BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14677_g1_i1 len=680 path=[658:0-679]

Length=680
                                                                      Score     E

ref|XP_009616364.1|  PREDICTED: inositol oxygenase 2-like               288   2e-93   
ref|XP_006353509.1|  PREDICTED: inositol oxygenase 4-like               286   9e-93   
ref|NP_001234593.1|  myo-inositol oxygenase                             286   2e-92   
emb|CDP03219.1|  unnamed protein product                                283   2e-91   
ref|XP_011093669.1|  PREDICTED: inositol oxygenase 2-like               275   4e-88   
gb|EYU27241.1|  hypothetical protein MIMGU_mgv1a008959mg                274   2e-87   
gb|EYU27240.1|  hypothetical protein MIMGU_mgv1a008959mg                274   3e-87   
gb|EYU27242.1|  hypothetical protein MIMGU_mgv1a008813mg                273   6e-87   
ref|XP_008387454.1|  PREDICTED: inositol oxygenase 4-like               269   1e-85   
gb|KDO55905.1|  hypothetical protein CISIN_1g021203mg                   263   3e-85   
emb|CAN78063.1|  hypothetical protein VITISV_036400                     266   9e-85   Vitis vinifera
ref|XP_002283119.1|  PREDICTED: probable inositol oxygenase             266   1e-84   Vitis vinifera
ref|XP_008242455.1|  PREDICTED: inositol oxygenase 1-like               266   2e-84   
ref|NP_001289646.1|  inositol oxygenase                                 265   2e-84   
gb|KDO55904.1|  hypothetical protein CISIN_1g021203mg                   263   3e-84   
ref|XP_006451360.1|  hypothetical protein CICLE_v10008962mg             265   3e-84   
ref|XP_010688397.1|  PREDICTED: inositol oxygenase 4                    264   8e-84   
ref|XP_010086904.1|  Inositol oxygenase 2                               264   9e-84   
gb|KDO55903.1|  hypothetical protein CISIN_1g021203mg                   263   2e-83   
gb|AFK40439.1|  unknown                                                 259   2e-83   
ref|XP_007160260.1|  hypothetical protein PHAVU_002G306200g             263   2e-83   
ref|XP_009352587.1|  PREDICTED: inositol oxygenase 2                    263   2e-83   
gb|KHM99828.1|  Inositol oxygenase 4                                    262   3e-83   
ref|NP_001242635.1|  uncharacterized protein LOC100788665               262   3e-83   
gb|ACU19277.1|  unknown                                                 261   4e-83   Glycine max [soybeans]
ref|XP_007203887.1|  hypothetical protein PRUPE_ppa008804mg             261   9e-83   
ref|XP_002514185.1|  myoinositol oxygenase, putative                    261   1e-82   Ricinus communis
ref|XP_007045580.1|  Myo-inositol oxygenase 1 isoform 1                 260   2e-82   
ref|XP_003630676.1|  Inositol oxygenase                                 259   4e-82   
gb|KHG27947.1|  Inositol oxygenase 2 -like protein                      258   1e-81   
ref|XP_008337619.1|  PREDICTED: inositol oxygenase 1-like               259   1e-81   
gb|ACJ84274.1|  unknown                                                 258   1e-81   Medicago truncatula
ref|XP_008459136.1|  PREDICTED: inositol oxygenase 2-like               261   3e-81   
gb|KCW65034.1|  hypothetical protein EUGRSUZ_G02560                     255   4e-81   
ref|XP_008361306.1|  PREDICTED: inositol oxygenase 2-like               257   7e-81   
ref|XP_008450805.1|  PREDICTED: inositol oxygenase 2-like               256   9e-81   
ref|XP_010062558.1|  PREDICTED: inositol oxygenase 1-like isoform X1    255   9e-81   
ref|XP_007045581.1|  Myo-inositol oxygenase 1 isoform 2                 255   1e-80   
ref|XP_010066969.1|  PREDICTED: inositol oxygenase 1-like               255   2e-80   
ref|XP_004141036.1|  PREDICTED: inositol oxygenase 2-like               255   2e-80   
ref|XP_004157903.1|  PREDICTED: inositol oxygenase 2-like               255   2e-80   
ref|XP_010267091.1|  PREDICTED: probable inositol oxygenase             254   3e-80   
ref|XP_006379810.1|  hypothetical protein POPTR_0008s14360g             253   3e-80   
ref|XP_011025349.1|  PREDICTED: inositol oxygenase 1                    254   3e-80   
gb|KDP33765.1|  hypothetical protein JCGZ_07336                         254   3e-80   
ref|XP_011008897.1|  PREDICTED: inositol oxygenase 2                    254   4e-80   
ref|XP_007012955.1|  Myo-inositol oxygenase 2 isoform 1                 254   5e-80   
ref|XP_002311571.2|  oxygenase-related family protein                   253   6e-80   Populus trichocarpa [western balsam poplar]
ref|XP_004287501.1|  PREDICTED: inositol oxygenase 4-like               252   6e-79   
ref|XP_004503512.1|  PREDICTED: inositol oxygenase 2-like isoform X1    251   7e-79   
gb|KCW65035.1|  hypothetical protein EUGRSUZ_G02560                     250   8e-79   
ref|XP_004503513.1|  PREDICTED: inositol oxygenase 2-like isoform X2    250   1e-78   
ref|XP_006371960.1|  hypothetical protein POPTR_0018s06700g             250   1e-78   
ref|XP_010915343.1|  PREDICTED: probable inositol oxygenase             250   1e-78   
gb|KGN66197.1|  hypothetical protein Csa_1G575130                       249   2e-78   
ref|XP_010062560.1|  PREDICTED: inositol oxygenase 1-like isoform X2    249   3e-78   
gb|KFK40347.1|  hypothetical protein AALP_AA3G362200                    249   5e-78   
ref|XP_006470903.1|  PREDICTED: inositol oxygenase 1-like isoform X1    247   1e-77   
ref|XP_008798609.1|  PREDICTED: probable inositol oxygenase             247   1e-77   
ref|NP_194356.2|  myo-inositol oxygenase 4                              247   2e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009590853.1|  PREDICTED: inositol oxygenase 2-like               247   3e-77   
ref|XP_010448299.1|  PREDICTED: inositol oxygenase 4-like isoform X4    247   3e-77   
ref|XP_004135682.1|  PREDICTED: inositol oxygenase 2-like               247   3e-77   
ref|XP_009758702.1|  PREDICTED: inositol oxygenase 2-like               247   3e-77   
ref|XP_004248391.1|  PREDICTED: inositol oxygenase 1-like               248   5e-77   
ref|NP_001190844.1|  myo-inositol oxygenase 4                           246   5e-77   
gb|KDP40824.1|  hypothetical protein JCGZ_24823                         246   6e-77   
ref|XP_003529067.1|  PREDICTED: inositol oxygenase 2-like isoform X1    246   6e-77   
gb|AAP59548.1|  myo-inositol oxygenase                                  246   9e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448298.1|  PREDICTED: inositol oxygenase 4-like isoform X3    246   9e-77   
ref|XP_010098174.1|  Inositol oxygenase 1                               246   1e-76   
ref|XP_006420666.1|  hypothetical protein CICLE_v10005543mg             244   1e-76   
ref|XP_002282395.1|  PREDICTED: inositol oxygenase 1                    245   1e-76   Vitis vinifera
gb|KDO57808.1|  hypothetical protein CISIN_1g046235mg                   244   1e-76   
ref|XP_004298756.1|  PREDICTED: inositol oxygenase 1-like               245   2e-76   
ref|XP_006426837.1|  hypothetical protein CICLE_v10026154mg             241   3e-76   
gb|KDO53722.1|  hypothetical protein CISIN_1g021944mg                   241   4e-76   
gb|KDO53721.1|  hypothetical protein CISIN_1g021944mg                   241   5e-76   
ref|XP_010433528.1|  PREDICTED: inositol oxygenase 4-like isoform X4    244   5e-76   
ref|XP_010467925.1|  PREDICTED: inositol oxygenase 2-like               243   6e-76   
gb|KHG19184.1|  Inositol oxygenase 1 -like protein                      244   7e-76   
ref|XP_010540994.1|  PREDICTED: inositol oxygenase 2                    243   8e-76   
ref|XP_010244380.1|  PREDICTED: probable inositol oxygenase             243   8e-76   
gb|KFK29141.1|  hypothetical protein AALP_AA7G093700                    243   1e-75   
gb|KDO53720.1|  hypothetical protein CISIN_1g021944mg                   243   1e-75   
ref|XP_006284128.1|  hypothetical protein CARUB_v10005260mg             243   1e-75   
emb|CDO97955.1|  unnamed protein product                                242   1e-75   
ref|NP_565459.1|  myo-inositol oxygenase 2                              243   1e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489128.1|  PREDICTED: inositol oxygenase 2-like               243   1e-75   
ref|XP_006465721.1|  PREDICTED: inositol oxygenase 1-like isoform X1    242   2e-75   
ref|XP_006426836.1|  hypothetical protein CICLE_v10026154mg             242   2e-75   
ref|XP_006465722.1|  PREDICTED: inositol oxygenase 1-like isoform X2    242   2e-75   
gb|AAM63498.1|  unknown                                                 242   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433526.1|  PREDICTED: inositol oxygenase 4-like isoform X2    245   3e-75   
gb|EYU21435.1|  hypothetical protein MIMGU_mgv1a010728mg                241   5e-75   
ref|XP_008221002.1|  PREDICTED: inositol oxygenase 1-like isoform X2    241   5e-75   
ref|XP_006305417.1|  hypothetical protein CARUB_v10009817mg             241   6e-75   
ref|XP_010416640.1|  PREDICTED: inositol oxygenase 2                    241   7e-75   
ref|XP_010433527.1|  PREDICTED: inositol oxygenase 4-like isoform X3    244   7e-75   
ref|XP_010433525.1|  PREDICTED: inositol oxygenase 4-like isoform X1    244   8e-75   
ref|XP_002883969.1|  myo-inositol oxygenase 2                           240   9e-75   
gb|KHF98793.1|  Inositol oxygenase 1 -like protein                      240   1e-74   
ref|XP_008221001.1|  PREDICTED: inositol oxygenase 1-like isoform X1    241   1e-74   
ref|XP_009351657.1|  PREDICTED: inositol oxygenase 1-like               239   2e-74   
ref|XP_010438781.1|  PREDICTED: inositol oxygenase 4 isoform X2         240   2e-74   
ref|XP_002869617.1|  myo-inositol oxygenase 4                           240   2e-74   
ref|XP_007222714.1|  hypothetical protein PRUPE_ppa009901mg             238   2e-74   
ref|XP_006417002.1|  hypothetical protein EUTSA_v10009301mg             239   2e-74   
gb|EYU30675.1|  hypothetical protein MIMGU_mgv1a010745mg                239   2e-74   
ref|NP_001154337.1|  inositol oxygenase 1                               239   3e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010527856.1|  PREDICTED: inositol oxygenase 1                    239   3e-74   
ref|XP_004297776.1|  PREDICTED: inositol oxygenase 1-like               239   3e-74   
ref|XP_010243881.1|  PREDICTED: probable inositol oxygenase             243   3e-74   
ref|XP_009402940.1|  PREDICTED: probable inositol oxygenase             238   3e-74   
ref|XP_011072454.1|  PREDICTED: inositol oxygenase 1-like isoform X1    238   4e-74   
gb|KGN58015.1|  hypothetical protein Csa_3G434960                       238   5e-74   
ref|XP_002892814.1|  myo-inisitol oxygenase                             238   5e-74   
ref|XP_008340501.1|  PREDICTED: inositol oxygenase 1                    238   5e-74   
ref|XP_011072455.1|  PREDICTED: inositol oxygenase 1-like isoform X2    238   5e-74   
ref|XP_011076857.1|  PREDICTED: probable inositol oxygenase             238   6e-74   
ref|XP_010438780.1|  PREDICTED: inositol oxygenase 4 isoform X1         238   6e-74   
ref|NP_172904.2|  inositol oxygenase 1                                  238   7e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009408907.1|  PREDICTED: probable inositol oxygenase             238   8e-74   
ref|XP_008244494.1|  PREDICTED: inositol oxygenase 4-like               237   1e-73   
dbj|BAC42925.1|  unknown protein                                        238   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148831.1|  PREDICTED: inositol oxygenase 1 isoform X2         237   1e-73   
gb|KFK43697.1|  hypothetical protein AALP_AA1G161300                    237   1e-73   
dbj|BAF01953.1|  hypothetical protein                                   236   2e-73   Arabidopsis thaliana [mouse-ear cress]
emb|CDY65374.1|  BnaC05g49660D                                          237   2e-73   
ref|XP_010476506.1|  PREDICTED: inositol oxygenase 1-like               237   2e-73   
ref|XP_010925499.1|  PREDICTED: probable inositol oxygenase isofo...    236   2e-73   
emb|CDY66453.1|  BnaAnng22250D                                          236   2e-73   
ref|XP_009343020.1|  PREDICTED: inositol oxygenase 1-like               236   3e-73   
gb|AAF43953.1|AC012188_30  Strong similarity to an unknown protei...    240   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001057871.1|  Os06g0561000                                       236   4e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010925498.1|  PREDICTED: probable inositol oxygenase isofo...    236   4e-73   
ref|XP_010536841.1|  PREDICTED: inositol oxygenase 4-like isoform X1    236   4e-73   
ref|XP_006408899.1|  hypothetical protein EUTSA_v10002046mg             236   4e-73   
ref|XP_009148830.1|  PREDICTED: inositol oxygenase 1 isoform X1         236   5e-73   
ref|XP_003563752.1|  PREDICTED: probable inositol oxygenase             235   6e-73   
ref|XP_009381183.1|  PREDICTED: probable inositol oxygenase             235   7e-73   
ref|XP_010496191.1|  PREDICTED: inositol oxygenase 1-like isoform X2    235   7e-73   
ref|XP_008447570.1|  PREDICTED: inositol oxygenase 1-like isoform X2    235   7e-73   
ref|XP_010496186.1|  PREDICTED: inositol oxygenase 1-like isoform X1    235   8e-73   
ref|XP_008805675.1|  PREDICTED: probable inositol oxygenase             235   8e-73   
ref|XP_007210179.1|  hypothetical protein PRUPE_ppa020229mg             234   8e-73   
ref|XP_004301722.1|  PREDICTED: inositol oxygenase 4-like               234   9e-73   
emb|CDY48730.1|  BnaA09g10050D                                          235   1e-72   
gb|KFK43696.1|  hypothetical protein AALP_AA1G161300                    235   1e-72   
ref|XP_006853784.1|  hypothetical protein AMTR_s00056p00210540          234   1e-72   
ref|XP_009112634.1|  PREDICTED: inositol oxygenase 2-like               234   3e-72   
ref|XP_004297627.1|  PREDICTED: inositol oxygenase 1-like               234   3e-72   
gb|KEH18253.1|  myo-inositol oxygenase                                  232   4e-72   
ref|XP_006656167.1|  PREDICTED: probable inositol oxygenase-like        233   4e-72   
ref|XP_010458952.1|  PREDICTED: inositol oxygenase 1 isoform X2         234   4e-72   
ref|XP_010458951.1|  PREDICTED: inositol oxygenase 1 isoform X1         234   4e-72   
ref|XP_004966088.1|  PREDICTED: probable inositol oxygenase-like        233   4e-72   
ref|XP_009590754.1|  PREDICTED: inositol oxygenase 1-like               233   6e-72   
ref|XP_009775832.1|  PREDICTED: inositol oxygenase 1-like               233   6e-72   
ref|XP_009337921.1|  PREDICTED: inositol oxygenase 1-like isoform X2    233   8e-72   
gb|KEH18252.1|  myo-inositol oxygenase                                  233   8e-72   
gb|AFK49356.1|  unknown                                                 233   8e-72   
ref|XP_008447569.1|  PREDICTED: inositol oxygenase 1-like isoform X1    233   9e-72   
gb|EAZ37359.1|  hypothetical protein OsJ_21699                          234   1e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006413210.1|  hypothetical protein EUTSA_v10025773mg             232   1e-71   
ref|XP_007160263.1|  hypothetical protein PHAVU_002G306500g             231   2e-71   
ref|XP_003630677.1|  Inositol oxygenase                                 227   2e-71   
ref|XP_009337920.1|  PREDICTED: inositol oxygenase 1-like isoform X1    232   2e-71   
ref|XP_007221110.1|  hypothetical protein PRUPE_ppa017891mg             231   2e-71   
ref|XP_008244738.1|  PREDICTED: inositol oxygenase 1-like               231   4e-71   
ref|XP_010312510.1|  PREDICTED: inositol oxygenase 1-like isoform X1    229   5e-71   
ref|XP_007024361.1|  Myo-inositol oxygenase 1 isoform 1                 230   5e-71   
ref|XP_011078224.1|  PREDICTED: inositol oxygenase 2-like               229   8e-71   
ref|XP_007024363.1|  Myo-inositol oxygenase 1 isoform 3                 227   1e-70   
gb|AFK33557.1|  unknown                                                 228   1e-70   
ref|XP_009124813.1|  PREDICTED: inositol oxygenase 4                    229   2e-70   
emb|CDY42748.1|  BnaA03g47910D                                          229   2e-70   
ref|XP_007024364.1|  Myo-inositol oxygenase 1 isoform 4                 227   2e-70   
emb|CDX92758.1|  BnaC07g40160D                                          229   3e-70   
ref|XP_010312511.1|  PREDICTED: probable inositol oxygenase isofo...    228   3e-70   
ref|XP_011078222.1|  PREDICTED: inositol oxygenase 1-like               228   5e-70   
gb|AFK34985.1|  unknown                                                 228   5e-70   
ref|XP_010924624.1|  PREDICTED: inositol oxygenase 1-like               228   5e-70   
gb|EMT27791.1|  Putative inositol oxygenase                             231   5e-70   
ref|XP_007024359.1|  Myo-inositol oxygenase 1                           227   6e-70   
emb|CDY03334.1|  BnaC09g10140D                                          228   8e-70   
ref|NP_001141330.1|  uncharacterized protein LOC100273421               227   9e-70   Zea mays [maize]
ref|XP_009102135.1|  PREDICTED: inositol oxygenase 2                    227   2e-69   
emb|CDX82723.1|  BnaC07g01430D                                          227   2e-69   
ref|XP_007215726.1|  hypothetical protein PRUPE_ppa009023mg             226   2e-69   
ref|XP_010322859.1|  PREDICTED: inositol oxygenase 1                    226   2e-69   
emb|CDY35889.1|  BnaA07g00980D                                          226   2e-69   
ref|XP_010433529.1|  PREDICTED: inositol oxygenase 4-like isoform X5    224   6e-69   
ref|XP_010443316.1|  PREDICTED: inositol oxygenase 5-like               225   8e-69   
ref|XP_004510326.1|  PREDICTED: inositol oxygenase 1-like               224   9e-69   
gb|AFW86646.1|  hypothetical protein ZEAMMB73_073834                    224   2e-68   
ref|XP_010451346.1|  PREDICTED: inositol oxygenase 5-like               224   2e-68   
gb|ACR38420.1|  unknown                                                 224   2e-68   Zea mays [maize]
gb|AFW90597.1|  Myo-inositol oxygenase                                  224   2e-68   
gb|ABK24160.1|  unknown                                                 224   3e-68   Picea sitchensis
ref|XP_002866159.1|  hypothetical protein ARALYDRAFT_495755             224   3e-68   
gb|AFK45472.1|  unknown                                                 219   3e-68   
ref|XP_007160262.1|  hypothetical protein PHAVU_002G306400g             222   4e-68   
ref|XP_010483142.1|  PREDICTED: inositol oxygenase 5                    223   4e-68   
ref|XP_010938965.1|  PREDICTED: probable inositol oxygenase             223   5e-68   
ref|XP_010438782.1|  PREDICTED: inositol oxygenase 4 isoform X3         222   6e-68   
ref|XP_009794933.1|  PREDICTED: inositol oxygenase 2-like               218   8e-68   
ref|XP_006298167.1|  hypothetical protein CARUB_v10014217mg             222   1e-67   
ref|XP_010448297.1|  PREDICTED: inositol oxygenase 4-like isoform X2    224   1e-67   
ref|XP_010448296.1|  PREDICTED: inositol oxygenase 4-like isoform X1    224   2e-67   
ref|XP_007024362.1|  Myo-inositol oxygenase 1 isoform 2                 221   2e-67   
ref|XP_010924477.1|  PREDICTED: probable inositol oxygenase             221   2e-67   
ref|XP_007135612.1|  hypothetical protein PHAVU_010G143500g             221   2e-67   
ref|XP_006357365.1|  PREDICTED: inositol oxygenase 1-like               220   4e-67   
ref|XP_006349939.1|  PREDICTED: inositol oxygenase 4-like               220   5e-67   
ref|NP_001241072.1|  uncharacterized protein LOC100794523               220   5e-67   
ref|XP_004253007.1|  PREDICTED: inositol oxygenase 5-like               219   7e-67   
gb|KHN39268.1|  Inositol oxygenase 1                                    219   8e-67   
ref|XP_006279854.1|  hypothetical protein CARUB_v10028439mg             219   1e-66   
ref|XP_006373403.1|  hypothetical protein POPTR_0017s13450g             218   2e-66   
gb|ACU18263.1|  unknown                                                 219   3e-66   Glycine max [soybeans]
ref|XP_010909937.1|  PREDICTED: probable inositol oxygenase             218   3e-66   
ref|XP_009126928.1|  PREDICTED: inositol oxygenase 5                    218   6e-66   
ref|XP_009395731.1|  PREDICTED: inositol oxygenase 1-like               217   8e-66   
ref|XP_011021080.1|  PREDICTED: inositol oxygenase 2-like               218   9e-66   
ref|XP_006401300.1|  hypothetical protein EUTSA_v10014148mg             217   1e-65   
ref|NP_200475.1|  myo-inositol oxygenase 5                              216   2e-65   Arabidopsis thaliana [mouse-ear cress]
emb|CDY41799.1|  BnaC02g12100D                                          216   2e-65   
gb|AAM61190.1|  unknown                                                 216   3e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007039457.1|  Myo-inositol oxygenase 4 isoform 3                 215   3e-65   
emb|CDY20714.1|  BnaA02g08540D                                          215   5e-65   
ref|XP_007039458.1|  Myo-inositol oxygenase 4 isoform 4                 214   5e-65   
ref|XP_007039455.1|  Myo-inositol oxygenase 4 isoform 1                 215   6e-65   
gb|ACU17735.1|  unknown                                                 213   8e-65   Glycine max [soybeans]
ref|XP_007039456.1|  Myo-inositol oxygenase 4 isoform 2                 215   8e-65   
ref|XP_006426838.1|  hypothetical protein CICLE_v10026154mg             213   1e-64   
gb|KDO53719.1|  hypothetical protein CISIN_1g021944mg                   213   1e-64   
ref|XP_010244377.1|  PREDICTED: probable inositol oxygenase isofo...    216   3e-64   
ref|XP_010244376.1|  PREDICTED: probable inositol oxygenase isofo...    216   3e-64   
gb|KDO53724.1|  hypothetical protein CISIN_1g021944mg                   207   1e-63   
emb|CDO99934.1|  unnamed protein product                                208   1e-62   
gb|AFW86644.1|  hypothetical protein ZEAMMB73_073834                    204   3e-62   
gb|AAF63180.1|AC010657_16  T5E21.2                                      211   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011093670.1|  PREDICTED: inositol oxygenase 1-like               203   3e-60   
ref|XP_006583567.1|  PREDICTED: inositol oxygenase 2-like isoform X2    201   9e-60   
ref|XP_009767150.1|  PREDICTED: inositol oxygenase 2-like               200   1e-59   
ref|XP_002978216.1|  hypothetical protein SELMODRAFT_176725             199   6e-59   
gb|KHG20649.1|  Inositol oxygenase 5                                    198   1e-58   
ref|XP_007158874.1|  hypothetical protein PHAVU_002G189000g             202   2e-58   
ref|XP_008354188.1|  PREDICTED: inositol oxygenase 2-like               196   3e-58   
ref|XP_002966344.1|  hypothetical protein SELMODRAFT_230879             196   7e-58   
gb|KDO55906.1|  hypothetical protein CISIN_1g035614mg                   194   4e-57   
ref|XP_010536842.1|  PREDICTED: inositol oxygenase 4-like isoform X2    192   2e-56   
gb|KHN05317.1|  Inositol oxygenase 1                                    188   3e-55   
ref|XP_007158875.1|  hypothetical protein PHAVU_002G189100g             184   2e-53   
ref|XP_007158873.1|  hypothetical protein PHAVU_002G1889000g            182   7e-53   
ref|XP_007160261.1|  hypothetical protein PHAVU_002G306300g             181   1e-52   
gb|EPS62521.1|  hypothetical protein M569_12269                         176   3e-52   
ref|XP_006451361.1|  hypothetical protein CICLE_v10010267mg             181   1e-51   
gb|EMS59186.1|  putative inositol oxygenase                             184   7e-51   
gb|AAK43906.1|AF370587_1  Unknown protein                               175   3e-50   Arabidopsis thaliana [mouse-ear cress]
gb|EYU21436.1|  hypothetical protein MIMGU_mgv1a010728mg                165   1e-46   
ref|XP_004149177.1|  PREDICTED: inositol oxygenase 1-like               164   3e-46   
gb|EYU21425.1|  hypothetical protein MIMGU_mgv1a015330mg                162   4e-46   
ref|XP_006365685.1|  PREDICTED: inositol oxygenase 2-like               163   8e-46   
ref|XP_006426835.1|  hypothetical protein CICLE_v10026154mg             162   2e-45   
ref|XP_002515913.1|  myoinositol oxygenase, putative                    157   2e-43   Ricinus communis
ref|XP_007024365.1|  Myo-inositol oxygenase 1 isoform 5                 157   3e-43   
ref|XP_006298168.1|  hypothetical protein CARUB_v10014217mg             155   1e-42   
ref|XP_010092932.1|  Inositol oxygenase 1                               161   2e-42   
ref|XP_007012956.1|  Myo-inositol oxygenase 2 isoform 2                 154   3e-42   
ref|XP_002869618.1|  hypothetical protein ARALYDRAFT_913936             153   3e-42   
ref|XP_007039459.1|  Myo-inositol oxygenase 5 isoform 5                 153   4e-42   
ref|XP_006853782.1|  hypothetical protein AMTR_s00056p00209200          142   6e-38   
gb|ADK27708.1|  MIOX                                                    138   4e-37   
gb|AAC05150.1|  PRE87 gene product                                      139   1e-36   Pinus radiata
gb|ABI26717.1|  myo-inositol oxidase                                    134   5e-36   Vitis vinifera
gb|AGO64479.1|  myo-inositol oxidase                                    130   5e-34   
gb|EFA78687.1|  inositol oxygenase                                      131   2e-33   Polysphondylium pallidum PN500
ref|WP_016197318.1|  Inositol oxygenase                                 130   2e-32   
ref|XP_001767567.1|  predicted protein                                  128   2e-32   
ref|XP_010438779.1|  PREDICTED: inositol oxygenase 5-like               123   6e-32   
ref|XP_635854.1|  inositol oxygenase                                    128   9e-32   
ref|WP_007806626.1|  inositol oxygenase                                 125   1e-30   
ref|WP_029445519.1|  inositol oxygenase                                 124   2e-30   
ref|WP_013070508.1|  inositol oxygenase                                 124   2e-30   
ref|WP_013549290.1|  inositol oxygenase                                 124   2e-30   
ref|WP_012025106.1|  inositol oxygenase                                 124   3e-30   
ref|WP_008469272.1|  inositol oxygenase                                 123   6e-30   
ref|WP_025146018.1|  inositol oxygenase                                 123   8e-30   
ref|WP_035638026.1|  inositol oxygenase                                 122   9e-30   
ref|WP_025497404.1|  inositol oxygenase                                 122   9e-30   
ref|WP_028376267.1|  inositol oxygenase                                 122   1e-29   
ref|WP_035644309.1|  inositol oxygenase                                 122   1e-29   
dbj|BAJ98201.1|  predicted protein                                      122   1e-29   
ref|WP_035689964.1|  inositol oxygenase                                 122   1e-29   
ref|WP_026984264.1|  inositol oxygenase                                 122   2e-29   
dbj|GAL79942.1|  inositol oxygenase                                     121   2e-29   
ref|WP_031453606.1|  inositol oxygenase                                 121   3e-29   
dbj|GAL64325.1|  inositol oxygenase                                     121   3e-29   
ref|WP_026712270.1|  inositol oxygenase                                 120   4e-29   
ref|WP_036152688.1|  inositol oxygenase                                 120   6e-29   
ref|WP_010517443.1|  inositol oxygenase                                 120   7e-29   
ref|WP_020529230.1|  inositol oxygenase                                 120   9e-29   
ref|WP_035658530.1|  inositol oxygenase                                 120   9e-29   
ref|WP_012411598.1|  inositol oxygenase                                 120   1e-28   
ref|WP_027064609.1|  inositol oxygenase                                 119   1e-28   
ref|WP_038126931.1|  inositol oxygenase                                 119   1e-28   
ref|WP_026774887.1|  inositol oxygenase                                 119   1e-28   
ref|WP_038073583.1|  inositol oxygenase                                 119   1e-28   
ref|WP_029284344.1|  inositol oxygenase                                 119   2e-28   
ref|WP_037979015.1|  inositol oxygenase                                 119   2e-28   
ref|WP_018614196.1|  inositol oxygenase                                 119   2e-28   
dbj|GAM22974.1|  hypothetical protein SAMD00019534_061490               118   3e-28   
ref|XP_003740786.1|  PREDICTED: inositol oxygenase-like                 118   3e-28   
ref|WP_008202409.1|  inositol oxygenase                                 118   4e-28   
gb|AHF14237.1|  inositol oxygenase                                      118   4e-28   
gb|AHG93271.1|  protein of unknown function DUF706                      118   4e-28   
ref|WP_007416147.1|  inositol oxygenase                                 118   5e-28   
ref|WP_020150877.1|  inositol oxygenase                                 118   5e-28   
ref|XP_006812619.1|  PREDICTED: inositol oxygenase-like                 115   8e-28   
ref|WP_013931001.1|  inositol oxygenase                                 117   1e-27   
ref|WP_039474556.1|  inositol oxygenase                                 117   2e-27   
ref|WP_026134305.1|  inositol oxygenase                                 117   2e-27   
ref|WP_038104581.1|  inositol oxygenase                                 116   2e-27   
ref|WP_026954729.1|  inositol oxygenase                                 116   2e-27   
ref|WP_015028145.1|  inositol oxygenase                                 117   2e-27   
ref|WP_018629268.1|  inositol oxygenase                                 116   2e-27   
ref|WP_039144521.1|  inositol oxygenase                                 116   3e-27   
ref|WP_036386272.1|  inositol oxygenase                                 115   6e-27   
ref|WP_008865701.1|  inositol oxygenase                                 115   6e-27   
ref|WP_013663514.1|  inositol oxygenase                                 115   7e-27   
ref|WP_009035890.1|  inositol oxygenase                                 115   8e-27   
ref|WP_013767952.1|  inositol oxygenase                                 114   1e-26   
ref|WP_022842995.1|  inositol oxygenase                                 114   1e-26   
gb|EEH19718.1|  hypothetical protein PABG_01977                         114   1e-26   
ref|WP_011685791.1|  inositol oxygenase                                 114   1e-26   
ref|WP_026443665.1|  inositol oxygenase                                 114   1e-26   
gb|KFY97977.1|  hypothetical protein V500_01831                         114   2e-26   
ref|WP_027302724.1|  inositol oxygenase                                 114   2e-26   
ref|WP_014266983.1|  inositol oxygenase                                 114   2e-26   
gb|KFZ24407.1|  hypothetical protein V502_01125                         114   2e-26   
ref|WP_028523987.1|  inositol oxygenase                                 113   2e-26   
ref|XP_003740785.1|  PREDICTED: inositol oxygenase-like                 113   2e-26   
ref|WP_015331340.1|  Inositol oxygenase                                 113   2e-26   
ref|WP_012929714.1|  inositol oxygenase                                 113   3e-26   
ref|XP_010756317.1|  hypothetical protein PADG_00361                    113   3e-26   
gb|AIE86728.1|  Inositol oxygenase                                      113   4e-26   
ref|WP_038121250.1|  inositol oxygenase                                 112   4e-26   
ref|WP_015267154.1|  hypothetical protein                               112   5e-26   
ref|WP_018474202.1|  inositol oxygenase                                 112   5e-26   
ref|WP_029247717.1|  inositol oxygenase                                 112   5e-26   
ref|WP_008505724.1|  inositol oxygenase                                 112   5e-26   
gb|KFY80106.1|  hypothetical protein V499_00995                         112   5e-26   
gb|KFZ06651.1|  hypothetical protein V501_07214                         112   7e-26   
ref|WP_014223416.1|  inositol oxygenase                                 112   8e-26   
ref|WP_019600568.1|  inositol oxygenase                                 112   8e-26   
gb|KFY94766.1|  hypothetical protein V500_03077                         112   1e-25   
ref|XP_007587415.1|  putative inositol oxygenase protein                112   1e-25   
ref|WP_020719475.1|  hypothetical protein                               112   1e-25   
gb|KFZ07861.1|  hypothetical protein V502_09694                         112   1e-25   
gb|EKG17920.1|  Inositol oxygenase                                      112   1e-25   
ref|WP_022908961.1|  inositol oxygenase                                 111   1e-25   
ref|WP_012792331.1|  inositol oxygenase                                 111   2e-25   
gb|KFY90916.1|  hypothetical protein V498_05759                         111   2e-25   
ref|XP_002565933.1|  Pc22g20330                                         111   2e-25   
ref|XP_008717504.1|  hypothetical protein HMPREF1541_04940              111   2e-25   
ref|WP_026336603.1|  inositol oxygenase                                 110   2e-25   
ref|WP_014021187.1|  inositol oxygenase                                 110   2e-25   
gb|EHL03420.1|  putative Inositol oxygenase 1                           110   3e-25   
ref|XP_755356.1|  inositol oxygenase                                    110   3e-25   
gb|AAR10057.1|  similar to Drosophila melanogaster CG6910               107   3e-25   
ref|WP_026448089.1|  inositol oxygenase                                 110   3e-25   
ref|WP_020605800.1|  inositol oxygenase                                 110   3e-25   
ref|XP_007677634.1|  hypothetical protein BAUCODRAFT_518428             110   3e-25   
ref|WP_020893274.1|  Inositol oxygenase                                 110   4e-25   
gb|EGC44773.1|  myo-inositol oxygenase                                  110   4e-25   
gb|KFY31528.1|  hypothetical protein V493_01022                         110   4e-25   
ref|XP_001260505.1|  inositol oxygenase, putative                       110   4e-25   
ref|WP_028666737.1|  inositol oxygenase                                 110   4e-25   
gb|EEH10301.1|  myo-inositol oxygenase                                  110   4e-25   
ref|XP_011055093.1|  PREDICTED: inositol oxygenase                      110   4e-25   
ref|WP_026969235.1|  inositol oxygenase                                 110   4e-25   
ref|WP_013572759.1|  inositol oxygenase                                 110   5e-25   
ref|XP_001744713.1|  hypothetical protein                               109   5e-25   
ref|XP_392190.2|  PREDICTED: inositol oxygenase-like                    109   6e-25   
ref|XP_001275322.1|  inositol oxygenase, putative                       110   6e-25   
ref|WP_010855021.1|  Inositol oxygenase                                 109   7e-25   
ref|XP_002796397.1|  inositol oxygenase                                 109   7e-25   
ref|XP_001956021.1|  GF24808                                            109   8e-25   
ref|XP_002850117.1|  inositol oxygenase 1                               109   8e-25   
ref|WP_020596359.1|  inositol oxygenase                                 109   8e-25   
gb|KFY47462.1|  hypothetical protein V496_10633                         112   9e-25   
ref|XP_003017104.1|  hypothetical protein ARB_03980                     109   1e-24   
gb|KDR71009.1|  hypothetical protein GALMADRAFT_75510                   108   1e-24   
ref|XP_007921100.1|  hypothetical protein MYCFIDRAFT_209610             109   1e-24   
ref|XP_001397784.1|  Inositol oxygenase 1                               109   1e-24   
ref|XP_003024042.1|  hypothetical protein TRV_01809                     108   1e-24   
ref|XP_008083235.1|  HD-domain/PDEase-like protein                      108   1e-24   
ref|WP_009284868.1|  inositol oxygenase                                 108   1e-24   
gb|KGO41406.1|  Inositol oxygenase                                      109   1e-24   
ref|XP_002625276.1|  inositol oxygenase                                 108   1e-24   
gb|EKV09480.1|  Inositol oxygenase, putative                            108   1e-24   
ref|WP_020532625.1|  inositol oxygenase                                 108   2e-24   
ref|WP_035176387.1|  inositol oxygenase                                 108   2e-24   
ref|XP_001972509.1|  GG15566                                            108   2e-24   
ref|WP_018618834.1|  inositol oxygenase                                 108   2e-24   
gb|KGO76869.1|  Inositol oxygenase                                      108   2e-24   
ref|XP_003857266.1|  inositol oxygenase protein                         108   2e-24   
ref|WP_031266287.1|  inositol oxygenase                                 108   2e-24   
ref|XP_006609024.1|  PREDICTED: inositol oxygenase-like                 108   2e-24   
ref|XP_002009894.1|  GI14990                                            108   2e-24   
ref|XP_003234908.1|  hypothetical protein TERG_03959                    108   2e-24   
gb|EPS28841.1|  hypothetical protein PDE_03787                          108   2e-24   
gb|EZF23071.1|  hypothetical protein H100_04185                         108   2e-24   
ref|XP_007722853.1|  inositol oxygenase                                 108   2e-24   
ref|XP_009159592.1|  inositol oxygenase                                 108   3e-24   
ref|XP_003696960.1|  PREDICTED: inositol oxygenase-like                 107   3e-24   
ref|WP_035358898.1|  inositol oxygenase                                 107   3e-24   
gb|ACF74352.1|  myo-inisitol oxygenase                                  103   3e-24   
emb|CDM27698.1|  Inositol oxygenase 1                                   108   3e-24   
ref|XP_002068297.1|  GK13270                                            107   3e-24   
emb|CEI91742.1|  Putative Inositol oxygenase                            110   4e-24   
emb|CEG71774.1|  Putative Inositol oxygenase                            107   4e-24   
ref|XP_003701536.1|  PREDICTED: inositol oxygenase-like                 107   4e-24   
emb|CEI92606.1|  Putative Inositol oxygenase                            108   4e-24   
gb|EFN79946.1|  Inositol oxygenase                                      107   4e-24   
gb|KFY28735.1|  hypothetical protein V491_00314                         107   4e-24   
ref|XP_003836888.1|  similar to inositol oxygenase                      107   4e-24   
gb|EIE91805.1|  hypothetical protein RO3G_16516                         107   4e-24   
gb|EPB85863.1|  inositol oxygenase                                      107   4e-24   
gb|EMF16502.1|  inositol oxygenase                                      107   4e-24   
gb|KFY09300.1|  hypothetical protein V491_08264                         107   4e-24   
emb|CCA73488.1|  probable aldehyde reductase 6                          108   5e-24   
ref|XP_003490061.1|  PREDICTED: inositol oxygenase-like                 107   5e-24   
ref|NP_001261748.1|  CG6910, isoform C                                  106   6e-24   
ref|XP_004357221.1|  GAT domain-containing protein                      110   6e-24   
ref|NP_648556.3|  CG6910, isoform B                                     107   6e-24   
gb|EFN64140.1|  Inositol oxygenase                                      107   6e-24   
pir||E88642  protein C54E4.5 [imported] - Caenorhabditis elegans        107   6e-24
ref|XP_007829449.1|  hypothetical protein PFICI_02677                   107   6e-24   
ref|XP_002030244.1|  GM25333                                            107   7e-24   
ref|NP_500170.3|  Protein C54E4.5                                       106   7e-24   
ref|XP_002094557.1|  GE21891                                            106   7e-24   
ref|XP_008554004.1|  PREDICTED: inositol oxygenase isoform X1           106   7e-24   
gb|ETZ21426.1|  inositol oxygenase                                      106   8e-24   
ref|XP_003393677.1|  PREDICTED: inositol oxygenase-like                 106   8e-24   
ref|XP_002084614.1|  GD14365                                            106   8e-24   
ref|XP_004520375.1|  PREDICTED: inositol oxygenase-like                 106   8e-24   
ref|WP_037443516.1|  inositol oxygenase                                 106   8e-24   
gb|ESZ98338.1|  inositol oxygenase                                      106   8e-24   
tpe|CBF70416.1|  TPA: inositol oxygenase, putative (AFU_orthologu...    106   9e-24   
gb|ETO26203.1|  hypothetical protein RFI_10933                          108   9e-24   
ref|XP_002634888.1|  Hypothetical protein CBG10559                      106   1e-23   
dbj|GAA85049.1|  inositol oxygenase                                     106   1e-23   
ref|XP_007346526.1|  myo-inositol oxygenase                             106   1e-23   
ref|XP_571356.1|  myo-inositol oxygenase                                106   1e-23   
ref|XP_005177285.1|  PREDICTED: inositol oxygenase-like                 106   1e-23   
ref|WP_020148821.1|  hypothetical protein                               106   1e-23   
ref|WP_029705412.1|  inositol oxygenase                                 105   1e-23   
ref|XP_007749518.1|  inositol oxygenase                                 106   1e-23   
ref|XP_002151934.1|  inositol oxygenase, putative                       106   1e-23   
ref|XP_007735490.1|  inositol oxygenase                                 106   1e-23   
ref|XP_001950796.1|  PREDICTED: inositol oxygenase                      105   1e-23   
dbj|GAD93750.1|  inositol oxygenase, putative                           106   2e-23   
gb|EGT53858.1|  hypothetical protein CAEBREN_08194                      105   2e-23   
ref|XP_002544755.1|  inositol oxygenase 1                               105   2e-23   
gb|KEF61322.1|  inositol oxygenase                                      105   2e-23   
ref|XP_002059020.1|  GJ15346                                            105   2e-23   
ref|XP_003194621.1|  myo-inositol oxygenase                             105   2e-23   
ref|XP_007270494.1|  DUF706-domain-containing protein                   105   2e-23   
ref|XP_007368924.1|  myo-inositol oxygenase                             105   2e-23   
ref|XP_002134834.1|  GA23704                                            105   2e-23   
ref|XP_002021098.1|  GL25160                                            105   2e-23   
gb|EMT70949.1|  Putative inositol oxygenase                             105   2e-23   
ref|XP_003094820.1|  hypothetical protein CRE_02593                     105   2e-23   
gb|KDQ31706.1|  hypothetical protein PLEOSDRAFT_1091809                 105   3e-23   
gb|EJL90967.1|  serine protease, S9A family peptidase                   105   3e-23   
ref|WP_036837044.1|  inositol oxygenase                                 104   3e-23   
gb|KFY90559.1|  hypothetical protein V500_05119                         105   3e-23   
gb|EGD92485.1|  myo-inositol oxygenase                                  105   3e-23   
gb|AAN85573.1|  myo-inositol oxygenase                                  105   3e-23   
ref|XP_003069493.1|  Inositol oxygenase, putative                       105   3e-23   
ref|XP_002605656.1|  hypothetical protein BRAFLDRAFT_279937             105   3e-23   
ref|WP_013567380.1|  inositol oxygenase                                 104   3e-23   
emb|CEG83146.1|  Putative Inositol oxygenase                            103   3e-23   
ref|WP_031499261.1|  inositol oxygenase                                 104   4e-23   
ref|XP_006463566.1|  hypothetical protein AGABI2DRAFT_194354            104   4e-23   
ref|XP_007783164.1|  hypothetical protein W97_07102                     105   4e-23   
ref|XP_001602144.1|  PREDICTED: inositol oxygenase                      104   4e-23   
ref|XP_007334319.1|  hypothetical protein AGABI1DRAFT_116583            104   5e-23   
gb|KFM59302.1|  Inositol oxygenase                                      104   6e-23   
ref|WP_026335770.1|  inositol oxygenase                                 104   6e-23   
gb|KGB76104.1|  myo-inositol oxygenase                                  104   6e-23   
gb|KFZ02873.1|  hypothetical protein V502_11422                         104   7e-23   
gb|KEQ81633.1|  inositol oxygenase 1                                    104   7e-23   
ref|XP_001213634.1|  inositol oxygenase 1                               104   7e-23   
ref|XP_001991572.1|  GH12734                                            103   7e-23   
dbj|GAM36949.1|  myo-inositol oxygenase                                 104   8e-23   
emb|CDO71022.1|  hypothetical protein BN946_scf184844.g26               103   9e-23   



>ref|XP_009616364.1| PREDICTED: inositol oxygenase 2-like [Nicotiana tomentosiformis]
Length=316

 Score =   288 bits (737),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 173/193 (90%), Gaps = 6/193 (3%)
 Frame = -3

Query  573  MTILIIEKP--AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTI +IE+P     VEEKQ +P  N NELILDGGFVVPK L S +GGFE PE+NSFGQSF
Sbjct  1    MTI-VIEQPEFGLQVEEKQ-IPC-NTNELILDGGFVVPKQL-SCDGGFEVPEINSFGQSF  56

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R Y+AESERQK+VEEFYRVQHINQTYD+VK+MRE YG+LDKVEMSIWECCELLNDVVDDS
Sbjct  57   RDYNAESERQKTVEEFYRVQHINQTYDYVKKMREKYGKLDKVEMSIWECCELLNDVVDDS  116

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQIEHLLQTAEAIRKDYP+  WLHLTALIHDLGKVLL PSFG LPQWAVVGDTF
Sbjct  117  DPDLDEPQIEHLLQTAEAIRKDYPNDDWLHLTALIHDLGKVLLLPSFGGLPQWAVVGDTF  176

Query  39   PLGCAFDESIVHH  1
            PLGCAFDESIVHH
Sbjct  177  PLGCAFDESIVHH  189



>ref|XP_006353509.1| PREDICTED: inositol oxygenase 4-like [Solanum tuberosum]
Length=317

 Score =   286 bits (733),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 174/193 (90%), Gaps = 5/193 (3%)
 Frame = -3

Query  573  MTILIIEKP--AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTILI ++P     VEEK+   S NANELILDGGF+VPKTL S +  FE P++N+FGQSF
Sbjct  1    MTILI-DQPEFGSQVEEKKV--SFNANELILDGGFMVPKTLSSQDEIFEVPDINAFGQSF  57

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R Y+A+SERQKSVEEFYRVQHINQTYD+VK+MRE+YG+L+K+EMSIW+CCELLNDVVDDS
Sbjct  58   RDYNAQSERQKSVEEFYRVQHINQTYDYVKKMREEYGKLNKIEMSIWDCCELLNDVVDDS  117

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLLHPSFG LPQWAVVGDTF
Sbjct  118  DPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLHPSFGGLPQWAVVGDTF  177

Query  39   PLGCAFDESIVHH  1
            PLGCAFDESIVHH
Sbjct  178  PLGCAFDESIVHH  190



>ref|NP_001234593.1| myo-inositol oxygenase [Solanum lycopersicum]
 gb|ACS45396.1| myo-inositol oxygenase [Solanum lycopersicum]
Length=317

 Score =   286 bits (731),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 173/193 (90%), Gaps = 5/193 (3%)
 Frame = -3

Query  573  MTILIIEKP--AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTILI E+P     VEEK+   S NANELILDGGF+VPKTL S +  FE P++N+FGQSF
Sbjct  1    MTILI-EQPEFGSQVEEKKV--SFNANELILDGGFMVPKTLSSQDEIFEVPDINAFGQSF  57

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R Y+ ESERQKSVEEFYRVQHINQTYD+VK+MR++YG+L+K+EMSIW+CCELLNDVVDDS
Sbjct  58   RDYNVESERQKSVEEFYRVQHINQTYDYVKKMRKEYGKLNKIEMSIWDCCELLNDVVDDS  117

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLLHPSFG LPQWAVVGDTF
Sbjct  118  DPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLHPSFGGLPQWAVVGDTF  177

Query  39   PLGCAFDESIVHH  1
            PLGCAFDESIVHH
Sbjct  178  PLGCAFDESIVHH  190



>emb|CDP03219.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   283 bits (724),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 169/193 (88%), Gaps = 6/193 (3%)
 Frame = -3

Query  573  MTILIIEKP--AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTILI ++P     V EK  +P D  NEL+LDGGFV+PKT   ++ GFEAPE+NSFG SF
Sbjct  1    MTILIEQQPDLGFPVGEKN-IPHDTINELVLDGGFVMPKT---TSDGFEAPEINSFGHSF  56

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R Y+AESERQK+VEEFYRV HINQTYDFVKRMRE Y +LDK EMSIWECCELLNDVVDDS
Sbjct  57   RDYNAESERQKTVEEFYRVNHINQTYDFVKRMREGYAKLDKAEMSIWECCELLNDVVDDS  116

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLLHP+FGELPQWAVVGDTF
Sbjct  117  DPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLHPTFGELPQWAVVGDTF  176

Query  39   PLGCAFDESIVHH  1
            PLGCAFDESIVHH
Sbjct  177  PLGCAFDESIVHH  189



>ref|XP_011093669.1| PREDICTED: inositol oxygenase 2-like [Sesamum indicum]
Length=315

 Score =   275 bits (702),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 168/192 (88%), Gaps = 5/192 (3%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTI  IE+P   ++ + + +PSD  NELILDGGF +PK  +    GFEAPE+NSFG SFR
Sbjct  1    MTI-AIEQPDLGLQVDAKKIPSD-TNELILDGGFALPK--LEPQVGFEAPEINSFGHSFR  56

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             Y+AESERQK+VEEFYR+ HINQTYDFVK+MRE YG+LD+VEMSIWECCELLNDVVDDSD
Sbjct  57   DYNAESERQKTVEEFYRLNHINQTYDFVKKMREKYGKLDRVEMSIWECCELLNDVVDDSD  116

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYPH+ WLHLTALIHDLGKVLL PSFG LPQWAVVGDTFP
Sbjct  117  PDLDEPQIEHLLQTAEAIRKDYPHEDWLHLTALIHDLGKVLLLPSFGGLPQWAVVGDTFP  176

Query  36   LGCAFDESIVHH  1
            LGCAFDESIVHH
Sbjct  177  LGCAFDESIVHH  188



>gb|EYU27241.1| hypothetical protein MIMGU_mgv1a008959mg [Erythranthe guttata]
Length=356

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 171/193 (89%), Gaps = 6/193 (3%)
 Frame = -3

Query  576  RMTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            +MTILI E+P   VE E + + +   NEL+LDGGF +PK L +  GGF+APE+N+FGQSF
Sbjct  42   KMTILI-EQPDLGVEVEGKKMET---NELVLDGGFPMPK-LDAHGGGFDAPEINAFGQSF  96

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R Y+AESERQK+VEEFYR+ HINQ++DFVK+MRE YG+LDK EMSIWECCELLN+VVD+S
Sbjct  97   RDYNAESERQKTVEEFYRLNHINQSFDFVKKMREKYGKLDKTEMSIWECCELLNEVVDES  156

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQIEHLLQTAEAIRKDYPHQ WLHLTALIHDLGKVLL PSFGELPQWAVVGDTF
Sbjct  157  DPDLDEPQIEHLLQTAEAIRKDYPHQDWLHLTALIHDLGKVLLLPSFGELPQWAVVGDTF  216

Query  39   PLGCAFDESIVHH  1
            PLGCAFD+SIVHH
Sbjct  217  PLGCAFDQSIVHH  229



>gb|EYU27240.1| hypothetical protein MIMGU_mgv1a008959mg [Erythranthe guttata]
Length=357

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 169/195 (87%), Gaps = 9/195 (5%)
 Frame = -3

Query  576  RMTILIIEKP---AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQ  406
            +MTILI E+P      VE K+       NEL+LDGGF +PK L +  GGF+APE+N+FGQ
Sbjct  42   KMTILI-EQPDLAGVEVEGKKM----ETNELVLDGGFPMPK-LDAHGGGFDAPEINAFGQ  95

Query  405  SFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvd  226
            SFR Y+AESERQK+VEEFYR+ HINQ++DFVK+MRE YG+LDK EMSIWECCELLN+VVD
Sbjct  96   SFRDYNAESERQKTVEEFYRLNHINQSFDFVKKMREKYGKLDKTEMSIWECCELLNEVVD  155

Query  225  dsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGD  46
            +SDPDLDEPQIEHLLQTAEAIRKDYPHQ WLHLTALIHDLGKVLL PSFGELPQWAVVGD
Sbjct  156  ESDPDLDEPQIEHLLQTAEAIRKDYPHQDWLHLTALIHDLGKVLLLPSFGELPQWAVVGD  215

Query  45   TFPLGCAFDESIVHH  1
            TFPLGCAFD+SIVHH
Sbjct  216  TFPLGCAFDQSIVHH  230



>gb|EYU27242.1| hypothetical protein MIMGU_mgv1a008813mg [Erythranthe guttata]
Length=361

 Score =   273 bits (698),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 167/193 (87%), Gaps = 6/193 (3%)
 Frame = -3

Query  576  RMTILIIEKP-AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            +MTILI ++     VE K+       NEL+LDGGF +PK L +  GGF+APE+N+FGQSF
Sbjct  47   KMTILIEQRDLGVEVEGKKM----ETNELVLDGGFPMPK-LDAHGGGFDAPEINAFGQSF  101

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R Y+AESERQK+VEEFYR+ HINQ++DFVK+MRE YG+LDK EMSIWECCELLN+VVD+S
Sbjct  102  RDYNAESERQKTVEEFYRLNHINQSFDFVKKMREKYGKLDKTEMSIWECCELLNEVVDES  161

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQIEHLLQTAEAIRKDYPHQ WLHLTALIHDLGKVLL P FGELPQWAVVGDTF
Sbjct  162  DPDLDEPQIEHLLQTAEAIRKDYPHQDWLHLTALIHDLGKVLLLPRFGELPQWAVVGDTF  221

Query  39   PLGCAFDESIVHH  1
            PLGCAFD+SIVHH
Sbjct  222  PLGCAFDQSIVHH  234



>ref|XP_008387454.1| PREDICTED: inositol oxygenase 4-like [Malus domestica]
Length=332

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 170/207 (82%), Gaps = 17/207 (8%)
 Frame = -3

Query  573  MTILIIEKP--AEHVEEKQAVPSDN---ANELILDGGFVVPKTL-----------MSSNG  442
            MTILI E+P     VEEK+ + S+N    N+L+LDGGFVVPK +             SN 
Sbjct  1    MTILI-EQPELGLRVEEKKIISSENNGEMNDLVLDGGFVVPKEISKNDGTVAQEITGSNE  59

Query  441  GFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSI  262
             F APE+NSFGQSFR Y+A SERQKSVEEFYR+ HINQT+DFVKRMRE+Y +L++VEMSI
Sbjct  60   AFIAPEINSFGQSFRDYNAXSERQKSVEEFYRLNHINQTHDFVKRMREEYSKLNRVEMSI  119

Query  261  WECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPS  82
            WECCELLNDV DDSDPDLDEP+IEHLLQTAEAIRKDYP++ WLHLTALIHDLGKVLL PS
Sbjct  120  WECCELLNDVXDDSDPDLDEPKIEHLLQTAEAIRKDYPNEDWLHLTALIHDLGKVLLLPS  179

Query  81   FGELPQWAVVGDTFPLGCAFDESIVHH  1
            FGELPQWAVVGDT PLGCAFDESIVHH
Sbjct  180  FGELPQWAVVGDTHPLGCAFDESIVHH  206



>gb|KDO55905.1| hypothetical protein CISIN_1g021203mg [Citrus sinensis]
Length=201

 Score =   263 bits (672),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 159/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI +        +     +  NEL+LDGGFVVPKT+   N GF APE+NSFG++FR 
Sbjct  1    MTILIDQPELIGSRAEDQNLQEQTNELVLDGGFVVPKTM--PNDGFVAPEINSFGKTFRD  58

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+AE ERQKSVEEFYR+QHINQTYDFVK+MRE+Y +LDK EMSIWECCELLN+VVD+SDP
Sbjct  59   YNAECERQKSVEEFYRLQHINQTYDFVKKMREEYAKLDKAEMSIWECCELLNEVVDESDP  118

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGKVL  P FG LPQWAVVGDTFPL
Sbjct  119  DLDEPQIQHLLQSAEAIRKDYPDEDWLHLTALIHDLGKVLTLPKFGGLPQWAVVGDTFPL  178

Query  33   GCAFDESIVHH  1
            GCAFDES VHH
Sbjct  179  GCAFDESNVHH  189



>emb|CAN78063.1| hypothetical protein VITISV_036400 [Vitis vinifera]
Length=309

 Score =   266 bits (679),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 159/191 (83%), Gaps = 9/191 (5%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI +       EK        NEL+LDGGF VPK       GF APE+NSFG SFR 
Sbjct  1    MTILIDQPELGSQPEKLY---SETNELVLDGGFPVPKD------GFMAPEINSFGNSFRD  51

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDAESERQK+VEEFYR+ HINQTYDFVK+MRE YG+LD+VEMSIWECCELLNDV+DDSDP
Sbjct  52   YDAESERQKTVEEFYRINHINQTYDFVKKMREAYGKLDRVEMSIWECCELLNDVIDDSDP  111

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLLHPSFGELPQWAVVGDTFPL
Sbjct  112  DLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLHPSFGELPQWAVVGDTFPL  171

Query  33   GCAFDESIVHH  1
            GCAFDE+ VHH
Sbjct  172  GCAFDEANVHH  182



>ref|XP_002283119.1| PREDICTED: probable inositol oxygenase [Vitis vinifera]
 emb|CBI27969.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 159/191 (83%), Gaps = 9/191 (5%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI +       EK        NEL+LDGGF VPK       GF APE+NSFG SFR 
Sbjct  1    MTILIDQPELGSQPEKLY---SETNELVLDGGFPVPKD------GFMAPEINSFGNSFRD  51

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDAESERQK+VEEFYR+ HINQTYDFVK+MRE YG+LD+VEMSIWECCELLNDV+DDSDP
Sbjct  52   YDAESERQKTVEEFYRINHINQTYDFVKKMREAYGKLDRVEMSIWECCELLNDVIDDSDP  111

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLLHPSFGELPQWAVVGDTFPL
Sbjct  112  DLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLHPSFGELPQWAVVGDTFPL  171

Query  33   GCAFDESIVHH  1
            GCAFDE+ VHH
Sbjct  172  GCAFDEANVHH  182



>ref|XP_008242455.1| PREDICTED: inositol oxygenase 1-like [Prunus mume]
Length=333

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 168/207 (81%), Gaps = 17/207 (8%)
 Frame = -3

Query  573  MTILIIEKP----AEHVEEKQAVPSDNAN-ELILDGGFVVPKTLMSSNG-----------  442
            MTILI E+P       +EEK+     N   EL+LDGGFVVPK +  +NG           
Sbjct  1    MTILI-EQPDHQLGSQMEEKKLCSESNETCELVLDGGFVVPKDISKNNGCVTQKIAASND  59

Query  441  GFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSI  262
             F APE+NSFGQSFR Y+AESERQKSVEEFY+  HINQT+DFVK+MRE+Y +L++VEMSI
Sbjct  60   AFIAPEINSFGQSFRDYNAESERQKSVEEFYKSNHINQTFDFVKKMREEYSKLNRVEMSI  119

Query  261  WECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPS  82
            WECCELLN+VVDDSDPDLDEPQIEHLLQTAEAIRKDYP++ WLHLTALIHDLGKVLL PS
Sbjct  120  WECCELLNEVVDDSDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTALIHDLGKVLLLPS  179

Query  81   FGELPQWAVVGDTFPLGCAFDESIVHH  1
            FGELPQWAVVGDT PLGCAFDESIVHH
Sbjct  180  FGELPQWAVVGDTHPLGCAFDESIVHH  206



>ref|NP_001289646.1| inositol oxygenase [Eucalyptus grandis]
 gb|ACF04280.1| myo-inositol oxygenase [Eucalyptus grandis]
 gb|KCW79589.1| hypothetical protein EUGRSUZ_C00949 [Eucalyptus grandis]
Length=315

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 7/193 (4%)
 Frame = -3

Query  573  MTILI--IEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTILI  IE  A+  E+K    +   N+L+LDGGF  PK   +SN GF APE+N+FG SF
Sbjct  1    MTILIEQIENGAQAEEQKTLTIT---NDLVLDGGFAEPKE--ASNDGFLAPEINAFGHSF  55

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R YDAES+RQK+VEEFYR+ HI+QTYDFVKR RE+YG+LDK+EMSIWECCELLNDV+D+S
Sbjct  56   RDYDAESQRQKTVEEFYRLNHIHQTYDFVKRKREEYGKLDKIEMSIWECCELLNDVIDES  115

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLHPSFG LPQWAVVGDT 
Sbjct  116  DPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPSFGGLPQWAVVGDTH  175

Query  39   PLGCAFDESIVHH  1
            PLGCAFDESIVHH
Sbjct  176  PLGCAFDESIVHH  188



>gb|KDO55904.1| hypothetical protein CISIN_1g021203mg [Citrus sinensis]
Length=254

 Score =   263 bits (671),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 159/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI +        +     +  NEL+LDGGFVVPKT+   N GF APE+NSFG++FR 
Sbjct  1    MTILIDQPELIGSRAEDQNLQEQTNELVLDGGFVVPKTM--PNDGFVAPEINSFGKTFRD  58

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+AE ERQKSVEEFYR+QHINQTYDFVK+MRE+Y +LDK EMSIWECCELLN+VVD+SDP
Sbjct  59   YNAECERQKSVEEFYRLQHINQTYDFVKKMREEYAKLDKAEMSIWECCELLNEVVDESDP  118

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGKVL  P FG LPQWAVVGDTFPL
Sbjct  119  DLDEPQIQHLLQSAEAIRKDYPDEDWLHLTALIHDLGKVLTLPKFGGLPQWAVVGDTFPL  178

Query  33   GCAFDESIVHH  1
            GCAFDES VHH
Sbjct  179  GCAFDESNVHH  189



>ref|XP_006451360.1| hypothetical protein CICLE_v10008962mg [Citrus clementina]
 ref|XP_006475366.1| PREDICTED: inositol oxygenase 2-like [Citrus sinensis]
 gb|ESR64600.1| hypothetical protein CICLE_v10008962mg [Citrus clementina]
Length=316

 Score =   265 bits (676),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 160/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI +        +     +  NEL+LDGGFVVPKT+   N GF APE+NSFG++FR 
Sbjct  1    MTILIDQPELIGSRAEDQNLQEQTNELVLDGGFVVPKTM--PNDGFVAPEINSFGKTFRD  58

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+AESERQKSVEEFYR+QHINQTYDFVK+MRE+Y +LDK EMSIWECCELLN+VVD+SDP
Sbjct  59   YNAESERQKSVEEFYRLQHINQTYDFVKKMREEYAKLDKAEMSIWECCELLNEVVDESDP  118

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGKVL  P FG LPQWAVVGDTFPL
Sbjct  119  DLDEPQIQHLLQSAEAIRKDYPDEDWLHLTALIHDLGKVLTLPKFGGLPQWAVVGDTFPL  178

Query  33   GCAFDESIVHH  1
            GCAFDES VHH
Sbjct  179  GCAFDESNVHH  189



>ref|XP_010688397.1| PREDICTED: inositol oxygenase 4 [Beta vulgaris subsp. vulgaris]
Length=318

 Score =   264 bits (674),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 162/192 (84%), Gaps = 2/192 (1%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTL-MSSNGGFEAPEMNSFGQSFR  397
            MT+++ E   E  EE + +  D  NEL+LD GF +P+   + SN GF  PE N+FG +FR
Sbjct  1    MTVIVEEPVFETQEETKKICLD-TNELVLDAGFKMPEPKDLVSNNGFSTPENNAFGNTFR  59

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAESERQKSVEEFY+  HI+QT DFVKRMRE+Y +LDKV+MSIWECCELLN VVD+SD
Sbjct  60   DYDAESERQKSVEEFYKQNHIHQTVDFVKRMREEYKKLDKVKMSIWECCELLNTVVDESD  119

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP++ WLHLTALIHDLGKVL+HPSFGELPQWAVVGDTFP
Sbjct  120  PDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTALIHDLGKVLVHPSFGELPQWAVVGDTFP  179

Query  36   LGCAFDESIVHH  1
            +GCAFDESIVHH
Sbjct  180  VGCAFDESIVHH  191



>ref|XP_010086904.1| Inositol oxygenase 2 [Morus notabilis]
 gb|EXB24695.1| Inositol oxygenase 2 [Morus notabilis]
Length=327

 Score =   264 bits (674),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 166/203 (82%), Gaps = 15/203 (7%)
 Frame = -3

Query  573  MTILIIEKP--AEHVEEKQAVPSDNANELILDGGFVVPKTLMS----------SNGGFEA  430
            MTILI E+P    HVE K+       NEL+LDGGFVVPK L +          SN  F A
Sbjct  1    MTILI-EQPEHVSHVENKKLCSE--TNELVLDGGFVVPKDLSNHGCVISEIFVSNNEFIA  57

Query  429  PEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECC  250
            PE+NSFGQSFR Y+AESERQK+VEEFYR+ H+NQTY++VKRMRE+YG+L++ EMSIWECC
Sbjct  58   PEINSFGQSFRDYNAESERQKTVEEFYRLNHLNQTYEYVKRMREEYGKLNRAEMSIWECC  117

Query  249  EllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGEL  70
            ELLN+VVDDSDPDLDEPQIEHLLQTAEAIRKDYP + WLHLTALIHDLGKVLL P FG L
Sbjct  118  ELLNEVVDDSDPDLDEPQIEHLLQTAEAIRKDYPEEDWLHLTALIHDLGKVLLLPVFGGL  177

Query  69   PQWAVVGDTFPLGCAFDESIVHH  1
            PQWAVVGDT PLGCAFDESIVHH
Sbjct  178  PQWAVVGDTHPLGCAFDESIVHH  200



>gb|KDO55903.1| hypothetical protein CISIN_1g021203mg [Citrus sinensis]
Length=316

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 159/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI +        +     +  NEL+LDGGFVVPKT+   N GF APE+NSFG++FR 
Sbjct  1    MTILIDQPELIGSRAEDQNLQEQTNELVLDGGFVVPKTM--PNDGFVAPEINSFGKTFRD  58

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+AE ERQKSVEEFYR+QHINQTYDFVK+MRE+Y +LDK EMSIWECCELLN+VVD+SDP
Sbjct  59   YNAECERQKSVEEFYRLQHINQTYDFVKKMREEYAKLDKAEMSIWECCELLNEVVDESDP  118

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGKVL  P FG LPQWAVVGDTFPL
Sbjct  119  DLDEPQIQHLLQSAEAIRKDYPDEDWLHLTALIHDLGKVLTLPKFGGLPQWAVVGDTFPL  178

Query  33   GCAFDESIVHH  1
            GCAFDES VHH
Sbjct  179  GCAFDESNVHH  189



>gb|AFK40439.1| unknown [Medicago truncatula]
Length=225

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 163/196 (83%), Gaps = 12/196 (6%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-----EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFG  409
            MTIL+     EHV+     + + V S++ NEL+LDGGF  PK   +S   F APE+N+FG
Sbjct  1    MTILV-----EHVDFGSQFDDKNVHSEDINELVLDGGFPQPKN--ASQNTFFAPEINAFG  53

Query  408  QSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvv  229
             SFR YD ESERQK VEEFYR+QHINQTYDFVK+MRE+Y +LDK EMSIWECCELLN+VV
Sbjct  54   HSFRNYDEESERQKGVEEFYRLQHINQTYDFVKKMREEYKKLDKAEMSIWECCELLNEVV  113

Query  228  ddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVG  49
            D+SDPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGK+LL P FGELPQWAVVG
Sbjct  114  DESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKILLLPKFGELPQWAVVG  173

Query  48   DTFPLGCAFDESIVHH  1
            DTFPLGCAFDES VHH
Sbjct  174  DTFPLGCAFDESNVHH  189



>ref|XP_007160260.1| hypothetical protein PHAVU_002G306200g [Phaseolus vulgaris]
 gb|ESW32254.1| hypothetical protein PHAVU_002G306200g [Phaseolus vulgaris]
Length=317

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 5/193 (3%)
 Frame = -3

Query  573  MTILIIEKPA--EHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTILI E+P   E   E + V +   NEL+LDGGF VPK    S  GF+ PE+NSFGQ+F
Sbjct  1    MTILI-EQPVLLESQVEGKNVHAVETNELVLDGGFQVPKN--ESKDGFKPPEINSFGQTF  57

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R Y+AESERQK VEEFYRVQHINQT+DFVKRMRE YG+LDK EMSIWECCELLN+VVDDS
Sbjct  58   RDYEAESERQKGVEEFYRVQHINQTHDFVKRMREKYGKLDKAEMSIWECCELLNEVVDDS  117

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGK+L+ P+FGELPQWAVVGDTF
Sbjct  118  DPDLDEPQIQHLLQSAEAIRKDYPDEDWLHLTALIHDLGKILILPAFGELPQWAVVGDTF  177

Query  39   PLGCAFDESIVHH  1
            P+GCAFD+S +HH
Sbjct  178  PVGCAFDKSNIHH  190



>ref|XP_009352587.1| PREDICTED: inositol oxygenase 2 [Pyrus x bretschneideri]
Length=333

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 169/207 (82%), Gaps = 17/207 (8%)
 Frame = -3

Query  573  MTILIIEKP--AEHVEEKQAVPSD---NANELILDGGFVVPKTLMSSNG-----------  442
            MTIL  E+P     +EEK+ + S+     NEL+LDGGFVVPK +  ++G           
Sbjct  1    MTILT-EQPELGLQMEEKKIISSEIDGEINELVLDGGFVVPKEISKNDGIVAQDIAVSNE  59

Query  441  GFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSI  262
             F APE+NSFGQSFR Y+AESER KSVEEFYR+ HI+QTYDFVK+MRE+Y +L++VEMSI
Sbjct  60   AFIAPEINSFGQSFRDYNAESERHKSVEEFYRLNHIHQTYDFVKQMREEYSKLNRVEMSI  119

Query  261  WECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPS  82
            WECCELLN+VVDDSDPDLDEPQIEHLLQTAEAIRKDYP + WLHLTALIHDLGKVLL PS
Sbjct  120  WECCELLNEVVDDSDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTALIHDLGKVLLLPS  179

Query  81   FGELPQWAVVGDTFPLGCAFDESIVHH  1
            FGELPQWAVVGDT PLGCAFDESIVHH
Sbjct  180  FGELPQWAVVGDTHPLGCAFDESIVHH  206



>gb|KHM99828.1| Inositol oxygenase 4 [Glycine soja]
Length=312

 Score =   262 bits (669),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 163/192 (85%), Gaps = 8/192 (4%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTILI E+PA  ++ E   V ++  NEL+L+GGF +PK       G+ APE+NSFG SFR
Sbjct  1    MTILI-EQPALELQVEGNNVHAEETNELVLEGGFPLPKD------GYMAPEINSFGHSFR  53

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAESERQK VEEFYR+QHINQTYDFVKRMRE+YG+LDK EM IWECCELLN++VD+SD
Sbjct  54   EYDAESERQKGVEEFYRLQHINQTYDFVKRMREEYGKLDKAEMGIWECCELLNELVDESD  113

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQ+AE IRKDYP++ WLHLTALIHDLGK+L  PSFGELPQWAVVGDTFP
Sbjct  114  PDLDEPQIQHLLQSAETIRKDYPNEDWLHLTALIHDLGKILALPSFGELPQWAVVGDTFP  173

Query  36   LGCAFDESIVHH  1
            LGCAFDES VHH
Sbjct  174  LGCAFDESNVHH  185



>ref|NP_001242635.1| uncharacterized protein LOC100788665 [Glycine max]
 gb|ACU22894.1| unknown [Glycine max]
Length=312

 Score =   262 bits (669),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 163/192 (85%), Gaps = 8/192 (4%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTILI E+PA  ++ E   V ++  NEL+L+GGF +PK       G+ APE+NSFG SFR
Sbjct  1    MTILI-EQPALELQVEGNNVHAEETNELVLEGGFPLPKD------GYMAPEINSFGHSFR  53

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAESERQK VEEFYR+QHINQTYDFVKRMRE+YG+LDK EM IWECCELLN++VD+SD
Sbjct  54   EYDAESERQKGVEEFYRLQHINQTYDFVKRMREEYGKLDKAEMGIWECCELLNELVDESD  113

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQ+AE IRKDYP++ WLHLTALIHDLGK+L  PSFGELPQWAVVGDTFP
Sbjct  114  PDLDEPQIQHLLQSAETIRKDYPNEDWLHLTALIHDLGKILALPSFGELPQWAVVGDTFP  173

Query  36   LGCAFDESIVHH  1
            LGCAFDES VHH
Sbjct  174  LGCAFDESNVHH  185



>gb|ACU19277.1| unknown [Glycine max]
Length=306

 Score =   261 bits (668),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 163/192 (85%), Gaps = 8/192 (4%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTILI E+PA  ++ E   V ++  NEL+L+GGF +PK       G+ APE+NSFG SFR
Sbjct  1    MTILI-EQPALELQVEGNNVHAEETNELVLEGGFPLPKD------GYMAPEINSFGHSFR  53

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAESERQK VEEFYR+QHINQTYDFVKRMRE+YG+LDK EM IWECCELLN++VD+SD
Sbjct  54   EYDAESERQKGVEEFYRLQHINQTYDFVKRMREEYGKLDKAEMGIWECCELLNELVDESD  113

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQ+AE IRKDYP++ WLHLTALIHDLGK+L  PSFGELPQWAVVGDTFP
Sbjct  114  PDLDEPQIQHLLQSAETIRKDYPNEDWLHLTALIHDLGKILALPSFGELPQWAVVGDTFP  173

Query  36   LGCAFDESIVHH  1
            LGCAFDES VHH
Sbjct  174  LGCAFDESNVHH  185



>ref|XP_007203887.1| hypothetical protein PRUPE_ppa008804mg [Prunus persica]
 gb|EMJ05086.1| hypothetical protein PRUPE_ppa008804mg [Prunus persica]
Length=318

 Score =   261 bits (667),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 159/189 (84%), Gaps = 11/189 (6%)
 Frame = -3

Query  534  EEKQAVPSDNANELILDGGFVVPKTL-----------MSSNGGFEAPEMNSFGQSFRAYD  388
            E+K    ++   EL+LDGGFVVPK +            +SN  F APE+NSFGQSFR Y+
Sbjct  3    EKKLCSETNETCELVLDGGFVVPKDISKNDGCVTQEIAASNDAFIAPEINSFGQSFRDYN  62

Query  387  AESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdl  208
            AESERQKSVEEFY+  HINQT+DFVK+MRE+Y +L++VEMSIWECCELLN+VVDDSDPDL
Sbjct  63   AESERQKSVEEFYKSNHINQTFDFVKKMREEYSKLNRVEMSIWECCELLNEVVDDSDPDL  122

Query  207  DEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGC  28
            DEPQIEHLLQTAEAIRKDYP++ WLHLTALIHDLGKVLL PSFGELPQWAVVGDT PLGC
Sbjct  123  DEPQIEHLLQTAEAIRKDYPNEDWLHLTALIHDLGKVLLLPSFGELPQWAVVGDTHPLGC  182

Query  27   AFDESIVHH  1
            AFDESIVHH
Sbjct  183  AFDESIVHH  191



>ref|XP_002514185.1| myoinositol oxygenase, putative [Ricinus communis]
 gb|EEF48139.1| myoinositol oxygenase, putative [Ricinus communis]
Length=315

 Score =   261 bits (666),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 160/191 (84%), Gaps = 3/191 (2%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI  +P            D+  EL+LDGGF VPKT  SS+ GF+APE+N+FG SFR 
Sbjct  1    MTILI-NQPELGSRVDDQKHQDDVKELVLDGGFPVPKT--SSDEGFDAPEINAFGNSFRD  57

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y AESER+KSVEEFYR QHINQTYDFVK+MRE+Y +LDK  MSIWECCELLN+VVDDSDP
Sbjct  58   YSAESERKKSVEEFYRQQHINQTYDFVKKMREEYSKLDKAVMSIWECCELLNEVVDDSDP  117

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKVLL P FGELPQWAVVGDTFPL
Sbjct  118  DLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVLLLPQFGELPQWAVVGDTFPL  177

Query  33   GCAFDESIVHH  1
            GCAFDES +HH
Sbjct  178  GCAFDESNIHH  188



>ref|XP_007045580.1| Myo-inositol oxygenase 1 isoform 1 [Theobroma cacao]
 gb|EOY01412.1| Myo-inositol oxygenase 1 isoform 1 [Theobroma cacao]
Length=316

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 160/192 (83%), Gaps = 4/192 (2%)
 Frame = -3

Query  573  MTILIIEKPAEH-VEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTILI +   E  + E+   P D  NEL+LDGGFVVP+T+   + GF AP+ NSFG +FR
Sbjct  1    MTILIEQPEFEGGIGERNKGPVD-ENELVLDGGFVVPETM--PDEGFVAPDTNSFGHTFR  57

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             Y  ESERQ  VEEFYR  HINQT DFV+RMRE+YG+L+KVEMSIWECCELLN+ VD+SD
Sbjct  58   DYHVESERQNGVEEFYRTNHINQTVDFVRRMREEYGKLNKVEMSIWECCELLNEFVDESD  117

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLHP+FGELPQWAVVGDTFP
Sbjct  118  PDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPAFGELPQWAVVGDTFP  177

Query  36   LGCAFDESIVHH  1
            +GCA+DESIVHH
Sbjct  178  VGCAYDESIVHH  189



>ref|XP_003630676.1| Inositol oxygenase [Medicago truncatula]
 gb|AET05152.1| myo-inositol oxygenase [Medicago truncatula]
Length=316

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 163/196 (83%), Gaps = 12/196 (6%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-----EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFG  409
            MTIL+     EHV+     + + V S++ NEL+LDGGF  PK   +S   F APE+N+FG
Sbjct  1    MTILV-----EHVDFGSQFDDKNVHSEDINELVLDGGFPQPKN--ASQNTFFAPEINAFG  53

Query  408  QSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvv  229
             SFR YD ESERQK VEEFYR+QHINQTYDFVK+MRE+Y +LDK EMSIWECCELLN+VV
Sbjct  54   HSFRNYDEESERQKGVEEFYRLQHINQTYDFVKKMREEYKKLDKAEMSIWECCELLNEVV  113

Query  228  ddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVG  49
            D+SDPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGK+LL P FGELPQWAVVG
Sbjct  114  DESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKILLLPKFGELPQWAVVG  173

Query  48   DTFPLGCAFDESIVHH  1
            DTFPLGCAFDES VHH
Sbjct  174  DTFPLGCAFDESNVHH  189



>gb|KHG27947.1| Inositol oxygenase 2 -like protein [Gossypium arboreum]
Length=315

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 163/191 (85%), Gaps = 3/191 (2%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI EKP    +    +  D + EL+LDGGF VPK+L  S  GF APE+NSFG SFR 
Sbjct  1    MTILI-EKPELVSQSDCQIHVDESKELVLDGGFPVPKSL--SGEGFLAPEVNSFGNSFRD  57

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+AESERQKSVEEFY+ QH+NQTYDFV++MRE+Y +L+++EMSIWECCELLN+VVDDSDP
Sbjct  58   YNAESERQKSVEEFYKQQHVNQTYDFVQKMREEYSKLNRMEMSIWECCELLNEVVDDSDP  117

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKVLL P FG LPQWAVVGDTFPL
Sbjct  118  DLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVLLLPKFGGLPQWAVVGDTFPL  177

Query  33   GCAFDESIVHH  1
            GCAFDE+ +HH
Sbjct  178  GCAFDEANIHH  188



>ref|XP_008337619.1| PREDICTED: inositol oxygenase 1-like [Malus domestica]
Length=333

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 169/207 (82%), Gaps = 17/207 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVE--EKQAVPSD---NANELILDGGFVVPKTL-----------MSSNG  442
            MTIL  E+P   ++  EK+ + S+     +EL+LDGGFVVPK +            +SN 
Sbjct  1    MTILT-EQPELGLQMGEKKIISSEINGEISELVLDGGFVVPKEISKNDGIVAQEIAASNE  59

Query  441  GFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSI  262
             F APE+NSFGQSFR Y+AESER KSVEEFYR+ HI+QTYDFVKRMRE+Y +L++V+MSI
Sbjct  60   AFIAPEINSFGQSFRDYNAESERHKSVEEFYRLNHIHQTYDFVKRMREEYSKLNRVKMSI  119

Query  261  WECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPS  82
            WECCELLN+VVDDSDPDLDEPQIEHLLQTAEAIRKDYP + WLHLTALIHDLGKVLL PS
Sbjct  120  WECCELLNEVVDDSDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTALIHDLGKVLLLPS  179

Query  81   FGELPQWAVVGDTFPLGCAFDESIVHH  1
            FGELPQWAVVGDT PLGCAFDESIVHH
Sbjct  180  FGELPQWAVVGDTHPLGCAFDESIVHH  206



>gb|ACJ84274.1| unknown [Medicago truncatula]
 gb|AFK39420.1| unknown [Medicago truncatula]
 gb|AFK41680.1| unknown [Medicago truncatula]
Length=316

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 163/196 (83%), Gaps = 12/196 (6%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-----EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFG  409
            MTIL+     EHV+     + + V S++ NEL+LDGGF  PK   +S   F APE+N+FG
Sbjct  1    MTILV-----EHVDFGSQFDDKNVHSEDINELVLDGGFPQPKN--ASQNTFFAPEINAFG  53

Query  408  QSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvv  229
             SF+ YD ESERQK VEEFYR+QHINQTYDFVK+MRE+Y +LDK EMSIWECCELLN+VV
Sbjct  54   HSFKNYDEESERQKGVEEFYRLQHINQTYDFVKKMREEYKKLDKAEMSIWECCELLNEVV  113

Query  228  ddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVG  49
            D+SDPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGK+LL P FGELPQWAVVG
Sbjct  114  DESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKILLLPKFGELPQWAVVG  173

Query  48   DTFPLGCAFDESIVHH  1
            DTFPLGCAFDES VHH
Sbjct  174  DTFPLGCAFDESNVHH  189



>ref|XP_008459136.1| PREDICTED: inositol oxygenase 2-like [Cucumis melo]
Length=428

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 164/193 (85%), Gaps = 3/193 (2%)
 Frame = -3

Query  576  RMTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            RMTIL+ ++        QA+  D +NEL+LDGGF+ PK+   ++ GF APE+NSFG SFR
Sbjct  111  RMTILVPQRQFASEAGTQAISLD-SNELVLDGGFINPKS-SPNDAGFFAPEINSFGHSFR  168

Query  396  AYD-AESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
             YD AES RQK+VEE YR+ HINQTYDFVKRMRE+YG+LDK EMSIWECCE+LN+VVDDS
Sbjct  169  DYDNAESVRQKTVEELYRLNHINQTYDFVKRMREEYGKLDKTEMSIWECCEMLNEVVDDS  228

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGKVL+ P+FG LPQWAVVGDT+
Sbjct  229  DPDLDEPQIQHLLQSAEAIRKDYPDEDWLHLTALIHDLGKVLMLPAFGGLPQWAVVGDTY  288

Query  39   PLGCAFDESIVHH  1
            PLGCAFD+SIVHH
Sbjct  289  PLGCAFDKSIVHH  301



>gb|KCW65034.1| hypothetical protein EUGRSUZ_G02560 [Eucalyptus grandis]
Length=260

 Score =   255 bits (651),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 156/191 (82%), Gaps = 14/191 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MT+ I+E+P   VE  +       NEL+LDGGFVVP+T             NSFGQ+FR 
Sbjct  1    MTV-IVEQPELEVEVVEKKDDVEENELLLDGGFVVPET-------------NSFGQTFRD  46

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+AESERQ SVE+FYR  HINQTYDFVK+MRE+YG L++VEMSIWECCELLN+ VD+SDP
Sbjct  47   YNAESERQSSVEQFYRTNHINQTYDFVKKMREEYGVLNRVEMSIWECCELLNEFVDESDP  106

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLLHPSFG LPQWAVVGDTFP+
Sbjct  107  DLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLHPSFGALPQWAVVGDTFPV  166

Query  33   GCAFDESIVHH  1
            GCAFDES+VHH
Sbjct  167  GCAFDESVVHH  177



>ref|XP_008361306.1| PREDICTED: inositol oxygenase 2-like [Malus domestica]
Length=333

 Score =   257 bits (656),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 168/207 (81%), Gaps = 17/207 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVE--EKQAVPSD---NANELILDGGFVVPKTL-----------MSSNG  442
            MTIL  E+P   ++  EK+ + S+     +EL+LDGGFVVPK +            +SN 
Sbjct  1    MTILT-EQPELGLQMGEKKIISSEINGEISELVLDGGFVVPKEISKNDGIVAQEIAASNE  59

Query  441  GFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSI  262
             F APE+NSFGQSFR Y+AESER KSVEEFYR+ HI+QTYDFVKRMRE+Y +L++V+MSI
Sbjct  60   AFIAPEINSFGQSFRDYNAESERHKSVEEFYRLNHIHQTYDFVKRMREEYSKLNRVKMSI  119

Query  261  WECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPS  82
            WECCELLN+VVDDSDPDLDEPQIEHLLQTAEAIRKDYP + WLHLTALIHDLGKVLL PS
Sbjct  120  WECCELLNEVVDDSDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTALIHDLGKVLLLPS  179

Query  81   FGELPQWAVVGDTFPLGCAFDESIVHH  1
            FGELPQWAVVGDT PLGCAFDES VHH
Sbjct  180  FGELPQWAVVGDTHPLGCAFDESXVHH  206



>ref|XP_008450805.1| PREDICTED: inositol oxygenase 2-like [Cucumis melo]
Length=315

 Score =   256 bits (653),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 160/191 (84%), Gaps = 3/191 (2%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI E+P   VE+++ V      EL+LDGGFVVP     +  GF APEMN+FG SFR 
Sbjct  1    MTILI-EQPHFEVEDEKKVGMTELKELVLDGGFVVPNA--RTTEGFAAPEMNAFGHSFRD  57

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+AESERQK VEEFYR  HI+QTY+FV +MRE+Y ++D+VEMSIWECCELLNDVVDDSDP
Sbjct  58   YEAESERQKGVEEFYRKNHIHQTYEFVTKMREEYKKMDRVEMSIWECCELLNDVVDDSDP  117

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQTAEAIRKDYP + WLHLTALIHDLGKVLL PSFG LPQWAVVGDT P+
Sbjct  118  DLDEPQIQHLLQTAEAIRKDYPDEDWLHLTALIHDLGKVLLLPSFGGLPQWAVVGDTHPV  177

Query  33   GCAFDESIVHH  1
            GCAFDESIVHH
Sbjct  178  GCAFDESIVHH  188



>ref|XP_010062558.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Eucalyptus grandis]
Length=304

 Score =   255 bits (652),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 157/191 (82%), Gaps = 14/191 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI ++P   VEE+  V  +   EL+LDGGF+             AP+ NSFG +FR 
Sbjct  1    MTILI-DQPEHAVEEETKVLVEEEKELVLDGGFL-------------APDTNSFGHTFRT  46

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDAESERQ  VE FYR+ HI+QTYD V+RMRE+YG+LDKVEMSIW+CCELLNDVVD+SDP
Sbjct  47   YDAESERQAGVENFYRINHISQTYDSVQRMREEYGKLDKVEMSIWDCCELLNDVVDESDP  106

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLLHPSFGELPQWAVVGDT+PL
Sbjct  107  DLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLHPSFGELPQWAVVGDTYPL  166

Query  33   GCAFDESIVHH  1
            GCAFDESIVHH
Sbjct  167  GCAFDESIVHH  177



>ref|XP_007045581.1| Myo-inositol oxygenase 1 isoform 2 [Theobroma cacao]
 gb|EOY01413.1| Myo-inositol oxygenase 1 isoform 2 [Theobroma cacao]
Length=317

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 160/193 (83%), Gaps = 5/193 (3%)
 Frame = -3

Query  573  MTILIIEKPAEH-VEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF-  400
            MTILI +   E  + E+   P D  NEL+LDGGFVVP+T+   + GF AP+ NSFG +F 
Sbjct  1    MTILIEQPEFEGGIGERNKGPVDE-NELVLDGGFVVPETM--PDEGFVAPDTNSFGHTFS  57

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R Y  ESERQ  VEEFYR  HINQT DFV+RMRE+YG+L+KVEMSIWECCELLN+ VD+S
Sbjct  58   RDYHVESERQNGVEEFYRTNHINQTVDFVRRMREEYGKLNKVEMSIWECCELLNEFVDES  117

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLHP+FGELPQWAVVGDTF
Sbjct  118  DPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPAFGELPQWAVVGDTF  177

Query  39   PLGCAFDESIVHH  1
            P+GCA+DESIVHH
Sbjct  178  PVGCAYDESIVHH  190



>ref|XP_010066969.1| PREDICTED: inositol oxygenase 1-like [Eucalyptus grandis]
 gb|KCW65033.1| hypothetical protein EUGRSUZ_G02560 [Eucalyptus grandis]
Length=304

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 156/191 (82%), Gaps = 14/191 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MT+ I+E+P   VE  +       NEL+LDGGFVVP+T             NSFGQ+FR 
Sbjct  1    MTV-IVEQPELEVEVVEKKDDVEENELLLDGGFVVPET-------------NSFGQTFRD  46

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+AESERQ SVE+FYR  HINQTYDFVK+MRE+YG L++VEMSIWECCELLN+ VD+SDP
Sbjct  47   YNAESERQSSVEQFYRTNHINQTYDFVKKMREEYGVLNRVEMSIWECCELLNEFVDESDP  106

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLLHPSFG LPQWAVVGDTFP+
Sbjct  107  DLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLHPSFGALPQWAVVGDTFPV  166

Query  33   GCAFDESIVHH  1
            GCAFDES+VHH
Sbjct  167  GCAFDESVVHH  177



>ref|XP_004141036.1| PREDICTED: inositol oxygenase 2-like [Cucumis sativus]
 gb|KGN60556.1| hypothetical protein Csa_2G000640 [Cucumis sativus]
Length=317

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 162/192 (84%), Gaps = 3/192 (2%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI ++        QA+  D +NEL+LDG FV PK+   ++ GF APE+NSFG SFR 
Sbjct  1    MTILIPQRQFASEAGTQAISLD-SNELVLDGEFVNPKS-SPNDAGFFAPEINSFGHSFRD  58

Query  393  YD-AESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
            YD AES RQK+VEE YR+ HINQTYDFVK+MRE+YG+LDK EMSIWECCE+LN+VVDDSD
Sbjct  59   YDNAESVRQKTVEELYRLNHINQTYDFVKKMREEYGKLDKTEMSIWECCEMLNEVVDDSD  118

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGKVLL P+FG LPQWAVVGDT+P
Sbjct  119  PDLDEPQIQHLLQSAEAIRKDYPDEDWLHLTALIHDLGKVLLLPAFGGLPQWAVVGDTYP  178

Query  36   LGCAFDESIVHH  1
            LGCAFD+SIVHH
Sbjct  179  LGCAFDKSIVHH  190



>ref|XP_004157903.1| PREDICTED: inositol oxygenase 2-like [Cucumis sativus]
Length=317

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 162/192 (84%), Gaps = 3/192 (2%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI ++        QA+  D +NEL+LDG FV PK+   ++ GF APE+NSFG SFR 
Sbjct  1    MTILIPQRQFASEAGTQAISLD-SNELVLDGEFVNPKS-SPNDAGFFAPEINSFGHSFRD  58

Query  393  YD-AESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
            YD AES RQK+VEE YR+ HINQTYDFVK+MRE+YG+LDK EMSIWECCE+LN+VVDDSD
Sbjct  59   YDNAESVRQKTVEELYRLNHINQTYDFVKKMREEYGKLDKTEMSIWECCEMLNEVVDDSD  118

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGKVLL P+FG LPQWAVVGDT+P
Sbjct  119  PDLDEPQIQHLLQSAEAIRKDYPDEDWLHLTALIHDLGKVLLLPAFGGLPQWAVVGDTYP  178

Query  36   LGCAFDESIVHH  1
            LGCAFD+SIVHH
Sbjct  179  LGCAFDKSIVHH  190



>ref|XP_010267091.1| PREDICTED: probable inositol oxygenase [Nelumbo nucifera]
Length=305

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 160/192 (83%), Gaps = 15/192 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MT+ IIE+P    + E + +PS +ANEL+LDGGFV             APE NSFG +FR
Sbjct  1    MTV-IIEQPEFGAQAENKKIPSSDANELVLDGGFV-------------APETNSFGHTFR  46

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAESERQK+VEEFYR+ HINQ++ FV++MRE+YG+L++VEMSIWECCELLN+ VD+SD
Sbjct  47   DYDAESERQKTVEEFYRMNHINQSFGFVRKMREEYGKLNRVEMSIWECCELLNEFVDESD  106

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLLHPSFG LPQWAVVGDTFP
Sbjct  107  PDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLHPSFGALPQWAVVGDTFP  166

Query  36   LGCAFDESIVHH  1
            +GCAFDES VH+
Sbjct  167  VGCAFDESNVHY  178



>ref|XP_006379810.1| hypothetical protein POPTR_0008s14360g [Populus trichocarpa]
 gb|ERP57607.1| hypothetical protein POPTR_0008s14360g [Populus trichocarpa]
Length=275

 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 155/196 (79%), Gaps = 18/196 (9%)
 Frame = -3

Query  573  MTILIIEKPAEHVE--EKQAVPSDN---ANELILDGGFVVPKTLMSSNGGFEAPEMNSFG  409
            MTIL    PA  VE  EK  +P D+    NEL+LD GFVVP T             NSFG
Sbjct  1    MTILCEHPPAFGVELEEKNNIPVDHDGQENELVLDEGFVVPDT-------------NSFG  47

Query  408  QSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvv  229
             +FR YD ESERQK VEEFYR  HINQTY FVKRMRE+YG+L++VEMSIWECCELLN+ +
Sbjct  48   HTFRDYDIESERQKGVEEFYRTNHINQTYGFVKRMREEYGKLNRVEMSIWECCELLNEFI  107

Query  228  ddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVG  49
            D+SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLHP+FGELPQWAVVG
Sbjct  108  DESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPAFGELPQWAVVG  167

Query  48   DTFPLGCAFDESIVHH  1
            DTFP+GCAFDESIVHH
Sbjct  168  DTFPVGCAFDESIVHH  183



>ref|XP_011025349.1| PREDICTED: inositol oxygenase 1 [Populus euphratica]
Length=309

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 157/195 (81%), Gaps = 17/195 (9%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDN---ANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQ  406
            MTIL    PA  VE E++ +P D+    NEL+LDGGF+VP             + NSFG 
Sbjct  1    MTILYEHPPAFGVELEEKNIPVDHDGQENELVLDGGFIVP-------------DANSFGH  47

Query  405  SFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvd  226
            +FR YD ESERQK VEEFYR  HINQTY FVKRMRE+YG+L++VEMSIWECCELLN+ +D
Sbjct  48   TFRDYDIESERQKGVEEFYRTNHINQTYGFVKRMREEYGKLNRVEMSIWECCELLNEFID  107

Query  225  dsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGD  46
            +SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLHP+FGELPQWAVVGD
Sbjct  108  ESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPAFGELPQWAVVGD  167

Query  45   TFPLGCAFDESIVHH  1
            TFP+GCAFDESIVHH
Sbjct  168  TFPVGCAFDESIVHH  182



>gb|KDP33765.1| hypothetical protein JCGZ_07336 [Jatropha curcas]
Length=315

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 161/191 (84%), Gaps = 3/191 (2%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI  +P   +  ++    D+  EL+LDGGF VPK+  +S   F+APE+NSFG SFR 
Sbjct  1    MTILI-SQPELGLHGEEQKHQDHVKELVLDGGFPVPKS--TSADAFDAPEINSFGNSFRD  57

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+AESERQK+VEEFYR QHINQTYDFVK+MRE+Y +LDK EMSIWECCELLN+VVDDSDP
Sbjct  58   YNAESERQKTVEEFYRQQHINQTYDFVKKMREEYEKLDKAEMSIWECCELLNEVVDDSDP  117

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKD+P + WLHLTALIHDLGKVLL P FG LPQWAVVGDTFPL
Sbjct  118  DLDEPQIQHLLQSAEAIRKDHPDEDWLHLTALIHDLGKVLLLPQFGALPQWAVVGDTFPL  177

Query  33   GCAFDESIVHH  1
            GCAFDES VH+
Sbjct  178  GCAFDESNVHY  188



>ref|XP_011008897.1| PREDICTED: inositol oxygenase 2 [Populus euphratica]
Length=310

 Score =   254 bits (648),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 159/191 (83%), Gaps = 8/191 (4%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI   P   + E   +   +A EL+LDGGFVVP    +    F+APE+NSFG SFR 
Sbjct  1    MTILI---PQPELSEGH-IDDYDAKELVLDGGFVVP----NKTEAFDAPEINSFGNSFRD  52

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+AESERQK+VEEFYR QHINQTYD+V +MRE+YG+LDK  MSIWECCELLNDVVDDSDP
Sbjct  53   YNAESERQKTVEEFYRQQHINQTYDYVMKMREEYGKLDKAVMSIWECCELLNDVVDDSDP  112

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKVLL P FG+LPQWAVVGDTFPL
Sbjct  113  DLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVLLLPQFGQLPQWAVVGDTFPL  172

Query  33   GCAFDESIVHH  1
            GCAFDES VHH
Sbjct  173  GCAFDESNVHH  183



>ref|XP_007012955.1| Myo-inositol oxygenase 2 isoform 1 [Theobroma cacao]
 gb|EOY30574.1| Myo-inositol oxygenase 2 isoform 1 [Theobroma cacao]
Length=315

 Score =   254 bits (648),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 162/198 (82%), Gaps = 17/198 (9%)
 Frame = -3

Query  573  MTILI----IEKPAE---HVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNS  415
            MTILI    IE  AE   HVEE         NEL+LDGGF VP  L  S+  F APE+NS
Sbjct  1    MTILIEKPEIESQAECQKHVEEN--------NELVLDGGFPVPTCL--SDDAFLAPEINS  50

Query  414  FGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllnd  235
            FG SFR YDAESERQKSVEEFYR QHINQTYDFV++MR++Y +L+++EMSIWECCELLN+
Sbjct  51   FGHSFRDYDAESERQKSVEEFYRQQHINQTYDFVQQMRKEYSKLNRMEMSIWECCELLNE  110

Query  234  vvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAV  55
            VVDDSDPDLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGKVLL P FG LPQWAV
Sbjct  111  VVDDSDPDLDEPQIQHLLQSAEAIRKDYPDEDWLHLTALIHDLGKVLLLPKFGGLPQWAV  170

Query  54   VGDTFPLGCAFDESIVHH  1
            VGDTFPLGCAFDE+ +HH
Sbjct  171  VGDTFPLGCAFDEANIHH  188



>ref|XP_002311571.2| oxygenase-related family protein [Populus trichocarpa]
 gb|EEE88938.2| oxygenase-related family protein [Populus trichocarpa]
Length=310

 Score =   253 bits (647),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 155/196 (79%), Gaps = 18/196 (9%)
 Frame = -3

Query  573  MTILIIEKPAEHVE--EKQAVPSDN---ANELILDGGFVVPKTLMSSNGGFEAPEMNSFG  409
            MTIL    PA  VE  EK  +P D+    NEL+LD GFVVP T             NSFG
Sbjct  1    MTILCEHPPAFGVELEEKNNIPVDHDGQENELVLDEGFVVPDT-------------NSFG  47

Query  408  QSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvv  229
             +FR YD ESERQK VEEFYR  HINQTY FVKRMRE+YG+L++VEMSIWECCELLN+ +
Sbjct  48   HTFRDYDIESERQKGVEEFYRTNHINQTYGFVKRMREEYGKLNRVEMSIWECCELLNEFI  107

Query  228  ddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVG  49
            D+SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLHP+FGELPQWAVVG
Sbjct  108  DESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPAFGELPQWAVVG  167

Query  48   DTFPLGCAFDESIVHH  1
            DTFP+GCAFDESIVHH
Sbjct  168  DTFPVGCAFDESIVHH  183



>ref|XP_004287501.1| PREDICTED: inositol oxygenase 4-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   252 bits (643),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 159/192 (83%), Gaps = 14/192 (7%)
 Frame = -3

Query  534  EEKQAVPSDN---ANELILDGGFVVPKT-----------LMSSNGGFEAPEMNSFGQSFR  397
            E K   P +N    ++L+LDGGFV+PK            L+ SN  F AP++N+FGQ+FR
Sbjct  23   ETKVLAPENNEEMCDQLVLDGGFVMPKEIADNDGCVKPELLVSNDEFIAPDINAFGQTFR  82

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             Y+AESERQKSVEEFYR+ HI+QTYDFVK+MRE Y ++D+VEMSIWECCELLN+VVD+SD
Sbjct  83   DYNAESERQKSVEEFYRLNHIHQTYDFVKKMREAYRKMDRVEMSIWECCELLNEVVDESD  142

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP++ WLHLTALIHDLGKVLL PSFG LPQWAVVGDT P
Sbjct  143  PDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTALIHDLGKVLLLPSFGGLPQWAVVGDTHP  202

Query  36   LGCAFDESIVHH  1
            LGCAFDESIVHH
Sbjct  203  LGCAFDESIVHH  214



>ref|XP_004503512.1| PREDICTED: inositol oxygenase 2-like isoform X1 [Cicer arietinum]
Length=322

 Score =   251 bits (641),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTIL+        E+K  V S++ NEL+LDGGF VP    +S  GF APE+NSFG SFR 
Sbjct  1    MTILV--DSGSQFEDKN-VHSEDTNELVLDGGFPVPN--HASQNGFLAPEINSFGHSFRN  55

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YD ESERQK V+EFYR+QHINQTYDFV +MRE+Y + +K EMSIWECCELLN+VVD+SDP
Sbjct  56   YDEESERQKGVDEFYRLQHINQTYDFVNKMREEYKKFNKAEMSIWECCELLNEVVDESDP  115

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGK+LL P FG LPQWAVVGDTFPL
Sbjct  116  DLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKILLLPKFGALPQWAVVGDTFPL  175

Query  33   GCAFDESIVHH  1
            GCAFDES V H
Sbjct  176  GCAFDESNVLH  186



>gb|KCW65035.1| hypothetical protein EUGRSUZ_G02560 [Eucalyptus grandis]
Length=293

 Score =   250 bits (638),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 151/181 (83%), Gaps = 16/181 (9%)
 Frame = -3

Query  543  EHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKS  364
            E VE+K  V     NEL+LDGGFVVP+T             NSFGQ+FR Y+AESERQ S
Sbjct  2    EVVEKKDDVEE---NELLLDGGFVVPET-------------NSFGQTFRDYNAESERQSS  45

Query  363  VEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHL  184
            VE+FYR  HINQTYDFVK+MRE+YG L++VEMSIWECCELLN+ VD+SDPDLDEPQIEHL
Sbjct  46   VEQFYRTNHINQTYDFVKKMREEYGVLNRVEMSIWECCELLNEFVDESDPDLDEPQIEHL  105

Query  183  LQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVH  4
            LQTAEAIRKDYP++ WLHLT LIHDLGKVLLHPSFG LPQWAVVGDTFP+GCAFDES+VH
Sbjct  106  LQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLHPSFGALPQWAVVGDTFPVGCAFDESVVH  165

Query  3    H  1
            H
Sbjct  166  H  166



>ref|XP_004503513.1| PREDICTED: inositol oxygenase 2-like isoform X2 [Cicer arietinum]
Length=313

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTIL+        E+K  V S++ NEL+LDGGF VP    +S  GF APE+NSFG SFR 
Sbjct  1    MTILV--DSGSQFEDKN-VHSEDTNELVLDGGFPVPN--HASQNGFLAPEINSFGHSFRN  55

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YD ESERQK V+EFYR+QHINQTYDFV +MRE+Y + +K EMSIWECCELLN+VVD+SDP
Sbjct  56   YDEESERQKGVDEFYRLQHINQTYDFVNKMREEYKKFNKAEMSIWECCELLNEVVDESDP  115

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGK+LL P FG LPQWAVVGDTFPL
Sbjct  116  DLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKILLLPKFGALPQWAVVGDTFPL  175

Query  33   GCAFDESIVHH  1
            GCAFDES V H
Sbjct  176  GCAFDESNVLH  186



>ref|XP_006371960.1| hypothetical protein POPTR_0018s06700g [Populus trichocarpa]
 gb|ERP49757.1| hypothetical protein POPTR_0018s06700g [Populus trichocarpa]
Length=310

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 158/191 (83%), Gaps = 8/191 (4%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI   P   + E   +   +A EL+LDGGFVVP    +    F+AP +NSFG SFR 
Sbjct  1    MTILI---PQPELSEGH-IDDYDAKELVLDGGFVVP----NKTEAFDAPVINSFGNSFRD  52

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+AESERQK+VEEFYR QHINQ+YD+V +MRE+YG+LDK  MSIWECCELLNDVVDDSDP
Sbjct  53   YNAESERQKTVEEFYRQQHINQSYDYVMKMREEYGKLDKAVMSIWECCELLNDVVDDSDP  112

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKVLL P FG+LPQWAVVGDTFPL
Sbjct  113  DLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVLLLPQFGQLPQWAVVGDTFPL  172

Query  33   GCAFDESIVHH  1
            GCAFDES VHH
Sbjct  173  GCAFDESNVHH  183



>ref|XP_010915343.1| PREDICTED: probable inositol oxygenase [Elaeis guineensis]
Length=305

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 154/192 (80%), Gaps = 15/192 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTI  IE+P   VE E + +PSD+  EL+LDGGF VP+T             NSFG SFR
Sbjct  1    MTI-AIEQPQIEVEVENKQIPSDDPTELVLDGGFTVPET-------------NSFGHSFR  46

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAESERQK+VEEFYR  HI+QTY FVKRMRE+YG+LD+ EMSIWEC ELLN+ +D+SD
Sbjct  47   EYDAESERQKTVEEFYRTNHIHQTYKFVKRMREEYGKLDRAEMSIWECIELLNEFIDESD  106

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP + WL LT LIHDLGKVLLHPSFG+LPQWAVVGDTFP
Sbjct  107  PDLDEPQIEHLLQTAEAIRKDYPDEDWLQLTGLIHDLGKVLLHPSFGQLPQWAVVGDTFP  166

Query  36   LGCAFDESIVHH  1
            +GCAFDE  VHH
Sbjct  167  VGCAFDECNVHH  178



>gb|KGN66197.1| hypothetical protein Csa_1G575130 [Cucumis sativus]
Length=314

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 159/191 (83%), Gaps = 4/191 (2%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI E+P    E+++ V      EL+LDGGFVVP    +   GF APEMN+FG SFR 
Sbjct  1    MTILI-EQPHFEGEDEKKVGITELKELVLDGGFVVPN---AKTEGFAAPEMNAFGHSFRD  56

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+AESERQK VEEFYR  HI+QTY+FV++MRE+Y ++D+ EMSIWECCELLNDVVDDSDP
Sbjct  57   YEAESERQKGVEEFYRQNHIHQTYEFVEKMREEYKKMDREEMSIWECCELLNDVVDDSDP  116

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQTAEAIRKDYP + WLHLTALIHDLGKVLL PSFG LPQWAVVGDT P+
Sbjct  117  DLDEPQIQHLLQTAEAIRKDYPDEDWLHLTALIHDLGKVLLLPSFGGLPQWAVVGDTHPV  176

Query  33   GCAFDESIVHH  1
            GCAFDESIVHH
Sbjct  177  GCAFDESIVHH  187



>ref|XP_010062560.1| PREDICTED: inositol oxygenase 1-like isoform X2 [Eucalyptus grandis]
 gb|KCW69697.1| hypothetical protein EUGRSUZ_F03092 [Eucalyptus grandis]
 gb|KCW69698.1| hypothetical protein EUGRSUZ_F03092 [Eucalyptus grandis]
Length=296

 Score =   249 bits (635),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 149/179 (83%), Gaps = 13/179 (7%)
 Frame = -3

Query  537  VEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVE  358
            VEE+  V  +   EL+LDGGF+             AP+ NSFG +FR YDAESERQ  VE
Sbjct  4    VEEETKVLVEEEKELVLDGGFL-------------APDTNSFGHTFRTYDAESERQAGVE  50

Query  357  EFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQ  178
             FYR+ HI+QTYD V+RMRE+YG+LDKVEMSIW+CCELLNDVVD+SDPDLDEPQIEHLLQ
Sbjct  51   NFYRINHISQTYDSVQRMREEYGKLDKVEMSIWDCCELLNDVVDESDPDLDEPQIEHLLQ  110

Query  177  TAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            TAEAIRKDYP++ WLHLT LIHDLGKVLLHPSFGELPQWAVVGDT+PLGCAFDESIVHH
Sbjct  111  TAEAIRKDYPNEDWLHLTGLIHDLGKVLLHPSFGELPQWAVVGDTYPLGCAFDESIVHH  169



>gb|KFK40347.1| hypothetical protein AALP_AA3G362200 [Arabis alpina]
Length=317

 Score =   249 bits (635),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 161/192 (84%), Gaps = 3/192 (2%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTIL+ +  ++   E++ V  +   EL+LDGGFVVPK++ S   GF+AP+MN  G SFR 
Sbjct  1    MTILVEQFVSDSRVEEKKVKDERDGELVLDGGFVVPKSMESD--GFDAPDMNFLGHSFRD  58

Query  393  YD-AESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
            YD  ESERQ+ VEEFYR+QHI+QTY FVK MR++YG+L+K+EMSIWECCELLN+VVD+SD
Sbjct  59   YDNGESERQQGVEEFYRMQHIHQTYGFVKEMRKEYGKLNKMEMSIWECCELLNNVVDESD  118

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQTAEAIR+DYP++ WLHLTALIHDLGKVLL P FGELPQWAVVGDTFP
Sbjct  119  PDLDEPQIQHLLQTAEAIRRDYPNEDWLHLTALIHDLGKVLLLPEFGELPQWAVVGDTFP  178

Query  36   LGCAFDESIVHH  1
            +GC FD S +HH
Sbjct  179  VGCTFDSSNIHH  190



>ref|XP_006470903.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Citrus sinensis]
Length=294

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -3

Query  465  KTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGR  286
            K L     GF  PE NSFGQ+FR YD ESERQK VEEFYR QHINQT DFVKRMRE+YG+
Sbjct  13   KQLQDGGEGFTVPETNSFGQTFRDYDVESERQKGVEEFYRTQHINQTCDFVKRMREEYGK  72

Query  285  LDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDL  106
            L++VEMSIWECCELLN+ VD+SDPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDL
Sbjct  73   LNRVEMSIWECCELLNEFVDESDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDL  132

Query  105  GKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            GKVLLHP FGELPQWAVVGDTFP+GCAFDESIVHH
Sbjct  133  GKVLLHPDFGELPQWAVVGDTFPVGCAFDESIVHH  167



>ref|XP_008798609.1| PREDICTED: probable inositol oxygenase [Phoenix dactylifera]
Length=305

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 155/192 (81%), Gaps = 15/192 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTI  IE+P   VE E + +PSD+  EL+LDGGF VP+T             NSFG SFR
Sbjct  1    MTI-AIEQPQTEVEVEDKQIPSDDPMELVLDGGFTVPET-------------NSFGHSFR  46

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAESERQK+VEEFY   HI+QTY+FVKRMRE+YG+LD+ EMSIWEC ELLN+ +D+SD
Sbjct  47   DYDAESERQKTVEEFYCTNHIHQTYNFVKRMREEYGKLDRAEMSIWECIELLNEFIDESD  106

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRK+YP + WLHLT LIHDLGKVLLHPSFG+LPQWAVVGDTFP
Sbjct  107  PDLDEPQIEHLLQTAEAIRKEYPDEDWLHLTGLIHDLGKVLLHPSFGQLPQWAVVGDTFP  166

Query  36   LGCAFDESIVHH  1
            +GCAFDE  VHH
Sbjct  167  VGCAFDECNVHH  178



>ref|NP_194356.2| myo-inositol oxygenase 4 [Arabidopsis thaliana]
 sp|Q8H1S0.1|MIOX4_ARATH RecName: Full=Inositol oxygenase 4; AltName: Full=Myo-inositol 
oxygenase 4; Short=AtMIOX4; Short=MI oxygenase 4 [Arabidopsis 
thaliana]
 gb|AAN13052.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85176.1| myo-inositol oxygenase 4 [Arabidopsis thaliana]
Length=317

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 156/193 (81%), Gaps = 5/193 (3%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAV--PSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTI  +EKP    EE  A     DN  EL LDGGF +PK   + +  F APEMN+FG+ F
Sbjct  1    MTI-SVEKPI--FEEVSAFEKSGDNIGELKLDGGFSMPKMDTNDDEAFLAPEMNAFGRQF  57

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R YD ESERQK VEEFYR+QHINQT DFVK+MR +YG+LDK+ MSIWECCELLN+VVD+S
Sbjct  58   RDYDVESERQKGVEEFYRLQHINQTVDFVKKMRAEYGKLDKMVMSIWECCELLNEVVDES  117

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWAVVGDTF
Sbjct  118  DPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQFGGLPQWAVVGDTF  177

Query  39   PLGCAFDESIVHH  1
            P+GCAFDES VHH
Sbjct  178  PVGCAFDESNVHH  190



>ref|XP_009590853.1| PREDICTED: inositol oxygenase 2-like [Nicotiana tomentosiformis]
Length=315

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 157/189 (83%), Gaps = 3/189 (2%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MT+L+ +       E + V +D A EL+LDGGFVVPK +  SN GF  P  N+FG SFR 
Sbjct  1    MTLLVAQTEHGAEVENKKVTTD-AEELLLDGGFVVPKNV--SNDGFVVPGNNAFGNSFRD  57

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+AE+ER+K VEE YR  HINQTYDFVK+MRE+Y ++++VEMSIWECCELLN+VVDDSDP
Sbjct  58   YNAETERKKIVEELYRQSHINQTYDFVKKMREEYEKVNRVEMSIWECCELLNEVVDDSDP  117

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQTAEAIRKDYP++ WLHLTALIHDLGKVLL PSFG LPQWAVVGDTFPL
Sbjct  118  DLDEPQIQHLLQTAEAIRKDYPNEDWLHLTALIHDLGKVLLLPSFGGLPQWAVVGDTFPL  177

Query  33   GCAFDESIV  7
            GCAFDES V
Sbjct  178  GCAFDESNV  186



>ref|XP_010448299.1| PREDICTED: inositol oxygenase 4-like isoform X4 [Camelina sativa]
Length=318

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 150/191 (79%), Gaps = 0/191 (0%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTI +     E V   Q    D   EL LDGGF++P      +  F AP+MN+FG+ FR 
Sbjct  1    MTISVENPIFEKVSAFQKKSEDKTGELKLDGGFLIPNMATKDDEAFLAPDMNAFGRQFRD  60

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YD ESERQKSVEEFYR+QHINQT DFV +MR +YG+LDK  MSIWECCELLN+VVD+SDP
Sbjct  61   YDVESERQKSVEEFYRLQHINQTVDFVTKMRAEYGKLDKKVMSIWECCELLNEVVDESDP  120

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWAVVGDTFP+
Sbjct  121  DLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQFGGLPQWAVVGDTFPV  180

Query  33   GCAFDESIVHH  1
            GCAFDES VHH
Sbjct  181  GCAFDESNVHH  191



>ref|XP_004135682.1| PREDICTED: inositol oxygenase 2-like [Cucumis sativus]
 ref|XP_004158428.1| PREDICTED: inositol oxygenase 2-like [Cucumis sativus]
Length=313

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI E+P    E+++ V      EL+LDGGFVVP    +   GF APEMN+FG SFR 
Sbjct  1    MTILI-EQP-HFGEDEKKVGITELKELVLDGGFVVPN---AKTEGFAAPEMNAFGHSFRD  55

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+AESERQK VEEFYR  HI+QTY+FV++MRE+Y ++D+ EMSIWECCELLNDVVDDSDP
Sbjct  56   YEAESERQKGVEEFYRQNHIHQTYEFVEKMREEYKKMDREEMSIWECCELLNDVVDDSDP  115

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQTAEAIRKDYP + WLHLTALIHDLGKVLL PSFG LPQWAVVGDT P+
Sbjct  116  DLDEPQIQHLLQTAEAIRKDYPDEDWLHLTALIHDLGKVLLLPSFGGLPQWAVVGDTHPV  175

Query  33   GCAFDESIVHH  1
            GCAFDESIVHH
Sbjct  176  GCAFDESIVHH  186



>ref|XP_009758702.1| PREDICTED: inositol oxygenase 2-like [Nicotiana sylvestris]
Length=315

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 154/189 (81%), Gaps = 3/189 (2%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MT L+ +       E + V +D A EL LDGGFVVPK +  SN GF  P  N+FG SFR 
Sbjct  1    MTFLVAQTEHGAEIENKKVTTD-AEELFLDGGFVVPKNV--SNDGFVVPGNNAFGNSFRD  57

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y AE++R+K VEE YR  HINQTYDFVK+MRE+YG+LDKVEMSIWE CELLN+VVDDSDP
Sbjct  58   YSAETDRKKIVEELYRQSHINQTYDFVKKMREEYGKLDKVEMSIWESCELLNEVVDDSDP  117

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQTAEAIRKDYP++ WLHLTALIHDLGKVLL PSFG LPQWAVVGDTFPL
Sbjct  118  DLDEPQIQHLLQTAEAIRKDYPNEDWLHLTALIHDLGKVLLLPSFGGLPQWAVVGDTFPL  177

Query  33   GCAFDESIV  7
            GCAFDES V
Sbjct  178  GCAFDESNV  186



>ref|XP_004248391.1| PREDICTED: inositol oxygenase 1-like [Solanum lycopersicum]
Length=350

 Score =   248 bits (632),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 145/162 (90%), Gaps = 4/162 (2%)
 Frame = -3

Query  474  VVPKTLMSSNGG----FEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKR  307
            V  K + S NG     FE   +N+FGQSFR Y+A+SERQKSVEEFYRVQHINQTYD+V +
Sbjct  62   VEEKKVASFNGNEGVVFEVSNINAFGQSFRDYNAKSERQKSVEEFYRVQHINQTYDYVTK  121

Query  306  MREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHL  127
            MR++YG+L+K+EMSIW+CCELLNDVVDDSDPDLDEPQIEHLLQTAEAIRKDYP++ WLHL
Sbjct  122  MRKEYGKLNKIEMSIWDCCELLNDVVDDSDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHL  181

Query  126  TALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            T LIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH
Sbjct  182  TGLIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  223



>ref|NP_001190844.1| myo-inositol oxygenase 4 [Arabidopsis thaliana]
 emb|CAB38955.1| putative protein [Arabidopsis thaliana]
 emb|CAB79481.1| putative protein [Arabidopsis thaliana]
 gb|AEE85177.1| myo-inositol oxygenase 4 [Arabidopsis thaliana]
Length=318

 Score =   246 bits (628),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -3

Query  513  SDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHI  334
             DN  EL LDGGF +PK   + +  F APEMN+FG+ FR YD ESERQK VEEFYR+QHI
Sbjct  21   GDNIGELKLDGGFSMPKMDTNDDEAFLAPEMNAFGRQFRDYDVESERQKGVEEFYRLQHI  80

Query  333  NQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKD  154
            NQT DFVK+MR +YG+LDK+ MSIWECCELLN+VVD+SDPDLDEPQI+HLLQ+AEAIRKD
Sbjct  81   NQTVDFVKKMRAEYGKLDKMVMSIWECCELLNEVVDESDPDLDEPQIQHLLQSAEAIRKD  140

Query  153  YPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            YP++ WLHLTALIHDLGKV+  P FG LPQWAVVGDTFP+GCAFDES VHH
Sbjct  141  YPNEDWLHLTALIHDLGKVITLPQFGGLPQWAVVGDTFPVGCAFDESNVHH  191



>gb|KDP40824.1| hypothetical protein JCGZ_24823 [Jatropha curcas]
Length=307

 Score =   246 bits (627),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 155/193 (80%), Gaps = 15/193 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEK--QAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTILI + P E   E   + + +D   E++L+GGFVVP T             NSFGQ+F
Sbjct  1    MTILIEQPPFEFEFEVEEKKIHADEKEEVVLEGGFVVPNT-------------NSFGQTF  47

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R YDAE ERQ  VE FYR+ H NQ+YDFVKRMRE+YG+L++VEMSIWECC+LLN+VVD+S
Sbjct  48   RDYDAEGERQPGVENFYRINHTNQSYDFVKRMREEYGKLNRVEMSIWECCQLLNNVVDES  107

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLLHPSFGEL QWAVVGDT+
Sbjct  108  DPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLHPSFGELAQWAVVGDTY  167

Query  39   PLGCAFDESIVHH  1
            P+GCAFDESIVHH
Sbjct  168  PVGCAFDESIVHH  180



>ref|XP_003529067.1| PREDICTED: inositol oxygenase 2-like isoform X1 [Glycine max]
 gb|KHN40357.1| Inositol oxygenase 2 [Glycine soja]
Length=316

 Score =   246 bits (628),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 151/177 (85%), Gaps = 2/177 (1%)
 Frame = -3

Query  531  EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEF  352
            E++ V S+++NEL+L G F + K       GF A +MN+FG SFR YDAESERQ+ VEE 
Sbjct  15   EEKNVHSEDSNELVLHGAFPLAKH--ERQNGFNATDMNAFGNSFRNYDAESERQRMVEEL  72

Query  351  YRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTA  172
            YR+QHINQTYD+ KRMRE+YG+LDK+EM IWECCELLN+V DDSDPDLDEPQI+HLLQ+A
Sbjct  73   YRMQHINQTYDYGKRMREEYGKLDKLEMGIWECCELLNEVTDDSDPDLDEPQIQHLLQSA  132

Query  171  EAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            EAIRKDYP++ WLHLTALIHDLGK+L+ PSFG LPQW+VVGDTFPLGCAFDES VHH
Sbjct  133  EAIRKDYPNEDWLHLTALIHDLGKILMLPSFGGLPQWSVVGDTFPLGCAFDESNVHH  189



>gb|AAP59548.1| myo-inositol oxygenase [Arabidopsis thaliana]
Length=317

 Score =   246 bits (627),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 156/193 (81%), Gaps = 5/193 (3%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAV--PSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTI  +EKP    EE  A     DN  EL LDGGF +PK   + +  F APEMN+FG+ F
Sbjct  1    MTI-SVEKPI--FEEVSAFEKSGDNIGELKLDGGFSMPKMDTNDDEAFLAPEMNAFGRQF  57

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R YD ESERQK VEEFYR++HINQT DFVK+MR +YG+LDK+ MSIWECCELLN+VVD+S
Sbjct  58   RDYDVESERQKGVEEFYRLRHINQTVDFVKKMRAEYGKLDKMVMSIWECCELLNEVVDES  117

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWAVVGDTF
Sbjct  118  DPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQFGGLPQWAVVGDTF  177

Query  39   PLGCAFDESIVHH  1
            P+GCAFDES VHH
Sbjct  178  PVGCAFDESNVHH  190



>ref|XP_010448298.1| PREDICTED: inositol oxygenase 4-like isoform X3 [Camelina sativa]
Length=319

 Score =   246 bits (627),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 152/193 (79%), Gaps = 3/193 (2%)
 Frame = -3

Query  573  MTILIIEKP--AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTI  +E P   E V   Q    D   EL LDGGF++P      +  F AP+MN+FG+ F
Sbjct  1    MTI-SVENPIFVEKVSAFQKKSEDKTGELKLDGGFLIPNMATKDDEAFLAPDMNAFGRQF  59

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R YD ESERQKSVEEFYR+QHINQT DFV +MR +YG+LDK  MSIWECCELLN+VVD+S
Sbjct  60   RDYDVESERQKSVEEFYRLQHINQTVDFVTKMRAEYGKLDKKVMSIWECCELLNEVVDES  119

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWAVVGDTF
Sbjct  120  DPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQFGGLPQWAVVGDTF  179

Query  39   PLGCAFDESIVHH  1
            P+GCAFDES VHH
Sbjct  180  PVGCAFDESNVHH  192



>ref|XP_010098174.1| Inositol oxygenase 1 [Morus notabilis]
 gb|EXB74611.1| Inositol oxygenase 1 [Morus notabilis]
Length=336

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 159/195 (82%), Gaps = 19/195 (10%)
 Frame = -3

Query  576  RMTILIIEKPAE---HVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQ  406
            RMTILI E+P E     EEK+ VP D   EL+LDGGF+VP+T             NSFGQ
Sbjct  31   RMTILI-EQPHEFGIEAEEKK-VPIDEK-ELVLDGGFLVPQT-------------NSFGQ  74

Query  405  SFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvd  226
            +FR YDAE ERQ  VE FYR+ H+NQTYDFVK+MRE+Y RL+++EMSIWECCELLNDVVD
Sbjct  75   TFRDYDAEGERQPGVENFYRINHLNQTYDFVKKMREEYSRLNRMEMSIWECCELLNDVVD  134

Query  225  dsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGD  46
            +SDPDLDEPQIEHLLQTAEAIR+DYP++ WLHLT LIHDLGKVLL PSFG LPQWAVVGD
Sbjct  135  ESDPDLDEPQIEHLLQTAEAIRRDYPNEDWLHLTGLIHDLGKVLLLPSFGGLPQWAVVGD  194

Query  45   TFPLGCAFDESIVHH  1
            T+P+GCAFDESIVHH
Sbjct  195  TYPVGCAFDESIVHH  209



>ref|XP_006420666.1| hypothetical protein CICLE_v10005543mg [Citrus clementina]
 gb|ESR33906.1| hypothetical protein CICLE_v10005543mg [Citrus clementina]
Length=294

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 143/174 (82%), Gaps = 11/174 (6%)
 Frame = -3

Query  522  AVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRV  343
            A  +DN  E + DGG            GF  PE NSFGQ+FR Y  ESERQK VEEFYR 
Sbjct  5    ADSNDNELEQLQDGG-----------EGFTVPETNSFGQTFRDYGVESERQKGVEEFYRT  53

Query  342  QHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAI  163
            QHINQT DFVKRMRE+YG+L++VEMSIWECCELLN+ VD+SDPDLDEPQIEHLLQTAEAI
Sbjct  54   QHINQTCDFVKRMREEYGKLNRVEMSIWECCELLNEFVDESDPDLDEPQIEHLLQTAEAI  113

Query  162  RKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            RKDYP++ WLHLT LIHDLGKVLLHP FGELPQWAVVGDTFP+GCAFDESIVHH
Sbjct  114  RKDYPNEDWLHLTGLIHDLGKVLLHPDFGELPQWAVVGDTFPVGCAFDESIVHH  167



>ref|XP_002282395.1| PREDICTED: inositol oxygenase 1 [Vitis vinifera]
 emb|CBI36013.3| unnamed protein product [Vitis vinifera]
Length=304

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 156/191 (82%), Gaps = 14/191 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI ++P      ++ V  +  NEL+LDGGFVVP             E N+FG +FR 
Sbjct  1    MTILI-DQPDFVEVVEKKVDVEQENELVLDGGFVVP-------------ESNAFGHTFRD  46

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDAES+R+  VE FYR+ HINQTYDFVK+MRE+Y RL++V+MSIWECCELLNDVVD+SDP
Sbjct  47   YDAESDRKDGVENFYRINHINQTYDFVKKMREEYSRLNRVQMSIWECCELLNDVVDESDP  106

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQIEHLLQTAEAIRKDYP++ W+HLTALIHDLGKVLL PSFGELPQWAVVGDTFP+
Sbjct  107  DLDEPQIEHLLQTAEAIRKDYPNEDWMHLTALIHDLGKVLLLPSFGELPQWAVVGDTFPV  166

Query  33   GCAFDESIVHH  1
            GCAFDESIVHH
Sbjct  167  GCAFDESIVHH  177



>gb|KDO57808.1| hypothetical protein CISIN_1g046235mg [Citrus sinensis]
Length=294

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 143/174 (82%), Gaps = 11/174 (6%)
 Frame = -3

Query  522  AVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRV  343
            A  +DN  E + DGG            GF  PE NSFGQ+FR Y  ESERQK VEEFYR 
Sbjct  5    ADSNDNELEQLQDGG-----------EGFTVPETNSFGQTFRDYGVESERQKGVEEFYRT  53

Query  342  QHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAI  163
            QHINQT DFVKRMRE+YG+L++VEMSIWECCELLN+ VD+SDPDLDEPQIEHLLQTAEAI
Sbjct  54   QHINQTCDFVKRMREEYGKLNRVEMSIWECCELLNEFVDESDPDLDEPQIEHLLQTAEAI  113

Query  162  RKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            RKDYP++ WLHLT LIHDLGKVLLHP FGELPQWAVVGDTFP+GCAFDESIVHH
Sbjct  114  RKDYPNEDWLHLTGLIHDLGKVLLHPDFGELPQWAVVGDTFPVGCAFDESIVHH  167



>ref|XP_004298756.1| PREDICTED: inositol oxygenase 1-like [Fragaria vesca subsp. vesca]
Length=326

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 160/202 (79%), Gaps = 15/202 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTL-----------MSSNGGFEAP  427
            MTIL+ +       E Q   SD    L+LDGGFVVPK +           + SN  F AP
Sbjct  1    MTILVEKAEIVAKVEDQNGTSD----LVLDGGFVVPKDVAENDGFVKAEGLVSNDEFIAP  56

Query  426  EMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCE  247
            E+N+FGQ+FR Y+AESERQK VEEFYR+ H++Q+YDFVK+MRE+Y ++++VEMSIWECCE
Sbjct  57   EINAFGQTFRDYNAESERQKGVEEFYRLNHVHQSYDFVKKMREEYKKMNRVEMSIWECCE  116

Query  246  llndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELP  67
            LLN+VVDDSDPDLDEPQIEHLLQTAEAIRKDYP + WLHLTALIHDLGKVLL PSFG LP
Sbjct  117  LLNEVVDDSDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTALIHDLGKVLLLPSFGGLP  176

Query  66   QWAVVGDTFPLGCAFDESIVHH  1
            QWAVVGDT P+GC FD+SIVHH
Sbjct  177  QWAVVGDTHPVGCPFDDSIVHH  198



>ref|XP_006426837.1| hypothetical protein CICLE_v10026154mg [Citrus clementina]
 gb|ESR40077.1| hypothetical protein CICLE_v10026154mg [Citrus clementina]
Length=226

 Score =   241 bits (615),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 156/192 (81%), Gaps = 16/192 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTILI ++P   VE +++ VP D   EL LDGGF+VP+T             NSFG +FR
Sbjct  1    MTILI-DQPHFGVEVQEKKVPIDEK-ELSLDGGFLVPQT-------------NSFGHTFR  45

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAE ERQ+ VE FYR+ HINQTYDFVK+MRE+YG+L++VEMSIWECCELLNDVVD+SD
Sbjct  46   DYDAEGERQEGVENFYRINHINQTYDFVKKMREEYGKLNRVEMSIWECCELLNDVVDESD  105

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVL  PSFG LPQWAVVGDTFP
Sbjct  106  PDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLNLPSFGGLPQWAVVGDTFP  165

Query  36   LGCAFDESIVHH  1
            +GCAFDESIVHH
Sbjct  166  VGCAFDESIVHH  177



>gb|KDO53722.1| hypothetical protein CISIN_1g021944mg [Citrus sinensis]
 gb|KDO53723.1| hypothetical protein CISIN_1g021944mg [Citrus sinensis]
Length=238

 Score =   241 bits (616),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 156/192 (81%), Gaps = 16/192 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTILI ++P   VE +++ VP D   EL LDGGF+VP+T             NSFG +FR
Sbjct  1    MTILI-DQPHFGVEVQEKKVPIDEK-ELSLDGGFLVPQT-------------NSFGHTFR  45

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAE ERQ+ VE FYR+ HINQTYDFVK+MRE+YG+L++VEMSIWECCELLNDVVD+SD
Sbjct  46   DYDAEGERQEGVENFYRINHINQTYDFVKKMREEYGKLNRVEMSIWECCELLNDVVDESD  105

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVL  PSFG LPQWAVVGDTFP
Sbjct  106  PDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLNLPSFGGLPQWAVVGDTFP  165

Query  36   LGCAFDESIVHH  1
            +GCAFDESIVHH
Sbjct  166  VGCAFDESIVHH  177



>gb|KDO53721.1| hypothetical protein CISIN_1g021944mg [Citrus sinensis]
Length=244

 Score =   241 bits (615),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 156/192 (81%), Gaps = 16/192 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTILI ++P   VE +++ VP D   EL LDGGF+VP+T             NSFG +FR
Sbjct  1    MTILI-DQPHFGVEVQEKKVPIDEK-ELSLDGGFLVPQT-------------NSFGHTFR  45

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAE ERQ+ VE FYR+ HINQTYDFVK+MRE+YG+L++VEMSIWECCELLNDVVD+SD
Sbjct  46   DYDAEGERQEGVENFYRINHINQTYDFVKKMREEYGKLNRVEMSIWECCELLNDVVDESD  105

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVL  PSFG LPQWAVVGDTFP
Sbjct  106  PDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLNLPSFGGLPQWAVVGDTFP  165

Query  36   LGCAFDESIVHH  1
            +GCAFDESIVHH
Sbjct  166  VGCAFDESIVHH  177



>ref|XP_010433528.1| PREDICTED: inositol oxygenase 4-like isoform X4 [Camelina sativa]
Length=319

 Score =   244 bits (622),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 152/193 (79%), Gaps = 3/193 (2%)
 Frame = -3

Query  573  MTILIIEKP--AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTI  +E P   E V   Q    D   EL LDGG ++P      +  F AP+MN+FG+ F
Sbjct  1    MTI-SVENPIFVEKVSAFQKKSEDKTGELKLDGGVLIPNMATKDDEAFLAPDMNAFGRQF  59

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R YDAESERQKSV+EFYR+QHINQT DFV +MR +YG+LDK  MSIWECCELLN+VVD+S
Sbjct  60   RDYDAESERQKSVQEFYRLQHINQTVDFVTKMRAEYGKLDKKVMSIWECCELLNEVVDES  119

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWAVVGDTF
Sbjct  120  DPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQFGGLPQWAVVGDTF  179

Query  39   PLGCAFDESIVHH  1
            P+GCAFDES VHH
Sbjct  180  PVGCAFDESNVHH  192



>ref|XP_010467925.1| PREDICTED: inositol oxygenase 2-like [Camelina sativa]
Length=318

 Score =   243 bits (621),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 159/193 (82%), Gaps = 5/193 (3%)
 Frame = -3

Query  573  MTILIIE-KPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTIL+    P   VEEK+     N  EL+LDGGFVVP++      GF+AP+MN  G SFR
Sbjct  1    MTILVEHFVPDSRVEEKKLTEERNE-ELVLDGGFVVPQS--KETNGFDAPDMNFLGHSFR  57

Query  396  AYDAE-SERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
             Y+ + SERQ+ VEEFYR+QHI+QTYDFVK+MR++YG+LDK+EMSIWECCELLN+VVD+S
Sbjct  58   DYENDLSERQQGVEEFYRLQHIHQTYDFVKKMRKEYGKLDKMEMSIWECCELLNNVVDES  117

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQTAEAIR+DYP++ WLHLTALIHDLGKVLL P FG LPQWAVVGDTF
Sbjct  118  DPDLDEPQIQHLLQTAEAIRRDYPNEDWLHLTALIHDLGKVLLLPEFGGLPQWAVVGDTF  177

Query  39   PLGCAFDESIVHH  1
            P+GC FD + +HH
Sbjct  178  PVGCTFDSANIHH  190



>gb|KHG19184.1| Inositol oxygenase 1 -like protein [Gossypium arboreum]
Length=327

 Score =   244 bits (622),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 151/191 (79%), Gaps = 14/191 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI ++P   VE       +  NEL+LDGGFVVP+T             NSFG +FR 
Sbjct  1    MTILI-DQPELGVEAGVNKLDNADNELVLDGGFVVPQT-------------NSFGHTFRD  46

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y  ESERQ+ VE FYR  HI QTYDFVKRMR +YG+L+K+EM IWECCELLNDV+D+SDP
Sbjct  47   YHVESERQQGVENFYRTNHIYQTYDFVKRMRTEYGKLNKMEMGIWECCELLNDVIDESDP  106

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQIEHLLQTAEAIRKDYP++ W+HLT LIHDLGKVLLHP FGELPQWAVVGDTFP+
Sbjct  107  DLDEPQIEHLLQTAEAIRKDYPNEDWMHLTGLIHDLGKVLLHPGFGELPQWAVVGDTFPV  166

Query  33   GCAFDESIVHH  1
            GCAFD+SIVHH
Sbjct  167  GCAFDKSIVHH  177



>ref|XP_010540994.1| PREDICTED: inositol oxygenase 2 [Tarenaya hassleriana]
Length=316

 Score =   243 bits (621),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 161/192 (84%), Gaps = 4/192 (2%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI +  ++   E++ V  +  NEL+LDGGFVVPK++ S   GF+AP +N  G +FR 
Sbjct  1    MTILIEQHNSDSRGEEKRVERER-NELVLDGGFVVPKSVASD--GFDAPHINFLGHAFRD  57

Query  393  YDAE-SERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
            Y++  SERQ+ VEEFYR+QHI+QTYDFV++ RE+YGR+ ++EMSIWECCELLN+VVDDSD
Sbjct  58   YESVVSERQQGVEEFYRLQHIHQTYDFVRKKREEYGRMRRMEMSIWECCELLNNVVDDSD  117

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQ+AEAIRKDYPH  WLHLTALIHDLGKVLL P FG LPQWAVVGDTFP
Sbjct  118  PDLDEPQIQHLLQSAEAIRKDYPHHDWLHLTALIHDLGKVLLLPGFGGLPQWAVVGDTFP  177

Query  36   LGCAFDESIVHH  1
            +GCAFDES +HH
Sbjct  178  VGCAFDESNIHH  189



>ref|XP_010244380.1| PREDICTED: probable inositol oxygenase [Nelumbo nucifera]
Length=308

 Score =   243 bits (620),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 158/195 (81%), Gaps = 18/195 (9%)
 Frame = -3

Query  573  MTILIIEKP---AEHVEEKQA-VPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQ  406
            MT+ II++P       E+KQA +  D+ +EL+LDG FVVP+T             NSFG 
Sbjct  1    MTV-IIQQPELLGYQEEDKQAPLSDDDVHELVLDGEFVVPET-------------NSFGH  46

Query  405  SFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvd  226
            +FR Y+AESER+ +VEEFYR+ HINQ+YDFVKRMRE+YG+L++ EMSIWECCELLN+ VD
Sbjct  47   TFRDYNAESERKNTVEEFYRMNHINQSYDFVKRMREEYGKLNRAEMSIWECCELLNEYVD  106

Query  225  dsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGD  46
            +SDPDLDEPQ EHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLHPSFGELPQWAVVGD
Sbjct  107  ESDPDLDEPQSEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPSFGELPQWAVVGD  166

Query  45   TFPLGCAFDESIVHH  1
            TFP+GC+FDES VHH
Sbjct  167  TFPVGCSFDESNVHH  181



>gb|KFK29141.1| hypothetical protein AALP_AA7G093700 [Arabis alpina]
Length=319

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 154/193 (80%), Gaps = 3/193 (2%)
 Frame = -3

Query  573  MTILIIEKPA-EHVEEKQAVPSDNANELILDGGFVVPKTLMSSNG-GFEAPEMNSFGQSF  400
            MTI  IEKP  E     Q    D   EL LDGGF +P+     +   F APEMN+FG+ F
Sbjct  1    MTI-SIEKPIFEEGSAFQKKSEDKTGELNLDGGFSMPEMATKDDDEAFLAPEMNAFGRQF  59

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R YDA+SERQKSVEEFYR+QHINQT DFVK+MR +YG+LDK  MSIWECCELLN+VVD+S
Sbjct  60   RDYDAKSERQKSVEEFYRLQHINQTVDFVKKMRAEYGKLDKKVMSIWECCELLNEVVDES  119

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWAVVGDTF
Sbjct  120  DPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQFGGLPQWAVVGDTF  179

Query  39   PLGCAFDESIVHH  1
            P+GCAFDES VHH
Sbjct  180  PVGCAFDESNVHH  192



>gb|KDO53720.1| hypothetical protein CISIN_1g021944mg [Citrus sinensis]
Length=305

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 156/192 (81%), Gaps = 16/192 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTILI ++P   VE +++ VP D   EL LDGGF+VP+T             NSFG +FR
Sbjct  1    MTILI-DQPHFGVEVQEKKVPIDEK-ELSLDGGFLVPQT-------------NSFGHTFR  45

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAE ERQ+ VE FYR+ HINQTYDFVK+MRE+YG+L++VEMSIWECCELLNDVVD+SD
Sbjct  46   DYDAEGERQEGVENFYRINHINQTYDFVKKMREEYGKLNRVEMSIWECCELLNDVVDESD  105

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVL  PSFG LPQWAVVGDTFP
Sbjct  106  PDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLNLPSFGGLPQWAVVGDTFP  165

Query  36   LGCAFDESIVHH  1
            +GCAFDESIVHH
Sbjct  166  VGCAFDESIVHH  177



>ref|XP_006284128.1| hypothetical protein CARUB_v10005260mg [Capsella rubella]
 gb|EOA17026.1| hypothetical protein CARUB_v10005260mg [Capsella rubella]
Length=321

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 151/190 (79%), Gaps = 5/190 (3%)
 Frame = -3

Query  567  ILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAY-  391
            I ++EK    V   Q    D   EL LDGGF++       N  F APEMN+FG+ FR Y 
Sbjct  9    IFVVEK----VSAFQKKSEDKTGELKLDGGFLIANMATEDNETFLAPEMNAFGRQFRDYN  64

Query  390  DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpd  211
            DAESERQKSVEEFYR+QHINQT DFV +MR +YG+LDK+ MSIWECCELLN+VVD+SDPD
Sbjct  65   DAESERQKSVEEFYRLQHINQTVDFVTKMRAEYGKLDKMVMSIWECCELLNEVVDESDPD  124

Query  210  lDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLG  31
            LDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWAVVGDTFP+G
Sbjct  125  LDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQFGGLPQWAVVGDTFPVG  184

Query  30   CAFDESIVHH  1
            CAFDES VHH
Sbjct  185  CAFDESNVHH  194



>emb|CDO97955.1| unnamed protein product [Coffea canephora]
Length=305

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 153/194 (79%), Gaps = 19/194 (10%)
 Frame = -3

Query  573  MTILIIEKP---AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQS  403
            MTIL+ E+P      VEEK      N  EL+LDGGF VP+              N+FGQ+
Sbjct  1    MTILV-EQPEFGINEVEEKGI--QKNERELVLDGGFSVPQA-------------NAFGQN  44

Query  402  FRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdd  223
            FR YDAES RQ+ VE FYR  HI QTYDFVK+MRE+YG+LDKVEMSIWECCELLN+VVD+
Sbjct  45   FRDYDAESARQQGVENFYRTNHICQTYDFVKKMREEYGKLDKVEMSIWECCELLNEVVDE  104

Query  222  sdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDT  43
            SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLTALIHDLGKVL  PSFGELPQWAVVGDT
Sbjct  105  SDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTALIHDLGKVLNLPSFGELPQWAVVGDT  164

Query  42   FPLGCAFDESIVHH  1
            FP+GCAFDESIVHH
Sbjct  165  FPVGCAFDESIVHH  178



>ref|NP_565459.1| myo-inositol oxygenase 2 [Arabidopsis thaliana]
 sp|O82200.2|MIOX2_ARATH RecName: Full=Inositol oxygenase 2; AltName: Full=Myo-inositol 
oxygenase 2; Short=AtMIOX2; Short=MI oxygenase 2 [Arabidopsis 
thaliana]
 gb|AAC62136.2| expressed protein [Arabidopsis thaliana]
 gb|ACF28396.1| At2g19800 [Arabidopsis thaliana]
 gb|AEC06927.1| myo-inositol oxygenase 2 [Arabidopsis thaliana]
Length=317

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 159/193 (82%), Gaps = 5/193 (3%)
 Frame = -3

Query  573  MTILIIE-KPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTIL+    P   V+EK+ +  +  NEL+LDGGFVVPK+       F+AP+MN  G SFR
Sbjct  1    MTILVEHFVPDSRVDEKKVI-EERDNELVLDGGFVVPKS--KETDAFDAPDMNFLGHSFR  57

Query  396  AY-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
             Y + ESERQ+ VEEFYR+QHI+QTYDFVK+MR++YG+L+K+EMSIWECCELLN+VVD+S
Sbjct  58   DYENGESERQQGVEEFYRMQHIHQTYDFVKKMRKEYGKLNKMEMSIWECCELLNNVVDES  117

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQTAEAIR+DYP + WLHLTALIHDLGKVLL P FG LPQWAVVGDTF
Sbjct  118  DPDLDEPQIQHLLQTAEAIRRDYPDEDWLHLTALIHDLGKVLLLPEFGGLPQWAVVGDTF  177

Query  39   PLGCAFDESIVHH  1
            P+GC FD + +HH
Sbjct  178  PVGCTFDSANIHH  190



>ref|XP_010489128.1| PREDICTED: inositol oxygenase 2-like [Camelina sativa]
Length=317

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 158/193 (82%), Gaps = 5/193 (3%)
 Frame = -3

Query  573  MTILIIEK-PAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTIL+    P   VEEK+     N  EL+LDGGFVVP++      GF+AP+MN  G SFR
Sbjct  1    MTILVEHVVPDSRVEEKKLTEERNE-ELVLDGGFVVPQS--KETNGFDAPDMNFLGHSFR  57

Query  396  AYDAE-SERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
             Y+ + SERQ+ VEEFYR+QHI+QTYDFVK+MR++YG+LDK+EMSIWECCELLN VVD+S
Sbjct  58   DYENDLSERQQGVEEFYRMQHIHQTYDFVKKMRKEYGKLDKMEMSIWECCELLNSVVDES  117

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQTAEAIR+DYP++ WLHLTALIHDLGKVLL P FG LPQWAVVGDTF
Sbjct  118  DPDLDEPQIQHLLQTAEAIRRDYPNEDWLHLTALIHDLGKVLLLPEFGGLPQWAVVGDTF  177

Query  39   PLGCAFDESIVHH  1
            P+GC FD + +HH
Sbjct  178  PVGCTFDLANIHH  190



>ref|XP_006465721.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Citrus sinensis]
 gb|KDO53718.1| hypothetical protein CISIN_1g021944mg [Citrus sinensis]
Length=304

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 156/192 (81%), Gaps = 16/192 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTILI ++P   VE +++ VP D   EL LDGGF+VP+T             NSFG +FR
Sbjct  1    MTILI-DQPHFGVEVQEKKVPIDE-KELSLDGGFLVPQT-------------NSFGHTFR  45

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAE ERQ+ VE FYR+ HINQTYDFVK+MRE+YG+L++VEMSIWECCELLNDVVD+SD
Sbjct  46   DYDAEGERQEGVENFYRINHINQTYDFVKKMREEYGKLNRVEMSIWECCELLNDVVDESD  105

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVL  PSFG LPQWAVVGDTFP
Sbjct  106  PDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLNLPSFGGLPQWAVVGDTFP  165

Query  36   LGCAFDESIVHH  1
            +GCAFDESIVHH
Sbjct  166  VGCAFDESIVHH  177



>ref|XP_006426836.1| hypothetical protein CICLE_v10026154mg [Citrus clementina]
 gb|ESR40076.1| hypothetical protein CICLE_v10026154mg [Citrus clementina]
Length=304

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 156/192 (81%), Gaps = 16/192 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTILI ++P   VE +++ VP D   EL LDGGF+VP+T             NSFG +FR
Sbjct  1    MTILI-DQPHFGVEVQEKKVPIDEK-ELSLDGGFLVPQT-------------NSFGHTFR  45

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAE ERQ+ VE FYR+ HINQTYDFVK+MRE+YG+L++VEMSIWECCELLNDVVD+SD
Sbjct  46   DYDAEGERQEGVENFYRINHINQTYDFVKKMREEYGKLNRVEMSIWECCELLNDVVDESD  105

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVL  PSFG LPQWAVVGDTFP
Sbjct  106  PDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLNLPSFGGLPQWAVVGDTFP  165

Query  36   LGCAFDESIVHH  1
            +GCAFDESIVHH
Sbjct  166  VGCAFDESIVHH  177



>ref|XP_006465722.1| PREDICTED: inositol oxygenase 1-like isoform X2 [Citrus sinensis]
Length=304

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 156/192 (81%), Gaps = 16/192 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTILI ++P   VE +++ VP D   EL LDGGF+VP+T             NSFG +FR
Sbjct  1    MTILI-DQPHFGVEVQEKKVPIDE-KELSLDGGFLVPQT-------------NSFGHTFR  45

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAE ERQ+ VE FYR+ HINQTYDFVK+MRE+YG+L++VEMSIWECCELLNDVVD+SD
Sbjct  46   DYDAEGERQEGVENFYRINHINQTYDFVKKMREEYGKLNRVEMSIWECCELLNDVVDESD  105

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVL  PSFG LPQWAVVGDTFP
Sbjct  106  PDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLNLPSFGGLPQWAVVGDTFP  165

Query  36   LGCAFDESIVHH  1
            +GCAFDESIVHH
Sbjct  166  VGCAFDESIVHH  177



>gb|AAM63498.1| unknown [Arabidopsis thaliana]
Length=317

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 159/193 (82%), Gaps = 5/193 (3%)
 Frame = -3

Query  573  MTILIIE-KPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTIL+    P   V+EK+ +  +  NEL+LDGGFVVPK+       F+AP+MN  G SFR
Sbjct  1    MTILVEHFVPDSRVDEKKVI-EERDNELVLDGGFVVPKS--KETDAFDAPDMNFLGHSFR  57

Query  396  AY-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
             Y + ESERQ+ VEEFYR+QHI+QTYDFVK+MR++YG+L+K+EMSIWECCELLN+VVD+S
Sbjct  58   DYENDESERQQGVEEFYRMQHIHQTYDFVKKMRKEYGKLNKMEMSIWECCELLNNVVDES  117

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQTAEAIR+DYP + WLHLTALIHDLGKVLL P FG LPQWAVVGDTF
Sbjct  118  DPDLDEPQIQHLLQTAEAIRRDYPDEDWLHLTALIHDLGKVLLLPEFGGLPQWAVVGDTF  177

Query  39   PLGCAFDESIVHH  1
            P+GC FD + +HH
Sbjct  178  PVGCTFDSANIHH  190



>ref|XP_010433526.1| PREDICTED: inositol oxygenase 4-like isoform X2 [Camelina sativa]
Length=423

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 151/192 (79%), Gaps = 0/192 (0%)
 Frame = -3

Query  576  RMTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            +MTI +     E V   Q    D   EL LDGG ++P      +  F AP+MN+FG+ FR
Sbjct  105  KMTISVENPIFEKVSAFQKKSEDKTGELKLDGGVLIPNMATKDDEAFLAPDMNAFGRQFR  164

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAESERQKSV+EFYR+QHINQT DFV +MR +YG+LDK  MSIWECCELLN+VVD+SD
Sbjct  165  DYDAESERQKSVQEFYRLQHINQTVDFVTKMRAEYGKLDKKVMSIWECCELLNEVVDESD  224

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWAVVGDTFP
Sbjct  225  PDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQFGGLPQWAVVGDTFP  284

Query  36   LGCAFDESIVHH  1
            +GCAFDES VHH
Sbjct  285  VGCAFDESNVHH  296


 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = -3

Query  306  MREDYGRLDKVEMSIWECCEllndvvddsdp-dlDEPQIEHLLQTAEAIRKDYPHQPWLH  130
            MR +YG+LDK  MSIWECCELLN  V D    DLDEPQI+HLLQ+AEAIRKDYP++ WLH
Sbjct  1    MRAEYGKLDKKVMSIWECCELLNYEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLH  60

Query  129  LTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            LTALIHDLGKV+  P FG LPQWAVVGD FP+GCAF ES VHH
Sbjct  61   LTALIHDLGKVMTLPQFGGLPQWAVVGDMFPVGCAFYESNVHH  103



>gb|EYU21435.1| hypothetical protein MIMGU_mgv1a010728mg [Erythranthe guttata]
Length=304

 Score =   241 bits (614),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 155/191 (81%), Gaps = 14/191 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI  +P   +E ++    ++  +L+LDGGFV+P               NSFG +FR 
Sbjct  1    MTILI-HQPDFGIEVEEKKVPNSEKDLVLDGGFVLPHA-------------NSFGHNFRD  46

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDAESERQ+ VE FY+ QHI+QTYDFVK+MR +YG+LDKVEMS+WECCELLN+VVD+SDP
Sbjct  47   YDAESERQQGVETFYKTQHIHQTYDFVKKMRGEYGKLDKVEMSLWECCELLNNVVDESDP  106

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQTAEAIR+DYP++ WLHLT LIHDLGKVLL PSFGELPQWAVVGDTFP+
Sbjct  107  DLDEPQIQHLLQTAEAIRRDYPNEDWLHLTGLIHDLGKVLLLPSFGELPQWAVVGDTFPV  166

Query  33   GCAFDESIVHH  1
            GCAFDESIVHH
Sbjct  167  GCAFDESIVHH  177



>ref|XP_008221002.1| PREDICTED: inositol oxygenase 1-like isoform X2 [Prunus mume]
Length=331

 Score =   241 bits (616),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 153/194 (79%), Gaps = 17/194 (9%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNA---NELILDGGFVVPKTLMSSNGGFEAPEMNSFGQS  403
            MTIL+ E P   VE ++   SD     NEL+LDGGFVVP T             N+FG +
Sbjct  25   MTILV-EHPDSAVEVEEKKVSDQTGEENELVLDGGFVVPPT-------------NAFGHT  70

Query  402  FRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdd  223
            FR YD  S+R+  VEEFYR+ HINQ+ DFVKRMRE+YG+LDKVEMSIWECCELLN+VVD+
Sbjct  71   FRDYDVNSDRRDGVEEFYRINHINQSVDFVKRMREEYGKLDKVEMSIWECCELLNEVVDE  130

Query  222  sdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDT  43
            SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLTALIHDLGKVL  P+FGELPQWAVVGDT
Sbjct  131  SDPDLDEPQIEHLLQTAEAIRKDYPDEGWLHLTALIHDLGKVLHLPAFGELPQWAVVGDT  190

Query  42   FPLGCAFDESIVHH  1
            +P+GCAFDES VHH
Sbjct  191  YPVGCAFDESTVHH  204



>ref|XP_006305417.1| hypothetical protein CARUB_v10009817mg [Capsella rubella]
 gb|EOA38315.1| hypothetical protein CARUB_v10009817mg [Capsella rubella]
Length=311

 Score =   241 bits (614),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 144/181 (80%), Gaps = 13/181 (7%)
 Frame = -3

Query  543  EHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKS  364
            E VE+ Q +  +   EL+LD  F             EAP  NSFG +FR YDAESER++ 
Sbjct  17   ETVEKNQGIVKEEETELVLDASF-------------EAPHTNSFGHTFRDYDAESERRRG  63

Query  363  VEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHL  184
            VEEFYRV HI QT DFV++ RE+YGRL++ EMSIWECCELLN+ +D+SDPD+DEPQIEHL
Sbjct  64   VEEFYRVNHIGQTVDFVRKRREEYGRLNRTEMSIWECCELLNEFIDESDPDMDEPQIEHL  123

Query  183  LQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVH  4
            LQTAEAIRKDYP + WLHLT LIHDLGKVLLHPSFGELPQWAVVGDT+P+GCAFDESIVH
Sbjct  124  LQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPSFGELPQWAVVGDTYPVGCAFDESIVH  183

Query  3    H  1
            H
Sbjct  184  H  184



>ref|XP_010416640.1| PREDICTED: inositol oxygenase 2 [Camelina sativa]
Length=317

 Score =   241 bits (614),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 157/193 (81%), Gaps = 5/193 (3%)
 Frame = -3

Query  573  MTILIIE-KPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTIL+    P   VEEK+     N  EL+LDGGFVVP++      GF+AP+MN  G SFR
Sbjct  1    MTILVEHFVPDSRVEEKKLTEERNE-ELVLDGGFVVPQS--KETDGFDAPDMNFLGHSFR  57

Query  396  AY-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
             Y +  S+RQ+ VEEFYR+QHI+QTYDFVK+MR++YG+LDK+EMSIWECCELLN VVD+S
Sbjct  58   DYENGLSDRQQGVEEFYRMQHIHQTYDFVKKMRKEYGKLDKMEMSIWECCELLNSVVDES  117

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQTAEAIR+DYP++ WLHLTALIHDLGKVLL P FG LPQWAVVGDTF
Sbjct  118  DPDLDEPQIQHLLQTAEAIRRDYPNEDWLHLTALIHDLGKVLLLPEFGGLPQWAVVGDTF  177

Query  39   PLGCAFDESIVHH  1
            P+GC FD + +HH
Sbjct  178  PVGCTFDSANIHH  190



>ref|XP_010433527.1| PREDICTED: inositol oxygenase 4-like isoform X3 [Camelina sativa]
Length=422

 Score =   244 bits (623),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 150/191 (79%), Gaps = 0/191 (0%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTI +     E V   Q    D   EL LDGG ++P      +  F AP+MN+FG+ FR 
Sbjct  105  MTISVENPIFEKVSAFQKKSEDKTGELKLDGGVLIPNMATKDDEAFLAPDMNAFGRQFRD  164

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDAESERQKSV+EFYR+QHINQT DFV +MR +YG+LDK  MSIWECCELLN+VVD+SDP
Sbjct  165  YDAESERQKSVQEFYRLQHINQTVDFVTKMRAEYGKLDKKVMSIWECCELLNEVVDESDP  224

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWAVVGDTFP+
Sbjct  225  DLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQFGGLPQWAVVGDTFPV  284

Query  33   GCAFDESIVHH  1
            GCAFDES VHH
Sbjct  285  GCAFDESNVHH  295


 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = -3

Query  306  MREDYGRLDKVEMSIWECCEllndvvddsdp-dlDEPQIEHLLQTAEAIRKDYPHQPWLH  130
            MR +YG+LDK  MSIWECCELLN  V D    DLDEPQI+HLLQ+AEAIRKDYP++ WLH
Sbjct  1    MRAEYGKLDKKVMSIWECCELLNYEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLH  60

Query  129  LTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            LTALIHDLGKV+  P FG LPQWAVVGD FP+GCAF ES VHH
Sbjct  61   LTALIHDLGKVMTLPQFGGLPQWAVVGDMFPVGCAFYESNVHH  103



>ref|XP_010433525.1| PREDICTED: inositol oxygenase 4-like isoform X1 [Camelina sativa]
Length=424

 Score =   244 bits (622),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 153/194 (79%), Gaps = 3/194 (2%)
 Frame = -3

Query  576  RMTILIIEKP--AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQS  403
            +MTI  +E P   E V   Q    D   EL LDGG ++P      +  F AP+MN+FG+ 
Sbjct  105  KMTI-SVENPIFVEKVSAFQKKSEDKTGELKLDGGVLIPNMATKDDEAFLAPDMNAFGRQ  163

Query  402  FRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdd  223
            FR YDAESERQKSV+EFYR+QHINQT DFV +MR +YG+LDK  MSIWECCELLN+VVD+
Sbjct  164  FRDYDAESERQKSVQEFYRLQHINQTVDFVTKMRAEYGKLDKKVMSIWECCELLNEVVDE  223

Query  222  sdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDT  43
            SDPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWAVVGDT
Sbjct  224  SDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQFGGLPQWAVVGDT  283

Query  42   FPLGCAFDESIVHH  1
            FP+GCAFDES VHH
Sbjct  284  FPVGCAFDESNVHH  297


 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = -3

Query  306  MREDYGRLDKVEMSIWECCEllndvvddsdp-dlDEPQIEHLLQTAEAIRKDYPHQPWLH  130
            MR +YG+LDK  MSIWECCELLN  V D    DLDEPQI+HLLQ+AEAIRKDYP++ WLH
Sbjct  1    MRAEYGKLDKKVMSIWECCELLNYEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLH  60

Query  129  LTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            LTALIHDLGKV+  P FG LPQWAVVGD FP+GCAF ES VHH
Sbjct  61   LTALIHDLGKVMTLPQFGGLPQWAVVGDMFPVGCAFYESNVHH  103



>ref|XP_002883969.1| myo-inositol oxygenase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60228.1| myo-inositol oxygenase 2 [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score =   240 bits (613),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 158/192 (82%), Gaps = 3/192 (2%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTIL+    ++   +++ V  +  +EL+LDGGFVVPK+       F+AP+MN  G SFR 
Sbjct  1    MTILVEHFVSDSRVDEKKVTEERDDELVLDGGFVVPKS--KETDAFDAPDMNFLGHSFRD  58

Query  393  Y-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
            Y + ESERQ+ VEEFYR+QHI+QTYDFVK+MR++YG+L+K+EMSIWECCELLN+VVD+SD
Sbjct  59   YENGESERQQGVEEFYRMQHIHQTYDFVKKMRKEYGKLNKMEMSIWECCELLNNVVDESD  118

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQTAEAIR+DYP + WLHLTALIHDLGKVLL P FG LPQWAVVGDTFP
Sbjct  119  PDLDEPQIQHLLQTAEAIRRDYPDEDWLHLTALIHDLGKVLLLPEFGGLPQWAVVGDTFP  178

Query  36   LGCAFDESIVHH  1
            +GC FD + +HH
Sbjct  179  VGCNFDSANIHH  190



>gb|KHF98793.1| Inositol oxygenase 1 -like protein [Gossypium arboreum]
Length=304

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 149/191 (78%), Gaps = 14/191 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI ++P   +E       D   E +L+GGF++P T             NSFG +FR 
Sbjct  1    MTILI-DQPDFGIEAGFNKADDVEKEGVLNGGFMMPHT-------------NSFGHTFRD  46

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y  ESERQ+ VE FYR  HINQTYDFVKRMRE+YG LDKVEMSIWECCELLNDVVD+SDP
Sbjct  47   YHVESERQQGVENFYRTNHINQTYDFVKRMREEYGNLDKVEMSIWECCELLNDVVDESDP  106

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLHPSFG LPQWAVVGDT+P+
Sbjct  107  DLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPSFGGLPQWAVVGDTYPV  166

Query  33   GCAFDESIVHH  1
            GCAFD+SIVHH
Sbjct  167  GCAFDKSIVHH  177



>ref|XP_008221001.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Prunus mume]
Length=347

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 153/194 (79%), Gaps = 17/194 (9%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNA---NELILDGGFVVPKTLMSSNGGFEAPEMNSFGQS  403
            MTIL+ E P   VE ++   SD     NEL+LDGGFVVP T             N+FG +
Sbjct  25   MTILV-EHPDSAVEVEEKKVSDQTGEENELVLDGGFVVPPT-------------NAFGHT  70

Query  402  FRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdd  223
            FR YD  S+R+  VEEFYR+ HINQ+ DFVKRMRE+YG+LDKVEMSIWECCELLN+VVD+
Sbjct  71   FRDYDVNSDRRDGVEEFYRINHINQSVDFVKRMREEYGKLDKVEMSIWECCELLNEVVDE  130

Query  222  sdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDT  43
            SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLTALIHDLGKVL  P+FGELPQWAVVGDT
Sbjct  131  SDPDLDEPQIEHLLQTAEAIRKDYPDEGWLHLTALIHDLGKVLHLPAFGELPQWAVVGDT  190

Query  42   FPLGCAFDESIVHH  1
            +P+GCAFDES VHH
Sbjct  191  YPVGCAFDESTVHH  204



>ref|XP_009351657.1| PREDICTED: inositol oxygenase 1-like [Pyrus x bretschneideri]
Length=306

 Score =   239 bits (611),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 150/192 (78%), Gaps = 14/192 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVP-SDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTIL+ +     VE ++ V  S   NEL+LDGGFV P T             N+FG +FR
Sbjct  1    MTILVQQPDFGAVEAEEKVSESGEENELVLDGGFVEPPT-------------NAFGHTFR  47

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YD  SER+  VEEFYR+ HI Q+ DFVKRMRE+YG+LDKVEMSIWECCE LN VVD+SD
Sbjct  48   DYDVSSERRDGVEEFYRINHIYQSVDFVKRMREEYGKLDKVEMSIWECCEHLNQVVDESD  107

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP++ WLHLTALIHDLGKVL  P+FGELPQWAVVGDTFP
Sbjct  108  PDLDEPQIEHLLQTAEAIRKDYPNEGWLHLTALIHDLGKVLNLPAFGELPQWAVVGDTFP  167

Query  36   LGCAFDESIVHH  1
            +GCAFDESIVHH
Sbjct  168  VGCAFDESIVHH  179



>ref|XP_010438781.1| PREDICTED: inositol oxygenase 4 isoform X2 [Camelina sativa]
Length=318

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 149/191 (78%), Gaps = 0/191 (0%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTI +     E V   +    D   +L LDGG ++P      +  F AP+MN+FG+ FR 
Sbjct  1    MTISVENPIFEKVSAFERKSEDKTGDLKLDGGVLIPNMATKDDEAFLAPDMNAFGRQFRD  60

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            +DAESERQK VEEFYR+QHINQT DFV +MR +YG+LDK  MSIWECCELLN+VVD+SDP
Sbjct  61   FDAESERQKRVEEFYRLQHINQTVDFVTKMRAEYGKLDKKVMSIWECCELLNEVVDESDP  120

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWAVVGDTFP+
Sbjct  121  DLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQFGGLPQWAVVGDTFPV  180

Query  33   GCAFDESIVHH  1
            GCAFDES VHH
Sbjct  181  GCAFDESNVHH  191



>ref|XP_002869617.1| myo-inositol oxygenase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45876.1| myo-inositol oxygenase 4 [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 151/193 (78%), Gaps = 5/193 (3%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAV--PSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTI  +EKP    EE  A     D   E  LDGGF +PK     +  F APEMN+FG+ F
Sbjct  1    MTI-SVEKPI--FEEGSAFKKSGDKIGEFKLDGGFSMPKMDTEDDEAFLAPEMNAFGRQF  57

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R YD ESERQK VEEFYR+QHINQT DFV +MR +YG+LDK  MSIWECCELLN+VVD+S
Sbjct  58   RDYDVESERQKGVEEFYRLQHINQTVDFVTKMRAEYGKLDKKVMSIWECCELLNEVVDES  117

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWAVVGDTF
Sbjct  118  DPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQFGGLPQWAVVGDTF  177

Query  39   PLGCAFDESIVHH  1
            P+GCAFDES VHH
Sbjct  178  PVGCAFDESNVHH  190



>ref|XP_007222714.1| hypothetical protein PRUPE_ppa009901mg [Prunus persica]
 gb|EMJ23913.1| hypothetical protein PRUPE_ppa009901mg [Prunus persica]
Length=272

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 153/194 (79%), Gaps = 17/194 (9%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNA---NELILDGGFVVPKTLMSSNGGFEAPEMNSFGQS  403
            MTI  IE+P   VE ++   SD     NEL+LDGGFVVP T             N+FG +
Sbjct  1    MTI-PIEQPDFAVEVEEKKVSDQTGEENELVLDGGFVVPPT-------------NAFGHT  46

Query  402  FRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdd  223
            FR YD  S+R+  VEEFYR+ HINQ+ DFVKRMRE+YG+LDKVEMSIWECCELLN+VVD+
Sbjct  47   FRDYDVNSDRRDGVEEFYRINHINQSVDFVKRMREEYGKLDKVEMSIWECCELLNEVVDE  106

Query  222  sdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDT  43
            SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLTALIHDLGKVL  P+FGELPQWAVVGDT
Sbjct  107  SDPDLDEPQIEHLLQTAEAIRKDYPDEGWLHLTALIHDLGKVLHLPAFGELPQWAVVGDT  166

Query  42   FPLGCAFDESIVHH  1
             P+GCAFDESIVHH
Sbjct  167  CPVGCAFDESIVHH  180



>ref|XP_006417002.1| hypothetical protein EUTSA_v10009301mg [Eutrema salsugineum]
 gb|ESQ35355.1| hypothetical protein EUTSA_v10009301mg [Eutrema salsugineum]
Length=311

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 149/197 (76%), Gaps = 19/197 (10%)
 Frame = -3

Query  573  MTILIIEKPAEH------VEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSF  412
            MTI I   P ++      VE+ Q    +   E +LDGGFV P T             NSF
Sbjct  1    MTIHIDHHPDQNHAGDEIVEKNQGNVKEQETEHVLDGGFVAPHT-------------NSF  47

Query  411  GQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndv  232
            G +FR YDAES R++SVE+FYR  HI QT DFVKRMRE YG+L++ EMSIWECCELLN+ 
Sbjct  48   GHTFRDYDAESGRRRSVEDFYRTNHIGQTVDFVKRMREAYGKLNRTEMSIWECCELLNEF  107

Query  231  vddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVV  52
            +D+SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLHPSFGELPQWAVV
Sbjct  108  IDESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPSFGELPQWAVV  167

Query  51   GDTFPLGCAFDESIVHH  1
            GDT+P+GCAFDESIVHH
Sbjct  168  GDTYPVGCAFDESIVHH  184



>gb|EYU30675.1| hypothetical protein MIMGU_mgv1a010745mg [Erythranthe guttata]
Length=303

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 144/162 (89%), Gaps = 2/162 (1%)
 Frame = -3

Query  486  DGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKR  307
            D  F VP+T   S GGFEAP++N+FG +FR Y+AESERQK+VEEFYR+ HINQ+YD+V +
Sbjct  17   DSDFPVPRT--ESQGGFEAPDINAFGNTFRDYNAESERQKTVEEFYRMNHINQSYDYVMK  74

Query  306  MREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHL  127
            MRE+Y +LDK EM++WECC LLNDVVD+SDPDLDEPQIEHLLQTAEAIRKDYP++ WLHL
Sbjct  75   MREEYEKLDKTEMTVWECCVLLNDVVDESDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHL  134

Query  126  TALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            TALIHDLGKVL  P+FG LPQWAVVGDTFP+GCAFDESIVHH
Sbjct  135  TALIHDLGKVLHLPTFGSLPQWAVVGDTFPVGCAFDESIVHH  176



>ref|NP_001154337.1| inositol oxygenase 1 [Arabidopsis thaliana]
 gb|AEE29175.1| inositol oxygenase 1 [Arabidopsis thaliana]
Length=309

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 150/195 (77%), Gaps = 17/195 (9%)
 Frame = -3

Query  573  MTILII----EKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQ  406
            MTILI     +   E VE+ Q    +   EL+LD GF             EAP  NSFG+
Sbjct  1    MTILIDRHSDQNGDEIVEKNQGNGKEEETELVLDAGF-------------EAPHTNSFGR  47

Query  405  SFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvd  226
            +FR YDAESER++ VEEFYRV HI QT DFV++MRE+Y +L++ EMSIWECCELLN+ +D
Sbjct  48   TFRDYDAESERRRGVEEFYRVNHIGQTVDFVRKMREEYEKLNRTEMSIWECCELLNEFID  107

Query  225  dsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGD  46
            +SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLH SFGELPQWAVVGD
Sbjct  108  ESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHSSFGELPQWAVVGD  167

Query  45   TFPLGCAFDESIVHH  1
            TFP+GCAFDESIVHH
Sbjct  168  TFPVGCAFDESIVHH  182



>ref|XP_010527856.1| PREDICTED: inositol oxygenase 1 [Tarenaya hassleriana]
Length=309

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 149/195 (76%), Gaps = 17/195 (9%)
 Frame = -3

Query  573  MTILIIE----KPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQ  406
            MTILI         E VE  +        +L+LDGGFVVP T             NSFG 
Sbjct  1    MTILIDRHSDHNGGEDVEMNRENEEVQETQLVLDGGFVVPHT-------------NSFGH  47

Query  405  SFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvd  226
            +FR YDAESER+  VEEFYR  HI QT DFV+RMR++YG+L+++EMSIWECCELLN+ VD
Sbjct  48   TFRDYDAESERRGGVEEFYRANHIGQTVDFVRRMRDEYGKLNRIEMSIWECCELLNEFVD  107

Query  225  dsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGD  46
            +SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLHP+FGELPQWAVVGD
Sbjct  108  ESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPAFGELPQWAVVGD  167

Query  45   TFPLGCAFDESIVHH  1
            T+P+GCAFDESIVHH
Sbjct  168  TYPVGCAFDESIVHH  182



>ref|XP_004297776.1| PREDICTED: inositol oxygenase 1-like [Fragaria vesca subsp. vesca]
Length=305

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 155/193 (80%), Gaps = 17/193 (9%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPS--DNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTI II++P E V+E + +    +N NEL+LDGGF VP T             N+FG +F
Sbjct  1    MTI-IIDQP-EFVDEVEEIIGYEENGNELVLDGGFEVPTT-------------NAFGHTF  45

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R YD  SER+  VE FYR+QHINQ+ DFVKRMRE+YG+LDKVEMSIWECCELLN+VVD+S
Sbjct  46   RDYDVHSERRDGVELFYRIQHINQSVDFVKRMREEYGKLDKVEMSIWECCELLNEVVDES  105

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQIEHLLQTAEA+RKDYP + WLHLTALIHDLGKVL  P+FGELPQWAVVGDTF
Sbjct  106  DPDLDEPQIEHLLQTAEAVRKDYPKEGWLHLTALIHDLGKVLNLPAFGELPQWAVVGDTF  165

Query  39   PLGCAFDESIVHH  1
            P+GCAFD SIVHH
Sbjct  166  PVGCAFDGSIVHH  178



>ref|XP_010243881.1| PREDICTED: probable inositol oxygenase [Nelumbo nucifera]
Length=454

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 149/180 (83%), Gaps = 14/180 (8%)
 Frame = -3

Query  537  VEEKQAVP-SDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSV  361
             +EK+ +P  D+  EL  D GFVVPKT             N+FG +FR YDAESER+K+V
Sbjct  161  AKEKKMIPLGDDNKELASDDGFVVPKT-------------NAFGHTFRDYDAESERKKTV  207

Query  360  EEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLL  181
            EEFYR+ HINQ+YDFVKRMR++YG+L++ EMSIWECCELLN+ VD+SDPDLDEPQIEHLL
Sbjct  208  EEFYRMNHINQSYDFVKRMRQEYGKLNRAEMSIWECCELLNEFVDESDPDLDEPQIEHLL  267

Query  180  QTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            QTAEAIRKDYP++ WLHLTALIHDLGKVLLHPSFG LPQWAVVGDTFP+GCAF ES VHH
Sbjct  268  QTAEAIRKDYPNEDWLHLTALIHDLGKVLLHPSFGALPQWAVVGDTFPVGCAFHESNVHH  327



>ref|XP_009402940.1| PREDICTED: probable inositol oxygenase [Musa acuminata subsp. 
malaccensis]
Length=289

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  456  MSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDK  277
            M   GGF  P  NSFGQ+FR YDA SERQKSVEEFYR  HI+QTYDFVK+MRE+YG+LD+
Sbjct  11   MGLGGGFVVPNTNSFGQTFRDYDAASERQKSVEEFYRANHIHQTYDFVKKMREEYGKLDR  70

Query  276  VEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKV  97
            VEMSIWEC ELLN+ VD+SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKV
Sbjct  71   VEMSIWECIELLNEFVDESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKV  130

Query  96   LLHPSFGELPQWAVVGDTFPLGCAFDESIVH  4
            LLHPSFG+LPQWAVVGDTFP+GCAFDES VH
Sbjct  131  LLHPSFGQLPQWAVVGDTFPVGCAFDESNVH  161



>ref|XP_011072454.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Sesamum indicum]
Length=303

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 151/191 (79%), Gaps = 15/191 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI +     +E ++   S    E++LD GF+VP             + N+FG +FR 
Sbjct  1    MTILIPQPQFAGIEVEEK--SSAKEEVVLDAGFLVP-------------DANAFGHNFRD  45

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YD ESERQ  VE FY++ HINQTY FVKRMRE+YG+LDKVEMSIWECCELLNDV+D+SDP
Sbjct  46   YDGESERQAGVETFYKINHINQTYHFVKRMREEYGKLDKVEMSIWECCELLNDVIDESDP  105

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQIEHLLQTAEAIR+DYP++ WLHLTALIHDLGKVL HP FGELPQWAVVGDTFP+
Sbjct  106  DLDEPQIEHLLQTAEAIRQDYPNEDWLHLTALIHDLGKVLHHPKFGELPQWAVVGDTFPV  165

Query  33   GCAFDESIVHH  1
            GCAFDESIVHH
Sbjct  166  GCAFDESIVHH  176



>gb|KGN58015.1| hypothetical protein Csa_3G434960 [Cucumis sativus]
Length=305

 Score =   238 bits (608),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 155/192 (81%), Gaps = 15/192 (8%)
 Frame = -3

Query  573  MTI-LIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTI L++E P   V  ++    +  +EL+LDGGF+VP               NSFG  FR
Sbjct  1    MTITLLVENPEFGVAAEEK-GFNQESELVLDGGFLVPYA-------------NSFGHGFR  46

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAESERQ+ VE FY++ HINQTYDFVK+MR++YG+L++VEMSIWECCELLNDVVD+SD
Sbjct  47   DYDAESERQEGVERFYKLNHINQTYDFVKKMRKEYGQLNRVEMSIWECCELLNDVVDESD  106

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP++ WLHLTALIHDLGKVLL PSFG LPQWAVVGDT+P
Sbjct  107  PDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTALIHDLGKVLLLPSFGGLPQWAVVGDTYP  166

Query  36   LGCAFDESIVHH  1
            LGCAFD+SIVHH
Sbjct  167  LGCAFDKSIVHH  178



>ref|XP_002892814.1| myo-inisitol oxygenase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69073.1| myo-inisitol oxygenase [Arabidopsis lyrata subsp. lyrata]
Length=311

 Score =   238 bits (608),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 149/197 (76%), Gaps = 19/197 (10%)
 Frame = -3

Query  573  MTILIIEKPAEH------VEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSF  412
            MTILI     ++      VE+ Q    +   EL+LD  F             EAP  NSF
Sbjct  1    MTILIDRHSDQNDAGDEIVEKNQGNVKEEETELVLDAAF-------------EAPHTNSF  47

Query  411  GQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndv  232
            G +FR YDAESER++ VEEFYRV HI QT DFV++MRE+Y +L++ EMSIWECCELLN+ 
Sbjct  48   GHTFRDYDAESERRRGVEEFYRVNHIGQTVDFVRKMREEYRKLNRTEMSIWECCELLNEF  107

Query  231  vddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVV  52
            +D+SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLHPSFGELPQWAVV
Sbjct  108  IDESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPSFGELPQWAVV  167

Query  51   GDTFPLGCAFDESIVHH  1
            GDTFP+GCAFDESIVHH
Sbjct  168  GDTFPVGCAFDESIVHH  184



>ref|XP_008340501.1| PREDICTED: inositol oxygenase 1 [Malus domestica]
Length=306

 Score =   238 bits (607),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 150/192 (78%), Gaps = 14/192 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVP-SDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTIL+ +     VE ++ V  S   NEL+LDGGFV P T             N+FG +FR
Sbjct  1    MTILVQQPDFGAVEAEEKVSESGEENELVLDGGFVEPPT-------------NAFGHTFR  47

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YD  SER+  VEEFYR+ HI Q+ DFVKRMR++YG+LDKVEMSIWECCE LN VVD+SD
Sbjct  48   DYDVSSERRDGVEEFYRINHIYQSVDFVKRMRKEYGKLDKVEMSIWECCEHLNQVVDESD  107

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP++ WLHLTALIHDLGKVL  P+FGELPQWAVVGDTFP
Sbjct  108  PDLDEPQIEHLLQTAEAIRKDYPNEGWLHLTALIHDLGKVLNLPAFGELPQWAVVGDTFP  167

Query  36   LGCAFDESIVHH  1
            +GCAFDESIVHH
Sbjct  168  VGCAFDESIVHH  179



>ref|XP_011072455.1| PREDICTED: inositol oxygenase 1-like isoform X2 [Sesamum indicum]
Length=302

 Score =   238 bits (607),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 152/192 (79%), Gaps = 18/192 (9%)
 Frame = -3

Query  573  MTILIIE-KPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTILI + +    VEEK    S    E++LD GF+VP             + N+FG +FR
Sbjct  1    MTILIPQPQFGIEVEEK----SSAKEEVVLDAGFLVP-------------DANAFGHNFR  43

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YD ESERQ  VE FY++ HINQTY FVKRMRE+YG+LDKVEMSIWECCELLNDV+D+SD
Sbjct  44   DYDGESERQAGVETFYKINHINQTYHFVKRMREEYGKLDKVEMSIWECCELLNDVIDESD  103

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIR+DYP++ WLHLTALIHDLGKVL HP FGELPQWAVVGDTFP
Sbjct  104  PDLDEPQIEHLLQTAEAIRQDYPNEDWLHLTALIHDLGKVLHHPKFGELPQWAVVGDTFP  163

Query  36   LGCAFDESIVHH  1
            +GCAFDESIVHH
Sbjct  164  VGCAFDESIVHH  175



>ref|XP_011076857.1| PREDICTED: probable inositol oxygenase [Sesamum indicum]
Length=304

 Score =   238 bits (607),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 151/191 (79%), Gaps = 14/191 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MT+LI E P   +EEK+     +++EL+LD GFVVP               NS+G SFR 
Sbjct  1    MTVLI-EHPEFGIEEKERRTVADSDELVLDEGFVVPAN-------------NSYGYSFRD  46

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDAESER++ VEE YR+ HINQTYDFVKRMRE Y  LD+VEMSIWECCELLN+VVDDSDP
Sbjct  47   YDAESERKERVEELYRLSHINQTYDFVKRMREAYSSLDRVEMSIWECCELLNEVVDDSDP  106

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLD PQI+HLLQ+AEA+RKDYP Q WLHLTALIHDLGKVLL PSFG LPQWAVVGDTFPL
Sbjct  107  DLDAPQIQHLLQSAEAVRKDYPDQDWLHLTALIHDLGKVLLLPSFGGLPQWAVVGDTFPL  166

Query  33   GCAFDESIVHH  1
            GCAFD S+VH+
Sbjct  167  GCAFDPSVVHY  177



>ref|XP_010438780.1| PREDICTED: inositol oxygenase 4 isoform X1 [Camelina sativa]
Length=319

 Score =   238 bits (608),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 151/193 (78%), Gaps = 3/193 (2%)
 Frame = -3

Query  573  MTILIIEKP--AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTI  +E P   E V   +    D   +L LDGG ++P      +  F AP+MN+FG+ F
Sbjct  1    MTI-SVENPIFVEKVSAFERKSEDKTGDLKLDGGVLIPNMATKDDEAFLAPDMNAFGRQF  59

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R +DAESERQK VEEFYR+QHINQT DFV +MR +YG+LDK  MSIWECCELLN+VVD+S
Sbjct  60   RDFDAESERQKRVEEFYRLQHINQTVDFVTKMRAEYGKLDKKVMSIWECCELLNEVVDES  119

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWAVVGDTF
Sbjct  120  DPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQFGGLPQWAVVGDTF  179

Query  39   PLGCAFDESIVHH  1
            P+GCAFDES VHH
Sbjct  180  PVGCAFDESNVHH  192



>ref|NP_172904.2| inositol oxygenase 1 [Arabidopsis thaliana]
 sp|Q8L799.1|MIOX1_ARATH RecName: Full=Inositol oxygenase 1; AltName: Full=Myo-inositol 
oxygenase 1; Short=AtMIOX1; Short=MI oxygenase 1 [Arabidopsis 
thaliana]
 gb|AAM97054.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15506.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD42878.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44453.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29174.1| inositol oxygenase 1 [Arabidopsis thaliana]
Length=311

 Score =   238 bits (607),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 150/197 (76%), Gaps = 19/197 (10%)
 Frame = -3

Query  573  MTILIIEKPAEH------VEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSF  412
            MTILI     ++      VE+ Q    +   EL+LD GF             EAP  NSF
Sbjct  1    MTILIDRHSDQNDAGDEIVEKNQGNGKEEETELVLDAGF-------------EAPHTNSF  47

Query  411  GQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndv  232
            G++FR YDAESER++ VEEFYRV HI QT DFV++MRE+Y +L++ EMSIWECCELLN+ 
Sbjct  48   GRTFRDYDAESERRRGVEEFYRVNHIGQTVDFVRKMREEYEKLNRTEMSIWECCELLNEF  107

Query  231  vddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVV  52
            +D+SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLH SFGELPQWAVV
Sbjct  108  IDESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHSSFGELPQWAVV  167

Query  51   GDTFPLGCAFDESIVHH  1
            GDTFP+GCAFDESIVHH
Sbjct  168  GDTFPVGCAFDESIVHH  184



>ref|XP_009408907.1| PREDICTED: probable inositol oxygenase [Musa acuminata subsp. 
malaccensis]
Length=305

 Score =   238 bits (606),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 151/188 (80%), Gaps = 14/188 (7%)
 Frame = -3

Query  564  LIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDA  385
            L++E+P     E +   SD   EL++DGGFVVP             + NSFG +FR Y+A
Sbjct  3    LVVEQPRPVTGEVKRTQSD-PKELLMDGGFVVP-------------DANSFGHTFRDYNA  48

Query  384  ESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlD  205
            ESERQK+VEEFYR+ HI+QT DFVKR+RE+YG+LD+VEMSIWEC ELLN+ VD+SDPDLD
Sbjct  49   ESERQKTVEEFYRMNHIHQTCDFVKRLREEYGKLDRVEMSIWECIELLNEFVDESDPDLD  108

Query  204  EPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCA  25
            EPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLHPSFG+LPQWAVVGDTFP+GCA
Sbjct  109  EPQIEHLLQTAEAIRKDYPEEDWLHLTGLIHDLGKVLLHPSFGQLPQWAVVGDTFPVGCA  168

Query  24   FDESIVHH  1
            FDE  VHH
Sbjct  169  FDECNVHH  176



>ref|XP_008244494.1| PREDICTED: inositol oxygenase 4-like [Prunus mume]
Length=282

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -3

Query  438  FEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIW  259
            F APE+NSFGQSFR Y+AESERQKSVEEFYR+ HINQTYDFVK+MRE+Y +L++VEMSIW
Sbjct  10   FIAPEINSFGQSFRDYNAESERQKSVEEFYRLNHINQTYDFVKKMREEYSKLNRVEMSIW  69

Query  258  ECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSF  79
            ECCELLN+VVDDSDPDLDEPQIEHLLQTAEA+RKDYP++ WLHLTALIHDLGKVLL P F
Sbjct  70   ECCELLNEVVDDSDPDLDEPQIEHLLQTAEAVRKDYPNEDWLHLTALIHDLGKVLLLPKF  129

Query  78   GELPQWAVVGDTFPLGCAFDESIVHH  1
            G LPQWAVVGDT PLGCAFDE+IVHH
Sbjct  130  GGLPQWAVVGDTHPLGCAFDEAIVHH  155



>dbj|BAC42925.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43581.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43596.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD94364.1| hypothetical protein [Arabidopsis thaliana]
Length=311

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 149/197 (76%), Gaps = 19/197 (10%)
 Frame = -3

Query  573  MTILIIEKPAEH------VEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSF  412
            MTILI     ++      VE+ Q    +   EL+LD GF             EAP  NSF
Sbjct  1    MTILIDRHSDQNDAGDEIVEKNQGNGKEEETELVLDAGF-------------EAPHTNSF  47

Query  411  GQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndv  232
            G++FR YDAESER++ VEEFYRV HI QT DFV++MRE+Y +L++ EMSIWECCELLN+ 
Sbjct  48   GRTFRDYDAESERRRGVEEFYRVNHIGQTVDFVRKMREEYEKLNRTEMSIWECCELLNEF  107

Query  231  vddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVV  52
            +D+ DPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLH SFGELPQWAVV
Sbjct  108  IDEGDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHSSFGELPQWAVV  167

Query  51   GDTFPLGCAFDESIVHH  1
            GDTFP+GCAFDESIVHH
Sbjct  168  GDTFPVGCAFDESIVHH  184



>ref|XP_009148831.1| PREDICTED: inositol oxygenase 1 isoform X2 [Brassica rapa]
Length=306

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 148/191 (77%), Gaps = 12/191 (6%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI        +  +   ++   EL+LD            +GGF AP  NSFG +FR 
Sbjct  1    MTILIDHSDHNGNDNVEKNVTEEETELVLD------------DGGFVAPHTNSFGHTFRD  48

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDA+SER++SVEEFY+  HI QT DFV+RMRE+YG+L++ EMSIWECCELLN+ +D+SDP
Sbjct  49   YDAQSERRRSVEEFYKTNHIGQTVDFVRRMREEYGKLNRTEMSIWECCELLNEFIDESDP  108

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLH SFGELPQWAVVGDT+P+
Sbjct  109  DLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHSSFGELPQWAVVGDTYPV  168

Query  33   GCAFDESIVHH  1
            GCAFDESIVHH
Sbjct  169  GCAFDESIVHH  179



>gb|KFK43697.1| hypothetical protein AALP_AA1G161300 [Arabis alpina]
Length=305

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 145/191 (76%), Gaps = 13/191 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI  +   + +E       N  EL+LDG FV P T             NSFG +FR 
Sbjct  1    MTILIDFQSDHNGDEIVEKSQGNVTELVLDGAFVAPHT-------------NSFGHTFRD  47

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDAESER+ SVE FYR  HI QT DFV+R RE+YG+L++ EMSIWECCELLN+ +D+SDP
Sbjct  48   YDAESERRTSVEHFYRTNHIGQTVDFVRRTREEYGKLNRTEMSIWECCELLNEFIDESDP  107

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLH SFGELPQWAVVGDT+P+
Sbjct  108  DLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHTSFGELPQWAVVGDTYPV  167

Query  33   GCAFDESIVHH  1
            GCAFDESIVHH
Sbjct  168  GCAFDESIVHH  178



>dbj|BAF01953.1| hypothetical protein [Arabidopsis thaliana]
Length=294

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 143/179 (80%), Gaps = 13/179 (7%)
 Frame = -3

Query  537  VEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVE  358
            VE+ Q    +   EL+LD GF             EAP  NSFG++FR YDAESER++ VE
Sbjct  2    VEKNQGNGKEEETELVLDAGF-------------EAPHTNSFGRTFRDYDAESERRRGVE  48

Query  357  EFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQ  178
            EFYRV HI QT DFV++MRE+Y +L++ EMSIWECCELLN+ +D+SDPDLDEPQIEHLLQ
Sbjct  49   EFYRVNHIGQTVDFVRKMREEYEKLNRTEMSIWECCELLNEFIDESDPDLDEPQIEHLLQ  108

Query  177  TAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            TAEAIRKDYP + WLHLT LIHDLGKVLLH SFGELPQWAVVGDTFP+GCAFDESIVHH
Sbjct  109  TAEAIRKDYPDEDWLHLTGLIHDLGKVLLHSSFGELPQWAVVGDTFPVGCAFDESIVHH  167



>emb|CDY65374.1| BnaC05g49660D [Brassica napus]
Length=306

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 151/194 (78%), Gaps = 18/194 (9%)
 Frame = -3

Query  573  MTILI---IEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQS  403
            MTILI    +   ++ EEK    ++   EL+LDG FV P T             NSFG +
Sbjct  1    MTILIDHHSDHNGDNTEEKNV--TEEETELVLDGVFVAPHT-------------NSFGHT  45

Query  402  FRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdd  223
            FR YDA+SER++SVEEFY+  HI QT DFV+RMRE+YG+L++ EMSIWECCELLN+ VD+
Sbjct  46   FRDYDAQSERRRSVEEFYKTNHIGQTVDFVRRMREEYGKLNRTEMSIWECCELLNEFVDE  105

Query  222  sdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDT  43
            SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLH SFGELPQWAVVGDT
Sbjct  106  SDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHSSFGELPQWAVVGDT  165

Query  42   FPLGCAFDESIVHH  1
            +P+GCAFDESIVHH
Sbjct  166  YPVGCAFDESIVHH  179



>ref|XP_010476506.1| PREDICTED: inositol oxygenase 1-like [Camelina sativa]
Length=308

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/194 (65%), Positives = 149/194 (77%), Gaps = 16/194 (8%)
 Frame = -3

Query  573  MTILI---IEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQS  403
            MTI+    +++  E  E+ Q +  +   EL+LD GF             EAP  NSFG +
Sbjct  1    MTIIFDHHLDQNDEIGEKNQGIDKEEETELVLDAGF-------------EAPHTNSFGHT  47

Query  402  FRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdd  223
            FR YD ESER++ VEEFYR  HI QT DFV++MRE+YG+L++ EMSIWECCELLN+ +D+
Sbjct  48   FRDYDVESERRRGVEEFYRANHIGQTVDFVRKMREEYGKLNRTEMSIWECCELLNEFIDE  107

Query  222  sdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDT  43
            SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLH SFGELPQWAVVGDT
Sbjct  108  SDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHSSFGELPQWAVVGDT  167

Query  42   FPLGCAFDESIVHH  1
            +P+GCAFDESIVHH
Sbjct  168  YPVGCAFDESIVHH  181



>ref|XP_010925499.1| PREDICTED: probable inositol oxygenase isoform X2 [Elaeis guineensis]
Length=283

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 152/192 (79%), Gaps = 19/192 (10%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTI  IE+P   VE E + VP     EL+LDGGF+VP+T             NSFG +FR
Sbjct  1    MTI-SIEQPQIEVEVEDKKVP----RELVLDGGFMVPET-------------NSFGHTFR  42

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YD ESER+K+VEEFYR  HI+QTYDFV RMRE+YG+LD+VEMSIWEC ELLN+ +DDSD
Sbjct  43   DYDVESERKKAVEEFYRTNHIHQTYDFVTRMREEYGKLDRVEMSIWECIELLNEFIDDSD  102

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLH +FG+LPQWAVVGDTFP
Sbjct  103  PDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHQNFGQLPQWAVVGDTFP  162

Query  36   LGCAFDESIVHH  1
            +GCAFDE  VHH
Sbjct  163  VGCAFDECNVHH  174



>emb|CDY66453.1| BnaAnng22250D [Brassica napus]
Length=306

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 147/191 (77%), Gaps = 12/191 (6%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI           +   ++   EL+LD            +GGF AP  NSFG +FR 
Sbjct  1    MTILIDHSDHNGDNNVEKNVTEEETELVLD------------DGGFVAPHTNSFGHTFRD  48

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDA+SER++SVEEFY+  HI QT DFV+RMRE+YG+L++ EMSIWECCELLN+ +D+SDP
Sbjct  49   YDAQSERRRSVEEFYKTNHIGQTVDFVRRMREEYGKLNRTEMSIWECCELLNEFIDESDP  108

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLH SFGELPQWAVVGDT+P+
Sbjct  109  DLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHSSFGELPQWAVVGDTYPV  168

Query  33   GCAFDESIVHH  1
            GCAFDESIVHH
Sbjct  169  GCAFDESIVHH  179



>ref|XP_009343020.1| PREDICTED: inositol oxygenase 1-like [Pyrus x bretschneideri]
Length=308

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 153/195 (78%), Gaps = 18/195 (9%)
 Frame = -3

Query  573  MTILIIEKPA----EHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQ  406
            MTILI E+P       +E ++    ++  EL LD GFVVP T             NSFGQ
Sbjct  1    MTILI-EQPEFAVEVEIEARERKVLNDEKELALDAGFVVPHT-------------NSFGQ  46

Query  405  SFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvd  226
            +FR YDAE ERQ SVE FY++ HINQTYDFV+RMR +Y +L++VEMSIWECCELLN+VVD
Sbjct  47   TFRDYDAEGERQPSVENFYQINHINQTYDFVQRMRNEYSKLNRVEMSIWECCELLNEVVD  106

Query  225  dsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGD  46
            +SDPDLDEPQIEHLLQTAEA+RKDYP++ WLHLT LIHDLGKVLL PSFGELPQWAVVGD
Sbjct  107  ESDPDLDEPQIEHLLQTAEALRKDYPNEDWLHLTGLIHDLGKVLLLPSFGELPQWAVVGD  166

Query  45   TFPLGCAFDESIVHH  1
            TFP+GCAFD+S VHH
Sbjct  167  TFPVGCAFDQSNVHH  181



>gb|AAF43953.1|AC012188_30 Strong similarity to an unknown protein from Arabidopsis thaliana 
gb|AL049171.1 [Arabidopsis thaliana]
Length=422

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 150/195 (77%), Gaps = 17/195 (9%)
 Frame = -3

Query  573  MTILII----EKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQ  406
            MTILI     +   E VE+ Q    +   EL+LD GF             EAP  NSFG+
Sbjct  1    MTILIDRHSDQNGDEIVEKNQGNGKEEETELVLDAGF-------------EAPHTNSFGR  47

Query  405  SFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvd  226
            +FR YDAESER++ VEEFYRV HI QT DFV++MRE+Y +L++ EMSIWECCELLN+ +D
Sbjct  48   TFRDYDAESERRRGVEEFYRVNHIGQTVDFVRKMREEYEKLNRTEMSIWECCELLNEFID  107

Query  225  dsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGD  46
            +SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLH SFGELPQWAVVGD
Sbjct  108  ESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHSSFGELPQWAVVGD  167

Query  45   TFPLGCAFDESIVHH  1
            TFP+GCAFDESIVHH
Sbjct  168  TFPVGCAFDESIVHH  182



>ref|NP_001057871.1| Os06g0561000 [Oryza sativa Japonica Group]
 sp|Q5Z8T3.1|MIOX_ORYSJ RecName: Full=Probable inositol oxygenase; AltName: Full=Myo-inositol 
oxygenase; Short=MI oxygenase [Oryza sativa Japonica 
Group]
 dbj|BAD53740.1| putative myo-inositol oxygenase [Oryza sativa Japonica Group]
 dbj|BAD53821.1| putative myo-inositol oxygenase [Oryza sativa Japonica Group]
 dbj|BAF19785.1| Os06g0561000 [Oryza sativa Japonica Group]
 gb|EAZ01345.1| hypothetical protein OsI_23379 [Oryza sativa Indica Group]
 dbj|BAG96353.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91132.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACU78065.1| myo-inositol oxygenase [Oryza sativa Japonica Group]
Length=308

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 151/193 (78%), Gaps = 16/193 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPS---DNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQS  403
            MTI I +   + + +++       DNA EL+LDGGFVVP +             N+FG +
Sbjct  1    MTITIEQPHLDAIADRKVAGGGGGDNAAELVLDGGFVVPDS-------------NAFGNA  47

Query  402  FRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdd  223
            FR Y+AESER+++VEEFYRV HINQTYDFV+RMRE+YGR+DK EM IWEC ELLN+ +DD
Sbjct  48   FRNYEAESERKETVEEFYRVNHINQTYDFVRRMREEYGRVDKTEMGIWECIELLNEFIDD  107

Query  222  sdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDT  43
            SDPDLD PQIEHLLQTAEAIRKD+P + WLHLT LIHDLGKVLLHPSFGELPQW+VVGDT
Sbjct  108  SDPDLDMPQIEHLLQTAEAIRKDFPDEDWLHLTGLIHDLGKVLLHPSFGELPQWSVVGDT  167

Query  42   FPLGCAFDESIVH  4
            FP+GCAFDE  VH
Sbjct  168  FPVGCAFDECNVH  180



>ref|XP_010925498.1| PREDICTED: probable inositol oxygenase isoform X1 [Elaeis guineensis]
Length=301

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 152/192 (79%), Gaps = 19/192 (10%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTI  IE+P   VE E + VP     EL+LDGGF+VP+T             NSFG +FR
Sbjct  1    MTI-SIEQPQIEVEVEDKKVP----RELVLDGGFMVPET-------------NSFGHTFR  42

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YD ESER+K+VEEFYR  HI+QTYDFV RMRE+YG+LD+VEMSIWEC ELLN+ +DDSD
Sbjct  43   DYDVESERKKAVEEFYRTNHIHQTYDFVTRMREEYGKLDRVEMSIWECIELLNEFIDDSD  102

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLH +FG+LPQWAVVGDTFP
Sbjct  103  PDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHQNFGQLPQWAVVGDTFP  162

Query  36   LGCAFDESIVHH  1
            +GCAFDE  VHH
Sbjct  163  VGCAFDECNVHH  174



>ref|XP_010536841.1| PREDICTED: inositol oxygenase 4-like isoform X1 [Tarenaya hassleriana]
Length=316

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 157/192 (82%), Gaps = 4/192 (2%)
 Frame = -3

Query  573  MTILIIEKPAEH-VEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTI  +EKP  H V   Q    +   EL LDGGF  P +   S+  F APEMN+FG++FR
Sbjct  1    MTI-SVEKPVFHDVSALQKKIEEQDRELKLDGGF--PMSDSPSDEAFLAPEMNAFGRAFR  57

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YD  SERQKSVEEFYR+QHI+QT DFV++MRE+YG+L+K+EMSIWECCELLNDVVD+SD
Sbjct  58   DYDVNSERQKSVEEFYRLQHIHQTVDFVEKMREEYGKLNKMEMSIWECCELLNDVVDESD  117

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQ+AEA+RKDYP++ WLHLTALIHDLGKVL  P FG LPQWAVVGDTFP
Sbjct  118  PDLDEPQIQHLLQSAEAVRKDYPNEDWLHLTALIHDLGKVLTLPQFGGLPQWAVVGDTFP  177

Query  36   LGCAFDESIVHH  1
            +GCAFD+S VH+
Sbjct  178  VGCAFDDSNVHN  189



>ref|XP_006408899.1| hypothetical protein EUTSA_v10002046mg [Eutrema salsugineum]
 gb|ESQ50352.1| hypothetical protein EUTSA_v10002046mg [Eutrema salsugineum]
Length=314

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 156/192 (81%), Gaps = 6/192 (3%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTIL+     + + E++    D   EL+LDGGFVVPK+      GF+AP++N  G SFR 
Sbjct  1    MTILVEHYVTDSIIEEKKKRGD---ELVLDGGFVVPKS--KEADGFDAPDINFLGHSFRD  55

Query  393  Y-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
            Y +  SERQ+ VEEFYR+QHI+QTYDFVK+MR++YG+L+K+EMSIWECCELLN+VVDDSD
Sbjct  56   YENGASERQQGVEEFYRMQHIHQTYDFVKKMRKEYGKLNKMEMSIWECCELLNNVVDDSD  115

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQTAEAIR+DYP + WLHLTALIHDLGKVLL P FG LPQWAVVGDTFP
Sbjct  116  PDLDEPQIQHLLQTAEAIRRDYPDEDWLHLTALIHDLGKVLLLPEFGGLPQWAVVGDTFP  175

Query  36   LGCAFDESIVHH  1
            +GC FD + +HH
Sbjct  176  VGCTFDSANIHH  187



>ref|XP_009148830.1| PREDICTED: inositol oxygenase 1 isoform X1 [Brassica rapa]
Length=308

 Score =   236 bits (601),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -3

Query  459  LMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLD  280
            L+  +GGF AP  NSFG +FR YDA+SER++SVEEFY+  HI QT DFV+RMRE+YG+L+
Sbjct  29   LVLDDGGFVAPHTNSFGHTFRDYDAQSERRRSVEEFYKTNHIGQTVDFVRRMREEYGKLN  88

Query  279  KVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGK  100
            + EMSIWECCELLN+ +D+SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGK
Sbjct  89   RTEMSIWECCELLNEFIDESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGK  148

Query  99   VLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            VLLH SFGELPQWAVVGDT+P+GCAFDESIVHH
Sbjct  149  VLLHSSFGELPQWAVVGDTYPVGCAFDESIVHH  181



>ref|XP_003563752.1| PREDICTED: probable inositol oxygenase [Brachypodium distachyon]
Length=303

 Score =   235 bits (600),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 148/190 (78%), Gaps = 15/190 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTI IIE+P   V  ++    D A EL+LDGGF VP +             N+FG +FR 
Sbjct  1    MTI-IIEQPQFDVAVERKAAGDAA-ELVLDGGFAVPDS-------------NAFGHTFRD  45

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDAESER+K+VEEFYR  HINQTY+FVKRMRE YG+LDK EM IWEC ELLN+ +DDSDP
Sbjct  46   YDAESERKKTVEEFYRSNHINQTYEFVKRMREGYGKLDKTEMGIWECIELLNEFIDDSDP  105

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLD PQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLHP+FGELPQWAVVGDTFP+
Sbjct  106  DLDMPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPTFGELPQWAVVGDTFPV  165

Query  33   GCAFDESIVH  4
            GCAFDE  VH
Sbjct  166  GCAFDECNVH  175



>ref|XP_009381183.1| PREDICTED: probable inositol oxygenase [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381184.1| PREDICTED: probable inositol oxygenase [Musa acuminata subsp. 
malaccensis]
Length=294

 Score =   235 bits (599),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 139/160 (87%), Gaps = 4/160 (3%)
 Frame = -3

Query  468  PKTLMS----SNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMR  301
            PKT ++     NGGF  P+ NSFG +FR Y+AESERQK+VEEFYR+ HI+QTYDFVKR R
Sbjct  8    PKTGVADEAKGNGGFVVPDTNSFGNTFRDYNAESERQKTVEEFYRMNHIHQTYDFVKRTR  67

Query  300  EDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTA  121
            E YG+LD+VEMSIWEC ELLN+ VD+SDPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT 
Sbjct  68   EKYGKLDRVEMSIWECIELLNEFVDESDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTG  127

Query  120  LIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            LIHDLGKVLLH SFGELPQWAVVGDTFP+GCAFDE  VHH
Sbjct  128  LIHDLGKVLLHRSFGELPQWAVVGDTFPVGCAFDECNVHH  167



>ref|XP_010496191.1| PREDICTED: inositol oxygenase 1-like isoform X2 [Camelina sativa]
Length=310

 Score =   235 bits (600),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -3

Query  465  KTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGR  286
            +T +  + GFEAP  NSFG +FR YDAESER++ VEEFYRV HI QT DFV++MR++YG+
Sbjct  29   ETELVLDAGFEAPHTNSFGHTFRDYDAESERRRGVEEFYRVNHIGQTVDFVRKMRQEYGK  88

Query  285  LDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDL  106
            L++ EMSIWECCELLN+ +D+SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDL
Sbjct  89   LNRTEMSIWECCELLNEFIDESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDL  148

Query  105  GKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            GKVLLH SFGELPQWAVVGDT+P+GCAFDESIVHH
Sbjct  149  GKVLLHSSFGELPQWAVVGDTYPVGCAFDESIVHH  183



>ref|XP_008447570.1| PREDICTED: inositol oxygenase 1-like isoform X2 [Cucumis melo]
Length=302

 Score =   235 bits (600),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 153/191 (80%), Gaps = 16/191 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MT+ ++ +  E  EEK     +  +EL+LDGGF+VP               NSFG  FR 
Sbjct  1    MTVTLLVENPEFAEEKGF---NEESELVLDGGFLVPYA-------------NSFGHGFRD  44

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDAESERQ+ VE FY++ HINQT+DFVK +R++YG+L++VEMSIWECCELLNDVVD+SDP
Sbjct  45   YDAESERQEGVESFYKLNHINQTFDFVKNIRKEYGQLNRVEMSIWECCELLNDVVDESDP  104

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQTAEAIRKDYP++ WLHLTALIHDLGKVLL PSFG LPQWAVVGDT+PL
Sbjct  105  DLDEPQIQHLLQTAEAIRKDYPNEDWLHLTALIHDLGKVLLLPSFGGLPQWAVVGDTYPL  164

Query  33   GCAFDESIVHH  1
            GCAFD+SIVHH
Sbjct  165  GCAFDKSIVHH  175



>ref|XP_010496186.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Camelina sativa]
Length=312

 Score =   235 bits (600),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -3

Query  465  KTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGR  286
            +T +  + GFEAP  NSFG +FR YDAESER++ VEEFYRV HI QT DFV++MR++YG+
Sbjct  31   ETELVLDAGFEAPHTNSFGHTFRDYDAESERRRGVEEFYRVNHIGQTVDFVRKMRQEYGK  90

Query  285  LDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDL  106
            L++ EMSIWECCELLN+ +D+SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDL
Sbjct  91   LNRTEMSIWECCELLNEFIDESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDL  150

Query  105  GKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            GKVLLH SFGELPQWAVVGDT+P+GCAFDESIVHH
Sbjct  151  GKVLLHSSFGELPQWAVVGDTYPVGCAFDESIVHH  185



>ref|XP_008805675.1| PREDICTED: probable inositol oxygenase [Phoenix dactylifera]
Length=303

 Score =   235 bits (599),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 153/191 (80%), Gaps = 15/191 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTI I     E  +EK+   +  +NEL+ DGGF              APE N+FGQ+FR 
Sbjct  1    MTIAIEHPEIEEGKEKKI--TTGSNELVPDGGFA-------------APETNAFGQTFRN  45

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+AESER+ SVEEFYR+ HI+QTY+FVK+MRE+Y +L+K +MSIWECCELL++ VD+SDP
Sbjct  46   YEAESERKDSVEEFYRINHIHQTYEFVKKMREEYSKLNKADMSIWECCELLDEFVDESDP  105

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIR+DYP + WLHLTALIHDLGKVLLHP FG+LPQWAVVGDTFP+
Sbjct  106  DLDEPQIQHLLQSAEAIREDYPGEDWLHLTALIHDLGKVLLHPKFGQLPQWAVVGDTFPV  165

Query  33   GCAFDESIVHH  1
            GCAFDESIVH+
Sbjct  166  GCAFDESIVHY  176



>ref|XP_007210179.1| hypothetical protein PRUPE_ppa020229mg [Prunus persica]
 ref|XP_007210788.1| hypothetical protein PRUPE_ppa018672mg [Prunus persica]
 gb|EMJ11378.1| hypothetical protein PRUPE_ppa020229mg [Prunus persica]
 gb|EMJ11987.1| hypothetical protein PRUPE_ppa018672mg [Prunus persica]
Length=282

 Score =   234 bits (597),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -3

Query  450  SNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVE  271
            ++  F +PE+NSFGQSFR Y+AESERQK VEEFYR+ HINQTYDFVK+MRE+Y +L++VE
Sbjct  6    ASDAFISPEINSFGQSFRDYNAESERQKGVEEFYRLNHINQTYDFVKKMREEYSKLNRVE  65

Query  270  MSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLL  91
            MSIWECCELLN+VVDDSDPDLDEPQIEHLLQTAEA+RKDYP++ WLHLTALIHDLGKVLL
Sbjct  66   MSIWECCELLNEVVDDSDPDLDEPQIEHLLQTAEAVRKDYPNEDWLHLTALIHDLGKVLL  125

Query  90   HPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
             P FG LPQWAVVGDT PLGCAFDE+IVHH
Sbjct  126  LPKFGGLPQWAVVGDTHPLGCAFDEAIVHH  155



>ref|XP_004301722.1| PREDICTED: inositol oxygenase 4-like [Fragaria vesca subsp. vesca]
Length=292

 Score =   234 bits (598),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  459  LMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLD  280
            ++ S+  F AP++NSF +SFR Y+AESERQKSVEEFYR+ HINQTYD+VK+MR++Y +LD
Sbjct  13   VVKSSDAFVAPDINSFSKSFRDYNAESERQKSVEEFYRLNHINQTYDYVKKMRDEYKKLD  72

Query  279  KVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGK  100
            +V+MSIWECC LLN+VVD+SDPDLDEPQI+HLLQTAEAIRKDYP++ WLHLTALIHDLGK
Sbjct  73   RVQMSIWECCGLLNEVVDESDPDLDEPQIQHLLQTAEAIRKDYPNEDWLHLTALIHDLGK  132

Query  99   VLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            VLL P FGELPQWAVVGDT PLGCAFDESIVHH
Sbjct  133  VLLLPKFGELPQWAVVGDTHPLGCAFDESIVHH  165



>emb|CDY48730.1| BnaA09g10050D [Brassica napus]
Length=317

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 157/192 (82%), Gaps = 3/192 (2%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MT+L+    ++   E++ +  +  +EL+ DGG VVPK+      GF+AP++N  G SFR 
Sbjct  1    MTVLVEHFTSDSRIEEKKMKDERDDELLWDGGLVVPKS--KEADGFDAPDINFLGHSFRD  58

Query  393  Y-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
            Y +  SERQK VEEFYR+QHI+QTYDFVK MR++YG+L+K++MSIWECCELLN+VVDDSD
Sbjct  59   YENGASERQKGVEEFYRMQHIHQTYDFVKEMRKEYGKLNKMDMSIWECCELLNNVVDDSD  118

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQTAEAIR+DYP++ WLHLTALIHDLGKVLL P FG LPQWAVVGDTFP
Sbjct  119  PDLDEPQIQHLLQTAEAIRRDYPNEDWLHLTALIHDLGKVLLLPEFGGLPQWAVVGDTFP  178

Query  36   LGCAFDESIVHH  1
            +GCAFD + +HH
Sbjct  179  VGCAFDSANIHH  190



>gb|KFK43696.1| hypothetical protein AALP_AA1G161300 [Arabis alpina]
Length=307

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 147/197 (75%), Gaps = 23/197 (12%)
 Frame = -3

Query  573  MTILI------IEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSF  412
            MTILI       +   E VE+ Q     N  EL+LDG FV P T             NSF
Sbjct  1    MTILIDFQSDHNDSGDEIVEKSQG----NVTELVLDGAFVAPHT-------------NSF  43

Query  411  GQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndv  232
            G +FR YDAESER+ SVE FYR  HI QT DFV+R RE+YG+L++ EMSIWECCELLN+ 
Sbjct  44   GHTFRDYDAESERRTSVEHFYRTNHIGQTVDFVRRTREEYGKLNRTEMSIWECCELLNEF  103

Query  231  vddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVV  52
            +D+SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLH SFGELPQWAVV
Sbjct  104  IDESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHTSFGELPQWAVV  163

Query  51   GDTFPLGCAFDESIVHH  1
            GDT+P+GCAFDESIVHH
Sbjct  164  GDTYPVGCAFDESIVHH  180



>ref|XP_006853784.1| hypothetical protein AMTR_s00056p00210540 [Amborella trichopoda]
 gb|ERN15251.1| hypothetical protein AMTR_s00056p00210540 [Amborella trichopoda]
Length=299

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 150/188 (80%), Gaps = 14/188 (7%)
 Frame = -3

Query  564  LIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDA  385
            + I+ P +H E + +V  +   ELILDG              F AP+MN+FG SFR YDA
Sbjct  1    MTIKVPIDHEEHQTSVFDEEKKELILDG--------------FVAPDMNTFGHSFRDYDA  46

Query  384  ESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlD  205
            +SER++SVE+FY++ HI QTY+FV+RMR++YG L++VEMSIWECCELLN+ VD+SDPDLD
Sbjct  47   DSERKRSVEQFYKLSHIYQTYEFVQRMRKEYGSLNRVEMSIWECCELLNEFVDESDPDLD  106

Query  204  EPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCA  25
            EPQIEHLLQTAEAIR+DYP + WLHLT LIHDLGKVLLHPSFG LPQWAVVGDTFP+GC 
Sbjct  107  EPQIEHLLQTAEAIRRDYPDEDWLHLTGLIHDLGKVLLHPSFGALPQWAVVGDTFPVGCR  166

Query  24   FDESIVHH  1
            FDES +H+
Sbjct  167  FDESNIHY  174



>ref|XP_009112634.1| PREDICTED: inositol oxygenase 2-like [Brassica rapa]
Length=317

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 157/192 (82%), Gaps = 3/192 (2%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MT+L+    ++   E++ +  +  +EL+ DGG +VPK+      GF+AP++N  G SFR 
Sbjct  1    MTVLVEHFTSDSRIEEKKMKDERDDELLWDGGLLVPKS--KEADGFDAPDINFLGHSFRD  58

Query  393  Y-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
            Y +  SERQK VEEFYR+QHI+QTYDFVK MR++YG+L+K++MSIWECCELLN+VVDDSD
Sbjct  59   YENGASERQKGVEEFYRMQHIHQTYDFVKEMRKEYGKLNKMDMSIWECCELLNNVVDDSD  118

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQTAEAIR+DYP++ WLHLTALIHDLGKVLL P FG LPQWAVVGDTFP
Sbjct  119  PDLDEPQIQHLLQTAEAIRRDYPNEDWLHLTALIHDLGKVLLLPEFGGLPQWAVVGDTFP  178

Query  36   LGCAFDESIVHH  1
            +GCAFD + +HH
Sbjct  179  VGCAFDSANIHH  190



>ref|XP_004297627.1| PREDICTED: inositol oxygenase 1-like [Fragaria vesca subsp. vesca]
Length=312

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 142/166 (86%), Gaps = 13/166 (8%)
 Frame = -3

Query  498  ELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYD  319
            EL+LDGGF+VP T             NSFGQ+FR YDAE ERQ SVE+FY++ HI+QTYD
Sbjct  31   ELVLDGGFLVPHT-------------NSFGQTFRDYDAEGERQPSVEKFYKINHIHQTYD  77

Query  318  FVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQP  139
            FV+RMR++Y +L++VEMSIWECCELLN+VVD+SDPDLDEPQIEHLLQTAEAIRKDYP++ 
Sbjct  78   FVQRMRKEYSKLNRVEMSIWECCELLNEVVDESDPDLDEPQIEHLLQTAEAIRKDYPNED  137

Query  138  WLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            WLHLT LIHDLGKVLL P FGELPQWAVVGDTFP+GCAFDES VHH
Sbjct  138  WLHLTGLIHDLGKVLLLPCFGELPQWAVVGDTFPVGCAFDESNVHH  183



>gb|KEH18253.1| myo-inositol oxygenase [Medicago truncatula]
Length=270

 Score =   232 bits (592),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 151/194 (78%), Gaps = 19/194 (10%)
 Frame = -3

Query  573  MTILIIEKP---AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQS  403
            MTILI ++P      VE K  V   N  EL+LDGGFV              P+ NSFG +
Sbjct  1    MTILI-DQPDYFGSDVEAKTVVA--NETELVLDGGFV-------------KPQANSFGHT  44

Query  402  FRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdd  223
            FR Y AESERQ+ VE FYR  HI Q++DFVK+MRE+YG+L++VEMSIWECCELLN+VVD+
Sbjct  45   FRDYAAESERQEGVENFYRKNHIYQSFDFVKKMREEYGKLNRVEMSIWECCELLNEVVDE  104

Query  222  sdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDT  43
            SDPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLL PSFG LPQWAVVGDT
Sbjct  105  SDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLLPSFGGLPQWAVVGDT  164

Query  42   FPLGCAFDESIVHH  1
            +P+GC FDESIVHH
Sbjct  165  YPVGCRFDESIVHH  178



>ref|XP_006656167.1| PREDICTED: probable inositol oxygenase-like [Oryza brachyantha]
Length=304

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 148/190 (78%), Gaps = 14/190 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTI I +   +   E++A   D+A EL+LDGGFVVP             E N+FG +FR 
Sbjct  1    MTITIEQPHLDGAGERKAA-GDDAVELVLDGGFVVP-------------ESNAFGNNFRN  46

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YD ESER+++VEEFYR+ HINQTYDFV+RMRE+YGRL + EM +WEC ELLN+ +DDSDP
Sbjct  47   YDEESERKETVEEFYRINHINQTYDFVRRMREEYGRLGRTEMGVWECIELLNEFIDDSDP  106

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLD PQIEHLLQTAEAIRKD+P   WLHLT LIHDLGKVLLHPSFGELPQWAVVGDTFP+
Sbjct  107  DLDMPQIEHLLQTAEAIRKDFPDDDWLHLTGLIHDLGKVLLHPSFGELPQWAVVGDTFPV  166

Query  33   GCAFDESIVH  4
            GCAFDE  VH
Sbjct  167  GCAFDECNVH  176



>ref|XP_010458952.1| PREDICTED: inositol oxygenase 1 isoform X2 [Camelina sativa]
Length=310

 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -3

Query  465  KTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGR  286
            +T +  + GFEAP  NSFG +FR YD ESER++ VEEFYRV HI QT DFV++MR++YG+
Sbjct  29   ETELVLDAGFEAPHTNSFGHTFRDYDVESERRRGVEEFYRVNHIGQTVDFVRKMRDEYGK  88

Query  285  LDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDL  106
            L++ EMSIWECCELLN+ +D+SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDL
Sbjct  89   LNRTEMSIWECCELLNEFIDESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDL  148

Query  105  GKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            GKVLLH SFGELPQWAVVGDT+P+GCAFDESIVHH
Sbjct  149  GKVLLHSSFGELPQWAVVGDTYPVGCAFDESIVHH  183



>ref|XP_010458951.1| PREDICTED: inositol oxygenase 1 isoform X1 [Camelina sativa]
Length=312

 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -3

Query  465  KTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGR  286
            +T +  + GFEAP  NSFG +FR YD ESER++ VEEFYRV HI QT DFV++MR++YG+
Sbjct  31   ETELVLDAGFEAPHTNSFGHTFRDYDVESERRRGVEEFYRVNHIGQTVDFVRKMRDEYGK  90

Query  285  LDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDL  106
            L++ EMSIWECCELLN+ +D+SDPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDL
Sbjct  91   LNRTEMSIWECCELLNEFIDESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDL  150

Query  105  GKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            GKVLLH SFGELPQWAVVGDT+P+GCAFDESIVHH
Sbjct  151  GKVLLHSSFGELPQWAVVGDTYPVGCAFDESIVHH  185



>ref|XP_004966088.1| PREDICTED: probable inositol oxygenase-like [Setaria italica]
Length=305

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 147/190 (77%), Gaps = 13/190 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTI I +   + V E++     N  EL+LDGGF+VP             + N+FG++FR 
Sbjct  1    MTITIEQPQLDAVAERKVAAGANPAELVLDGGFIVP-------------DANAFGKTFRD  47

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDAESER+++VEEFYRV HI QT++FV RMR +YGRLDK EM IWEC ELLN+ VDDSDP
Sbjct  48   YDAESERKETVEEFYRVNHIRQTHEFVSRMRGEYGRLDKTEMGIWECIELLNEFVDDSDP  107

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLD PQIEHLLQTAEAIRKDYP Q WLHLT LIHDLGKVLLHP+FGELPQWAVVGDTFP+
Sbjct  108  DLDMPQIEHLLQTAEAIRKDYPDQDWLHLTGLIHDLGKVLLHPTFGELPQWAVVGDTFPV  167

Query  33   GCAFDESIVH  4
            GCA+DE  VH
Sbjct  168  GCAYDECNVH  177



>ref|XP_009590754.1| PREDICTED: inositol oxygenase 1-like [Nicotiana tomentosiformis]
Length=304

 Score =   233 bits (594),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 151/190 (79%), Gaps = 14/190 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI E+P   ++ ++    DN  EL+LDGGF VP+T             N+FG +FR 
Sbjct  1    MTILI-EQPQFEIQAEEKKFHDNEKELVLDGGFAVPET-------------NAFGHNFRD  46

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+ ES RQ+ VE FY++ HINQTYD++++MRE Y + DK EMSIWECCELLNDVVDDSDP
Sbjct  47   YNVESARQEGVETFYKINHINQTYDYIRKMREKYAKCDKAEMSIWECCELLNDVVDDSDP  106

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGKVLL PSFGELPQWAVVGDT+P+
Sbjct  107  DLDEPQIQHLLQSAEAIRKDYPDEDWLHLTALIHDLGKVLLLPSFGELPQWAVVGDTYPV  166

Query  33   GCAFDESIVH  4
            GCAF++SIVH
Sbjct  167  GCAFNDSIVH  176



>ref|XP_009775832.1| PREDICTED: inositol oxygenase 1-like [Nicotiana sylvestris]
Length=304

 Score =   233 bits (593),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 149/190 (78%), Gaps = 14/190 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI E+P   ++ ++    DN  EL+LDGGF VP+T             N+FG +FR 
Sbjct  1    MTILI-EQPQFEIQAEEKKIYDNEKELVLDGGFAVPET-------------NAFGHNFRD  46

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y  ES RQ+ VE FY++ HINQTYD+VK+MRE Y + DK EMSIWECCELLNDVVDDSDP
Sbjct  47   YTVESARQEGVETFYKINHINQTYDYVKKMREKYAKCDKAEMSIWECCELLNDVVDDSDP  106

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGK LL PSFGELPQWAVVGDT+P+
Sbjct  107  DLDEPQIQHLLQSAEAIRKDYPDEDWLHLTALIHDLGKALLLPSFGELPQWAVVGDTYPV  166

Query  33   GCAFDESIVH  4
            GCAF++SIVH
Sbjct  167  GCAFNDSIVH  176



>ref|XP_009337921.1| PREDICTED: inositol oxygenase 1-like isoform X2 [Pyrus x bretschneideri]
Length=308

 Score =   233 bits (593),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 150/194 (77%), Gaps = 16/194 (8%)
 Frame = -3

Query  573  MTILIIEKP---AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQS  403
            MTILI ++       +E  +    ++  EL LD GFVVP T             NSFGQ+
Sbjct  1    MTILIEQREFGVEVEIEAGERKVLNDEKELALDAGFVVPHT-------------NSFGQT  47

Query  402  FRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdd  223
            FR YD E ERQ SVE FY++ HINQTYDFV+RMR +Y +L++V+MSIWECCELLN+VVD+
Sbjct  48   FRDYDVEGERQPSVENFYQINHINQTYDFVQRMRNEYSKLNRVKMSIWECCELLNEVVDE  107

Query  222  sdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDT  43
            SDPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLL PSFGELPQWAVVGDT
Sbjct  108  SDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLLPSFGELPQWAVVGDT  167

Query  42   FPLGCAFDESIVHH  1
            FP+GCAFD+S VHH
Sbjct  168  FPVGCAFDQSNVHH  181



>gb|KEH18252.1| myo-inositol oxygenase [Medicago truncatula]
Length=305

 Score =   233 bits (593),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 151/194 (78%), Gaps = 19/194 (10%)
 Frame = -3

Query  573  MTILIIEKP---AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQS  403
            MTILI ++P      VE K  V   N  EL+LDGGFV              P+ NSFG +
Sbjct  1    MTILI-DQPDYFGSDVEAKTVVA--NETELVLDGGFV-------------KPQANSFGHT  44

Query  402  FRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdd  223
            FR Y AESERQ+ VE FYR  HI Q++DFVK+MRE+YG+L++VEMSIWECCELLN+VVD+
Sbjct  45   FRDYAAESERQEGVENFYRKNHIYQSFDFVKKMREEYGKLNRVEMSIWECCELLNEVVDE  104

Query  222  sdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDT  43
            SDPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLL PSFG LPQWAVVGDT
Sbjct  105  SDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLLPSFGGLPQWAVVGDT  164

Query  42   FPLGCAFDESIVHH  1
            +P+GC FDESIVHH
Sbjct  165  YPVGCRFDESIVHH  178



>gb|AFK49356.1| unknown [Medicago truncatula]
Length=305

 Score =   233 bits (593),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 151/194 (78%), Gaps = 19/194 (10%)
 Frame = -3

Query  573  MTILIIEKP---AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQS  403
            MTILI ++P      VE K  V   N  EL+LDGGFV              P+ NSFG +
Sbjct  1    MTILI-DQPDYFGSDVEAKTVVA--NETELVLDGGFV-------------KPQANSFGHT  44

Query  402  FRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdd  223
            FR Y AESERQ+ VE FYR  HI Q++DFVK+MRE+YG+L++VEMSIWECCELLN+VVD+
Sbjct  45   FRDYAAESERQEGVENFYRKNHIYQSFDFVKKMREEYGKLNRVEMSIWECCELLNEVVDE  104

Query  222  sdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDT  43
            SDPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLL PSFG LPQWAVVGDT
Sbjct  105  SDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLLPSFGGLPQWAVVGDT  164

Query  42   FPLGCAFDESIVHH  1
            +P+GC FDESIVHH
Sbjct  165  YPVGCRFDESIVHH  178



>ref|XP_008447569.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Cucumis melo]
Length=305

 Score =   233 bits (593),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 155/192 (81%), Gaps = 15/192 (8%)
 Frame = -3

Query  573  MTI-LIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MT+ L++E P   V  ++   ++ + EL+LDGGF+VP               NSFG  FR
Sbjct  1    MTVTLLVENPEFGVAAEEKGFNEES-ELVLDGGFLVPYA-------------NSFGHGFR  46

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAESERQ+ VE FY++ HINQT+DFVK +R++YG+L++VEMSIWECCELLNDVVD+SD
Sbjct  47   DYDAESERQEGVESFYKLNHINQTFDFVKNIRKEYGQLNRVEMSIWECCELLNDVVDESD  106

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQTAEAIRKDYP++ WLHLTALIHDLGKVLL PSFG LPQWAVVGDT+P
Sbjct  107  PDLDEPQIQHLLQTAEAIRKDYPNEDWLHLTALIHDLGKVLLLPSFGGLPQWAVVGDTYP  166

Query  36   LGCAFDESIVHH  1
            LGCAFD+SIVHH
Sbjct  167  LGCAFDKSIVHH  178



>gb|EAZ37359.1| hypothetical protein OsJ_21699 [Oryza sativa Japonica Group]
Length=379

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 140/169 (83%), Gaps = 13/169 (8%)
 Frame = -3

Query  510  DNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHIN  331
            DNA EL+LDGGFVVP +             N+FG +FR Y+AESER+++VEEFYRV H N
Sbjct  96   DNAAELVLDGGFVVPDS-------------NAFGNAFRNYEAESERKETVEEFYRVNHFN  142

Query  330  QTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDY  151
            QTYDFV+RMRE+YGR+DK EM IWEC ELLN+ +DDSDPDLD PQIEHLLQTAEAIRKD+
Sbjct  143  QTYDFVRRMREEYGRVDKTEMGIWECIELLNEFIDDSDPDLDMPQIEHLLQTAEAIRKDF  202

Query  150  PHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVH  4
            P + WLHLT LIHDLGKVLLHPSFGELPQW+VVGDTFP+GCAFDE  VH
Sbjct  203  PDEDWLHLTGLIHDLGKVLLHPSFGELPQWSVVGDTFPVGCAFDECNVH  251



>ref|XP_006413210.1| hypothetical protein EUTSA_v10025773mg [Eutrema salsugineum]
 gb|ESQ54663.1| hypothetical protein EUTSA_v10025773mg [Eutrema salsugineum]
Length=313

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 148/191 (77%), Gaps = 5/191 (3%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTI  IEKP    ++ +    D   EL  DG F +P           APEMN+FG+ FR 
Sbjct  1    MTI-SIEKPIFVTDKNE----DKTGELRSDGRFSMPNIATEEEVALLAPEMNAFGRQFRD  55

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDA+SERQKSVEEFY +QHINQT DFVK+MR +YG+LDK  MSIWECCELLN+VVD+SDP
Sbjct  56   YDAKSERQKSVEEFYSLQHINQTVDFVKKMRAEYGKLDKKVMSIWECCELLNEVVDESDP  115

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWA VGDTFP+
Sbjct  116  DLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQFGGLPQWATVGDTFPV  175

Query  33   GCAFDESIVHH  1
            GCAFDES VHH
Sbjct  176  GCAFDESNVHH  186



>ref|XP_007160263.1| hypothetical protein PHAVU_002G306500g [Phaseolus vulgaris]
 gb|ESW32257.1| hypothetical protein PHAVU_002G306500g [Phaseolus vulgaris]
Length=297

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = -3

Query  480  GFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMR  301
            G  VPK    +  GF AP++NS+G SFR YD ESERQK VEEFYR+QHINQTYDF KRMR
Sbjct  11   GNNVPKNNNEAKDGFMAPDINSYGHSFRDYDVESERQKGVEEFYRLQHINQTYDFAKRMR  70

Query  300  EDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTA  121
            E Y  +DK EM IWECCELLN+VVDD+DPDLDE QI+HLLQ+AEAIRKDYP Q WLHLTA
Sbjct  71   EIYVTMDKAEMGIWECCELLNEVVDDNDPDLDEAQIQHLLQSAEAIRKDYPDQDWLHLTA  130

Query  120  LIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            LIHDLGK+LL P FG LPQWAVVGDTFPLGCAFDES +HH
Sbjct  131  LIHDLGKILLLPRFGALPQWAVVGDTFPLGCAFDESNIHH  170



>ref|XP_003630677.1| Inositol oxygenase [Medicago truncatula]
Length=173

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 148/180 (82%), Gaps = 12/180 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-----EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFG  409
            MTIL+     EHV+     + + V S++ NEL+LDGGF  PK   +S   F APE+N+FG
Sbjct  1    MTILV-----EHVDFGSQFDDKNVHSEDINELVLDGGFPQPKN--ASQNTFFAPEINAFG  53

Query  408  QSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvv  229
             SFR YD ESERQK VEEFYR+QHINQTYDFVK+MRE+Y +LDK EMSIWECCELLN+VV
Sbjct  54   HSFRNYDEESERQKGVEEFYRLQHINQTYDFVKKMREEYKKLDKAEMSIWECCELLNEVV  113

Query  228  ddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVG  49
            D+SDPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGK+LL P FGELPQWAVVG
Sbjct  114  DESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKILLLPKFGELPQWAVVG  173



>ref|XP_009337920.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Pyrus x bretschneideri]
Length=310

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 150/196 (77%), Gaps = 18/196 (9%)
 Frame = -3

Query  573  MTILIIEKP-----AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFG  409
            MTILI ++         +E  +    ++  EL LD GFVVP T             NSFG
Sbjct  1    MTILIEQREFVIGVEVEIEAGERKVLNDEKELALDAGFVVPHT-------------NSFG  47

Query  408  QSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvv  229
            Q+FR YD E ERQ SVE FY++ HINQTYDFV+RMR +Y +L++V+MSIWECCELLN+VV
Sbjct  48   QTFRDYDVEGERQPSVENFYQINHINQTYDFVQRMRNEYSKLNRVKMSIWECCELLNEVV  107

Query  228  ddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVG  49
            D+SDPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLL PSFGELPQWAVVG
Sbjct  108  DESDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLLPSFGELPQWAVVG  167

Query  48   DTFPLGCAFDESIVHH  1
            DTFP+GCAFD+S VHH
Sbjct  168  DTFPVGCAFDQSNVHH  183



>ref|XP_007221110.1| hypothetical protein PRUPE_ppa017891mg, partial [Prunus persica]
 gb|EMJ22309.1| hypothetical protein PRUPE_ppa017891mg, partial [Prunus persica]
Length=280

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  459  LMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLD  280
            +++S+  F APE+NS+G+SFR Y+ E+ERQ+SVEEFYR+ HINQ YDFVKRMRE+Y +L+
Sbjct  1    VVASSDAFIAPEINSYGKSFRDYNVENERQRSVEEFYRLNHINQIYDFVKRMREEYKKLN  60

Query  279  KVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGK  100
            +VEMSIWECCELLN+VVDDSDP LDEPQIEHLLQTAEAIRKDYP++ WLHLTALIHDLGK
Sbjct  61   RVEMSIWECCELLNEVVDDSDPKLDEPQIEHLLQTAEAIRKDYPNEDWLHLTALIHDLGK  120

Query  99   VLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            VL+ PSFG LPQW VVGDT PLGC FDE IVHH
Sbjct  121  VLMLPSFGGLPQWVVVGDTHPLGCGFDEYIVHH  153



>ref|XP_008244738.1| PREDICTED: inositol oxygenase 1-like [Prunus mume]
Length=309

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -3

Query  465  KTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGR  286
            K L+  +G F  P  NSFGQ+FR YDAE ERQ SVE FY++ HINQTYDFV+RMRE+Y +
Sbjct  28   KELVLDDGLFVVPHTNSFGQTFRDYDAEGERQPSVEIFYQINHINQTYDFVQRMREEYSK  87

Query  285  LDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDL  106
            L++VEMSIWECCELLN+VVD+SDPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDL
Sbjct  88   LNRVEMSIWECCELLNEVVDESDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDL  147

Query  105  GKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            GKVLL PSFGELPQWAVVGDTFP+GCAFD++ VHH
Sbjct  148  GKVLLLPSFGELPQWAVVGDTFPVGCAFDQANVHH  182



>ref|XP_010312510.1| PREDICTED: inositol oxygenase 1-like isoform X1 [Solanum lycopersicum]
Length=251

 Score =   229 bits (583),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  450  SNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVE  271
            S+G F  P  N+FG SFR Y+AE+ERQK V E YR  HINQTYDFVK+MRE+YG+++KVE
Sbjct  19   SDGIFVVPGNNAFGNSFRDYNAEAERQKIVRELYRQSHINQTYDFVKKMREEYGKMNKVE  78

Query  270  MSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLL  91
            MSIWECCELLN+VVDDSDPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLL
Sbjct  79   MSIWECCELLNEVVDDSDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLL  138

Query  90   HPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
             PSFG LPQWAVVGDTFPLGCAFDESIV H
Sbjct  139  LPSFGGLPQWAVVGDTFPLGCAFDESIVLH  168



>ref|XP_007024361.1| Myo-inositol oxygenase 1 isoform 1 [Theobroma cacao]
 gb|EOY26983.1| Myo-inositol oxygenase 1 isoform 1 [Theobroma cacao]
Length=304

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 149/191 (78%), Gaps = 14/191 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI ++P   VE       +    ++LDGGF+VP+T             NSFG +FR 
Sbjct  1    MTILI-DQPEFGVEAGFDKVDNVEKGMVLDGGFMVPQT-------------NSFGHTFRD  46

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y  ESERQ+ VE FYR  HINQTYDFVKRMR+++G+L+KVE+SIWECCELLNDVVD+SDP
Sbjct  47   YHVESERQQGVENFYRTNHINQTYDFVKRMRKEHGKLNKVELSIWECCELLNDVVDESDP  106

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQIEHLLQTAEAIRKDYP + WLHL  L+HDLGKVLLHP FG LPQWAVVGDT+P+
Sbjct  107  DLDEPQIEHLLQTAEAIRKDYPDEDWLHLAGLVHDLGKVLLHPGFGGLPQWAVVGDTYPV  166

Query  33   GCAFDESIVHH  1
            GCAFD++IVHH
Sbjct  167  GCAFDKTIVHH  177



>ref|XP_011078224.1| PREDICTED: inositol oxygenase 2-like [Sesamum indicum]
Length=295

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  456  MSSNGGFEAPEMNSFGQSFRAY-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLD  280
            M S G FEAP++N+FGQ+FR Y + ESERQKSVEEFYR  HINQT DFVK+M E Y +LD
Sbjct  16   MESKGVFEAPQVNAFGQTFRDYTNVESERQKSVEEFYRQNHINQTVDFVKKMIEQYSKLD  75

Query  279  KVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGK  100
            K EMSIWECCELLN VVDDSDPDLDEPQI+HLLQ+AEA RKDYP++ WLHLTALIHDLGK
Sbjct  76   KTEMSIWECCELLNQVVDDSDPDLDEPQIQHLLQSAEAARKDYPNEDWLHLTALIHDLGK  135

Query  99   VLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            VL  PSFG+LPQWAVVGDTFP+GCAFDESIVHH
Sbjct  136  VLCLPSFGQLPQWAVVGDTFPVGCAFDESIVHH  168



>ref|XP_007024363.1| Myo-inositol oxygenase 1 isoform 3 [Theobroma cacao]
 gb|EOY26985.1| Myo-inositol oxygenase 1 isoform 3 [Theobroma cacao]
Length=227

 Score =   227 bits (578),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 138/165 (84%), Gaps = 13/165 (8%)
 Frame = -3

Query  495  LILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDF  316
            ++LDGGF+VP+T             NSFG +FR Y  ESERQ+ VE FYR  HINQTYDF
Sbjct  1    MVLDGGFMVPQT-------------NSFGHTFRDYHVESERQQGVENFYRTNHINQTYDF  47

Query  315  VKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPW  136
            VKRMR+++G+L+KVE+SIWECCELLNDVVD+SDPDLDEPQIEHLLQTAEAIRKDYP + W
Sbjct  48   VKRMRKEHGKLNKVELSIWECCELLNDVVDESDPDLDEPQIEHLLQTAEAIRKDYPDEDW  107

Query  135  LHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            LHL  L+HDLGKVLLHP FG LPQWAVVGDT+P+GCAFD++IVHH
Sbjct  108  LHLAGLVHDLGKVLLHPGFGGLPQWAVVGDTYPVGCAFDKTIVHH  152



>gb|AFK33557.1| unknown [Lotus japonicus]
Length=274

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 151/193 (78%), Gaps = 17/193 (9%)
 Frame = -3

Query  573  MTILIIEKPAEHVE--EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTI II++P       E + VP D   EL+LDGGFV+P T             NSFG +F
Sbjct  1    MTI-IIDQPDHFGSDVEGKTVPIDEK-ELVLDGGFVMPHT-------------NSFGHTF  45

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R Y+AESERQ+ VE FYR  HI Q+ DFVK+MRE+YG+L++VEMS+WECCELLN+VVD+S
Sbjct  46   RDYNAESERQEGVENFYRKNHIYQSVDFVKKMREEYGKLNRVEMSMWECCELLNEVVDES  105

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLL P FG LPQWAVVGDTF
Sbjct  106  DPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLLPVFGGLPQWAVVGDTF  165

Query  39   PLGCAFDESIVHH  1
            P+GC FDESIVHH
Sbjct  166  PVGCRFDESIVHH  178



>ref|XP_009124813.1| PREDICTED: inositol oxygenase 4 [Brassica rapa]
Length=309

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 147/191 (77%), Gaps = 9/191 (5%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTI I +   E V   Q    +N  +L +             +  F APEMN+FG+ FR 
Sbjct  1    MTISIDKPMFEEVSAFQKKSENNTRDLTMAS---------EHDEAFLAPEMNAFGRQFRN  51

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDAE+ERQKSVEEFYR+QHINQT DFVK+MR +YG+LDK+ MSIWECCELLNDVVD+SDP
Sbjct  52   YDAENERQKSVEEFYRLQHINQTVDFVKKMRAEYGKLDKMVMSIWECCELLNDVVDESDP  111

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWA VGDTFP+
Sbjct  112  DLDEPQIQHLLQSAEAIRKDYPNEEWLHLTALIHDLGKVITLPQFGGLPQWATVGDTFPV  171

Query  33   GCAFDESIVHH  1
            GCAFDES VHH
Sbjct  172  GCAFDESNVHH  182



>emb|CDY42748.1| BnaA03g47910D [Brassica napus]
Length=310

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 149/193 (77%), Gaps = 12/193 (6%)
 Frame = -3

Query  573  MTILIIEKP--AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTI  IEKP   E V   Q    +N  +L +             +  F APEMN+FG+ F
Sbjct  1    MTI-SIEKPMFVEEVSAFQKKSENNTRDLTMAS---------EHDEAFLAPEMNAFGRQF  50

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R YDAE+ERQKSVEEFYR+QHINQT DFVK+MR +YG+LDK+ MSIWECCELLNDVVD+S
Sbjct  51   RNYDAENERQKSVEEFYRLQHINQTVDFVKKMRAEYGKLDKMVMSIWECCELLNDVVDES  110

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWA VGDTF
Sbjct  111  DPDLDEPQIQHLLQSAEAIRKDYPNEEWLHLTALIHDLGKVITLPQFGGLPQWATVGDTF  170

Query  39   PLGCAFDESIVHH  1
            P+GCAFDES VHH
Sbjct  171  PVGCAFDESNVHH  183



>ref|XP_007024364.1| Myo-inositol oxygenase 1 isoform 4 [Theobroma cacao]
 gb|EOY26986.1| Myo-inositol oxygenase 1 isoform 4 [Theobroma cacao]
Length=250

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 138/165 (84%), Gaps = 13/165 (8%)
 Frame = -3

Query  495  LILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDF  316
            ++LDGGF+VP+T             NSFG +FR Y  ESERQ+ VE FYR  HINQTYDF
Sbjct  1    MVLDGGFMVPQT-------------NSFGHTFRDYHVESERQQGVENFYRTNHINQTYDF  47

Query  315  VKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPW  136
            VKRMR+++G+L+KVE+SIWECCELLNDVVD+SDPDLDEPQIEHLLQTAEAIRKDYP + W
Sbjct  48   VKRMRKEHGKLNKVELSIWECCELLNDVVDESDPDLDEPQIEHLLQTAEAIRKDYPDEDW  107

Query  135  LHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            LHL  L+HDLGKVLLHP FG LPQWAVVGDT+P+GCAFD++IVHH
Sbjct  108  LHLAGLVHDLGKVLLHPGFGGLPQWAVVGDTYPVGCAFDKTIVHH  152



>emb|CDX92758.1| BnaC07g40160D [Brassica napus]
Length=310

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 149/193 (77%), Gaps = 12/193 (6%)
 Frame = -3

Query  573  MTILIIEKP--AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTI  IEKP   E V   Q    +N  +L +             +  F APEMN+FG+ F
Sbjct  1    MTI-SIEKPMFVEEVSAFQKKSENNTGDLTMAS---------EHDEAFLAPEMNAFGRQF  50

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R YDAE+ERQKSVEEFYR+QHINQT DFVK+MR +YG+LDK+ MSIWECCELLNDVVD+S
Sbjct  51   RNYDAENERQKSVEEFYRLQHINQTVDFVKKMRAEYGKLDKMVMSIWECCELLNDVVDES  110

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P FG LPQWA VGDTF
Sbjct  111  DPDLDEPQIQHLLQSAEAIRKDYPNEEWLHLTALIHDLGKVITLPQFGGLPQWATVGDTF  170

Query  39   PLGCAFDESIVHH  1
            P+GCAFDES VHH
Sbjct  171  PVGCAFDESNVHH  183



>ref|XP_010312511.1| PREDICTED: probable inositol oxygenase isoform X2 [Solanum lycopersicum]
Length=296

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  450  SNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVE  271
            S+G F  P  N+FG SFR Y+AE+ERQK V E YR  HINQTYDFVK+MRE+YG+++KVE
Sbjct  20   SDGIFVVPGNNAFGNSFRDYNAEAERQKIVRELYRQSHINQTYDFVKKMREEYGKMNKVE  79

Query  270  MSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLL  91
            MSIWECCELLN+VVDDSDPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLL
Sbjct  80   MSIWECCELLNEVVDDSDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLL  139

Query  90   HPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
             PSFG LPQWAVVGDTFPLGCAFDESIV H
Sbjct  140  LPSFGGLPQWAVVGDTFPLGCAFDESIVLH  169



>ref|XP_011078222.1| PREDICTED: inositol oxygenase 1-like [Sesamum indicum]
Length=298

 Score =   228 bits (581),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  456  MSSNGGFEAPEMNSFGQSFRAYD-AESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLD  280
            + S G FEAPE+N+FGQ+FR Y+  ESERQKSVEEFYR+ HI+Q+ DFVK+MRE+Y + +
Sbjct  19   VESKGAFEAPEINAFGQTFRDYNNVESERQKSVEEFYRLNHISQSVDFVKKMREEYSKFN  78

Query  279  KVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGK  100
            + EMSIWECCELLN VVD SDPDLDEPQI+HLLQ+AEA RKDYP++ WLHLT LIHDLGK
Sbjct  79   RTEMSIWECCELLNQVVDKSDPDLDEPQIQHLLQSAEAARKDYPNEDWLHLTCLIHDLGK  138

Query  99   VLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            VL  PSFGELPQWAVVGDTFP+GCAFDESIVHH
Sbjct  139  VLCLPSFGELPQWAVVGDTFPVGCAFDESIVHH  171



>gb|AFK34985.1| unknown [Lotus japonicus]
Length=305

 Score =   228 bits (581),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 151/193 (78%), Gaps = 17/193 (9%)
 Frame = -3

Query  573  MTILIIEKPAEHVE--EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTI II++P       E + VP D   EL+LDGGFV+P T             NSFG +F
Sbjct  1    MTI-IIDQPDHFGSDVEGKTVPIDEK-ELVLDGGFVMPHT-------------NSFGHTF  45

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R Y+AESERQ+ VE FYR  HI Q+ DFVK+MRE+YG+L++VEMS+WECCELLN+VVD+S
Sbjct  46   RDYNAESERQEGVENFYRKNHIYQSVDFVKKMREEYGKLNRVEMSMWECCELLNEVVDES  105

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKVLL P FG LPQWAVVGDTF
Sbjct  106  DPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLLPVFGGLPQWAVVGDTF  165

Query  39   PLGCAFDESIVHH  1
            P+GC FDESI+HH
Sbjct  166  PVGCRFDESIIHH  178



>ref|XP_010924624.1| PREDICTED: inositol oxygenase 1-like [Elaeis guineensis]
Length=301

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  456  MSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDK  277
            + SN GF  P  N+FG +FR Y+A SER+ +VEEFYR QH+ QT +FVK+MRE+YG+L+K
Sbjct  23   LVSNAGFVVPGNNAFGNTFRDYEANSERKDTVEEFYRKQHMYQTVEFVKKMREEYGKLNK  82

Query  276  VEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKV  97
             EMSIWECCELLN+ VD+SDPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGKV
Sbjct  83   AEMSIWECCELLNEFVDESDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKV  142

Query  96   LLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            LLHPSFG+LPQWAVVGDTFP+GCAFDES VHH
Sbjct  143  LLHPSFGQLPQWAVVGDTFPVGCAFDESNVHH  174



>gb|EMT27791.1| Putative inositol oxygenase [Aegilops tauschii]
Length=392

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 136/165 (82%), Gaps = 13/165 (8%)
 Frame = -3

Query  498  ELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYD  319
            EL+LDGGF VP +             N+FG +FR YDAESER+K+VEEFY V HINQTY+
Sbjct  113  ELVLDGGFTVPDS-------------NAFGHTFRDYDAESERKKTVEEFYSVNHINQTYE  159

Query  318  FVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQP  139
            FV+RMR+ YGRLDK EMSIWEC ELLN+ +DDSDPDLD PQIEHLLQTAEAIRKDYP + 
Sbjct  160  FVQRMRDAYGRLDKTEMSIWECIELLNEFIDDSDPDLDMPQIEHLLQTAEAIRKDYPDED  219

Query  138  WLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVH  4
            WLHLT LIHDLGKVLLHPSFGELPQWAVVGDTFP+GCAFDE  VH
Sbjct  220  WLHLTGLIHDLGKVLLHPSFGELPQWAVVGDTFPVGCAFDECNVH  264



>ref|XP_007024359.1| Myo-inositol oxygenase 1 [Theobroma cacao]
 gb|EOY26981.1| Myo-inositol oxygenase 1 [Theobroma cacao]
Length=284

 Score =   227 bits (579),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 146/188 (78%), Gaps = 14/188 (7%)
 Frame = -3

Query  564  LIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDA  385
            ++I++P E +E       +   E++ DGGF+VP+T             NSFG +FR Y  
Sbjct  3    ILIDQP-EFLEAGFNKVDNVEKEMVFDGGFMVPQT-------------NSFGYTFRDYHV  48

Query  384  ESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlD  205
            ESERQ+ VE FYR  HINQTYDFVKRMR++YG+L+KV MSIWECCELLNDVVD+SDPDLD
Sbjct  49   ESERQQGVENFYRTNHINQTYDFVKRMRKEYGKLNKVGMSIWECCELLNDVVDESDPDLD  108

Query  204  EPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCA  25
            EPQIEHLLQTAEAIRKDYP + WLHL   +HDLGKVLLHPSF  LPQWAVVGDT+P+GCA
Sbjct  109  EPQIEHLLQTAEAIRKDYPDEDWLHLAGFVHDLGKVLLHPSFEGLPQWAVVGDTYPVGCA  168

Query  24   FDESIVHH  1
            FD+SIVHH
Sbjct  169  FDKSIVHH  176



>emb|CDY03334.1| BnaC09g10140D [Brassica napus]
Length=317

 Score =   228 bits (580),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 154/192 (80%), Gaps = 3/192 (2%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MT+L+    ++   E++ +  +  +E++ D G VV K+      GF+AP++N  G SFR 
Sbjct  1    MTVLVEHFTSDSRIEEKKMKDERDDEVLWDTGLVVSKS--KEADGFDAPDINFLGHSFRD  58

Query  393  Y-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
            Y +  SERQK VEEFYR+QHI+QTYDFVK MR++YG+L+K++MSIWECCELLN+VVDDSD
Sbjct  59   YENGASERQKGVEEFYRMQHIHQTYDFVKEMRKEYGKLNKMDMSIWECCELLNNVVDDSD  118

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQTAEAIR+DYP + WLHLTALIHDLGKVLL P FG LPQWAVVGDTFP
Sbjct  119  PDLDEPQIQHLLQTAEAIRRDYPKEDWLHLTALIHDLGKVLLLPEFGGLPQWAVVGDTFP  178

Query  36   LGCAFDESIVHH  1
            +GCAFD + +HH
Sbjct  179  VGCAFDSANIHH  190



>ref|NP_001141330.1| uncharacterized protein LOC100273421 [Zea mays]
 gb|ACF78953.1| unknown [Zea mays]
 gb|ACF86090.1| unknown [Zea mays]
 gb|ACR37619.1| unknown [Zea mays]
 gb|ACR38135.1| unknown [Zea mays]
 gb|AFW86643.1| hypothetical protein ZEAMMB73_073834 [Zea mays]
Length=305

 Score =   227 bits (579),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 145/190 (76%), Gaps = 13/190 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTI I +   + V E++     +  EL+LD GFVVP             + N+FG +FR 
Sbjct  1    MTITIEQPQLDAVAERKVPGGGDPAELVLDAGFVVP-------------DANAFGNTFRD  47

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDAESER+++VEEFYRV H+ QT++FV RMR +YGRLDK EM IWEC ELLN+ +DDSDP
Sbjct  48   YDAESERKQTVEEFYRVNHVRQTHEFVARMRAEYGRLDKTEMGIWECIELLNEFIDDSDP  107

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLD PQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLHPSFGELPQWAVVGDTFP+
Sbjct  108  DLDMPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPSFGELPQWAVVGDTFPV  167

Query  33   GCAFDESIVH  4
            GCA+DE  VH
Sbjct  168  GCAYDECNVH  177



>ref|XP_009102135.1| PREDICTED: inositol oxygenase 2 [Brassica rapa]
Length=312

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 150/192 (78%), Gaps = 8/192 (4%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MT+L+     EH      +      E   DGGF+VPK+  +    F+AP++N  G SFR 
Sbjct  1    MTVLV-----EHYVSDSRIEEKKTKEERGDGGFMVPKSKETDE--FDAPDINFLGHSFRD  53

Query  393  Y-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
            Y + ESERQ+ VEEFYR+QHI+QTYDFVK MR++YG+L+K+EMSIWECCE LN+VVD+SD
Sbjct  54   YENGESERQQGVEEFYRMQHIHQTYDFVKDMRKEYGKLNKMEMSIWECCEQLNNVVDESD  113

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQTAEAIRKDYP++ WLHLTALIHDLGKVLL P FG LPQWAVVGDTFP
Sbjct  114  PDLDEPQIQHLLQTAEAIRKDYPNEDWLHLTALIHDLGKVLLLPEFGGLPQWAVVGDTFP  173

Query  36   LGCAFDESIVHH  1
            +GC FD + +HH
Sbjct  174  VGCTFDPANIHH  185



>emb|CDX82723.1| BnaC07g01430D [Brassica napus]
Length=312

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 151/192 (79%), Gaps = 8/192 (4%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MT+L+     EH      +      E   DGGF+VPK+  +    F+AP++N  G SFR 
Sbjct  1    MTVLV-----EHYVSDSRIEEKKTKEERGDGGFMVPKSKETDE--FDAPDINFLGHSFRD  53

Query  393  Y-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
            Y + ESERQ+ VEEFYR+QHI+QTYDFVK MR++YG+L+K+EMSIWECCELLN+VVD+SD
Sbjct  54   YENGESERQQGVEEFYRMQHIHQTYDFVKDMRKEYGKLNKMEMSIWECCELLNNVVDESD  113

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQTAEAIRKDYP++ WLHLTALIHDLGKVLL P FG LPQWAVVGDTFP
Sbjct  114  PDLDEPQIQHLLQTAEAIRKDYPNEDWLHLTALIHDLGKVLLLPEFGGLPQWAVVGDTFP  173

Query  36   LGCAFDESIVHH  1
            +GC FD + +HH
Sbjct  174  VGCTFDPASIHH  185



>ref|XP_007215726.1| hypothetical protein PRUPE_ppa009023mg [Prunus persica]
 gb|EMJ16925.1| hypothetical protein PRUPE_ppa009023mg [Prunus persica]
Length=309

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -3

Query  459  LMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLD  280
            L+  +G F  P  NSFGQ+FR YDAE ERQ SVE FY++ HINQTYDFV+RMR++Y +L+
Sbjct  30   LVLDDGLFVVPHTNSFGQTFRDYDAEGERQPSVEIFYQINHINQTYDFVQRMRKEYSKLN  89

Query  279  KVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGK  100
            +VEMSIWECCELLN+VVD+SDPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGK
Sbjct  90   RVEMSIWECCELLNEVVDESDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGK  149

Query  99   VLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            VLL PSFGELPQWAVVGDTFP+GC+FD++ VHH
Sbjct  150  VLLLPSFGELPQWAVVGDTFPVGCSFDQANVHH  182



>ref|XP_010322859.1| PREDICTED: inositol oxygenase 1 [Solanum lycopersicum]
Length=305

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 145/190 (76%), Gaps = 13/190 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI + P E   ++  + + N  EL+L  GF VP+T             N+FG +FR 
Sbjct  1    MTILIEQLPVEIQADETNIHAQNQKELVLGDGFAVPET-------------NAFGHNFRD  47

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y  ES RQ+ VE FY++ H NQTYD+V +MR +Y +LDK EMSIWECCELLNDVVDDSDP
Sbjct  48   YTVESARQQGVENFYKINHFNQTYDYVSKMRVEYAKLDKAEMSIWECCELLNDVVDDSDP  107

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGKVLL PSFGELPQWAVVGDTFP+
Sbjct  108  DLDEPQIQHLLQSAEAIRKDYPDEDWLHLTALIHDLGKVLLLPSFGELPQWAVVGDTFPV  167

Query  33   GCAFDESIVH  4
            GCAF +SIVH
Sbjct  168  GCAFHDSIVH  177



>emb|CDY35889.1| BnaA07g00980D [Brassica napus]
Length=312

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 151/192 (79%), Gaps = 8/192 (4%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MT+L+     EH      +      E   DGGF+VPK+  +    F+AP++N  G SFR 
Sbjct  1    MTVLV-----EHYVSDSRIEEKKTKEERGDGGFMVPKSKETDE--FDAPDINFLGHSFRD  53

Query  393  Y-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
            Y + ESERQ+ VEEFYR+QHI+QTYDFVK MR++YG+L+K+EMSIWECCELLN+VVD+SD
Sbjct  54   YENGESERQQGVEEFYRMQHIHQTYDFVKDMRKEYGKLNKMEMSIWECCELLNNVVDESD  113

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQTAEAIRKDYP++ WLHLTALIHDLGKVLL P FG LPQWAVVGDTFP
Sbjct  114  PDLDEPQIQHLLQTAEAIRKDYPNEDWLHLTALIHDLGKVLLLPEFGGLPQWAVVGDTFP  173

Query  36   LGCAFDESIVHH  1
            +GC FD + +HH
Sbjct  174  VGCTFDPANIHH  185



>ref|XP_010433529.1| PREDICTED: inositol oxygenase 4-like isoform X5 [Camelina sativa]
 ref|XP_010433530.1| PREDICTED: inositol oxygenase 4-like isoform X5 [Camelina sativa]
Length=281

 Score =   224 bits (572),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  441  GFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSI  262
             F AP+MN+FG+ FR YDAESERQKSV+EFYR+QHINQT DFV +MR +YG+LDK  MSI
Sbjct  8    AFLAPDMNAFGRQFRDYDAESERQKSVQEFYRLQHINQTVDFVTKMRAEYGKLDKKVMSI  67

Query  261  WECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPS  82
            WECCELLN+VVD+SDPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P 
Sbjct  68   WECCELLNEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQ  127

Query  81   FGELPQWAVVGDTFPLGCAFDESIVHH  1
            FG LPQWAVVGDTFP+GCAFDES VHH
Sbjct  128  FGGLPQWAVVGDTFPVGCAFDESNVHH  154



>ref|XP_010443316.1| PREDICTED: inositol oxygenase 5-like [Camelina sativa]
Length=315

 Score =   225 bits (574),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 145/179 (81%), Gaps = 2/179 (1%)
 Frame = -3

Query  534  EEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAY-DAESERQKSVE  358
            E + +  +    EL LD G  + K + S +  F APEMN+FG+ FR Y DA+SERQK VE
Sbjct  11   EYEDSTTNKKIGELQLDSGIPMSK-ISSDDEVFLAPEMNAFGRQFRDYADAKSERQKGVE  69

Query  357  EFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQ  178
             FY+ QH NQT DFVK+MR +YG+LDK+ M+IWECCELLN+VVD+SDPDLDEPQI+HLLQ
Sbjct  70   HFYKTQHTNQTVDFVKKMRSEYGKLDKMVMNIWECCELLNEVVDESDPDLDEPQIQHLLQ  129

Query  177  TAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            +AEAIRKDYP++ WLHLTALIHDLGKVL  P FGELPQWAVVGDTFP+GCAFDES VHH
Sbjct  130  SAEAIRKDYPNEDWLHLTALIHDLGKVLTLPQFGELPQWAVVGDTFPVGCAFDESNVHH  188



>ref|XP_004510326.1| PREDICTED: inositol oxygenase 1-like [Cicer arietinum]
Length=305

 Score =   224 bits (572),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 148/191 (77%), Gaps = 13/191 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI +      + +    + N  EL+LDG FV+P               NSFG +FR 
Sbjct  1    MTILIDQPDYFGSDVEAKTVAVNERELVLDGEFVIPHA-------------NSFGHTFRD  47

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDAESER++ VE FYR  HI Q++DFVK+MRE+YG+L++VEMSIWECCELLN+VVD+SDP
Sbjct  48   YDAESERREGVENFYRKNHIYQSFDFVKKMREEYGKLNRVEMSIWECCELLNEVVDESDP  107

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQIEHLLQTAEAIRK+YP++ WLHLT LIHDLGKVLL PSFG LPQWAVVGDT+P+
Sbjct  108  DLDEPQIEHLLQTAEAIRKEYPNEDWLHLTGLIHDLGKVLLLPSFGGLPQWAVVGDTYPV  167

Query  33   GCAFDESIVHH  1
            GC FDESIVH+
Sbjct  168  GCRFDESIVHN  178



>gb|AFW86646.1| hypothetical protein ZEAMMB73_073834 [Zea mays]
Length=304

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 141/181 (78%), Gaps = 13/181 (7%)
 Frame = -3

Query  546  AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQK  367
            A+ V E++     +  EL+LD GFVVP             + N+FG +FR YDAESER++
Sbjct  9    ADAVAERKVPGGGDPAELVLDAGFVVP-------------DANAFGNTFRDYDAESERKQ  55

Query  366  SVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEH  187
            +VEEFYRV H+ QT++FV RMR +YGRLDK EM IWEC ELLN+ +DDSDPDLD PQIEH
Sbjct  56   TVEEFYRVNHVRQTHEFVARMRAEYGRLDKTEMGIWECIELLNEFIDDSDPDLDMPQIEH  115

Query  186  LLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIV  7
            LLQTAEAIRKDYP + WLHLT LIHDLGKVLLHPSFGELPQWAVVGDTFP+GCA+DE  V
Sbjct  116  LLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPSFGELPQWAVVGDTFPVGCAYDECNV  175

Query  6    H  4
            H
Sbjct  176  H  176



>ref|XP_010451346.1| PREDICTED: inositol oxygenase 5-like [Camelina sativa]
Length=315

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 146/180 (81%), Gaps = 4/180 (2%)
 Frame = -3

Query  534  EEKQAVPSDNANELILDGGFVVPKTLMSSNGG-FEAPEMNSFGQSFRAY-DAESERQKSV  361
            E + +  +    EL LD G  VP + +SS+   F APEMN+FG+ FR Y D +SERQK V
Sbjct  11   EYEDSTTNKKTGELQLDSG--VPMSKISSDDEVFLAPEMNAFGRQFRDYADTKSERQKGV  68

Query  360  EEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLL  181
            E FY+ QH NQT DFVK+MR +YG+LDK+ M+IWECCELLN+VVD+SDPDLDEPQI+HLL
Sbjct  69   ELFYKTQHTNQTVDFVKKMRSEYGKLDKMVMNIWECCELLNEVVDESDPDLDEPQIQHLL  128

Query  180  QTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            Q+AEAIRKDYP++ WLHLTALIHDLGKVL  P FGELPQWAVVGDTFP+GCAFDES VHH
Sbjct  129  QSAEAIRKDYPNEDWLHLTALIHDLGKVLTLPQFGELPQWAVVGDTFPVGCAFDESNVHH  188



>gb|ACR38420.1| unknown [Zea mays]
Length=302

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 141/181 (78%), Gaps = 13/181 (7%)
 Frame = -3

Query  546  AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQK  367
            A+ V E++     +  EL+LD GFVVP             + N+FG +FR YDAESER++
Sbjct  7    ADAVAERKVPGGGDPAELVLDAGFVVP-------------DANAFGNTFRDYDAESERKQ  53

Query  366  SVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEH  187
            +VEEFYRV H+ QT++FV RMR +YGRLDK EM IWEC ELLN+ +DDSDPDLD PQIEH
Sbjct  54   TVEEFYRVNHVRQTHEFVARMRAEYGRLDKTEMGIWECIELLNEFIDDSDPDLDMPQIEH  113

Query  186  LLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIV  7
            LLQTAEAIRKDYP + WLHLT LIHDLGKVLLHPSFGELPQWAVVGDTFP+GCA+DE  V
Sbjct  114  LLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPSFGELPQWAVVGDTFPVGCAYDECNV  173

Query  6    H  4
            H
Sbjct  174  H  174



>gb|AFW90597.1| Myo-inositol oxygenase [Solanum tuberosum]
Length=304

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 145/191 (76%), Gaps = 14/191 (7%)
 Frame = -3

Query  573  MTILIIEKPAE-HVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTILI + P E   +E     + N  EL+L  GF VP+T             N+FG +FR
Sbjct  1    MTILIEQLPVEIQADETNIHHAQNQKELVLVDGFAVPQT-------------NAFGHNFR  47

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             Y  ES RQ+ VE FY++ H NQTYD+V +MR +Y +LDK EMSIWECCELLNDVVDDSD
Sbjct  48   DYTVESARQQGVEFFYKINHFNQTYDYVSKMRVEYAKLDKAEMSIWECCELLNDVVDDSD  107

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKVLL PSFGELPQWAVVGDTFP
Sbjct  108  PDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVLLLPSFGELPQWAVVGDTFP  167

Query  36   LGCAFDESIVH  4
            +GCAF +SIVH
Sbjct  168  VGCAFHDSIVH  178



>gb|ABK24160.1| unknown [Picea sitchensis]
Length=316

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  459  LMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLD  280
            ++  +GGF  P+ N+FG SFR YD ESER+  V+EFYR+ HINQTY++V   RE YG+LD
Sbjct  37   ILQLDGGFVTPDSNAFGHSFRDYDKESERRAGVQEFYRINHINQTYEYVLSKREHYGKLD  96

Query  279  KVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGK  100
            K  MSIWECCELLN+ VD+SDPDLDEPQIEHLLQTAEAIRKDYP++ WLHLT LIHDLGK
Sbjct  97   KAVMSIWECCELLNEFVDESDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGK  156

Query  99   VLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            VLLHPSFGE PQWA VGDT+PLGCAFDESIVH+
Sbjct  157  VLLHPSFGEEPQWAAVGDTYPLGCAFDESIVHY  189



>ref|XP_002866159.1| hypothetical protein ARALYDRAFT_495755 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42418.1| hypothetical protein ARALYDRAFT_495755 [Arabidopsis lyrata subsp. 
lyrata]
Length=315

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 142/168 (85%), Gaps = 4/168 (2%)
 Frame = -3

Query  498  ELILDGGFVVPKTLMSSNGG-FEAPEMNSFGQSFRAY-DAESERQKSVEEFYRVQHINQT  325
            EL +D G  +P + +SSN   F APEMN+FG+ FR Y D  SERQKSVE FY+ QHINQ+
Sbjct  23   ELRMDSG--IPMSKISSNDEVFLAPEMNAFGRQFRDYTDTNSERQKSVEHFYKTQHINQS  80

Query  324  YDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPH  145
             DFVK+MR +YG+LDK+ M+IWECCELLN+VVD+SDPDLDEPQI+HLLQ+AEAIRKDYP+
Sbjct  81   LDFVKKMRSEYGKLDKMVMNIWECCELLNEVVDESDPDLDEPQIQHLLQSAEAIRKDYPN  140

Query  144  QPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            + WLHLTALIHDLGKVL  P FG LPQWAVVGDTFP+GCAFDES VHH
Sbjct  141  EDWLHLTALIHDLGKVLTLPQFGGLPQWAVVGDTFPVGCAFDESNVHH  188



>gb|AFK45472.1| unknown [Lotus japonicus]
Length=182

 Score =   219 bits (558),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = -3

Query  531  EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEF  352
            E++ V S+  NEL+LDGGF  P     SN GF  PE+NSFG SFR YDAESER+K VEEF
Sbjct  15   EEKNVHSEETNELVLDGGF--PSLKQVSNDGFTVPEINSFGHSFRNYDAESERKKGVEEF  72

Query  351  YRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTA  172
            YR+QHINQTYDFVKR RE+Y +LDK EMSIWECCELLN+VVD+SDPDLDEPQI+HLLQ+A
Sbjct  73   YRLQHINQTYDFVKRTREEYKKLDKAEMSIWECCELLNEVVDESDPDLDEPQIQHLLQSA  132

Query  171  EAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVV  52
            EAIRKDYP + WLHLTALIHDLGK+LL P FGELPQW   
Sbjct  133  EAIRKDYPDEDWLHLTALIHDLGKILLLPKFGELPQWGCC  172



>ref|XP_007160262.1| hypothetical protein PHAVU_002G306400g [Phaseolus vulgaris]
 gb|ESW32256.1| hypothetical protein PHAVU_002G306400g [Phaseolus vulgaris]
Length=272

 Score =   222 bits (566),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  APEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWEC  253
            AP++NS+G SFR YD ESERQK VEEFYR+QHINQTYDF KRMRE Y  +DK EM IWEC
Sbjct  2    APDINSYGHSFRDYDVESERQKGVEEFYRLQHINQTYDFAKRMREIYVTMDKAEMGIWEC  61

Query  252  CEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGE  73
            CELLN+VVDDSDPDLDE QI+HLLQ+AEAIRKDYP Q WLHLTALIHDLGK+LL P FG 
Sbjct  62   CELLNEVVDDSDPDLDEAQIQHLLQSAEAIRKDYPDQDWLHLTALIHDLGKILLLPRFGA  121

Query  72   LPQWAVVGDTFPLGCAFDESIVHH  1
            LPQWAVVGDTFPLGCAFDES +HH
Sbjct  122  LPQWAVVGDTFPLGCAFDESNIHH  145



>ref|XP_010483142.1| PREDICTED: inositol oxygenase 5 [Camelina sativa]
Length=315

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 145/180 (81%), Gaps = 4/180 (2%)
 Frame = -3

Query  534  EEKQAVPSDNANELILDGGFVVPKTLMSSNGG-FEAPEMNSFGQSFRAY-DAESERQKSV  361
            E + +  +    EL LD G  +P + +SS+   F APEMN+FG+ FR Y D  SERQK V
Sbjct  11   EYEDSTTNKKTGELQLDSG--IPMSKVSSDDEVFLAPEMNAFGRQFRDYADTNSERQKGV  68

Query  360  EEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLL  181
            E FY+ QH NQT DFVK+MR +YG+LDK+ M+IWECCELLN+VVD+SDPDLDEPQI+HLL
Sbjct  69   EHFYKTQHTNQTVDFVKKMRSEYGKLDKMVMNIWECCELLNEVVDESDPDLDEPQIQHLL  128

Query  180  QTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            Q+AEAIRKDYP++ WLHLTALIHDLGKVL  P FGELPQWAVVGDTFP+GCAFDES VHH
Sbjct  129  QSAEAIRKDYPNEDWLHLTALIHDLGKVLTLPQFGELPQWAVVGDTFPVGCAFDESNVHH  188



>ref|XP_010938965.1| PREDICTED: probable inositol oxygenase [Elaeis guineensis]
Length=303

 Score =   223 bits (567),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 149/191 (78%), Gaps = 15/191 (8%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTI  IE+P     + + +P + + EL+ D GFV P+T             N+FGQ+FR 
Sbjct  1    MTI-AIEQPQIEEGKGKKIPIE-SKELVSDSGFVTPET-------------NAFGQTFRN  45

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y+ ESER+ SVEEFYR+ HI+QT +FVK MRE+Y +L+K +MSIWECCELLN+ VD+SD 
Sbjct  46   YETESERKDSVEEFYRMNHIHQTCEFVKNMREEYIKLNKAKMSIWECCELLNEFVDESDL  105

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGKVLLHP FG LPQWAVVGDTFP+
Sbjct  106  DLDEPQIQHLLQSAEAIRKDYPDEDWLHLTALIHDLGKVLLHPKFGLLPQWAVVGDTFPV  165

Query  33   GCAFDESIVHH  1
            GCAFDESIVH+
Sbjct  166  GCAFDESIVHY  176



>ref|XP_010438782.1| PREDICTED: inositol oxygenase 4 isoform X3 [Camelina sativa]
Length=281

 Score =   222 bits (565),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  441  GFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSI  262
             F AP+MN+FG+ FR +DAESERQK VEEFYR+QHINQT DFV +MR +YG+LDK  MSI
Sbjct  8    AFLAPDMNAFGRQFRDFDAESERQKRVEEFYRLQHINQTVDFVTKMRAEYGKLDKKVMSI  67

Query  261  WECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPS  82
            WECCELLN+VVD+SDPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P 
Sbjct  68   WECCELLNEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQ  127

Query  81   FGELPQWAVVGDTFPLGCAFDESIVHH  1
            FG LPQWAVVGDTFP+GCAFDES VHH
Sbjct  128  FGGLPQWAVVGDTFPVGCAFDESNVHH  154



>ref|XP_009794933.1| PREDICTED: inositol oxygenase 2-like [Nicotiana sylvestris]
Length=166

 Score =   218 bits (554),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 141/164 (86%), Gaps = 6/164 (4%)
 Frame = -3

Query  573  MTILIIEKP--AEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSF  400
            MTILI E+P     VEEKQ +P D  NELILDGGFVVPK L S +GGFE PE+NSFGQSF
Sbjct  1    MTILI-EQPEFGLQVEEKQ-IPYD-TNELILDGGFVVPKQL-SCDGGFEVPEINSFGQSF  56

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R Y+AESERQK+VEEFYRVQHINQTYD+VK+MRE YG+LDKVEMSIWECCELLNDVVDDS
Sbjct  57   RDYNAESERQKTVEEFYRVQHINQTYDYVKKMREKYGKLDKVEMSIWECCELLNDVVDDS  116

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLH  88
            DPDLDEPQIEHLLQTAEAIRKDYP+  WLHLTALIH +   + H
Sbjct  117  DPDLDEPQIEHLLQTAEAIRKDYPNDDWLHLTALIHGMSLFIYH  160



>ref|XP_006298167.1| hypothetical protein CARUB_v10014217mg, partial [Capsella rubella]
 gb|EOA31065.1| hypothetical protein CARUB_v10014217mg, partial [Capsella rubella]
Length=315

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 142/175 (81%), Gaps = 3/175 (2%)
 Frame = -3

Query  522  AVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAY-DAESERQKSVEEFYR  346
            AV    A E   D   VVP++      GF+AP+MN  G SFR Y + ESERQ+ VEEFYR
Sbjct  4    AVEKKVAEERRDDDESVVPQS--KETDGFDAPDMNFLGHSFRDYENGESERQQGVEEFYR  61

Query  345  VQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEA  166
            +QHI+QTYDFVK MR++YG+LDK+EMSIWECCELLN+VVD+SDPDLDEPQI+HLLQTAEA
Sbjct  62   MQHIHQTYDFVKEMRKEYGKLDKMEMSIWECCELLNNVVDESDPDLDEPQIQHLLQTAEA  121

Query  165  IRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            IR+DYP + WLHLTALIHDLGKVLL P FG LPQWAVVGDTFP+GC FD + +HH
Sbjct  122  IRRDYPDEDWLHLTALIHDLGKVLLLPEFGGLPQWAVVGDTFPVGCTFDSANIHH  176



>ref|XP_010448297.1| PREDICTED: inositol oxygenase 4-like isoform X2 [Camelina sativa]
Length=397

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  441  GFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSI  262
             F APEMN+FG+ FR YD ESERQKSVEEFYR+QHINQT DFV +MR +YG+LDK  MSI
Sbjct  124  AFLAPEMNAFGRQFRDYDVESERQKSVEEFYRLQHINQTVDFVTKMRAEYGKLDKKVMSI  183

Query  261  WECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPS  82
            WECCELLN+VVD+SDPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P 
Sbjct  184  WECCELLNEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQ  243

Query  81   FGELPQWAVVGDTFPLGCAFDESIVHH  1
            FG LPQWAVVGDTFP+GCAFDES VHH
Sbjct  244  FGGLPQWAVVGDTFPVGCAFDESNVHH  270


 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -3

Query  306  MREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHL  127
            MR +YG+LDK  MSIWECCELLN+VVD+SDPDLDEPQI+HLLQ+AEAIRKDYP+  WLHL
Sbjct  1    MRAEYGKLDKKVMSIWECCELLNEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNDDWLHL  60

Query  126  TALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            TALIHDLGKV   P FG LPQWAVVGDTFPLGCAFDES VHH
Sbjct  61   TALIHDLGKVRNLPQFGGLPQWAVVGDTFPLGCAFDESNVHH  102



>ref|XP_010448296.1| PREDICTED: inositol oxygenase 4-like isoform X1 [Camelina sativa]
Length=400

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  441  GFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSI  262
             F APEMN+FG+ FR YD ESERQKSVEEFYR+QHINQT DFV +MR +YG+LDK  MSI
Sbjct  127  AFLAPEMNAFGRQFRDYDVESERQKSVEEFYRLQHINQTVDFVTKMRAEYGKLDKKVMSI  186

Query  261  WECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPS  82
            WECCELLN+VVD+SDPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKV+  P 
Sbjct  187  WECCELLNEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQ  246

Query  81   FGELPQWAVVGDTFPLGCAFDESIVHH  1
            FG LPQWAVVGDTFP+GCAFDES VHH
Sbjct  247  FGGLPQWAVVGDTFPVGCAFDESNVHH  273


 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 91/105 (87%), Gaps = 3/105 (3%)
 Frame = -3

Query  306  MREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHL  127
            MR +YG+LDK  MSIWECCELLN+VVD+SDPDLDEPQI+HLLQ+AEAIRKDYP+  WLHL
Sbjct  1    MRAEYGKLDKKVMSIWECCELLNEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNDDWLHL  60

Query  126  TALIH---DLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            TALIH   DLGKV   P FG LPQWAVVGDTFPLGCAFDES VHH
Sbjct  61   TALIHGKFDLGKVRNLPQFGGLPQWAVVGDTFPLGCAFDESNVHH  105



>ref|XP_007024362.1| Myo-inositol oxygenase 1 isoform 2 [Theobroma cacao]
 gb|EOY26984.1| Myo-inositol oxygenase 1 isoform 2 [Theobroma cacao]
Length=286

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 138/172 (80%), Gaps = 20/172 (12%)
 Frame = -3

Query  495  LILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDF  316
            ++LDGGF+VP+T             NSFG +FR Y  ESERQ+ VE FYR  HINQTYDF
Sbjct  1    MVLDGGFMVPQT-------------NSFGHTFRDYHVESERQQGVENFYRTNHINQTYDF  47

Query  315  -------VKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRK  157
                   VKRMR+++G+L+KVE+SIWECCELLNDVVD+SDPDLDEPQIEHLLQTAEAIRK
Sbjct  48   VSNSCFYVKRMRKEHGKLNKVELSIWECCELLNDVVDESDPDLDEPQIEHLLQTAEAIRK  107

Query  156  DYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            DYP + WLHL  L+HDLGKVLLHP FG LPQWAVVGDT+P+GCAFD++IVHH
Sbjct  108  DYPDEDWLHLAGLVHDLGKVLLHPGFGGLPQWAVVGDTYPVGCAFDKTIVHH  159



>ref|XP_010924477.1| PREDICTED: probable inositol oxygenase [Elaeis guineensis]
Length=310

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 144/196 (73%), Gaps = 18/196 (9%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPS-----DNANELILDGGFVVPKTLMSSNGGFEAPEMNSFG  409
            M +++ E   E     Q V +     +N  +L LDGGFVVP +             N+FG
Sbjct  1    MAVIVPEPVLEGSNNSQDVENYVKEQENDGDLSLDGGFVVPDS-------------NAFG  47

Query  408  QSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvv  229
             SFR Y+ E ER+ +VE+FYR  HINQTY+  KR +E+YG+LDK  MSIWEC ELLN+ V
Sbjct  48   HSFRDYEKEGERKATVEDFYRTNHINQTYELAKRKKEEYGKLDKTVMSIWECIELLNEYV  107

Query  228  ddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVG  49
            D+SDPDLDEPQI+HLLQ+AEAIR+DYP + WLHLTALIHDLGKVLLHPSFGE PQW VVG
Sbjct  108  DESDPDLDEPQIQHLLQSAEAIRRDYPDEDWLHLTALIHDLGKVLLHPSFGEQPQWCVVG  167

Query  48   DTFPLGCAFDESIVHH  1
            DTFPLGCAFDESIVHH
Sbjct  168  DTFPLGCAFDESIVHH  183



>ref|XP_007135612.1| hypothetical protein PHAVU_010G143500g [Phaseolus vulgaris]
 gb|ESW07606.1| hypothetical protein PHAVU_010G143500g [Phaseolus vulgaris]
Length=306

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 144/192 (75%), Gaps = 14/192 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI +      E +      N  EL+LDGGF++P+T             N+FG  FRA
Sbjct  1    MTILIQQPHHLGAEVEANTAEINEGELVLDGGFLIPQT-------------NTFGHIFRA  47

Query  393  Y-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
            Y DAESER + VE FYR  H  Q+ DFVK++RE+Y +L+KVEMSIWECCELLN+VVD+SD
Sbjct  48   YNDAESERHEGVENFYRKNHTYQSLDFVKKLREEYAKLNKVEMSIWECCELLNEVVDESD  107

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVL  PSFG LPQWAVVGDTFP
Sbjct  108  PDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLNLPSFGGLPQWAVVGDTFP  167

Query  36   LGCAFDESIVHH  1
            +GC FDESIVHH
Sbjct  168  VGCRFDESIVHH  179



>ref|XP_006357365.1| PREDICTED: inositol oxygenase 1-like [Solanum tuberosum]
Length=302

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 126/194 (65%), Positives = 145/194 (75%), Gaps = 24/194 (12%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNAN----ELILDGGFVVPKTLMSSNGGFEAPEMNSFGQ  406
            MTILI + P E       + +D  N    EL+L  GF VP+T             N+FG 
Sbjct  1    MTILIEQLPVE-------IQADETNIHQKELVLVDGFAVPQT-------------NAFGH  40

Query  405  SFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvd  226
            +FR Y  ES RQ+ VE FY++ H NQTYD+V +MR DY +LDK EMSIWECCELLNDVVD
Sbjct  41   NFRDYTVESARQQGVEFFYKINHFNQTYDYVSKMRVDYAKLDKAEMSIWECCELLNDVVD  100

Query  225  dsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGD  46
            DSDPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKVLL PSFGELPQWAVVGD
Sbjct  101  DSDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVLLLPSFGELPQWAVVGD  160

Query  45   TFPLGCAFDESIVH  4
            TFP+GCAF +SIVH
Sbjct  161  TFPVGCAFHDSIVH  174



>ref|XP_006349939.1| PREDICTED: inositol oxygenase 4-like [Solanum tuberosum]
Length=289

 Score =   220 bits (560),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = -3

Query  438  FEAPEMNSFGQSFRAYD-AESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSI  262
            F  P+ N+FG +FR Y+ A+SERQK VE+FY+ QHINQTYDFVK+MREDY +LDK +MSI
Sbjct  16   FMVPQTNAFGHNFRDYNNAQSERQKGVEKFYKTQHINQTYDFVKKMREDYTKLDKAKMSI  75

Query  261  WECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPS  82
            WECCELLNDVVDDSDPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGK+L+ P 
Sbjct  76   WECCELLNDVVDDSDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKILVLPK  135

Query  81   FGELPQWAVVGDTFPLGCAFDESIVHH  1
            FG LPQWAVVGDTFPLGC+FDES +HH
Sbjct  136  FGGLPQWAVVGDTFPLGCSFDESNIHH  162



>ref|NP_001241072.1| uncharacterized protein LOC100794523 [Glycine max]
 gb|ACU24324.1| unknown [Glycine max]
 gb|KHN03220.1| Inositol oxygenase 2 [Glycine soja]
Length=311

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 145/190 (76%), Gaps = 7/190 (4%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            M +LI     E  E  +    +N ++L+LDGGF + K+   S+ GF  P++NS+G SFR 
Sbjct  1    MVVLI-----EQSELTRPQAEENNDDLVLDGGFSLLKS--PSHVGFTVPDINSYGHSFRN  53

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            Y  ESER KSVEE YR QH NQTY+F K+MRE+YG+L+KVE+ IWECCE+L+ +VD SDP
Sbjct  54   YYDESERNKSVEELYRQQHTNQTYEFAKKMREEYGKLNKVEVGIWECCEMLDKIVDASDP  113

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPL  34
            DL+E QI+H LQTAEA R DYP++ WLHLTALIHDLGKVLL PSFG LPQWAVVGD+FPL
Sbjct  114  DLEESQIQHALQTAEAARNDYPNEDWLHLTALIHDLGKVLLLPSFGGLPQWAVVGDSFPL  173

Query  33   GCAFDESIVH  4
            GCAF E+  H
Sbjct  174  GCAFHEANTH  183



>ref|XP_004253007.1| PREDICTED: inositol oxygenase 5-like [Solanum lycopersicum]
Length=289

 Score =   219 bits (559),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -3

Query  438  FEAPEMNSFGQSFRAYD-AESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSI  262
            F  P+ N+FG  FR Y+ A+SERQK VE+FY+ QHINQTYDFVK+MREDY +LDK +MSI
Sbjct  16   FMVPQTNAFGHDFRDYNNAQSERQKGVEKFYKTQHINQTYDFVKKMREDYIKLDKAKMSI  75

Query  261  WECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPS  82
            WECCELLNDVVDDSDPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGK+L+ P 
Sbjct  76   WECCELLNDVVDDSDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKILVLPK  135

Query  81   FGELPQWAVVGDTFPLGCAFDESIVHH  1
            FG LPQWAVVGDTFPLGCAFDES +HH
Sbjct  136  FGGLPQWAVVGDTFPLGCAFDESNIHH  162



>gb|KHN39268.1| Inositol oxygenase 1 [Glycine soja]
Length=306

 Score =   219 bits (559),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 144/192 (75%), Gaps = 14/192 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI +      E +      N  EL+LDGGF++P+T             NSFG  FRA
Sbjct  1    MTILIEQSDHFGAEVEAKTEPINERELVLDGGFLIPQT-------------NSFGHMFRA  47

Query  393  Y-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
            Y DA SER++ VE FYR  H  Q+ DFVK+MRE+Y +L++VEMSIWECCELLN+VVD+SD
Sbjct  48   YNDAGSERREGVENFYRKNHTYQSVDFVKKMREEYAKLNRVEMSIWECCELLNEVVDESD  107

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIR+DYP + WLHLT LIHDLGKVL  PSFG LPQWAVVGDTFP
Sbjct  108  PDLDEPQIEHLLQTAEAIRRDYPDEDWLHLTGLIHDLGKVLNLPSFGGLPQWAVVGDTFP  167

Query  36   LGCAFDESIVHH  1
            +GC FDESIVHH
Sbjct  168  VGCRFDESIVHH  179



>ref|XP_006279854.1| hypothetical protein CARUB_v10028439mg [Capsella rubella]
 gb|EOA12752.1| hypothetical protein CARUB_v10028439mg [Capsella rubella]
Length=315

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 150/193 (78%), Gaps = 7/193 (4%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGG-FEAPEMNSFGQSFR  397
            MTI  ++ P    EE  A   +   EL LD    +P + + S+G  F APEMN+FG+ FR
Sbjct  1    MTI-SVQNPVFVNEESTA--HEKTGELQLDSE--IPMSKIPSDGDVFLAPEMNAFGRQFR  55

Query  396  AY-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
             Y D +SERQKSVE FY  QH NQT DFVK+MR +YG+LDK+ M+IWECCELLN+VVD+S
Sbjct  56   DYEDTKSERQKSVEHFYETQHTNQTLDFVKKMRSEYGKLDKMVMNIWECCELLNEVVDES  115

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGKVL  P FG LPQWAVVGDTF
Sbjct  116  DPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVLTLPQFGGLPQWAVVGDTF  175

Query  39   PLGCAFDESIVHH  1
            P+GCAFDES VHH
Sbjct  176  PVGCAFDESNVHH  188



>ref|XP_006373403.1| hypothetical protein POPTR_0017s13450g [Populus trichocarpa]
 gb|ERP51200.1| hypothetical protein POPTR_0017s13450g [Populus trichocarpa]
Length=308

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 152/196 (78%), Gaps = 20/196 (10%)
 Frame = -3

Query  573  MTILIIEKPAEHVE----EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQ  406
            MT+ I+E P E +E    +K+ +  D  +EL+ DGGF +P +             N+FGQ
Sbjct  1    MTV-IVENPVEDIELFEEQKKEIHVD-PDELVSDGGFTMPDS-------------NAFGQ  45

Query  405  SFRAY-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvv  229
            SFR Y +AE+ER + VE+ YR+QHINQTYD+VK+MRE+Y RLDK EMSIWECCELLNDVV
Sbjct  46   SFRDYENAETERHQIVEQTYRLQHINQTYDYVKKMREEYSRLDKAEMSIWECCELLNDVV  105

Query  228  ddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVG  49
            D+SDPDLDEPQI HLLQ+AEAIRKDYP++ WLHLTALIHDLGK+LL P FG LPQW+ VG
Sbjct  106  DESDPDLDEPQIMHLLQSAEAIRKDYPNEDWLHLTALIHDLGKILLLPQFGGLPQWSAVG  165

Query  48   DTFPLGCAFDESIVHH  1
            D FP+GCAFDES VH+
Sbjct  166  DIFPVGCAFDESNVHY  181



>gb|ACU18263.1| unknown [Glycine max]
Length=335

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 144/192 (75%), Gaps = 14/192 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI +      E +      N  EL+LDGGF++P+T             NSFG  FRA
Sbjct  1    MTILIEQSDHFGAEVEAKTEPINERELVLDGGFLIPQT-------------NSFGHMFRA  47

Query  393  Y-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
            Y DA SER++ VE FYR  H  Q+ DFVK+MRE+Y +L++VEMSIWECCELLN+VVD+SD
Sbjct  48   YNDAVSERREGVENFYRKNHTYQSVDFVKKMREEYAKLNRVEMSIWECCELLNEVVDESD  107

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQTAEAIR+DYP + WLHLT LIHDLGKVL  PSFG LPQWAVVGDTFP
Sbjct  108  PDLDEPQIEHLLQTAEAIRRDYPDEDWLHLTGLIHDLGKVLNLPSFGGLPQWAVVGDTFP  167

Query  36   LGCAFDESIVHH  1
            +GC FDESIVHH
Sbjct  168  VGCRFDESIVHH  179



>ref|XP_010909937.1| PREDICTED: probable inositol oxygenase [Elaeis guineensis]
Length=301

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 145/192 (76%), Gaps = 19/192 (10%)
 Frame = -3

Query  573  MTILIIEKPAE-HVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MT+++ E   + +VEE+Q        +L LDGGFVVP +             N+FG SFR
Sbjct  1    MTVVVSEPVLQSYVEEQQT-----GGDLTLDGGFVVPDS-------------NAFGHSFR  42

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             Y+ E ER+  VEEFYR+ HINQTY+F K+ +E+YG+LD   MSIW+C +LLN+ VD+SD
Sbjct  43   DYEKEGERKAIVEEFYRINHINQTYEFAKKKKEEYGKLDNAVMSIWDCIDLLNEFVDESD  102

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFP  37
            PDLDEPQIEHLLQ+AEAIR+DYP Q WLHLTALIHDLGKVLLHPSFG  PQW VVGDTFP
Sbjct  103  PDLDEPQIEHLLQSAEAIRRDYPDQDWLHLTALIHDLGKVLLHPSFGGEPQWCVVGDTFP  162

Query  36   LGCAFDESIVHH  1
            LGCAFDESIVH+
Sbjct  163  LGCAFDESIVHY  174



>ref|XP_009126928.1| PREDICTED: inositol oxygenase 5 [Brassica rapa]
Length=315

 Score =   218 bits (554),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 141/168 (84%), Gaps = 4/168 (2%)
 Frame = -3

Query  498  ELILDGGFVVPKTLMSSNGG-FEAPEMNSFGQSFRAY-DAESERQKSVEEFYRVQHINQT  325
            EL LD   ++P +  SS+   F APE+N+FG+ FR Y DA +ERQKSVEEFY+ QH NQ+
Sbjct  23   ELQLDN--IIPTSKTSSDDDVFLAPEVNAFGRQFRDYADANNERQKSVEEFYKTQHTNQS  80

Query  324  YDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPH  145
             DFVK+MR +YG+LDK+ M+IWECCELLN+VVD+SDPDLDEPQI+HLLQ+AEAIRKDYP 
Sbjct  81   LDFVKKMRHEYGKLDKMVMNIWECCELLNEVVDESDPDLDEPQIQHLLQSAEAIRKDYPD  140

Query  144  QPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            + WLHLTALIHDLGKVL  P FG LPQWAVVGDTFP+GCAFDES +HH
Sbjct  141  EDWLHLTALIHDLGKVLTLPQFGGLPQWAVVGDTFPVGCAFDESNIHH  188



>ref|XP_009395731.1| PREDICTED: inositol oxygenase 1-like [Musa acuminata subsp. malaccensis]
Length=305

 Score =   217 bits (553),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 145/195 (74%), Gaps = 21/195 (11%)
 Frame = -3

Query  573  MTILI----IEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQ  406
            MT+++    +E+    VEE+Q     +   L LDG FVVP +             N+FG 
Sbjct  1    MTVIVPEPVLEENHNSVEEQQK----DGGALDLDGEFVVPGS-------------NAFGH  43

Query  405  SFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvd  226
            SFR Y+ E+ R+ +VEEFYRV HI QTYDF KR +E+YG+L K EMSIWEC ELLN+ VD
Sbjct  44   SFRDYEKETARRATVEEFYRVNHIYQTYDFAKRKKEEYGKLQKGEMSIWECVELLNEFVD  103

Query  225  dsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGD  46
            +SDPDLDEPQIEHLLQ+AEAIR+DYP Q WLHLTALIHDLGKVLLHP+FG  PQW VVGD
Sbjct  104  ESDPDLDEPQIEHLLQSAEAIRRDYPDQDWLHLTALIHDLGKVLLHPTFGGEPQWCVVGD  163

Query  45   TFPLGCAFDESIVHH  1
            TFPLGCAFDESIVHH
Sbjct  164  TFPLGCAFDESIVHH  178



>ref|XP_011021080.1| PREDICTED: inositol oxygenase 2-like [Populus euphratica]
Length=318

 Score =   218 bits (554),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 151/197 (77%), Gaps = 19/197 (10%)
 Frame = -3

Query  579  GRMTILIIEKPAEHVE---EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFG  409
             +MT+ I+E P E +E    K+ +  D  +EL+ DGGF +P +             N+FG
Sbjct  10   SKMTV-IVENPVEDMELYEHKKEIHVD-PDELVSDGGFTMPDS-------------NAFG  54

Query  408  QSFRAY-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndv  232
            QSFR Y +AE+ER + VE  YR+QHINQTYD+VK+MRE+Y RLDK EMSIWECCELLNDV
Sbjct  55   QSFRDYENAENERHQIVERTYRLQHINQTYDYVKKMREEYSRLDKAEMSIWECCELLNDV  114

Query  231  vddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVV  52
            VD+SDPDLDEPQI HLLQ+AEAIRKDYP++ WLHLTALIHDLGK+LL P FG LPQW+ V
Sbjct  115  VDESDPDLDEPQIMHLLQSAEAIRKDYPNEDWLHLTALIHDLGKILLLPRFGGLPQWSAV  174

Query  51   GDTFPLGCAFDESIVHH  1
            GD FP+GCAFDES VH+
Sbjct  175  GDIFPVGCAFDESNVHY  191



>ref|XP_006401300.1| hypothetical protein EUTSA_v10014148mg [Eutrema salsugineum]
 gb|ESQ42753.1| hypothetical protein EUTSA_v10014148mg [Eutrema salsugineum]
Length=315

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 140/169 (83%), Gaps = 4/169 (2%)
 Frame = -3

Query  504  ANELILDGGFVVPKTLMSSNGG-FEAPEMNSFGQSFRAY-DAESERQKSVEEFYRVQHIN  331
              EL LD   ++P +  SS+   F APE+N+FG+ FR Y DA SERQKSVEEFY+ QH N
Sbjct  21   TKELQLDN--IIPMSKESSDDVVFLAPEVNAFGRQFRDYADANSERQKSVEEFYKTQHTN  78

Query  330  QTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDY  151
            QT DFVK+MR +YG+LDK+ M+IWECCELLN+VVD+SDPDLDEPQI+HLLQ+AEAIRKDY
Sbjct  79   QTLDFVKKMRSEYGKLDKMVMNIWECCELLNEVVDESDPDLDEPQIQHLLQSAEAIRKDY  138

Query  150  PHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVH  4
            P + WLHLTALIHDLGKVL  P FG LPQWAVVGDTFP+GCAFDES VH
Sbjct  139  PDEDWLHLTALIHDLGKVLTLPQFGGLPQWAVVGDTFPVGCAFDESNVH  187



>ref|NP_200475.1| myo-inositol oxygenase 5 [Arabidopsis thaliana]
 sp|Q9FJU4.1|MIOX5_ARATH RecName: Full=Inositol oxygenase 5; AltName: Full=Myo-inositol 
oxygenase 5; Short=AtMIOX5; Short=MI oxygenase 5 [Arabidopsis 
thaliana]
 dbj|BAB09882.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96791.1| myo-inositol oxygenase 5 [Arabidopsis thaliana]
Length=314

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 135/167 (81%), Gaps = 2/167 (1%)
 Frame = -3

Query  498  ELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAY-DAESERQKSVEEFYRVQHINQTY  322
            EL LD    + K + S +  F APEMN+FG+ FR Y D  SERQKSVE FY  QH NQT 
Sbjct  22   ELRLDSDIPMSK-ISSDDEVFLAPEMNAFGRQFRDYTDTNSERQKSVEHFYATQHTNQTL  80

Query  321  DFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQ  142
            DFV++MR +YG+LDK+ M+IWECCEL  +VVD+SDPDLDEPQI+HLLQ+AEAIRKDYP++
Sbjct  81   DFVQKMRSEYGKLDKMVMNIWECCELSKEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNE  140

Query  141  PWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
             WLHLTALIHDLGKVL  P FG LPQWAVVGDTFP+GCAFDES VHH
Sbjct  141  DWLHLTALIHDLGKVLTLPQFGGLPQWAVVGDTFPVGCAFDESNVHH  187



>emb|CDY41799.1| BnaC02g12100D [Brassica napus]
Length=316

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 141/169 (83%), Gaps = 5/169 (3%)
 Frame = -3

Query  498  ELILDGGFVVPKTLMSSNGG-FEAPEMNSFGQSFRA--YDAESERQKSVEEFYRVQHINQ  328
            EL LD   ++P +  SS+   F APE+N+FG+ FR    DA +ERQKSVEEFY+ QH NQ
Sbjct  23   ELQLDN--IIPTSKTSSDDDVFLAPEVNAFGRQFRLDYADANNERQKSVEEFYKTQHTNQ  80

Query  327  TYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYP  148
            T DFVK+MR +YG+LDK+ M+IWECCELLN+VVD+SDPDLDEPQI+HLLQ+AEAIRKDYP
Sbjct  81   TLDFVKKMRHEYGKLDKMVMNIWECCELLNEVVDESDPDLDEPQIQHLLQSAEAIRKDYP  140

Query  147  HQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            ++ WLHLTALIHDLGKVL  P FG LPQWAVVGDTFP+GCAFDES +HH
Sbjct  141  NEDWLHLTALIHDLGKVLTLPQFGGLPQWAVVGDTFPVGCAFDESNIHH  189



>gb|AAM61190.1| unknown [Arabidopsis thaliana]
Length=314

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 136/167 (81%), Gaps = 2/167 (1%)
 Frame = -3

Query  498  ELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAY-DAESERQKSVEEFYRVQHINQTY  322
            EL LD    + K + S +  F APEMN+FG+ FR Y D  SERQKSVE FY  QH NQT 
Sbjct  22   ELRLDSDIPMSK-ISSDDEVFLAPEMNAFGRQFRDYTDTNSERQKSVEHFYATQHTNQTL  80

Query  321  DFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQ  142
            DFV++MR +YG+LDK+ M+IWECCELL +VVD+SDPDLDEPQI+HLLQ+AEAIRKDYP++
Sbjct  81   DFVQKMRSEYGKLDKMVMNIWECCELLKEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNE  140

Query  141  PWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
             WLHLTALIHDLGKVL  P FG LPQWAVVGDTFP+GCAFDES VHH
Sbjct  141  DWLHLTALIHDLGKVLTLPQFGGLPQWAVVGDTFPVGCAFDESNVHH  187



>ref|XP_007039457.1| Myo-inositol oxygenase 4 isoform 3 [Theobroma cacao]
 gb|EOY23958.1| Myo-inositol oxygenase 4 isoform 3 [Theobroma cacao]
Length=280

 Score =   215 bits (547),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  456  MSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDK  277
            ++S   F  PE N+FG+SFR Y+A+ ER+  VE+ Y++ HINQTYDFVKRMRE+Y +LDK
Sbjct  8    LASKEEFAVPENNAFGKSFRDYEADGERKDIVEQHYKLSHINQTYDFVKRMREEYKKLDK  67

Query  276  VEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKV  97
             EM IWECCEL N+VVDDSDPDLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGK+
Sbjct  68   AEMGIWECCELHNEVVDDSDPDLDEPQIQHLLQSAEAIRKDYPEEDWLHLTALIHDLGKI  127

Query  96   LLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            L+ P FG LPQWAVVGDTFP+GCAFD+S VHH
Sbjct  128  LVLPKFGGLPQWAVVGDTFPVGCAFDDSNVHH  159



>emb|CDY20714.1| BnaA02g08540D [Brassica napus]
Length=316

 Score =   215 bits (548),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 140/169 (83%), Gaps = 5/169 (3%)
 Frame = -3

Query  498  ELILDGGFVVPKTLMSSNGG-FEAPEMNSFGQSFRA--YDAESERQKSVEEFYRVQHINQ  328
            EL LD   ++P +  SS+   F APE+N+FG+ FR    DA +ERQKSVEEFY+ QH NQ
Sbjct  23   ELQLDN--IIPTSKTSSDDDVFLAPEVNAFGRQFRLDYADANNERQKSVEEFYKTQHTNQ  80

Query  327  TYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYP  148
            T DFVK+MR +YG+LDK+ M+IWECCELLN+VVD+SDPDLDEPQI+HLLQ+AEAIRKDYP
Sbjct  81   TLDFVKKMRHEYGKLDKMVMNIWECCELLNEVVDESDPDLDEPQIQHLLQSAEAIRKDYP  140

Query  147  HQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
             + WLHLTALIHDLGKVL  P FG LPQWAVVGDTFP+GCAFDES +HH
Sbjct  141  DEDWLHLTALIHDLGKVLTLPQFGGLPQWAVVGDTFPVGCAFDESNIHH  189



>ref|XP_007039458.1| Myo-inositol oxygenase 4 isoform 4 [Theobroma cacao]
 gb|EOY23959.1| Myo-inositol oxygenase 4 isoform 4 [Theobroma cacao]
Length=280

 Score =   214 bits (545),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  456  MSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDK  277
            ++S   F  PE N+FG+SFR Y+A+ ER+  VE+ Y++ HINQTYDFVKRMRE+Y +LDK
Sbjct  8    LASKEEFAVPENNAFGKSFRDYEADGERKDIVEQHYKLSHINQTYDFVKRMREEYKKLDK  67

Query  276  VEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKV  97
             EM IWECCEL N+VVDDSDPDLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGK+
Sbjct  68   AEMGIWECCELHNEVVDDSDPDLDEPQIQHLLQSAEAIRKDYPEEDWLHLTALIHDLGKI  127

Query  96   LLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            L+ P FG LPQWAVVGDTFP+GCAFD+S VHH
Sbjct  128  LVLPKFGGLPQWAVVGDTFPVGCAFDDSNVHH  159



>ref|XP_007039455.1| Myo-inositol oxygenase 4 isoform 1 [Theobroma cacao]
 gb|EOY23956.1| Myo-inositol oxygenase 4 isoform 1 [Theobroma cacao]
Length=306

 Score =   215 bits (547),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  456  MSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDK  277
            ++S   F  PE N+FG+SFR Y+A+ ER+  VE+ Y++ HINQTYDFVKRMRE+Y +LDK
Sbjct  28   LASKEEFAVPENNAFGKSFRDYEADGERKDIVEQHYKLSHINQTYDFVKRMREEYKKLDK  87

Query  276  VEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKV  97
             EM IWECCEL N+VVDDSDPDLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGK+
Sbjct  88   AEMGIWECCELHNEVVDDSDPDLDEPQIQHLLQSAEAIRKDYPEEDWLHLTALIHDLGKI  147

Query  96   LLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            L+ P FG LPQWAVVGDTFP+GCAFD+S VHH
Sbjct  148  LVLPKFGGLPQWAVVGDTFPVGCAFDDSNVHH  179



>gb|ACU17735.1| unknown [Glycine max]
Length=252

 Score =   213 bits (542),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 144/197 (73%), Gaps = 19/197 (10%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTILI +      E +      N  EL+LDGGF++P+T             NSFG  FRA
Sbjct  1    MTILIEQSDHFGAEVEAKTEPINERELVLDGGFLIPQT-------------NSFGHMFRA  47

Query  393  Y-DAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
            Y DA SER++ VE FYR  H  Q+ DFVK+MRE+Y +L++VEMSIWECCELLN+VVD+SD
Sbjct  48   YNDAVSERREGVENFYRKNHTYQSVDFVKKMREEYAKLNRVEMSIWECCELLNEVVDESD  107

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIH-----DLGKVLLHPSFGELPQWAVV  52
            PDLDEPQIEHLLQTAEAIR+DYP + WLHLT LIH     DLGKVL  PSFG LPQWAVV
Sbjct  108  PDLDEPQIEHLLQTAEAIRRDYPDEDWLHLTGLIHVWLNADLGKVLNLPSFGGLPQWAVV  167

Query  51   GDTFPLGCAFDESIVHH  1
            GDTFP+GC FDESIVHH
Sbjct  168  GDTFPVGCRFDESIVHH  184



>ref|XP_007039456.1| Myo-inositol oxygenase 4 isoform 2 [Theobroma cacao]
 gb|EOY23957.1| Myo-inositol oxygenase 4 isoform 2 [Theobroma cacao]
Length=320

 Score =   215 bits (547),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  456  MSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDK  277
            ++S   F  PE N+FG+SFR Y+A+ ER+  VE+ Y++ HINQTYDFVKRMRE+Y +LDK
Sbjct  42   LASKEEFAVPENNAFGKSFRDYEADGERKDIVEQHYKLSHINQTYDFVKRMREEYKKLDK  101

Query  276  VEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKV  97
             EM IWECCEL N+VVDDSDPDLDEPQI+HLLQ+AEAIRKDYP + WLHLTALIHDLGK+
Sbjct  102  AEMGIWECCELHNEVVDDSDPDLDEPQIQHLLQSAEAIRKDYPEEDWLHLTALIHDLGKI  161

Query  96   LLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            L+ P FG LPQWAVVGDTFP+GCAFD+S VHH
Sbjct  162  LVLPKFGGLPQWAVVGDTFPVGCAFDDSNVHH  193



>ref|XP_006426838.1| hypothetical protein CICLE_v10026154mg [Citrus clementina]
 gb|ESR40078.1| hypothetical protein CICLE_v10026154mg [Citrus clementina]
Length=262

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -3

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R YDAE ERQ+ VE FYR+ HINQTYDFVK+MRE+YG+L++VEMSIWECCELLNDVVD+S
Sbjct  3    RDYDAEGERQEGVENFYRINHINQTYDFVKKMREEYGKLNRVEMSIWECCELLNDVVDES  62

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVL  PSFG LPQWAVVGDTF
Sbjct  63   DPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLNLPSFGGLPQWAVVGDTF  122

Query  39   PLGCAFDESIVHH  1
            P+GCAFDESIVHH
Sbjct  123  PVGCAFDESIVHH  135



>gb|KDO53719.1| hypothetical protein CISIN_1g021944mg [Citrus sinensis]
Length=262

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -3

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R YDAE ERQ+ VE FYR+ HINQTYDFVK+MRE+YG+L++VEMSIWECCELLNDVVD+S
Sbjct  3    RDYDAEGERQEGVENFYRINHINQTYDFVKKMREEYGKLNRVEMSIWECCELLNDVVDES  62

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVL  PSFG LPQWAVVGDTF
Sbjct  63   DPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLNLPSFGGLPQWAVVGDTF  122

Query  39   PLGCAFDESIVHH  1
            P+GCAFDESIVHH
Sbjct  123  PVGCAFDESIVHH  135



>ref|XP_010244377.1| PREDICTED: probable inositol oxygenase isoform X2 [Nelumbo nucifera]
Length=408

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -3

Query  444  GGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMS  265
            GGF  PE N+FG SFR Y+ ESER+ SVEEFY+  HI QTY+F K+ +E+YG+L+K +MS
Sbjct  134  GGFVVPESNTFGHSFRDYEKESERKASVEEFYKNNHIYQTYEFAKKKKEEYGKLEKTKMS  193

Query  264  IWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHP  85
            IWECCELLN+ VD+SDPDLDEPQIEHLLQ+AEAIRKDYP   WLHLTALIHDLGKVLLHP
Sbjct  194  IWECCELLNEFVDESDPDLDEPQIEHLLQSAEAIRKDYPDHDWLHLTALIHDLGKVLLHP  253

Query  84   SFGELPQWAVVGDTFPLGCAFDESIVHH  1
            SFG  PQW VVGDTFPLGCAF E IVHH
Sbjct  254  SFGGEPQWCVVGDTFPLGCAFHECIVHH  281



>ref|XP_010244376.1| PREDICTED: probable inositol oxygenase isoform X1 [Nelumbo nucifera]
Length=410

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -3

Query  444  GGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMS  265
            GGF  PE N+FG SFR Y+ ESER+ SVEEFY+  HI QTY+F K+ +E+YG+L+K +MS
Sbjct  136  GGFVVPESNTFGHSFRDYEKESERKASVEEFYKNNHIYQTYEFAKKKKEEYGKLEKTKMS  195

Query  264  IWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHP  85
            IWECCELLN+ VD+SDPDLDEPQIEHLLQ+AEAIRKDYP   WLHLTALIHDLGKVLLHP
Sbjct  196  IWECCELLNEFVDESDPDLDEPQIEHLLQSAEAIRKDYPDHDWLHLTALIHDLGKVLLHP  255

Query  84   SFGELPQWAVVGDTFPLGCAFDESIVHH  1
            SFG  PQW VVGDTFPLGCAF E IVHH
Sbjct  256  SFGGEPQWCVVGDTFPLGCAFHECIVHH  283



>gb|KDO53724.1| hypothetical protein CISIN_1g021944mg [Citrus sinensis]
Length=183

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 141/177 (80%), Gaps = 16/177 (9%)
 Frame = -3

Query  573  MTILIIEKPAEHVE-EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFR  397
            MTILI ++P   VE +++ VP D   EL LDGGF+VP+T             NSFG +FR
Sbjct  1    MTILI-DQPHFGVEVQEKKVPIDEK-ELSLDGGFLVPQT-------------NSFGHTFR  45

Query  396  AYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsd  217
             YDAE ERQ+ VE FYR+ HINQTYDFVK+MRE+YG+L++VEMSIWECCELLNDVVD+SD
Sbjct  46   DYDAEGERQEGVENFYRINHINQTYDFVKKMREEYGKLNRVEMSIWECCELLNDVVDESD  105

Query  216  pdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGD  46
            PDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVL  PSFG LPQWAVVG+
Sbjct  106  PDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLNLPSFGGLPQWAVVGE  162



>emb|CDO99934.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  FGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllnd  235
             G  F  Y AE+ER+K VEE YR+ HINQTYDFVK+MRE Y ++D+VEMSIWECCELLND
Sbjct  32   LGSCFPDYHAETERKKIVEELYRLSHINQTYDFVKKMREAYKKMDRVEMSIWECCELLND  91

Query  234  vvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAV  55
            VVDDSDPDLDEPQ+EHLLQTAEAIR+DYP + WLHLT LIHDLGKVLL PSFG LPQWAV
Sbjct  92   VVDDSDPDLDEPQMEHLLQTAEAIRRDYPDEDWLHLTGLIHDLGKVLLLPSFGGLPQWAV  151

Query  54   VGDTFPLGCAFDESIVHH  1
            VGDTFPLGCAFDESIVHH
Sbjct  152  VGDTFPLGCAFDESIVHH  169



>gb|AFW86644.1| hypothetical protein ZEAMMB73_073834 [Zea mays]
Length=203

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 132/175 (75%), Gaps = 13/175 (7%)
 Frame = -3

Query  573  MTILIIEKPAEHVEEKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRA  394
            MTI I +   + V E++     +  EL+LD GFVVP             + N+FG +FR 
Sbjct  1    MTITIEQPQLDAVAERKVPGGGDPAELVLDAGFVVP-------------DANAFGNTFRD  47

Query  393  YDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdp  214
            YDAESER+++VEEFYRV H+ QT++FV RMR +YGRLDK EM IWEC ELLN+ +DDSDP
Sbjct  48   YDAESERKQTVEEFYRVNHVRQTHEFVARMRAEYGRLDKTEMGIWECIELLNEFIDDSDP  107

Query  213  dlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVG  49
            DLD PQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLHPSFGELPQWAVVG
Sbjct  108  DLDMPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHPSFGELPQWAVVG  162



>gb|AAF63180.1|AC010657_16 T5E21.2 [Arabidopsis thaliana]
Length=452

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -3

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R YDAESER++ VEEFYRV HI QT DFV++MRE+Y +L++ EMSIWECCELLN+ +D+S
Sbjct  41   RDYDAESERRRGVEEFYRVNHIGQTVDFVRKMREEYEKLNRTEMSIWECCELLNEFIDES  100

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDEPQIEHLLQTAEAIRKDYP + WLHLT LIHDLGKVLLH SFGELPQWAVVGDTF
Sbjct  101  DPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHSSFGELPQWAVVGDTF  160

Query  39   PLGCAFDESIVHH  1
            P+GCAFDESIVHH
Sbjct  161  PVGCAFDESIVHH  173



>ref|XP_011093670.1| PREDICTED: inositol oxygenase 1-like [Sesamum indicum]
Length=320

 Score =   203 bits (516),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = -3

Query  441  GFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSI  262
            GF APE N+FG SFR Y  ES R+  VEEFYR  H  QTYDF    +E++GRL+K  MSI
Sbjct  47   GFFAPENNAFGNSFRNYQQESLRRIIVEEFYRKNHTFQTYDFAMAKKEEHGRLNKGVMSI  106

Query  261  WECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPS  82
            WECCELLN+ VD+SD D DEP +EHLLQTAEAIR+DYPHQ WLHLTAL+HDLGKVLLHP+
Sbjct  107  WECCELLNEYVDESDLDSDEPPMEHLLQTAEAIRRDYPHQDWLHLTALLHDLGKVLLHPA  166

Query  81   FGELPQWAVVGDTFPLGCAFDESIVHH  1
            FG  PQW VVGDTFPLGCAF E+IVHH
Sbjct  167  FGGEPQWCVVGDTFPLGCAFSEAIVHH  193



>ref|XP_006583567.1| PREDICTED: inositol oxygenase 2-like isoform X2 [Glycine max]
Length=296

 Score =   201 bits (512),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 133/177 (75%), Gaps = 22/177 (12%)
 Frame = -3

Query  531  EKQAVPSDNANELILDGGFVVPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEF  352
            E++ V S+++NEL+L G F + K       GF A +MN+FG SFR YDAESERQ+ VEE 
Sbjct  15   EEKNVHSEDSNELVLHGAFPLAKH--ERQNGFNATDMNAFGNSFRNYDAESERQRMVEEL  72

Query  351  YRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTA  172
            YR+QHINQTYD+ KRMRE+YG+LDK+EM IWECCELLN+V DDSDPDLDEPQI+HLLQ+A
Sbjct  73   YRMQHINQTYDYGKRMREEYGKLDKLEMGIWECCELLNEVTDDSDPDLDEPQIQHLLQSA  132

Query  171  EAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            EAIRKDYP++ WLHLTALIH                    GDTFPLGCAFDES VHH
Sbjct  133  EAIRKDYPNEDWLHLTALIH--------------------GDTFPLGCAFDESNVHH  169



>ref|XP_009767150.1| PREDICTED: inositol oxygenase 2-like [Nicotiana sylvestris]
Length=281

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 127/153 (83%), Gaps = 9/153 (6%)
 Frame = -3

Query  432  APEMNSFGQSFRAYD-AESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWE  256
             P+ N+FG +FR Y+ AES RQ+ VE FY+ QHI+QTYDFVK+MR++Y   +K +MSIWE
Sbjct  2    VPQTNAFGHNFRDYNNAESARQQGVENFYKTQHIHQTYDFVKKMRQEYANFNKAQMSIWE  61

Query  255  CCEllndvvddsdpdlDEPQIEHLLQ--------TAEAIRKDYPHQPWLHLTALIHDLGK  100
            CCELLNDVVDDSDPDLDEPQI+HLLQ        +AEAIRKDYP+Q WLHL ALIHDLGK
Sbjct  62   CCELLNDVVDDSDPDLDEPQIQHLLQNDRPGHHKSAEAIRKDYPNQDWLHLIALIHDLGK  121

Query  99   VLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            +L+ P FG LPQWAVVGDTFP+GCAFDESI+HH
Sbjct  122  ILVLPKFGGLPQWAVVGDTFPVGCAFDESIIHH  154



>ref|XP_002978216.1| hypothetical protein SELMODRAFT_176725 [Selaginella moellendorffii]
 gb|EFJ20873.1| hypothetical protein SELMODRAFT_176725 [Selaginella moellendorffii]
Length=311

 Score =   199 bits (507),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = -3

Query  471  VPKTLMSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDY  292
            + K ++ S   FE P  N+FG  FR Y+ ESER   VE FY++ H NQTYDF   MR+ +
Sbjct  27   IAKGMIGSMQAFEKPGANAFGHEFREYNKESERSSGVESFYKINHTNQTYDFAMEMRKKH  86

Query  291  GRLDKVEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIH  112
              LDK  M IWECCELLN+ VD+SDPDLDEPQIEHLLQTAEAIRKD+P++ W HLT LIH
Sbjct  87   LVLDKAVMGIWECCELLNEYVDESDPDLDEPQIEHLLQTAEAIRKDHPNEDWFHLTGLIH  146

Query  111  DLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVH  4
            DLGKVLLHP FGE PQWAVVGDTFPLGC F +SIVH
Sbjct  147  DLGKVLLHPKFGEEPQWAVVGDTFPLGCPFSKSIVH  182



>gb|KHG20649.1| Inositol oxygenase 5 [Gossypium arboreum]
Length=294

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 124/152 (82%), Gaps = 8/152 (5%)
 Frame = -3

Query  456  MSSNGGFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDK  277
            + SN  F  PE N+FG SFR        +  VE+ Y+  HINQTYDFVK+MRE+Y +LDK
Sbjct  24   LVSNDEFALPEKNAFGNSFR--------KDIVEQHYKSSHINQTYDFVKQMREEYMKLDK  75

Query  276  VEMSIWECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKV  97
             EM IWECCELLN+VVDDSDPDLDEPQI+HLLQ+AEAIRKDYP++ WLHLTALIHDLGK+
Sbjct  76   AEMGIWECCELLNEVVDDSDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKI  135

Query  96   LLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            L+ P FG LPQWAVVGDTFP+GCAFDES VHH
Sbjct  136  LVLPKFGGLPQWAVVGDTFPVGCAFDESNVHH  167



>ref|XP_007158874.1| hypothetical protein PHAVU_002G189000g [Phaseolus vulgaris]
 gb|ESW30868.1| hypothetical protein PHAVU_002G189000g [Phaseolus vulgaris]
Length=454

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = -3

Query  399  RAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSIWECCEllndvvdds  220
            R Y+ ESERQK VEEFYR+QH NQTYDF KRMRE Y  LDK EM IWECCELLN+VVDDS
Sbjct  29   RDYNIESERQKGVEEFYRLQHTNQTYDFAKRMREIYVILDKAEMGIWECCELLNEVVDDS  88

Query  219  dpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDLGKVLLHPSFGELPQWAVVGDTF  40
            DPDLDE QI+HLLQ+AEAIRKDYP Q WLHLTALIHDLGK+LL P FG LPQWAVVGDTF
Sbjct  89   DPDLDEAQIQHLLQSAEAIRKDYPDQDWLHLTALIHDLGKILLLPRFGALPQWAVVGDTF  148

Query  39   PLGCAFDESIVHH  1
            PLGCAFDES +HH
Sbjct  149  PLGCAFDESNIHH  161


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  DLGKVLLHPSFGELPQWAVVGDTFPLGCAFDESIVHH  1
            DL K+L+ P+FGELPQ AV GDTF +GC FD+S +HH
Sbjct  320  DLRKILVLPAFGELPQLAVFGDTFLVGCVFDKSNIHH  356



>ref|XP_008354188.1| PREDICTED: inositol oxygenase 2-like, partial [Malus domestica]
Length=253

 Score =   196 bits (498),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 137/172 (80%), Gaps = 17/172 (10%)
 Frame = -3

Query  573  MTILIIEKP--AEHVEEKQAVPSDN---ANELILDGGFVVPKTL-----------MSSNG  442
            MTILI E+P     VEEK+ + S+N    N+L+LDGGFVVPK +             SN 
Sbjct  1    MTILI-EQPELGLRVEEKKIISSENNGEMNDLVLDGGFVVPKEISKNDGTVAQEITGSNE  59

Query  441  GFEAPEMNSFGQSFRAYDAESERQKSVEEFYRVQHINQTYDFVKRMREDYGRLDKVEMSI  262
             F A E+NSFGQSFR Y+AESERQKSVEEFYR+ HINQT+DFVKRMRE+Y +L++VEMSI
Sbjct  60   AFIALEINSFGQSFRDYNAESERQKSVEEFYRLIHINQTHDFVKRMREEYSKLNRVEMSI  119

Query  261  WECCEllndvvddsdpdlDEPQIEHLLQTAEAIRKDYPHQPWLHLTALIHDL  106
            WECCELLNDV+DDSDPDLDEPQIEHLLQTAEAIRKDYP++ WLHLTALIH +
Sbjct  120  WECCELLNDVMDDSDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTALIHGI  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1017575415288