRYHSFYPLHTAGEYTHLMNEEDTENLKWLHVFNKYELYSKSKVHIDVEKVKPYYM  411

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP  LRW
Sbjct  412  SLIKKYFPENLRW  424



>ref|XP_004503512.1| PREDICTED: inositol oxygenase 2-like isoform X1 [Cicer arietinum]
Length=322

 Score =   212 bits (539),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES V HKYFK+N D     Y+TKNG+Y EGCGLD V MSWGHDDYMY VAKENGTTLP A
Sbjct  181  ESNVLHKYFKDNLDTKCPAYSTKNGIYTEGCGLDNVTMSWGHDDYMYWVAKENGTTLPPA  240

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LHREGAYTHLMNEED+EN+KWL +FNKYDLYSKSKV IDVEEVKPYYL
Sbjct  241  GLFIIRYHSFYPLHREGAYTHLMNEEDRENLKWLHVFNKYDLYSKSKVLIDVEEVKPYYL  300

Query  362  SLIEK  376
            SLIEK
Sbjct  301  SLIEK  305



>ref|XP_010244377.1| PREDICTED: probable inositol oxygenase isoform X2 [Nelumbo nucifera]
Length=408

 Score =   214 bits (545),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E IVHH+YFK NPD  N  + TK G+Y E CGLDKV MSWGHD+YMYLVAK N TTLP A
Sbjct  276  ECIVHHQYFKGNPDHQNPTFRTKLGIYSENCGLDKVTMSWGHDEYMYLVAKGNKTTLPPA  335

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIR+HSFYALHR GAYT+LMN++DKE +KWL++F+KYDLYSKS V+I+ EEVK YYL
Sbjct  336  ALFIIRFHSFYALHRSGAYTYLMNDDDKEMLKWLQVFSKYDLYSKSNVKINQEEVKAYYL  395

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  396  SLIEKYFPAKLRW  408



>ref|XP_010244376.1| PREDICTED: probable inositol oxygenase isoform X1 [Nelumbo nucifera]
Length=410

 Score =   214 bits (545),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E IVHH+YFK NPD  N  + TK G+Y E CGLDKV MSWGHD+YMYLVAK N TTLP A
Sbjct  278  ECIVHHQYFKGNPDHQNPTFRTKLGIYSENCGLDKVTMSWGHDEYMYLVAKGNKTTLPPA  337

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIR+HSFYALHR GAYT+LMN++DKE +KWL++F+KYDLYSKS V+I+ EEVK YYL
Sbjct  338  ALFIIRFHSFYALHRSGAYTYLMNDDDKEMLKWLQVFSKYDLYSKSNVKINQEEVKAYYL  397

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAKLRW
Sbjct  398  SLIEKYFPAKLRW  410



>ref|XP_011093670.1| PREDICTED: inositol oxygenase 1-like [Sesamum indicum]
Length=320

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E+IVHHK+F +NPD  N  YNTK G+Y + CGL+ V MSWGHD+YMYLVAK N TTLP A
Sbjct  188  EAIVHHKFFIQNPDSRNPEYNTKLGIYIDNCGLENVTMSWGHDEYMYLVAKGNNTTLPPA  247

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFYALH+ GAYT+LMN EDKE ++WL +F KYDLYSKS+VRI+ EEVKPYYL
Sbjct  248  ALFIIRYHSFYALHQGGAYTYLMNNEDKEMLEWLHVFKKYDLYSKSRVRINQEEVKPYYL  307

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPA+LRW
Sbjct  308  SLIEKYFPARLRW  320



>emb|CDP11052.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 116/138 (84%), Gaps = 5/138 (4%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E IVH ++FK++PD NN  YNTK+GVY EGCGL+ VLMSWGHDDYMYLVAKEN TTLP A
Sbjct  108  EPIVHQEFFKDSPDHNNPAYNTKHGVYTEGCGLENVLMSWGHDDYMYLVAKENKTTLPPA  167

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRY+SFYALH+ G Y HLMNEED EN+KW +IFNKYDLYSK KVRI V++VKPYY 
Sbjct  168  ALFIIRYYSFYALHKAGTYKHLMNEEDVENLKWFQIFNKYDLYSKIKVRIYVDKVKPYYQ  227

Query  362  SLIEK-----YFPAKLRW  400
            SLIEK     YFP+KL+W
Sbjct  228  SLIEKYHYLWYFPSKLKW  245



>ref|XP_007158873.1| hypothetical protein PHAVU_002G1889000g, partial [Phaseolus vulgaris]
 gb|ESW30867.1| hypothetical protein PHAVU_002G1889000g, partial [Phaseolus vulgaris]
Length=269

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES +HHKYFK NPD     Y TKNG+Y EGCGL  V+MSWGHD+YMYLVAK+NG+TLPSA
Sbjct  145  ESNIHHKYFKNNPDYQCPAYQTKNGIYTEGCGLQNVMMSWGHDEYMYLVAKKNGSTLPSA  204

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIR+HSFY LH+EGAYTHLMNEED EN+KWL++FNKYDLYSKSKV +DVE+VKPYY+
Sbjct  205  GLFIIRFHSFYPLHKEGAYTHLMNEEDVENLKWLEVFNKYDLYSKSKVLVDVEKVKPYYM  264

Query  362  SLIEK  376
            SLIEK
Sbjct  265  SLIEK  269



>ref|XP_006451361.1| hypothetical protein CICLE_v10010267mg [Citrus clementina]
 gb|ESR64601.1| hypothetical protein CICLE_v10010267mg [Citrus clementina]
Length=313

 Score =   207 bits (526),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +2

Query  5    SIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAA  184
            +IVHH++FKENPD  N  +NTK G+Y E  GLD + MSWGHD+YM LVAK N TTLP A 
Sbjct  182  NIVHHQFFKENPDSRNPAFNTKLGIYSENIGLDNITMSWGHDEYMCLVAKGNNTTLPPAG  241

Query  185  LFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLS  364
            LFIIR+HSFYA+HR GAYT LMN+EDKE +KWL++FNKYDLYSKSKV+I+ EEVKPYYLS
Sbjct  242  LFIIRFHSFYAMHRHGAYTFLMNDEDKEMLKWLQVFNKYDLYSKSKVKINQEEVKPYYLS  301

Query  365  LIEKYFPAKLRW  400
            LI+KYFP KL+W
Sbjct  302  LIKKYFPEKLKW  313



>gb|ACU19277.1| unknown [Glycine max]
Length=306

 Score =   206 bits (525),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 110/133 (83%), Gaps = 6/133 (5%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES VHHKYFK+NPD     Y+TKNG+Y EGCGLD ++MSWGHDDYMY+VAK NGTTLP A
Sbjct  180  ESNVHHKYFKDNPDYKCPAYSTKNGIYTEGCGLDNIVMSWGHDDYMYMVAKANGTTLPFA  239

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFI RYH FY LH+EGAYTH MNEED EN+KWLKIFN      KSKV +DVE+VKPYY+
Sbjct  240  GLFIFRYHFFYPLHKEGAYTHFMNEEDVENLKWLKIFN------KSKVLVDVEKVKPYYV  293

Query  362  SLIEKYFPAKLRW  400
            SLIEKYFPAK+RW
Sbjct  294  SLIEKYFPAKVRW  306



>ref|XP_006298167.1| hypothetical protein CARUB_v10014217mg, partial [Capsella rubella]
 gb|EOA31065.1| hypothetical protein CARUB_v10014217mg, partial [Capsella rubella]
Length=315

 Score =   207 bits (526),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  11   VHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALF  190
            +HHKYFK N D NN  YNTKNGVY EGCGLD VLMSWGHDDYMYLVAKENGTTLP AALF
Sbjct  174  IHHKYFKGNSDNNNPKYNTKNGVYSEGCGLDNVLMSWGHDDYMYLVAKENGTTLPHAALF  233

Query  191  IIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLI  370
            IIRYHSFY LH   AYT LMN+ED++++KWL +FNKYDLYSKSKV +DVE+VKPYY+SLI
Sbjct  234  IIRYHSFYPLHTAAAYTQLMNDEDRDDLKWLHVFNKYDLYSKSKVHVDVEQVKPYYISLI  293

Query  371  EK  376
             K
Sbjct  294  NK  295



>gb|EMS59186.1| putative inositol oxygenase [Triticum urartu]
Length=562

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E  VH KYFKENPD +N  +NTK G Y EGCGLD VLMSWGHDDYM LVAKEN TTLPSA
Sbjct  267  ECNVHFKYFKENPDYHNPEFNTKFGAYSEGCGLDNVLMSWGHDDYMCLVAKENKTTLPSA  326

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
             LFIIRYHSFY LH+ GAY HLMNEEDKEN+KWL +FNKYDLYSKS VRIDVEEVKPYY+
Sbjct  327  GLFIIRYHSFYPLHKHGAYMHLMNEEDKENLKWLHVFNKYDLYSKSSVRIDVEEVKPYYM  386

Query  362  SLIEK  376
            SLI+K
Sbjct  387  SLIDK  391



>ref|XP_006853784.1| hypothetical protein AMTR_s00056p00210540 [Amborella trichopoda]
 gb|ERN15251.1| hypothetical protein AMTR_s00056p00210540 [Amborella trichopoda]
Length=299

 Score =   204 bits (518),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            ES +H+KYFK+NPD NN  YNT+ GVY EGCGL+ VLMSWGHDDYMYLVAKEN TTLP A
Sbjct  169  ESNIHYKYFKDNPDFNNQKYNTEFGVYTEGCGLNNVLMSWGHDDYMYLVAKENKTTLPDA  228

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSFY LH+ GAY + MNE+D E +KWL++FNKYDLYSKSKVRIDVE+VKPYY+
Sbjct  229  ALFIIRYHSFYPLHKAGAYKYFMNEKDHEGLKWLQVFNKYDLYSKSKVRIDVEKVKPYYI  288

Query  362  SLIEK  376
            SLI K
Sbjct  289  SLINK  293



>ref|NP_001241072.1| uncharacterized protein LOC100794523 [Glycine max]
 gb|ACU24324.1| unknown [Glycine max]
 gb|KHN03220.1| Inositol oxygenase 2 [Glycine soja]
Length=311

 Score =   203 bits (517),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    ESIVHHKYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSA  181
            E+  H KYFK+NPD NN  YNTK G+Y+EGCGLD V+MSWGHD+YMYLV K N TTLPS 
Sbjct  179  EANTHFKYFKDNPDSNNPAYNTKKGIYDEGCGLDNVMMSWGHDEYMYLVTKGNNTTLPSE  238

Query  182  ALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYL  361
            ALFIIRYHSF+ L++ GAY HL +EED +N+KWL+IF+KYDLYSKS V IDVE+VKPYY+
Sbjct  239  ALFIIRYHSFHPLYQTGAYKHLYSEEDVKNLKWLEIFHKYDLYSKSNVLIDVEKVKPYYM  298

Query  362  SLIEKYFPAKLRW  400
            SLI+KYFP KL W
Sbjct  299  SLIKKYFPPKLIW  311



>ref|XP_010092932.1| Inositol oxygenase 1 [Morus notabilis]
 gb|EXC37941.1| Inositol oxygenase 1 [Morus notabilis]
Length=619

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +2

Query  20   KYFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLVAKENGTTLPSAALFIIR  199
            +YFK NPD +N  +NTK GVY EGCGLD V+MSWGHDDYMYLVA EN TTLPSA LFIIR
Sbjct  132  QYFKRNPDNSNPSFNTKYGVYSEGCGLDNVMMSWGHDDYMYLVATENKTTLPSAGLFIIR  191

Query  200  YHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDLYSKSKVRIDVEEVKPYYLSLIEKY  379
            YHSFYALH+ GAY HLMNEED +N+KWLKIFNKYDLYSKSKVR+DVE+VKPYYLSLIEK+
Sbjct  192  YHSFYALHKAGAYKHLMNEEDMDNLKWLKIFNKYDLYSKSKVRVDVEKVKPYYLSLIEKF  251



>gb|AAF63180.1|AC010657_16 T5E21.2 [Arabidopsis thaliana]
Length=452

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 111/143 (78%), Gaps = 18/143 (13%)
 Frame = +2

Query  2    ESIVHHK---YFKENPDCNNTLYNTKNGVYEEGCGLDKVLMSWGHDDYMYLV--------  148
            ESIVHHK   YFKENPD +N  YN+K G+Y EGCGLD VLMSWGHDDYMYLV        
Sbjct  168  ESIVHHKVHKYFKENPDYDNPSYNSKYGIYTEGCGLDNVLMSWGHDDYMYLVSSLQSQHV  227

Query  149  -------AKENGTTLPSAALFIIRYHSFYALHREGAYTHLMNEEDKENMKWLKIFNKYDL  307
                   AKEN TTLPSA LFIIRYHSFYALH+  AY HLMN ED+ENMKWLK+FNKYDL
Sbjct  228  FMIYRHVAKENQTTLPSAGLFIIRYHSFYALHKSEAYKHLMNNEDRENMKWLKVFNKYDL  287

Query  308  YSKSKVRIDVEEVKPYYLSLIEK  376
            YSKSKVR++VEEVKPYYLSL  K
Sbjct  288  YSKSKVRVNVEEVKPYYLSLTNK  310



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 801610136576