BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14646_g1_i2 len=147 path=[85:0-22 108:23-108 28:109-146]

Length=147
                                                                      Score     E

gb|EYU34015.1|  hypothetical protein MIMGU_mgv1a021513mg              80.9    5e-16   
gb|AFJ19235.1|  mixed amyrin synthase                                 76.6    1e-14   
gb|AEX99665.1|  amyrin synthase                                       76.6    1e-14   
gb|AJC01929.1|  dammarenediol synthase                                75.1    2e-14   
ref|XP_009344034.1|  PREDICTED: beta-amyrin synthase-like             72.0    6e-14   
gb|AGS16975.1|  dammarenediol synthase II                             74.3    8e-14   
gb|AJC01930.1|  dammarenediol synthase                                73.2    9e-14   
gb|KCW70926.1|  hypothetical protein EUGRSUZ_F040412                  71.6    9e-14   
gb|AHF22084.1|  OSC2                                                  74.3    9e-14   
gb|ADX01169.1|  putative beta-amyrin synthase                         73.9    1e-13   
gb|ADM86392.1|  putative beta-amyrin synthase                         74.3    1e-13   
gb|AJC01927.1|  dammarenediol synthase                                73.2    1e-13   
gb|AIS39793.1|  mixed amyrin synthase 1                               74.3    1e-13   
gb|AJC01928.1|  dammarenediol synthase                                72.8    1e-13   
ref|XP_009347736.1|  PREDICTED: beta-Amyrin Synthase 1-like           71.2    1e-13   
emb|CDP10664.1|  unnamed protein product                              73.6    2e-13   
ref|XP_010655247.1|  PREDICTED: beta-Amyrin Synthase 1 isoform X2     73.6    2e-13   
ref|XP_006468101.1|  PREDICTED: beta-amyrin synthase-like isoform X1  68.9    2e-13   
gb|KFK42270.1|  hypothetical protein AALP_AA2G234200                  73.6    2e-13   
ref|XP_006389937.1|  hypothetical protein EUTSA_v10018165mg           73.6    2e-13   
sp|E2IUA8.1|FRIES_KALDA  RecName: Full=Friedelin synthase; Short=...  73.6    2e-13   
ref|XP_010472731.1|  PREDICTED: camelliol C synthase-like isoform X1  73.6    2e-13   
gb|AHF49822.1|  bAS                                                   73.6    2e-13   
ref|XP_009106612.1|  PREDICTED: camelliol C synthase                  73.6    2e-13   
gb|AHX97777.1|  beta-amyrin synthase                                  73.6    2e-13   
emb|CDX88493.1|  BnaC06g39370D                                        73.6    2e-13   
ref|XP_011102143.1|  PREDICTED: beta-Amyrin Synthase 1-like           69.7    2e-13   
gb|KDO43821.1|  hypothetical protein CISIN_1g0264851mg                69.7    2e-13   
gb|AAD05032.1|  lupeol synthase                                       72.8    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006468103.1|  PREDICTED: beta-amyrin synthase-like             72.8    3e-13   
gb|AGI19258.1|  dammarenediol synthase                                72.8    3e-13   
sp|Q08IT1.1|DADIS_PANGI  RecName: Full=Dammarenediol II synthase      72.8    4e-13   Panax ginseng [Asiatic ginseng]
gb|AGI15962.1|  dammarenediol synthase                                72.8    4e-13   
gb|AIK21788.1|  dammarenediol-II synthase                             72.8    4e-13   
gb|AGS79229.1|  dammarenediol-II synthase                             72.8    4e-13   
gb|AEO27862.1|  dammarenediol synthase                                72.8    4e-13   
gb|AED99865.1|  DS synthase                                           72.8    4e-13   
gb|ACZ71036.1|  dammarenediol synthase protein                        72.8    4e-13   Panax ginseng [Asiatic ginseng]
dbj|BAD15332.1|  beta-amyrin synthase                                 72.4    4e-13   Panax ginseng [Asiatic ginseng]
ref|NP_683508.1|  camelliol C synthase 1                              72.4    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887764.1|  hypothetical protein ARALYDRAFT_477065           72.4    4e-13   
emb|CBI16770.3|  unnamed protein product                              68.9    6e-13   
ref|XP_010245756.1|  PREDICTED: beta-amyrin synthase-like             72.0    6e-13   
ref|XP_011096562.1|  PREDICTED: dammarenediol II synthase-like        72.0    6e-13   
ref|XP_010245746.1|  PREDICTED: beta-amyrin synthase-like isoform X1  72.0    6e-13   
ref|XP_009379199.1|  PREDICTED: beta-amyrin synthase-like             72.0    7e-13   
gb|AAC17080.1|  Strong similarity to lupeol synthase gb|U49919 an...  72.4    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006436402.1|  hypothetical protein CICLE_v100339301mg          71.2    7e-13   
ref|XP_010417509.1|  PREDICTED: camelliol C synthase                  71.6    7e-13   
emb|CDP12624.1|  unnamed protein product                              71.6    7e-13   
ref|XP_003521100.1|  PREDICTED: beta-amyrin synthase-like isoformX1   71.6    8e-13   
ref|XP_006300769.1|  hypothetical protein CARUB_v10019844mg           71.6    9e-13   
ref|XP_006374734.1|  hypothetical protein POPTR_0014s00350g           71.6    9e-13   
dbj|BAF63702.1|  mixed amyrin synthase                                71.6    9e-13   Olea europaea
ref|XP_002889222.1|  hypothetical protein ARALYDRAFT_316793           71.6    1e-12   
ref|XP_010065062.1|  PREDICTED: beta-amyrin synthase-like             71.2    1e-12   
ref|XP_009344016.1|  PREDICTED: beta-amyrin synthase-like             71.2    1e-12   
gb|AIS39794.1|  mixed amyrin synthase 2                               71.2    1e-12   
gb|AGK62449.1|  dammarenediol-II synthase                             71.2    1e-12   
gb|AED99864.1|  DS synthase                                           71.2    1e-12   
gb|AAC17055.1|  Strong similarity to lupeol synthase gb|U49919 fr...  70.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010065065.1|  PREDICTED: beta-amyrin synthase-like             70.5    1e-12   
gb|KDO43820.1|  hypothetical protein CISIN_1g0264851mg                68.2    1e-12   
ref|XP_002890175.1|  hypothetical protein ARALYDRAFT_334934           66.6    1e-12   
gb|AAB94341.1|  2,3-oxidosqualene-triterpenoid cyclase                70.9    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178018.1|  lupeol synthase 1                                   70.9    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007023608.1|  Beta-Amyrin Synthase                             70.9    2e-12   
sp|Q8W3Z1.1|BAMS_BETPL  RecName: Full=Beta-amyrin synthase            70.9    2e-12   Betula platyphylla [Asian white birch]
gb|EYU33367.1|  hypothetical protein MIMGU_mgv1a001775mg              70.9    2e-12   
ref|XP_002271333.1|  PREDICTED: beta-Amyrin Synthase 1 isoform X1     70.9    2e-12   Vitis vinifera
sp|E2IUA9.1|LUPS_KALDA  RecName: Full=Lupeol synthase; Short=KdLUS    70.5    2e-12   
emb|CBI18382.3|  unnamed protein product                              70.9    2e-12   
emb|CBI18406.3|  unnamed protein product                              70.9    2e-12   
gb|AAS01523.1|  putative beta-amyrin synthase                         70.5    2e-12   Centella asiatica [Asiatic pennywort]
gb|AGG09939.1|  beta-amyrin synthase                                  70.5    2e-12   
emb|CAN77299.1|  hypothetical protein VITISV_033299                   70.5    2e-12   Vitis vinifera
gb|KFK42272.1|  hypothetical protein AALP_AA2G234400                  70.5    2e-12   
ref|XP_004507562.1|  PREDICTED: beta-amyrin synthase-like isoform X1  70.5    2e-12   
ref|XP_006425178.1|  hypothetical protein CICLE_v10027855mg           70.5    2e-12   
ref|XP_009347735.1|  PREDICTED: beta-amyrin synthase-like             70.1    3e-12   
ref|XP_009370029.1|  PREDICTED: cycloartenol Synthase-like            70.1    3e-12   
ref|XP_010053899.1|  PREDICTED: beta-Amyrin Synthase 1-like           69.7    3e-12   
ref|XP_006306840.1|  hypothetical protein CARUB_v10008384mg           70.1    3e-12   
gb|KHN38796.1|  Beta-amyrin synthase                                  69.7    3e-12   
ref|XP_003636065.1|  Beta-amyrin synthase                             68.9    3e-12   
emb|CAN60786.1|  hypothetical protein VITISV_015054                   70.1    3e-12   Vitis vinifera
emb|CBI18386.3|  unnamed protein product                              68.9    3e-12   
gb|EYU38890.1|  hypothetical protein MIMGU_mgv1a001796mg              70.1    3e-12   
ref|XP_010091128.1|  Beta-amyrin synthase                             70.1    3e-12   
ref|XP_010539601.1|  PREDICTED: camelliol C synthase-like isoform X4  69.7    3e-12   
ref|XP_006436395.1|  hypothetical protein CICLE_v10030771mg           70.1    3e-12   
ref|XP_010313621.1|  PREDICTED: delta-amyrin synthase isoform X1      69.7    3e-12   
ref|XP_010539602.1|  PREDICTED: camelliol C synthase-like isoform X5  69.7    4e-12   
ref|XP_010065063.1|  PREDICTED: beta-amyrin synthase-like             69.7    4e-12   
gb|KCW70930.1|  hypothetical protein EUGRSUZ_F04043                   69.7    4e-12   
ref|XP_010531942.1|  PREDICTED: beta-amyrin synthase-like             69.7    4e-12   
ref|XP_006468107.1|  PREDICTED: beta-amyrin synthase-like             69.7    4e-12   
ref|XP_010054896.1|  PREDICTED: beta-amyrin synthase-like             69.7    4e-12   
gb|AGA17940.1|  beta-amyrin synthase                                  69.7    4e-12   
gb|AFM82492.1|  lupeol synthase                                       69.7    4e-12   
gb|KCW78276.1|  hypothetical protein EUGRSUZ_D02459                   69.7    4e-12   
ref|XP_009350597.1|  PREDICTED: beta-amyrin synthase-like             68.9    5e-12   
ref|XP_010655243.1|  PREDICTED: beta-Amyrin Synthase 1                69.3    5e-12   
gb|KCW70932.1|  hypothetical protein EUGRSUZ_F04049                   69.3    5e-12   
ref|XP_010063690.1|  PREDICTED: beta-amyrin synthase-like             69.3    5e-12   
ref|XP_010063691.1|  PREDICTED: beta-amyrin synthase-like             69.3    5e-12   
ref|XP_010245751.1|  PREDICTED: beta-amyrin synthase-like isoform X3  69.3    5e-12   
ref|XP_011085901.1|  PREDICTED: beta-amyrin synthase-like             69.3    5e-12   
ref|XP_011093795.1|  PREDICTED: beta-amyrin synthase                  69.3    5e-12   
ref|XP_010245749.1|  PREDICTED: beta-amyrin synthase-like isoform X1  69.3    5e-12   
emb|CBI18407.3|  unnamed protein product                              69.3    6e-12   
sp|E2IUA7.1|GLUTS_KALDA  RecName: Full=Glutinol synthase; Short=K...  69.3    6e-12   
gb|AIK19223.1|  triterpene synthase                                   68.9    7e-12   
ref|XP_010531953.1|  PREDICTED: camelliol C synthase-like isoform X3  68.9    7e-12   
ref|XP_010531955.1|  PREDICTED: camelliol C synthase-like isoform X5  68.9    7e-12   
ref|XP_002270934.1|  PREDICTED: beta-amyrin synthase                  68.9    7e-12   Vitis vinifera
ref|XP_010531954.1|  PREDICTED: camelliol C synthase-like isoform X4  68.9    7e-12   
ref|XP_008380418.1|  PREDICTED: beta-amyrin synthase                  68.9    7e-12   
ref|XP_009344015.1|  PREDICTED: beta-amyrin synthase                  68.9    7e-12   
ref|XP_009369010.1|  PREDICTED: beta-amyrin synthase-like             68.9    7e-12   
emb|CAN60316.1|  hypothetical protein VITISV_012054                   68.6    8e-12   Vitis vinifera
emb|CAN82129.1|  hypothetical protein VITISV_040666                   68.6    8e-12   Vitis vinifera
ref|XP_010313624.1|  PREDICTED: beta-amyrin synthase isoform X1       68.9    8e-12   
ref|XP_010531951.1|  PREDICTED: camelliol C synthase-like isoform X1  68.6    8e-12   
gb|ACO24697.1|  beta-amyrin synthase                                  68.6    9e-12   Gentiana straminea
gb|AGG09938.1|  beta-amyrin synthase                                  68.6    9e-12   
gb|KHG28038.1|  Beta-amyrin synthase                                  68.6    9e-12   
ref|XP_010531952.1|  PREDICTED: camelliol C synthase-like isoform X2  68.6    9e-12   
ref|NP_001234604.1|  beta-amyrin synthase                             68.6    9e-12   
gb|ACZ02441.1|  2,3-oxidosqualene cyclase                             64.3    9e-12   Diospyros kaki [Japanese persimmon]
ref|XP_009344148.1|  PREDICTED: beta-amyrin synthase-like             68.6    9e-12   
ref|XP_002269328.2|  PREDICTED: beta-Amyrin Synthase 1-like           68.6    9e-12   Vitis vinifera
ref|XP_002265019.2|  PREDICTED: beta-amyrin synthase-like             68.6    9e-12   Vitis vinifera
sp|A8C981.1|TARS_RHISY  RecName: Full=Taraxerol synthase; Short=RsM2  68.6    9e-12   Rhizophora stylosa
gb|AIK21791.1|  beta-amyrin synthase                                  68.6    9e-12   
ref|XP_002449432.1|  hypothetical protein SORBIDRAFT_05g011020        67.4    9e-12   Sorghum bicolor [broomcorn]
ref|XP_008353809.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amyrin ...  68.6    1e-11   
ref|XP_010245752.1|  PREDICTED: taraxerol synthase-like               68.6    1e-11   
ref|XP_008362478.1|  PREDICTED: beta-amyrin synthase                  68.6    1e-11   
emb|CBI18393.3|  unnamed protein product                              68.6    1e-11   
ref|XP_010532332.1|  PREDICTED: camelliol C synthase-like             68.6    1e-11   
ref|XP_010539600.1|  PREDICTED: camelliol C synthase-like isoform X3  68.6    1e-11   
ref|XP_008365698.1|  PREDICTED: beta-amyrin synthase-like             68.6    1e-11   
gb|KCW70929.1|  hypothetical protein EUGRSUZ_F04042                   68.2    1e-11   
emb|CBI20812.3|  unnamed protein product                              65.1    1e-11   
ref|XP_006436398.1|  hypothetical protein CICLE_v10033377mg           68.6    1e-11   
ref|XP_010520561.1|  PREDICTED: lanosterol synthase isoform X1        68.6    1e-11   
ref|XP_010520562.1|  PREDICTED: lanosterol synthase isoform X2        68.6    1e-11   
ref|XP_010539597.1|  PREDICTED: camelliol C synthase-like isoform X1  68.6    1e-11   
gb|ACM89978.1|  putative beta amyrin synthase                         68.6    1e-11   Malus domestica [apple tree]
gb|KGN63900.1|  hypothetical protein Csa_1G025820                     63.9    1e-11   
gb|KCW83375.1|  hypothetical protein EUGRSUZ_B00308                   68.2    1e-11   
ref|XP_008380417.1|  PREDICTED: beta-amyrin synthase-like             68.2    1e-11   
sp|O82140.1|BAMS1_PANGI  RecName: Full=Beta-Amyrin Synthase 1         68.2    1e-11   Panax ginseng [Asiatic ginseng]
dbj|BAD94022.1|  putative lupeol synthase                             67.0    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010027785.1|  PREDICTED: beta-amyrin synthase-like             68.2    1e-11   
ref|XP_010065064.1|  PREDICTED: beta-amyrin synthase-like             68.2    1e-11   
ref|XP_010027664.1|  PREDICTED: beta-amyrin synthase-like isoform X1  68.2    1e-11   
ref|XP_010696136.1|  PREDICTED: beta-amyrin synthase-like             68.2    1e-11   
ref|XP_010539599.1|  PREDICTED: camelliol C synthase-like isoform X2  68.2    1e-11   
ref|XP_010027674.1|  PREDICTED: beta-amyrin synthase-like isoform X2  68.2    1e-11   
ref|XP_010063688.1|  PREDICTED: beta-amyrin synthase-like             68.2    1e-11   
gb|AAO33580.1|AF478455_1  multifunctional beta-amyrin synthase        68.2    1e-11   Lotus japonicus
sp|E2IUA6.1|TARS_KALDA  RecName: Full=Taraxerol synthase; Short=K...  68.2    1e-11   
ref|XP_010655249.1|  PREDICTED: beta-amyrin synthase                  68.2    1e-11   
emb|CBI18395.3|  unnamed protein product                              67.8    1e-11   
ref|XP_004305792.1|  PREDICTED: beta-amyrin synthase-like             68.2    1e-11   
emb|CAN65908.1|  hypothetical protein VITISV_001241                   68.2    2e-11   Vitis vinifera
ref|XP_010537757.1|  PREDICTED: camelliol C synthase-like isoform X3  67.8    2e-11   
ref|XP_007224874.1|  hypothetical protein PRUPE_ppa022710mg           67.8    2e-11   
emb|CBI18408.3|  unnamed protein product                              68.2    2e-11   
ref|XP_003627087.1|  Beta-amyrin synthase                             67.8    2e-11   
ref|XP_009149097.1|  PREDICTED: amyrin synthase LUP2-like             67.8    2e-11   
ref|XP_010063692.1|  PREDICTED: beta-amyrin synthase                  67.8    2e-11   
emb|CAB72151.1|  oxidosqualene cyclase-like protein                   67.8    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104558.1|  PREDICTED: amyrin synthase LUP2-like             67.8    2e-11   
ref|XP_004251564.1|  PREDICTED: beta-amyrin synthase-like isoform X1  67.8    2e-11   
ref|XP_010537756.1|  PREDICTED: camelliol C synthase-like isoform X2  67.8    2e-11   
ref|XP_010537755.1|  PREDICTED: camelliol C synthase-like isoform X1  67.8    2e-11   
ref|XP_002305339.1|  putative oxidosqualene cyclase family protein    67.4    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_006436396.1|  hypothetical protein CICLE_v10033368mg           67.4    2e-11   
emb|CDY35103.1|  BnaA06g11130D                                        67.8    2e-11   
ref|XP_006656974.1|  PREDICTED: achilleol B synthase-like             67.4    2e-11   
gb|KDP25033.1|  hypothetical protein JCGZ_22568                       67.4    2e-11   
gb|ABL07607.1|  beta-amyrin synthase                                  67.4    2e-11   Polygala tenuifolia [Chinese senega-root]
sp|O82146.1|BAMS2_PANGI  RecName: Full=Beta-Amyrin Synthase 2         67.4    2e-11   Panax ginseng [Asiatic ginseng]
ref|XP_008223939.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...  67.4    3e-11   
dbj|BAG82628.1|  beta-amyrin synthase                                 67.4    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178016.2|  beta-amyrin synthase                                67.4    3e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CDY72111.1|  BnaCnng76020D                                        66.6    3e-11   
ref|XP_010655316.1|  PREDICTED: beta-Amyrin Synthase 1-like           66.6    3e-11   
ref|XP_002445263.1|  hypothetical protein SORBIDRAFT_07g007030        67.0    3e-11   Sorghum bicolor [broomcorn]
emb|CAN73194.1|  hypothetical protein VITISV_028269                   67.0    3e-11   Vitis vinifera
gb|AAO33579.1|AF478454_1  putative beta-amyrin synthase               67.0    3e-11   Lotus japonicus
emb|CDX88494.1|  BnaC06g39380D                                        67.0    3e-11   
dbj|BAE53429.1|  beta-amyrin synthase                                 67.0    3e-11   Lotus japonicus
gb|ABC33922.1|  beta-amyrin synthase                                  67.0    3e-11   Gypsophila paniculata
ref|XP_006488698.1|  PREDICTED: beta-amyrin synthase-like             67.0    3e-11   
gb|ACA13386.1|  beta-amyrin synthase                                  67.0    3e-11   Artemisia annua [sweet Annie]
ref|XP_009379200.1|  PREDICTED: beta-amyrin synthase-like             67.0    3e-11   
dbj|BAF01935.1|  putative lupeol synthase                             66.6    3e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ACB87531.1|  beta-amyrin synthase                                  67.0    3e-11   Artemisia annua [sweet Annie]
ref|NP_001234597.1|  delta-amyrin synthase                            67.0    4e-11   
gb|ABK76265.1|  beta-amyrin synthase                                  67.0    4e-11   Gypsophila vaccaria [bladder-soapwort]
ref|NP_178017.2|  lupeol synthase 2                                   66.6    4e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010052732.1|  PREDICTED: beta-amyrin synthase-like isoform X1  66.6    4e-11   
ref|XP_006364889.1|  PREDICTED: delta-amyrin synthase-like            66.6    4e-11   
ref|XP_010429761.1|  PREDICTED: beta-amyrin synthase                  66.6    4e-11   
ref|XP_009779991.1|  PREDICTED: beta-amyrin synthase-like             66.6    4e-11   
ref|XP_002887763.1|  ATLUP2                                           66.6    4e-11   
ref|NP_001172793.1|  Os02g0139500                                     63.2    5e-11   
ref|XP_007023625.1|  Cycloartenol synthase 1                          66.6    5e-11   
dbj|BAE43642.1|  beta-amyrin synthase                                 66.6    5e-11   Euphorbia tirucalli
ref|XP_003604121.1|  Beta-amyrin synthase                             66.6    5e-11   
gb|AAO33578.1|AF478453_1  beta-amyrin synthase                        66.6    5e-11   Medicago truncatula
ref|XP_007014076.1|  Cycloartenol synthase 1                          66.6    5e-11   
ref|XP_010106930.1|  Cycloartenol synthase                            66.6    5e-11   
ref|XP_006340479.1|  PREDICTED: cycloartenol Synthase-like            66.6    5e-11   
gb|ADK12003.1|  beta-amyrin synthase                                  66.2    5e-11   
ref|XP_011031246.1|  PREDICTED: beta-amyrin synthase-like             66.2    6e-11   
ref|XP_008384950.1|  PREDICTED: camelliol C synthase-like             62.8    6e-11   
emb|CDP08999.1|  unnamed protein product                              66.2    6e-11   
sp|Q2XPU6.1|CAS1_RICCO  RecName: Full=Cycloartenol synthase; Shor...  66.2    6e-11   Ricinus communis
ref|XP_002527812.1|  Cycloartenol synthase, putative                  66.2    6e-11   Ricinus communis
gb|AFZ93646.1|  cycloartenol synthase                                 66.2    6e-11   
ref|XP_006374736.1|  hypothetical protein POPTR_0014s00370g           66.2    6e-11   
ref|XP_006374737.1|  hypothetical protein POPTR_0014s00370g           66.2    6e-11   
dbj|BAA85267.1|  oxidosqualene cyclase                                66.2    6e-11   Luffa aegyptiaca [dishcloth gourd]
ref|XP_009337925.1|  PREDICTED: beta-amyrin synthase-like             66.2    6e-11   
ref|XP_008362067.1|  PREDICTED: cycloartenol synthase-like            64.3    6e-11   
ref|XP_007147805.1|  hypothetical protein PHAVU_006G156500g           66.2    6e-11   
gb|KHG27893.1|  Cycloartenol synthase                                 66.2    7e-11   
ref|XP_011009935.1|  PREDICTED: beta-amyrin synthase-like isoform X2  66.2    7e-11   
ref|XP_004301515.1|  PREDICTED: beta-amyrin synthase-like             65.5    7e-11   
ref|XP_002888561.1|  hypothetical protein ARALYDRAFT_475791           66.2    7e-11   
gb|ADE75873.1|  unknown                                               63.5    7e-11   
ref|XP_006371457.1|  hypothetical protein POPTR_0019s10800g           65.9    7e-11   
gb|KHN33083.1|  Beta-amyrin synthase                                  65.9    8e-11   
ref|XP_011009936.1|  PREDICTED: beta-amyrin synthase-like isoform X3  65.9    8e-11   
ref|XP_007025071.1|  Beta-Amyrin Synthase, putative                   65.9    9e-11   
ref|XP_002310351.1|  hypothetical protein POPTR_0007s15210g           65.9    9e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009345284.1|  PREDICTED: cycloartenol synthase 2-like          65.9    9e-11   
ref|XP_009344149.1|  PREDICTED: camelliol C synthase-like             61.2    9e-11   
gb|AET01563.2|  beta-amyrin synthase                                  65.9    9e-11   
ref|XP_011009937.1|  PREDICTED: beta-amyrin synthase-like isoform X4  65.5    1e-10   
ref|XP_008661275.1|  PREDICTED: achilleol B synthase-like isoform X4  65.5    1e-10   
ref|XP_011009932.1|  PREDICTED: beta-amyrin synthase-like isoform X1  65.9    1e-10   
ref|XP_011031247.1|  PREDICTED: beta-amyrin synthase                  65.9    1e-10   
ref|XP_007148271.1|  hypothetical protein PHAVU_006G1942000g          65.5    1e-10   
ref|XP_007148270.1|  hypothetical protein PHAVU_006G1942000g          65.5    1e-10   
ref|XP_002310349.1|  beta-Amyrin synthase family protein              65.5    1e-10   Populus trichocarpa [western balsam poplar]
gb|EMT31298.1|  Cycloartenol synthase                                 65.5    1e-10   
tpg|DAA47221.1|  TPA: hypothetical protein ZEAMMB73_272092            65.5    1e-10   
ref|XP_008777165.1|  PREDICTED: cycloartenol synthase-like            62.8    1e-10   
ref|XP_006598332.1|  PREDICTED: beta-amyrin synthase-like             65.5    1e-10   
gb|ABY90140.2|  beta-amyrin synthase                                  65.5    1e-10   Bupleurum chinense
ref|XP_008809098.1|  PREDICTED: cycloartenol synthase-like            63.2    1e-10   
ref|XP_006598306.1|  PREDICTED: beta-amyrin synthase-like             65.5    1e-10   
gb|KFK42271.1|  hypothetical protein AALP_AA2G234300                  65.5    1e-10   
gb|AFW70110.1|  hypothetical protein ZEAMMB73_823385                  65.1    1e-10   
ref|XP_009620777.1|  PREDICTED: cycloartenol Synthase-like isofor...  65.5    1e-10   
gb|AIY33888.1|  cycloartenol synthase                                 65.5    1e-10   
ref|XP_007214977.1|  hypothetical protein PRUPE_ppa001810mg           65.5    1e-10   
ref|XP_006409184.1|  hypothetical protein EUTSA_v10022563mg           65.5    1e-10   
emb|CDX79277.1|  BnaC06g20260D                                        65.1    1e-10   
ref|XP_008661273.1|  PREDICTED: achilleol B synthase-like isoform X2  65.1    1e-10   
ref|XP_010531948.1|  PREDICTED: camelliol C synthase-like isoform X2  65.1    1e-10   
emb|CDP17719.1|  unnamed protein product                              62.8    1e-10   
sp|F8WQD0.1|SHS1_ASTTA  RecName: Full=Shionone synthase; Short=At...  65.5    1e-10   
ref|XP_006389936.1|  hypothetical protein EUTSA_v10018166mg           65.1    1e-10   
ref|XP_008661272.1|  PREDICTED: achilleol B synthase-like isoform X1  65.1    1e-10   
ref|XP_007153005.1|  hypothetical protein PHAVU_004G178500g           65.1    1e-10   
gb|AIE17465.1|  oxidosqualene cyclase                                 65.1    1e-10   
emb|CDP15852.1|  unnamed protein product                              65.1    1e-10   
gb|EPS65499.1|  beta-amyrin synthase                                  65.1    1e-10   
emb|CDX87419.1|  BnaA07g34540D                                        65.1    1e-10   
ref|XP_008661274.1|  PREDICTED: achilleol B synthase-like isoform X3  65.1    1e-10   
ref|XP_008228023.1|  PREDICTED: beta-amyrin synthase                  65.1    1e-10   
gb|AFF27505.1|  beta-amyrin synthase                                  65.1    1e-10   
ref|XP_010417510.1|  PREDICTED: amyrin synthase LUP2-like isoform X1  65.1    1e-10   
ref|XP_008643825.1|  PREDICTED: cycloartenol synthase isoform X1      65.1    2e-10   
ref|XP_010417512.1|  PREDICTED: amyrin synthase LUP2-like isoform X3  65.1    2e-10   
ref|XP_010417511.1|  PREDICTED: amyrin synthase LUP2-like isoform X2  65.1    2e-10   
ref|XP_006364890.1|  PREDICTED: beta-amyrin synthase-like             65.1    2e-10   
ref|XP_010417513.1|  PREDICTED: amyrin synthase LUP2-like isoform X4  65.1    2e-10   
ref|XP_010531947.1|  PREDICTED: camelliol C synthase-like isoform X1  65.1    2e-10   
ref|XP_007135871.1|  hypothetical protein PHAVU_010G165100g           65.1    2e-10   
ref|XP_004309763.1|  PREDICTED: beta-amyrin synthase-like             65.1    2e-10   
ref|XP_010112462.1|  hypothetical protein L484_013846                 65.1    2e-10   
gb|ADG60271.1|  cycloartenol synthase                                 65.1    2e-10   
ref|XP_007147808.1|  hypothetical protein PHAVU_006G1566000g          64.7    2e-10   
gb|AET01567.2|  beta-amyrin synthase                                  65.1    2e-10   
ref|XP_009106614.1|  PREDICTED: amyrin synthase LUP2                  65.1    2e-10   
ref|XP_006656089.1|  PREDICTED: achilleol B synthase-like             65.1    2e-10   
ref|XP_007147800.1|  hypothetical protein PHAVU_006G156000g           65.1    2e-10   
ref|XP_008678653.1|  PREDICTED: achilleol B synthase-like             65.1    2e-10   
dbj|BAF93208.1|  cycloartenol synthase                                65.1    2e-10   
sp|A8C980.1|GERS_RHISY  RecName: Full=Germanicol synthase; Short=...  65.1    2e-10   
gb|AAG50587.1|AC083891_1  lupeol synthase, 5' partial                 62.0    2e-10   
gb|KHN00954.1|  Lupeol synthase                                       65.1    2e-10   
ref|XP_006606308.1|  PREDICTED: lupeol synthase-like isoform X1       65.1    2e-10   
ref|XP_009591746.1|  PREDICTED: beta-amyrin synthase-like             64.7    2e-10   
gb|ACH88048.1|  beta-amyrin synthase                                  64.7    2e-10   
gb|ACN34296.1|  unknown                                               64.7    2e-10   
gb|KDO39926.1|  hypothetical protein CISIN_1g043877mg                 60.8    2e-10   
ref|XP_006301366.1|  hypothetical protein CARUB_v10021777mg           64.7    2e-10   
ref|XP_011006636.1|  PREDICTED: beta-amyrin synthase-like             64.7    2e-10   
ref|XP_004959022.1|  PREDICTED: achilleol B synthase-like             64.7    2e-10   
ref|XP_007216254.1|  hypothetical protein PRUPE_ppa017215mg           64.7    2e-10   
ref|XP_003627091.1|  Beta-amyrin synthase                             64.7    2e-10   
ref|XP_008462186.1|  PREDICTED: cycloartenol synthase                 64.7    2e-10   
ref|XP_006374735.1|  hypothetical protein POPTR_0014s003601g          64.3    2e-10   
ref|XP_002450598.1|  hypothetical protein SORBIDRAFT_05g008010        62.4    2e-10   
ref|XP_004141754.1|  PREDICTED: cycloartenol synthase-like            64.7    2e-10   
ref|XP_004159000.1|  PREDICTED: cycloartenol synthase-like            64.7    2e-10   
dbj|BAE95410.1|  lanosterol synthase                                  64.7    2e-10   
gb|KFK33872.1|  hypothetical protein AALP_AA5G071200                  64.7    2e-10   
sp|O82139.1|CAS1_PANGI  RecName: Full=Cycloartenol Synthase           64.7    2e-10   
ref|XP_007214978.1|  hypothetical protein PRUPE_ppa001812mg           64.7    2e-10   
ref|XP_008661279.1|  PREDICTED: achilleol B synthase-like isoform X5  64.7    2e-10   
sp|Q2XPU7.1|LUPS_RICCO  RecName: Full=Lupeol synthase                 64.7    2e-10   
gb|ACN34222.1|  unknown                                               64.7    2e-10   
gb|KEH25840.1|  beta-amyrin synthase                                  64.7    2e-10   
gb|AGK62447.1|  cycloartenol synthase                                 64.7    2e-10   
sp|Q9LRH8.1|BAMS_PEA  RecName: Full=Beta-amyrin synthase              64.7    2e-10   
ref|XP_006416800.1|  hypothetical protein EUTSA_v10007055mg           64.3    2e-10   
ref|XP_007019802.1|  Cycloartenol synthase 1 isoform 1                64.3    3e-10   
ref|XP_008661282.1|  PREDICTED: achilleol B synthase-like isoform X6  64.3    3e-10   
ref|XP_007019803.1|  Cycloartenol synthase 1 isoform 2                64.3    3e-10   
gb|KEH27284.1|  cycloartenol synthase                                 64.3    3e-10   
gb|KHG20017.1|  Lupeol synthase                                       63.5    3e-10   
ref|XP_002304910.2|  putative oxidosqualene cyclase family protein    64.3    3e-10   
gb|KHG26534.1|  Lupeol synthase                                       63.5    3e-10   
ref|XP_011037652.1|  PREDICTED: beta-amyrin synthase-like             64.3    3e-10   
ref|XP_004167036.1|  PREDICTED: beta-Amyrin Synthase 1-like           62.0    3e-10   
gb|KHG12373.1|  Cycloartenol synthase 2                               64.3    3e-10   
sp|Q9LRH7.1|ABAMS_PEA  RecName: Full=Mixed-amyrin synthase            64.3    3e-10   
ref|XP_008341158.1|  PREDICTED: cycloartenol synthase 2-like          63.9    3e-10   
gb|EMS57649.1|  Cycloartenol synthase                                 61.6    3e-10   
ref|XP_004513125.1|  PREDICTED: lupeol synthase-like                  64.3    3e-10   
ref|XP_003620644.1|  Lanosterol synthase                              64.3    3e-10   
gb|AIE17466.1|  oxidosqualene cyclase                                 64.3    3e-10   
ref|XP_009623450.1|  PREDICTED: LOW QUALITY PROTEIN: lupeol synth...  63.2    3e-10   
ref|XP_010068963.1|  PREDICTED: cycloartenol Synthase-like            63.9    4e-10   
ref|XP_006409183.1|  hypothetical protein EUTSA_v10022563mg           63.9    4e-10   
ref|XP_006474650.1|  PREDICTED: cycloartenol synthase 2-like          63.9    4e-10   
ref|XP_006453177.1|  hypothetical protein CICLE_v10007530mg           63.9    4e-10   
gb|KDO62053.1|  hypothetical protein CISIN_1g043885mg                 63.9    4e-10   
ref|XP_003627088.1|  Beta-amyrin synthase                             63.5    4e-10   
ref|XP_010429762.1|  PREDICTED: amyrin synthase LUP2-like             63.9    4e-10   
gb|ACV21067.1|  beta-amyrin synthase                                  63.9    4e-10   
sp|Q8W3Z3.1|CAS2_BETPL  RecName: Full=Cycloartenol synthase 2         63.9    4e-10   
sp|Q9MB42.1|BAMS_GLYGL  RecName: Full=Beta-amyrin synthase            63.9    4e-10   
gb|ADE88148.1|  beta-amyrin synthase                                  63.9    4e-10   
gb|KHG20016.1|  Lupeol synthase                                       62.8    4e-10   
ref|XP_006368912.1|  hypothetical protein POPTR_0001s14610g           63.9    4e-10   
gb|AAC98864.1|  pentacyclic triterpene synthase                       63.9    4e-10   
gb|AAG41762.1|AF099968_1  pentacyclic triterpene synthase             63.9    4e-10   
dbj|BAL41371.1|  lupeol synthase                                      63.9    4e-10   
ref|XP_007147807.1|  hypothetical protein PHAVU_006G1566000g          63.5    4e-10   
ref|XP_006468102.1|  PREDICTED: beta-amyrin synthase-like isoform X2  59.7    4e-10   
sp|Q764T8.1|LUPS_GLYGL  RecName: Full=Lupeol synthase; Short=GgLUS1   63.9    4e-10   
sp|Q8W3Z4.1|CAS1_BETPL  RecName: Full=Cycloartenol synthase           63.9    4e-10   
ref|XP_010472733.1|  PREDICTED: amyrin synthase LUP2 isoform X1       63.9    4e-10   
dbj|BAG89975.1|  unnamed protein product                              63.2    4e-10   
ref|XP_010472735.1|  PREDICTED: amyrin synthase LUP2 isoform X2       63.9    4e-10   
gb|AAS01524.1|  cycloartenol synthase                                 63.9    5e-10   
ref|XP_006300770.1|  hypothetical protein CARUB_v10019849mg           63.9    5e-10   
gb|KEH22226.1|  beta-amyrin synthase                                  63.5    5e-10   
gb|KHG26533.1|  Lupeol synthase                                       62.8    5e-10   
ref|XP_004965451.1|  PREDICTED: achilleol B synthase-like             63.5    5e-10   
emb|CDY57947.1|  BnaA07g38460D                                        63.5    5e-10   
emb|CDP14235.1|  unnamed protein product                              63.5    5e-10   
ref|XP_009364429.1|  PREDICTED: beta-amyrin synthase-like             63.5    5e-10   
gb|AAX14716.1|  beta-amyrin synthase                                  63.5    5e-10   
ref|XP_008661271.1|  PREDICTED: achilleol B synthase-like isoform X3  63.5    5e-10   
ref|XP_008661270.1|  PREDICTED: achilleol B synthase-like isoform X2  63.5    5e-10   
gb|AIU41743.1|  beta-amyrin synthase                                  63.5    5e-10   
ref|XP_002531376.1|  Cycloartenol synthase, putative                  62.4    5e-10   
ref|XP_008661269.1|  PREDICTED: achilleol B synthase-like isoform X1  63.5    5e-10   
ref|XP_009370034.1|  PREDICTED: cycloartenol synthase 2               63.5    5e-10   
emb|CDY20917.1|  BnaC06g01370D                                        62.8    6e-10   
ref|XP_011017592.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...  63.5    6e-10   
gb|KEH18380.1|  beta-amyrin synthase                                  63.5    6e-10   
ref|XP_008661245.1|  PREDICTED: achilleol B synthase-like isoform X2  63.5    6e-10   
ref|XP_004157337.1|  PREDICTED: beta-Amyrin Synthase 1-like           60.8    6e-10   
ref|XP_002887124.1|  ATLUP2                                           63.2    6e-10   
ref|XP_008661241.1|  PREDICTED: achilleol B synthase-like isoform X1  63.2    6e-10   
emb|CBI30907.3|  unnamed protein product                              63.9    7e-10   
dbj|BAE53430.1|  lupeol synthase                                      63.2    7e-10   
ref|XP_004173097.1|  PREDICTED: beta-amyrin synthase-like             62.4    7e-10   
gb|EEE56271.1|  hypothetical protein OsJ_05320                        63.2    7e-10   
ref|XP_008809074.1|  PREDICTED: cycloartenol synthase-like isofor...  63.2    7e-10   
dbj|BAF35580.1|  multifunctional triterpene synthase                  63.2    7e-10   
ref|XP_002453283.1|  hypothetical protein SORBIDRAFT_04g003200        63.2    7e-10   
ref|XP_006453169.1|  hypothetical protein CICLE_v10007532mg           63.2    7e-10   
gb|EEC72449.1|  hypothetical protein OsI_05791                        63.2    7e-10   
ref|XP_002453282.1|  hypothetical protein SORBIDRAFT_04g003190        63.2    7e-10   
ref|XP_006474340.1|  PREDICTED: cycloartenol synthase 2-like isof...  63.2    7e-10   
ref|XP_003627085.1|  Beta-amyrin synthase                             61.2    7e-10   
ref|NP_001168640.1|  hypothetical protein                             63.2    7e-10   
gb|KHG20398.1|  Lupeol synthase                                       62.8    8e-10   
ref|XP_008809071.1|  PREDICTED: cycloartenol synthase-like isofor...  63.2    8e-10   
emb|CDX85103.1|  BnaC07g08030D                                        59.3    8e-10   
ref|XP_010429765.1|  PREDICTED: amyrin synthase LUP2-like isoform X1  63.2    8e-10   
ref|XP_008365649.1|  PREDICTED: beta-amyrin synthase                  63.2    8e-10   
ref|XP_010429766.1|  PREDICTED: amyrin synthase LUP2-like isoform X2  63.2    8e-10   
sp|Q9SLP9.1|CAS1_LUFAE  RecName: Full=Cycloartenol synthase; Shor...  63.2    8e-10   
ref|XP_003531781.1|  PREDICTED: beta-amyrin synthase-like isoform 1   63.2    8e-10   
gb|KHG20397.1|  Lupeol synthase                                       62.8    8e-10   
ref|XP_009779988.1|  PREDICTED: beta-amyrin synthase                  63.2    8e-10   
gb|KHN33631.1|  Beta-amyrin synthase                                  62.8    9e-10   
gb|AFW74541.1|  hypothetical protein ZEAMMB73_859231                  60.1    9e-10   
ref|XP_009362029.1|  PREDICTED: cycloartenol synthase 2-like          62.8    9e-10   
gb|KHN39383.1|  Beta-amyrin synthase                                  62.8    9e-10   
ref|XP_006582958.1|  PREDICTED: beta-amyrin synthase isoform X1       62.8    9e-10   
ref|XP_004972557.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...  62.8    9e-10   
gb|KFK40207.1|  hypothetical protein AALP_AA3G344300                  62.8    9e-10   
ref|NP_001236591.1|  beta-amyrin synthase                             62.8    9e-10   
sp|Q6BE25.1|CAS1_CUCPE  RecName: Full=Cycloartenol synthase           62.8    1e-09   
ref|XP_002264289.1|  PREDICTED: cycloartenol Synthase                 62.8    1e-09   
ref|XP_002446429.1|  hypothetical protein SORBIDRAFT_06g015952        58.5    1e-09   
gb|EYU26562.1|  hypothetical protein MIMGU_mgv1a001674mg              62.8    1e-09   
ref|XP_002877385.1|  hypothetical protein ARALYDRAFT_905658           62.8    1e-09   
gb|AHI17180.1|  beta-amyrin synthase                                  62.8    1e-09   
sp|A8CDT2.1|BAS_BRUGY  RecName: Full=Beta-amyrin synthase; Short=...  62.8    1e-09   
gb|KHN32928.1|  Cycloartenol synthase                                 62.8    1e-09   
dbj|BAF73929.1|  cycloartenol synthase                                62.8    1e-09   
ref|NP_001045851.1|  Os02g0140200                                     62.4    1e-09   
ref|XP_009764017.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...  62.8    1e-09   
gb|EMT15654.1|  Cycloartenol synthase                                 60.1    1e-09   
ref|XP_006453168.1|  hypothetical protein CICLE_v10007532mg           62.8    1e-09   
ref|XP_006474339.1|  PREDICTED: cycloartenol synthase 2-like isof...  62.8    1e-09   
ref|NP_001152006.1|  cycloartenol synthase                            62.8    1e-09   
ref|XP_011019952.1|  PREDICTED: cycloartenol synthase 2-like          62.8    1e-09   
ref|XP_003517615.1|  PREDICTED: cycloartenol synthase-like            62.8    1e-09   
dbj|BAB83254.1|  multifunctional triterpene synthase                  62.4    1e-09   
ref|XP_004305793.1|  PREDICTED: beta-amyrin synthase-like             62.4    1e-09   
ref|XP_007153003.1|  hypothetical protein PHAVU_004G178300g           62.4    1e-09   
ref|XP_006408625.1|  hypothetical protein EUTSA_v10001913mg           62.4    1e-09   
gb|AEM42982.1|  cucurbitadienol synthase                              62.4    1e-09   
ref|XP_006351975.1|  PREDICTED: beta-amyrin synthase-like             62.4    1e-09   
ref|XP_008223938.1|  PREDICTED: cycloartenol synthase 2               62.4    1e-09   
ref|XP_007225240.1|  hypothetical protein PRUPE_ppa001844mg           62.4    1e-09   
ref|XP_010112464.1|  hypothetical protein L484_013848                 62.4    1e-09   
ref|XP_006488602.1|  PREDICTED: beta-amyrin synthase-like             62.4    1e-09   
dbj|BAE95409.1|  oxidosqualene cyclase                                62.4    1e-09   
gb|EMS53487.1|  Cycloartenol synthase                                 62.4    1e-09   
ref|XP_010655252.1|  PREDICTED: cycloartenol Synthase isoform X1      62.4    1e-09   
gb|EMT12088.1|  Cycloartenol synthase                                 62.4    1e-09   
ref|XP_010655253.1|  PREDICTED: cycloartenol Synthase isoform X2      62.4    1e-09   
gb|EMS57560.1|  hypothetical protein TRIUR3_04749                     58.9    1e-09   
ref|XP_010091121.1|  Lupeol synthase                                  62.4    1e-09   
ref|XP_004510379.1|  PREDICTED: mixed-amyrin synthase-like            62.4    1e-09   
ref|XP_008465722.1|  PREDICTED: beta-amyrin synthase-like isoform X1  62.4    1e-09   
sp|E2IUB0.1|CASS_KALDA  RecName: Full=Cycloartenol synthase; Shor...  62.4    1e-09   
gb|KDP27754.1|  hypothetical protein JCGZ_19783                       62.4    2e-09   
gb|ABG22398.1|  Cycloartenol synthase, putative, expressed            62.0    2e-09   
gb|KHN38795.1|  Beta-amyrin synthase                                  62.0    2e-09   
ref|XP_011094034.1|  PREDICTED: cycloartenol Synthase                 62.4    2e-09   
gb|KEH28511.1|  beta-amyrin synthase                                  62.4    2e-09   
dbj|BAF73930.1|  cycloartenol synthase                                62.0    2e-09   
dbj|BAG97845.1|  unnamed protein product                              61.6    2e-09   
ref|XP_004143785.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amyrin ...  62.4    2e-09   
emb|CDP12480.1|  unnamed protein product                              62.0    2e-09   
ref|XP_003521102.1|  PREDICTED: beta-amyrin synthase-like isoform X1  62.0    2e-09   
gb|EEC72453.1|  hypothetical protein OsI_05797                        62.0    2e-09   
gb|EEE56273.1|  hypothetical protein OsJ_05325                        62.0    2e-09   
gb|AGA17939.1|  lupeol synthase                                       62.0    2e-09   
ref|NP_001176396.1|  Os11g0189600                                     62.0    2e-09   
emb|CAA75588.1|  cycloartenol synthase                                61.6    2e-09   
ref|XP_007134028.1|  hypothetical protein PHAVU_010G013200g           62.0    2e-09   
ref|NP_001045853.1|  Os02g0140400                                     61.6    2e-09   
sp|H2KWF1.1|PAKSY_ORYSJ  RecName: Full=Parkeol synthase               62.0    2e-09   
ref|XP_010234472.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...  62.0    2e-09   
dbj|BAA86931.1|  cycloartenol synthase                                61.6    2e-09   
ref|XP_008465723.1|  PREDICTED: beta-amyrin synthase-like isoform X2  62.0    2e-09   
gb|KEH22896.1|  cycloartenol synthase                                 62.0    2e-09   
ref|XP_006474653.1|  PREDICTED: cycloartenol Synthase-like            62.0    2e-09   
gb|KHN32929.1|  Cycloartenol synthase                                 62.0    2e-09   
ref|XP_008459938.1|  PREDICTED: cucurbitadienol synthase              62.0    2e-09   
gb|KDP37007.1|  hypothetical protein JCGZ_06063                       62.0    2e-09   
emb|CBI30890.3|  unnamed protein product                              62.0    2e-09   
gb|EMS63323.1|  Cycloartenol synthase                                 61.6    2e-09   
ref|XP_008462187.1|  PREDICTED: isomultiflorenol synthase             62.0    2e-09   
ref|XP_003516849.1|  PREDICTED: cycloartenol synthase                 62.0    2e-09   
gb|KDP37006.1|  hypothetical protein JCGZ_06062                       62.0    2e-09   
emb|CDP12483.1|  unnamed protein product                              62.0    2e-09   
gb|EMS58271.1|  Cycloartenol synthase                                 62.0    2e-09   
ref|XP_011031251.1|  PREDICTED: cycloartenol synthase-like            61.6    2e-09   
ref|XP_010656689.1|  PREDICTED: lupeol synthase isoform X2            61.6    2e-09   
ref|XP_010048520.1|  PREDICTED: LOW QUALITY PROTEIN: lupeol synth...  61.6    2e-09   
gb|KCW80789.1|  hypothetical protein EUGRSUZ_C02165                   61.6    2e-09   
emb|CBI24038.3|  unnamed protein product                              61.6    2e-09   
gb|KEH27290.1|  beta-amyrin synthase                                  61.6    2e-09   
ref|XP_002269060.2|  PREDICTED: lupeol synthase isoform X1            61.6    2e-09   
ref|XP_008391430.1|  PREDICTED: cycloartenol synthase 2 isoform X1    61.6    2e-09   
gb|KHG28306.1|  Beta-amyrin synthase                                  61.6    2e-09   
gb|AAX95229.1|  Similar to cycloartenol synthase                      60.1    3e-09   
ref|XP_009612988.1|  PREDICTED: beta-amyrin synthase                  61.6    3e-09   



>gb|EYU34015.1| hypothetical protein MIMGU_mgv1a021513mg [Erythranthe guttata]
Length=727

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 36/46 (78%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQVSQLF  10
            TSWAMLGLMY G AERD TPLHKA KLLIN Q+ DGDFPQQV+  F
Sbjct  682  TSWAMLGLMYGGQAERDPTPLHKAAKLLINEQMSDGDFPQQVNHFF  727



>gb|AFJ19235.1| mixed amyrin synthase [Catharanthus roseus]
Length=762

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLMY G AERD TPLHKA KLLINAQ++DGDFPQQ
Sbjct  683  TSWAMLGLMYGGQAERDPTPLHKAAKLLINAQMDDGDFPQQ  723



>gb|AEX99665.1| amyrin synthase [Catharanthus roseus]
Length=762

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLMY G AERD TPLHKA KLLINAQ++DGDFPQQ
Sbjct  683  TSWAMLGLMYGGQAERDPTPLHKAAKLLINAQMDDGDFPQQ  723



>gb|AJC01929.1| dammarenediol synthase, partial [Panax ginseng]
Length=367

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G AERD TPLH+A KLLINAQ+++GDFPQQ
Sbjct  286  TSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDNGDFPQQ  326



>ref|XP_009344034.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=211

 Score = 72.0 bits (175),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ-VSQLF*LN  1
            T+WAM+GL+Y G AERD  PLH+A KL+IN+Q+E+GDFPQQ ++ +F +N
Sbjct  132  TAWAMMGLIYAGQAERDPAPLHRAAKLIINSQMENGDFPQQEIAGVFKMN  181



>gb|AGS16975.1| dammarenediol synthase II [Panax vietnamensis]
Length=769

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G AERD TPLH+A KLLINAQ+++GDFPQQ
Sbjct  686  TSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDNGDFPQQ  726



>gb|AJC01930.1| dammarenediol synthase, partial [Panax ginseng]
Length=371

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G AERD TPLH+A KLLINAQ+++GDFP Q
Sbjct  297  TSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDNGDFPHQ  337



>gb|KCW70926.1| hypothetical protein EUGRSUZ_F040412, partial [Eucalyptus grandis]
Length=270

 Score = 71.6 bits (174),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KLLIN+Q+EDGD+PQQ
Sbjct  190  TAWAMMGLIHAGQAERDPTPLHRAAKLLINSQMEDGDYPQQ  230



>gb|AHF22084.1| OSC2 [Artemisia annua]
Length=760

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G AERD TPLHKA K+LINAQ++DGDFPQQ
Sbjct  682  TSWAMLGLMFGGQAERDPTPLHKAAKILINAQMDDGDFPQQ  722



>gb|ADX01169.1| putative beta-amyrin synthase [Bacopa monnieri]
Length=643

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAMLGLMY G AERD TPL KA KLLINAQ+EDGDFPQQ
Sbjct  558  TAWAMLGLMYGGQAERDTTPLDKAAKLLINAQMEDGDFPQQ  598



>gb|ADM86392.1| putative beta-amyrin synthase [Bacopa monnieri]
Length=764

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAMLGLMY G AERD TPL KA KLLINAQ+EDGDFPQQ
Sbjct  679  TAWAMLGLMYGGQAERDTTPLDKAAKLLINAQMEDGDFPQQ  719



>gb|AJC01927.1| dammarenediol synthase, partial [Panax ginseng]
 gb|AJC01931.1| dammarenediol synthase, partial [Panax ginseng]
Length=380

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G AERD TPLH+A KLLINAQ+++GDFPQQ
Sbjct  297  TSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDNGDFPQQ  337



>gb|AIS39793.1| mixed amyrin synthase 1 [Ilex asprella var. asprella]
Length=762

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GLMY G AERD TPLH+A KLLINAQ++DGDFPQQ
Sbjct  682  TAWAMMGLMYAGQAERDPTPLHRAAKLLINAQMDDGDFPQQ  722



>gb|AJC01928.1| dammarenediol synthase, partial [Panax ginseng]
Length=380

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G AERD TPLH+A KLLINAQ+++GDFPQQ
Sbjct  297  TSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDNGDFPQQ  337



>ref|XP_009347736.1| PREDICTED: beta-Amyrin Synthase 1-like [Pyrus x bretschneideri]
Length=216

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KL+IN+Q+E+GDFPQQ
Sbjct  138  TAWAMMGLIHVGQAERDPTPLHRAAKLIINSQMENGDFPQQ  178



>emb|CDP10664.1| unnamed protein product [Coffea canephora]
Length=761

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G AERD TPLHK  KLLINAQ++DGDFPQQ
Sbjct  682  TSWAMLGLMFGGQAERDPTPLHKGAKLLINAQMDDGDFPQQ  722



>ref|XP_010655247.1| PREDICTED: beta-Amyrin Synthase 1 isoform X2 [Vitis vinifera]
Length=735

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQVSQLF  10
            T WA++GL+ +G AERD TPLH+A KLLIN+Q+EDGDFPQQ+  +F
Sbjct  681  TGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDGDFPQQIIGIF  726



>ref|XP_006468101.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Citrus sinensis]
Length=95

 Score = 68.9 bits (167),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+ L++ G  ERD TPLH+A KLLIN+QLEDGDFPQQ
Sbjct  16   TSWAMMALIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQ  56



>gb|KFK42270.1| hypothetical protein AALP_AA2G234200 [Arabis alpina]
Length=759

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL++ G AERD TPLH+A KLLIN+QLE+GDFPQQ
Sbjct  683  TSWAMMGLLHAGQAERDPTPLHRAAKLLINSQLENGDFPQQ  723



>ref|XP_006389937.1| hypothetical protein EUTSA_v10018165mg [Eutrema salsugineum]
 gb|ESQ27223.1| hypothetical protein EUTSA_v10018165mg [Eutrema salsugineum]
Length=765

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL++ G AERD TPLH+A KLLIN+QLE+GDFPQQ
Sbjct  685  TSWAMMGLLHAGQAERDPTPLHRAAKLLINSQLENGDFPQQ  725



>sp|E2IUA8.1|FRIES_KALDA RecName: Full=Friedelin synthase; Short=KdFRS [Kalanchoe daigremontiana]
 gb|ADK35125.1| friedelin synthase [Kalanchoe daigremontiana]
Length=767

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ-VSQLF*LN  1
            TSWA++GL+Y G A+RD TPLH+A KLLIN+QLEDGDFPQQ ++ +F +N
Sbjct  682  TSWALMGLIYAGQADRDPTPLHRAAKLLINSQLEDGDFPQQEIAGVFKMN  731



>ref|XP_010472731.1| PREDICTED: camelliol C synthase-like isoform X1 [Camelina sativa]
Length=768

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL++ G AERD TPLH+A KLLIN+QLE+GDFPQQ
Sbjct  682  TSWAMMGLLHAGQAERDPTPLHRAAKLLINSQLENGDFPQQ  722



>gb|AHF49822.1| bAS [Maesa lanceolata]
Length=760

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL++TG AERD TPLH+A KLLIN+Q E+GDFPQQ
Sbjct  683  TSWAMMGLIHTGQAERDPTPLHRAAKLLINSQFENGDFPQQ  723



>ref|XP_009106612.1| PREDICTED: camelliol C synthase [Brassica rapa]
 emb|CDX87420.1| BnaA07g34530D [Brassica napus]
Length=768

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL++ G AERD TPLH+A KLLIN+QLE+GDFPQQ
Sbjct  683  TSWAMMGLLHAGQAERDPTPLHRAAKLLINSQLENGDFPQQ  723



>gb|AHX97777.1| beta-amyrin synthase [Gentiana straminea]
Length=758

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL+++G AERD TPLH+A KL+IN+Q+EDGDFPQQ
Sbjct  681  TSWAMMGLIHSGQAERDPTPLHRAAKLIINSQMEDGDFPQQ  721



>emb|CDX88493.1| BnaC06g39370D [Brassica napus]
Length=778

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL++ G AERD TPLH+A KLLIN+QLE+GDFPQQ
Sbjct  683  TSWAMMGLLHAGQAERDPTPLHRAAKLLINSQLENGDFPQQ  723



>ref|XP_011102143.1| PREDICTED: beta-Amyrin Synthase 1-like [Sesamum indicum]
Length=139

 Score = 69.7 bits (169),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+++G A+RD TPLH+  KLLIN+QLEDGDFPQQ
Sbjct  57   TAWAMMGLIHSGQADRDPTPLHRGAKLLINSQLEDGDFPQQ  97



>gb|KDO43821.1| hypothetical protein CISIN_1g0264851mg, partial [Citrus sinensis]
Length=151

 Score = 69.7 bits (169),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+ L++ G  ERD TPLH+A KLLIN+QLEDGDFPQQ
Sbjct  111  TAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQ  151



>gb|AAD05032.1| lupeol synthase [Arabidopsis thaliana]
Length=757

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+ L++TG AERDLTPLH+A KL+IN+QLE+GDFPQQ
Sbjct  680  TSWAMMALIHTGQAERDLTPLHRAAKLIINSQLENGDFPQQ  720



>ref|XP_006468103.1| PREDICTED: beta-amyrin synthase-like [Citrus sinensis]
Length=763

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL++ G  ERD TPLH+A KLLIN+QLEDGDFPQQ
Sbjct  684  TSWAMMGLIHAGQMERDPTPLHRASKLLINSQLEDGDFPQQ  724



>gb|AGI19258.1| dammarenediol synthase [Panax notoginseng]
Length=769

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G AERD TPLH+A KLLINAQ+++GDFPQQ
Sbjct  686  TSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDNGDFPQQ  726



>sp|Q08IT1.1|DADIS_PANGI RecName: Full=Dammarenediol II synthase [Panax ginseng]
 dbj|BAF33291.1| dammarenediol-II synthase [Panax ginseng]
Length=769

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G AERD TPLH+A KLLINAQ+++GDFPQQ
Sbjct  686  TSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDNGDFPQQ  726



>gb|AGI15962.1| dammarenediol synthase [Panax quinquefolius]
Length=769

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G AERD TPLH+A KLLINAQ+++GDFPQQ
Sbjct  686  TSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDNGDFPQQ  726



>gb|AIK21788.1| dammarenediol-II synthase [Panax notoginseng]
Length=769

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G AERD TPLH+A KLLINAQ+++GDFPQQ
Sbjct  686  TSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDNGDFPQQ  726



>gb|AGS79229.1| dammarenediol-II synthase [Panax notoginseng]
Length=769

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G AERD TPLH+A KLLINAQ+++GDFPQQ
Sbjct  686  TSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDNGDFPQQ  726



>gb|AEO27862.1| dammarenediol synthase [Panax ginseng]
Length=769

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G AERD TPLH+A KLLINAQ+++GDFPQQ
Sbjct  686  TSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDNGDFPQQ  726



>gb|AED99865.1| DS synthase [Panax notoginseng]
Length=769

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G AERD TPLH+A KLLINAQ+++GDFPQQ
Sbjct  686  TSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDNGDFPQQ  726



>gb|ACZ71036.1| dammarenediol synthase protein [Panax ginseng]
Length=769

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G AERD TPLH+A KLLINAQ+++GDFPQQ
Sbjct  686  TSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDNGDFPQQ  726



>dbj|BAD15332.1| beta-amyrin synthase [Panax ginseng]
Length=769

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G AERD TPLH+A KLLINAQ+++GDFPQQ
Sbjct  686  TSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDNGDFPQQ  726



>ref|NP_683508.1| camelliol C synthase 1 [Arabidopsis thaliana]
 sp|P0C8Y0.1|LUP3_ARATH RecName: Full=Camelliol C synthase; AltName: Full=Lupeol synthase 
3; Short=AtLUP3 [Arabidopsis thaliana]
 gb|AEE36184.1| camelliol C synthase 1 [Arabidopsis thaliana]
Length=769

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL++ G AERD +PLH+A KLLIN+QLE+GDFPQQ
Sbjct  683  TSWAMMGLLHAGQAERDPSPLHRAAKLLINSQLENGDFPQQ  723



>ref|XP_002887764.1| hypothetical protein ARALYDRAFT_477065 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64023.1| hypothetical protein ARALYDRAFT_477065 [Arabidopsis lyrata subsp. 
lyrata]
Length=756

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+ L++TG AERDL PLH+A KL+IN+QLE+GDFPQQ
Sbjct  680  TSWAMMALIHTGQAERDLIPLHRAAKLIINSQLENGDFPQQ  720



>emb|CBI16770.3| unnamed protein product [Vitis vinifera]
Length=184

 Score = 68.9 bits (167),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WAML L+  G  ERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  102  TRWAMLALIRAGQEERDPTPLHRATKLLINSQMEDGDFPQQ  142



>ref|XP_010245756.1| PREDICTED: beta-amyrin synthase-like [Nelumbo nucifera]
Length=763

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+++G AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  681  TAWAMMGLIHSGQAERDATPLHRAAKLLINSQMEDGDFPQQ  721



>ref|XP_011096562.1| PREDICTED: dammarenediol II synthase-like [Sesamum indicum]
 ref|XP_011096564.1| PREDICTED: dammarenediol II synthase-like [Sesamum indicum]
Length=761

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGL+ +G AERD TPLH+A KLLINAQ++DGDFPQQ
Sbjct  682  TSWAMLGLLQSGQAERDPTPLHRAAKLLINAQMDDGDFPQQ  722



>ref|XP_010245746.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Nelumbo nucifera]
Length=762

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GLM+ G AERD TPLH+A KLLIN+QLE+GDFPQQ
Sbjct  681  TAWAMMGLMHAGQAERDATPLHRAAKLLINSQLENGDFPQQ  721



>ref|XP_009379199.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=761

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ-VSQLF*LN  1
            T+WAM+GL+Y G AERD  PLH+A KL+IN+QLE+GDFPQQ ++ +F +N
Sbjct  682  TAWAMMGLIYAGQAERDPAPLHRAAKLIINSQLENGDFPQQEIAGVFKMN  731



>gb|AAC17080.1| Strong similarity to lupeol synthase gb|U49919 and cycloartenol 
synthase gb|U02555 from A. thaliana (the third gene with 
similar homology) [Arabidopsis thaliana]
Length=1565

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL++ G AERD +PLH+A KLLIN+QLE+GDFPQQ
Sbjct  683  TSWAMMGLLHAGQAERDPSPLHRAAKLLINSQLENGDFPQQ  723


 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147   TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
             T+WA++GL+++G AERD  PLH+A KL+IN+QLE GDFPQQ
Sbjct  1489  TAWALMGLIHSGQAERDPIPLHRAAKLIINSQLESGDFPQQ  1529



>ref|XP_006436402.1| hypothetical protein CICLE_v100339301mg, partial [Citrus clementina]
 gb|ESR49642.1| hypothetical protein CICLE_v100339301mg, partial [Citrus clementina]
Length=529

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+ L++ G  ERD TPLH+A KLLIN+QLEDGDFPQQ
Sbjct  458  TSWAMMALIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQ  498



>ref|XP_010417509.1| PREDICTED: camelliol C synthase [Camelina sativa]
Length=594

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL++ G AERD  PLH+A KLLIN+QLE+GDFPQQ
Sbjct  508  TSWAMMGLLHAGQAERDPAPLHRAAKLLINSQLENGDFPQQ  548



>emb|CDP12624.1| unnamed protein product [Coffea canephora]
Length=761

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAMLGLM+ G AERD TPLHKA KLL+NAQ++DGDFPQQ
Sbjct  682  TAWAMLGLMHGGQAERDPTPLHKAAKLLMNAQMDDGDFPQQ  722



>ref|XP_003521100.1| PREDICTED: beta-amyrin synthase-like isoformX1 [Glycine max]
 ref|XP_006576765.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Glycine max]
Length=762

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+Y G +ERDLTPLH+A KLLIN+QLE+GD+PQQ
Sbjct  682  TAWALMGLIYAGQSERDLTPLHQAAKLLINSQLEEGDWPQQ  722



>ref|XP_006300769.1| hypothetical protein CARUB_v10019844mg [Capsella rubella]
 gb|EOA33667.1| hypothetical protein CARUB_v10019844mg [Capsella rubella]
Length=769

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL++ G AERD  PLH+A KLLIN+QLE+GDFPQQ
Sbjct  683  TSWAMMGLLHAGQAERDPAPLHRAAKLLINSQLENGDFPQQ  723



>ref|XP_006374734.1| hypothetical protein POPTR_0014s00350g [Populus trichocarpa]
 gb|ERP52531.1| hypothetical protein POPTR_0014s00350g [Populus trichocarpa]
Length=762

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+Y G  +RD+TPLH+A KL+IN+QLEDGDFPQQ
Sbjct  682  TAWAMMGLIYAGQMDRDITPLHRAAKLIINSQLEDGDFPQQ  722



>dbj|BAF63702.1| mixed amyrin synthase [Olea europaea]
Length=762

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLMY G AERD T LHKA KLLI+AQ++DGDFPQQ
Sbjct  683  TSWAMLGLMYGGQAERDPTSLHKAAKLLIDAQMDDGDFPQQ  723



>ref|XP_002889222.1| hypothetical protein ARALYDRAFT_316793 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65481.1| hypothetical protein ARALYDRAFT_316793 [Arabidopsis lyrata subsp. 
lyrata]
Length=1556

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL++ G AERD  PLH+A KLLIN+QLE+GDFPQQ
Sbjct  683  TSWAMMGLLHAGQAERDPAPLHRAAKLLINSQLENGDFPQQ  723


 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147   TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
             T+WA++GL+++G AERD  PLH+  KL+IN+QLE GDFPQQ
Sbjct  1480  TAWALMGLIHSGQAERDPVPLHRGAKLIINSQLESGDFPQQ  1520



>ref|XP_010065062.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW70925.1| hypothetical protein EUGRSUZ_F04040 [Eucalyptus grandis]
Length=761

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+G++Y G AERD TPLH+A KLLIN+Q+EDGD+PQQ
Sbjct  681  TAWAMMGMIYAGQAERDPTPLHRAAKLLINSQMEDGDYPQQ  721



>ref|XP_009344016.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=761

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ-VSQLF*LN  1
            T+WAM+GL+Y G AERD  PLH+A KL+IN+QLE+GDFPQQ ++ +F +N
Sbjct  682  TAWAMMGLIYGGQAERDPAPLHRAAKLIINSQLENGDFPQQEIAGVFKMN  731



>gb|AIS39794.1| mixed amyrin synthase 2 [Ilex asprella var. asprella]
Length=761

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WAM+GL+++G AERD TPLH+A KLLIN+Q+E+GDFPQQ
Sbjct  681  TGWAMMGLIHSGQAERDPTPLHRAAKLLINSQMENGDFPQQ  721



>gb|AGK62449.1| dammarenediol-II synthase [Panax quinquefolius]
Length=769

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWA+LGLM+ G AERD TPLH+A KLLINAQ+++GDFPQQ
Sbjct  686  TSWAILGLMFGGQAERDPTPLHRAAKLLINAQMDNGDFPQQ  726



>gb|AED99864.1| DS synthase [Panax quinquefolius]
Length=769

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWA+LGLM+ G AERD TPLH+A KLLINAQ+++GDFPQQ
Sbjct  686  TSWAILGLMFGGQAERDPTPLHRAAKLLINAQMDNGDFPQQ  726



>gb|AAC17055.1| Strong similarity to lupeol synthase gb|U49919 from A. thaliana, 
Landsberg strain. The cDNA gb|ATU49919 may come from this 
gene. EST gb|T22249 and gb|N96338 come from this gene (first 
gene in a series of three) [Arabidopsis thaliana]
Length=830

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+ L++TG AERDL PLH+A KL+IN+QLE+GDFPQQ
Sbjct  753  TSWAMMALIHTGQAERDLIPLHRAAKLIINSQLENGDFPQQ  793



>ref|XP_010065065.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
Length=512

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+G++Y G AERD +PLH+A KLLIN+Q+EDGD+PQQ
Sbjct  432  TAWAMMGMIYAGQAERDPSPLHRAAKLLINSQMEDGDYPQQ  472



>gb|KDO43820.1| hypothetical protein CISIN_1g0264851mg, partial [Citrus sinensis]
Length=199

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+ L++ G  ERD TPLH+A KLLIN+QLEDGDFPQQ
Sbjct  159  TAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQ  199



>ref|XP_002890175.1| hypothetical protein ARALYDRAFT_334934 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66434.1| hypothetical protein ARALYDRAFT_334934 [Arabidopsis lyrata subsp. 
lyrata]
Length=107

 Score = 66.6 bits (161),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++TG AERD  PLH+A KL+IN QLE+GD+PQQ
Sbjct  37   TAWAMMGLIHTGQAERDPMPLHRAAKLIINLQLENGDYPQQ  77



>gb|AAB94341.1| 2,3-oxidosqualene-triterpenoid cyclase [Arabidopsis thaliana]
Length=757

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+ L++TG AERDL PLH+A KL+IN+QLE+GDFPQQ
Sbjct  680  TSWAMMALIHTGQAERDLIPLHRAAKLIINSQLENGDFPQQ  720



>ref|NP_178018.1| lupeol synthase 1 [Arabidopsis thaliana]
 ref|NP_849903.1| lupeol synthase 1 [Arabidopsis thaliana]
 sp|Q9C5M3.1|LUP1_ARATH RecName: Full=Lupeol synthase 1; Short=AtLUP1; AltName: Full=Lupan-3-beta,20-diol 
synthase [Arabidopsis thaliana]
 gb|AAK25857.1|AF360147_1 putative lupeol synthase [Arabidopsis thaliana]
 gb|AAK96549.1| At1g78970/YUP8H12R_28 [Arabidopsis thaliana]
 gb|AAN13216.1| putative lupeol synthase [Arabidopsis thaliana]
 gb|AEE36186.1| lupeol synthase 1 [Arabidopsis thaliana]
 gb|AEE36187.1| lupeol synthase 1 [Arabidopsis thaliana]
Length=757

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+ L++TG AERDL PLH+A KL+IN+QLE+GDFPQQ
Sbjct  680  TSWAMMALIHTGQAERDLIPLHRAAKLIINSQLENGDFPQQ  720



>ref|XP_007023608.1| Beta-Amyrin Synthase [Theobroma cacao]
 gb|EOY26230.1| Beta-Amyrin Synthase [Theobroma cacao]
Length=758

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KL+IN+QLEDGDFPQQ
Sbjct  682  TAWAMMGLIHAGQAERDPTPLHRAAKLIINSQLEDGDFPQQ  722



>sp|Q8W3Z1.1|BAMS_BETPL RecName: Full=Beta-amyrin synthase [Betula platyphylla]
 dbj|BAB83088.1| beta-amyrin synthase [Betula platyphylla]
Length=779

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KL+IN+QLEDGDFPQQ
Sbjct  682  TAWAMMGLIHAGQAERDPTPLHRAAKLIINSQLEDGDFPQQ  722



>gb|EYU33367.1| hypothetical protein MIMGU_mgv1a001775mg [Erythranthe guttata]
Length=761

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLMY G AERD  PLHKA KLLIN Q+ DGDFPQQ
Sbjct  682  TSWAMLGLMYGGQAERDPMPLHKAAKLLINEQMIDGDFPQQ  722



>ref|XP_002271333.1| PREDICTED: beta-Amyrin Synthase 1 isoform X1 [Vitis vinifera]
 ref|XP_010655244.1| PREDICTED: beta-Amyrin Synthase 1 isoform X1 [Vitis vinifera]
 ref|XP_010655245.1| PREDICTED: beta-Amyrin Synthase 1 isoform X1 [Vitis vinifera]
 ref|XP_010655246.1| PREDICTED: beta-Amyrin Synthase 1 isoform X1 [Vitis vinifera]
Length=769

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+ +G AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  681  TGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDGDFPQQ  721



>sp|E2IUA9.1|LUPS_KALDA RecName: Full=Lupeol synthase; Short=KdLUS [Kalanchoe daigremontiana]
 gb|ADK35126.1| lupeol synthase [Kalanchoe daigremontiana]
Length=765

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWA++GL+Y G A+RD TPLH+A +LLIN+QLEDGDFPQQ
Sbjct  682  TSWALMGLIYAGQADRDPTPLHRAAQLLINSQLEDGDFPQQ  722



>emb|CBI18382.3| unnamed protein product [Vitis vinifera]
Length=885

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+ +G AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  797  TGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDGDFPQQ  837



>emb|CBI18406.3| unnamed protein product [Vitis vinifera]
Length=910

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+ +G AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  822  TGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDGDFPQQ  862



>gb|AAS01523.1| putative beta-amyrin synthase [Centella asiatica]
Length=760

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAMLGLM+ G A RD TPLH+A KLLINAQL +GDFPQQ
Sbjct  683  TSWAMLGLMFGGQATRDPTPLHRAAKLLINAQLNNGDFPQQ  723



>gb|AGG09939.1| beta-amyrin synthase [Panax quinquefolius]
 gb|AGK62450.1| beta-amyrin synthase [Panax quinquefolius]
Length=761

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL+++G AERD TPLH+A KLLIN+Q+E GDFPQQ
Sbjct  681  TSWAMMGLIHSGQAERDPTPLHRAAKLLINSQMESGDFPQQ  721



>emb|CAN77299.1| hypothetical protein VITISV_033299 [Vitis vinifera]
Length=755

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+ +G AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  667  TGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDGDFPQQ  707



>gb|KFK42272.1| hypothetical protein AALP_AA2G234400 [Arabis alpina]
Length=759

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQVS  19
            TSWA++GL+++G A+RD  PLH+AVKL+IN+QLE+GDFPQQ S
Sbjct  683  TSWALMGLIHSGQAKRDPVPLHRAVKLIINSQLENGDFPQQQS  725



>ref|XP_004507562.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Cicer arietinum]
Length=762

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA+LGL++ G AERDLTPLH+A KLLIN+QLE+G++PQQ
Sbjct  682  TAWALLGLIHVGQAERDLTPLHRAAKLLINSQLEEGNWPQQ  722



>ref|XP_006425178.1| hypothetical protein CICLE_v10027855mg [Citrus clementina]
 gb|ESR38418.1| hypothetical protein CICLE_v10027855mg [Citrus clementina]
Length=785

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KLLIN+QLEDGDFPQ+
Sbjct  689  TAWAMMGLLHAGQAERDPTPLHRAAKLLINSQLEDGDFPQE  729



>ref|XP_009347735.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=760

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KL+IN+Q+E+GDFPQQ
Sbjct  682  TAWAMMGLIHVGQAERDPTPLHRAAKLIINSQMENGDFPQQ  722



>ref|XP_009370029.1| PREDICTED: cycloartenol Synthase-like [Pyrus x bretschneideri]
Length=772

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WAMLGL+  G AERD TPLH+A KLLIN+Q+E+GDFPQQ
Sbjct  686  TGWAMLGLIDAGQAERDTTPLHRAAKLLINSQMENGDFPQQ  726



>ref|XP_010053899.1| PREDICTED: beta-Amyrin Synthase 1-like [Eucalyptus grandis]
Length=494

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL++ G AERD  PLH+A KL+IN+Q+E+GDFPQQ
Sbjct  417  TSWAMMGLIHAGQAERDPAPLHRAAKLIINSQMENGDFPQQ  457



>ref|XP_006306840.1| hypothetical protein CARUB_v10008384mg [Capsella rubella]
 gb|EOA39738.1| hypothetical protein CARUB_v10008384mg [Capsella rubella]
Length=761

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++TG AERD  PLH+A KL+IN+QLE+GD+PQQ
Sbjct  683  TAWAMMGLIHTGQAERDPVPLHRAAKLVINSQLENGDYPQQ  723



>gb|KHN38796.1| Beta-amyrin synthase [Glycine soja]
Length=641

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+Y G +ERDLTPLH+A KLLIN+QLE+GD+PQQ
Sbjct  561  TAWALMGLIYAGQSERDLTPLHQAAKLLINSQLEEGDWPQQ  601



>ref|XP_003636065.1| Beta-amyrin synthase, partial [Medicago truncatula]
Length=367

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQV  22
            TSWA++ L++ G AERD TPLH+AVKL+IN QL++GD+PQQV
Sbjct  323  TSWALMALIHAGQAERDATPLHRAVKLIINLQLKEGDWPQQV  364



>emb|CAN60786.1| hypothetical protein VITISV_015054 [Vitis vinifera]
Length=707

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQVS  19
            T W ++GL+++G AERD TPLH+A KLLIN+Q+EDGDFP Q S
Sbjct  359  TGWTLMGLIHSGQAERDPTPLHRAAKLLINSQMEDGDFPHQAS  401



>emb|CBI18386.3| unnamed protein product [Vitis vinifera]
Length=394

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+ +G AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  306  TGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDGDFPQQ  346



>gb|EYU38890.1| hypothetical protein MIMGU_mgv1a001796mg [Erythranthe guttata]
Length=758

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL++ G A+RD TPLH+A KLLIN+QL+DGDFPQQ
Sbjct  678  TSWAMMGLIHAGQADRDPTPLHRAAKLLINSQLQDGDFPQQ  718



>ref|XP_010091128.1| Beta-amyrin synthase [Morus notabilis]
 gb|EXB42563.1| Beta-amyrin synthase [Morus notabilis]
Length=877

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KL+IN+Q+E+GDFPQQ
Sbjct  821  TAWAMMGLIHAGQAERDPTPLHRAAKLIINSQMENGDFPQQ  861



>ref|XP_010539601.1| PREDICTED: camelliol C synthase-like isoform X4 [Tarenaya hassleriana]
Length=645

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL++ G AERD TPLH AVKL+IN+QLE+GDFPQQ
Sbjct  558  TAWAVMGLLHAGQAERDPTPLHPAVKLIINSQLENGDFPQQ  598



>ref|XP_006436395.1| hypothetical protein CICLE_v10030771mg [Citrus clementina]
 gb|ESR49635.1| hypothetical protein CICLE_v10030771mg [Citrus clementina]
Length=763

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+ L++ G  ERD TPLH+A KLLIN+QLEDGDFPQQ
Sbjct  684  TAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQ  724



>ref|XP_010313621.1| PREDICTED: delta-amyrin synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010313622.1| PREDICTED: delta-amyrin synthase isoform X1 [Solanum lycopersicum]
Length=768

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQV  22
            T+WA++GL+++G  ERD  PLH+A KLLIN+Q+EDGDFPQQ+
Sbjct  681  TAWALMGLIHSGQVERDPRPLHRAAKLLINSQMEDGDFPQQI  722



>ref|XP_010539602.1| PREDICTED: camelliol C synthase-like isoform X5 [Tarenaya hassleriana]
Length=770

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL++ G AERD TPLH AVKL+IN+QLE+GDFPQQ
Sbjct  693  TAWAVMGLLHAGQAERDPTPLHPAVKLIINSQLENGDFPQQ  733



>ref|XP_010065063.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
Length=661

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KLLIN+Q+EDGD+PQQ
Sbjct  548  TAWAMMGLIHAGQAERDPTPLHRAAKLLINSQMEDGDYPQQ  588



>gb|KCW70930.1| hypothetical protein EUGRSUZ_F04043 [Eucalyptus grandis]
Length=628

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KLLIN+Q+EDGD+PQQ
Sbjct  548  TAWAMMGLIHAGQAERDPTPLHRAAKLLINSQMEDGDYPQQ  588



>ref|XP_010531942.1| PREDICTED: beta-amyrin synthase-like [Tarenaya hassleriana]
Length=760

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWA++GL++ G AERD  PLH+A KL+IN+QLE+GDFPQQ
Sbjct  683  TSWALMGLLHAGQAERDQVPLHRAAKLIINSQLENGDFPQQ  723



>ref|XP_006468107.1| PREDICTED: beta-amyrin synthase-like [Citrus sinensis]
Length=763

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+ L++ G  ERD TPLH+A KLLIN+QLEDGDFPQQ
Sbjct  684  TAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQ  724



>ref|XP_010054896.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
Length=732

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL++ G AERD  PLH+A KL+IN+Q+E+GDFPQQ
Sbjct  655  TSWAMMGLIHAGQAERDPAPLHRAAKLIINSQMENGDFPQQ  695



>gb|AGA17940.1| beta-amyrin synthase [Withania somnifera]
Length=762

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+++G  +RDL PLH+A KLLIN+Q+EDGDFPQQ
Sbjct  682  TAWALMGLIHSGQVDRDLRPLHRAAKLLINSQMEDGDFPQQ  722



>gb|AFM82492.1| lupeol synthase [Eleutherococcus trifoliatus]
Length=763

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+++G AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  683  TGWALMGLIHSGQAERDPTPLHRAAKLLINSQMEDGDFPQQ  723



>gb|KCW78276.1| hypothetical protein EUGRSUZ_D02459 [Eucalyptus grandis]
Length=729

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL++ G AERD  PLH+A KL+IN+Q+E+GDFPQQ
Sbjct  652  TSWAMMGLIHAGQAERDPAPLHRAAKLIINSQMENGDFPQQ  692



>ref|XP_009350597.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=515

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+Y G AERD  PLH+A KL+IN+Q+E+GDFPQQ
Sbjct  436  TAWAMMGLIYAGQAERDPAPLHRAAKLIINSQMENGDFPQQ  476



>ref|XP_010655243.1| PREDICTED: beta-Amyrin Synthase 1 [Vitis vinifera]
 emb|CBI18392.3| unnamed protein product [Vitis vinifera]
Length=769

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+ +G AERD TPLHKA KLLIN+Q+EDGDFPQQ
Sbjct  681  TGWALMGLLSSGQAERDPTPLHKAAKLLINSQMEDGDFPQQ  721



>gb|KCW70932.1| hypothetical protein EUGRSUZ_F04049 [Eucalyptus grandis]
Length=720

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KLLIN+Q+EDGD+PQQ
Sbjct  640  TAWAMMGLIHAGQAERDPTPLHRAAKLLINSQMEDGDYPQQ  680



>ref|XP_010063690.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
Length=761

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KLLIN+Q+EDGD+PQQ
Sbjct  681  TAWAMMGLIHAGQAERDPTPLHRAAKLLINSQMEDGDYPQQ  721



>ref|XP_010063691.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW70924.1| hypothetical protein EUGRSUZ_F04039 [Eucalyptus grandis]
Length=761

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KLLIN+Q+EDGD+PQQ
Sbjct  681  TAWAMMGLIHAGQAERDPTPLHRAAKLLINSQMEDGDYPQQ  721



>ref|XP_010245751.1| PREDICTED: beta-amyrin synthase-like isoform X3 [Nelumbo nucifera]
Length=667

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL++ G AERD TPLH+A KLLIN+Q+E+GDFPQ+
Sbjct  585  TAWALMGLIHAGQAERDATPLHRAAKLLINSQMENGDFPQE  625



>ref|XP_011085901.1| PREDICTED: beta-amyrin synthase-like [Sesamum indicum]
Length=763

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+++G A+RD TPLH+  KLLIN+QLEDGDFPQQ
Sbjct  681  TAWAMMGLIHSGQADRDPTPLHRGAKLLINSQLEDGDFPQQ  721



>ref|XP_011093795.1| PREDICTED: beta-amyrin synthase [Sesamum indicum]
Length=763

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+++G A+RD TPLH+  KLLIN+QLEDGDFPQQ
Sbjct  681  TAWAMMGLIHSGQADRDPTPLHRGAKLLINSQLEDGDFPQQ  721



>ref|XP_010245749.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Nelumbo nucifera]
Length=763

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL++ G AERD TPLH+A KLLIN+Q+E+GDFPQ+
Sbjct  681  TAWALMGLIHAGQAERDATPLHRAAKLLINSQMENGDFPQE  721



>emb|CBI18407.3| unnamed protein product [Vitis vinifera]
Length=846

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+ +G AERD TPLH+A KLLIN Q+EDGDFPQQ
Sbjct  770  TGWALMGLISSGQAERDPTPLHRAAKLLINFQMEDGDFPQQ  810



>sp|E2IUA7.1|GLUTS_KALDA RecName: Full=Glutinol synthase; Short=KdGLS [Kalanchoe daigremontiana]
 gb|ADK35124.1| glutinol synthase [Kalanchoe daigremontiana]
Length=767

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ-VSQLF*LN  1
            TSWA++GL+ +G A+RD  PLH+A KLLIN+QLEDGDFPQQ ++ +F +N
Sbjct  682  TSWALMGLLCSGQADRDPNPLHRAAKLLINSQLEDGDFPQQEITGVFKMN  731



>gb|AIK19223.1| triterpene synthase [Eugenia uniflora]
Length=761

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WAM+GL++ G AERD TPLH+A KLLIN+Q+EDGD+PQQ
Sbjct  681  TGWAMMGLIHAGQAERDPTPLHRAAKLLINSQMEDGDYPQQ  721



>ref|XP_010531953.1| PREDICTED: camelliol C synthase-like isoform X3 [Tarenaya hassleriana]
Length=693

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL+++G AERD  PLH+A KL+IN+QLE GDFPQQ
Sbjct  615  TSWAMMGLLHSGQAERDPNPLHRAAKLIINSQLEKGDFPQQ  655



>ref|XP_010531955.1| PREDICTED: camelliol C synthase-like isoform X5 [Tarenaya hassleriana]
Length=690

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL+++G AERD  PLH+A KL+IN+QLE GDFPQQ
Sbjct  612  TSWAMMGLLHSGQAERDPNPLHRAAKLIINSQLEKGDFPQQ  652



>ref|XP_002270934.1| PREDICTED: beta-amyrin synthase [Vitis vinifera]
 ref|XP_010655248.1| PREDICTED: beta-amyrin synthase [Vitis vinifera]
Length=757

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+ +G AERD TPLH+A KLLIN Q+EDGDFPQQ
Sbjct  681  TGWALMGLISSGQAERDPTPLHRAAKLLINFQMEDGDFPQQ  721



>ref|XP_010531954.1| PREDICTED: camelliol C synthase-like isoform X4 [Tarenaya hassleriana]
Length=691

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL+++G AERD  PLH+A KL+IN+QLE GDFPQQ
Sbjct  613  TSWAMMGLLHSGQAERDPNPLHRAAKLIINSQLEKGDFPQQ  653



>ref|XP_008380418.1| PREDICTED: beta-amyrin synthase [Malus domestica]
Length=761

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+Y G AERD  PLH+A KL+IN+Q+E+GDFPQQ
Sbjct  682  TAWAMMGLIYAGQAERDPAPLHRAAKLIINSQMENGDFPQQ  722



>ref|XP_009344015.1| PREDICTED: beta-amyrin synthase [Pyrus x bretschneideri]
Length=761

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+Y G AERD  PLH+A KL+IN+Q+E+GDFPQQ
Sbjct  682  TAWAMMGLIYAGQAERDPAPLHRAAKLIINSQMENGDFPQQ  722



>ref|XP_009369010.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=761

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+Y G AERD  PLH+A KL+IN+Q+E+GDFPQQ
Sbjct  682  TAWAMMGLIYAGQAERDPAPLHRAAKLIINSQMENGDFPQQ  722



>emb|CAN60316.1| hypothetical protein VITISV_012054 [Vitis vinifera]
Length=664

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+ +G AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  576  TGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDGDFPQQ  616



>emb|CAN82129.1| hypothetical protein VITISV_040666 [Vitis vinifera]
Length=691

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+ +G AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  612  TGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDGDFPQQ  652



>ref|XP_010313624.1| PREDICTED: beta-amyrin synthase isoform X1 [Solanum lycopersicum]
Length=761

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+++G A+RD  PLH+A KLLIN+Q+EDGDFPQQ
Sbjct  681  TAWALMGLIHSGQADRDPKPLHRAAKLLINSQMEDGDFPQQ  721



>ref|XP_010531951.1| PREDICTED: camelliol C synthase-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010531958.1| PREDICTED: camelliol C synthase-like isoform X8 [Tarenaya hassleriana]
Length=762

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL+++G AERD  PLH+A KL+IN+QLE GDFPQQ
Sbjct  684  TSWAMMGLLHSGQAERDPNPLHRAAKLIINSQLEKGDFPQQ  724



>gb|ACO24697.1| beta-amyrin synthase [Gentiana straminea]
Length=755

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+++G A+RD TPLH A KLLIN+QLE+GDFPQQ
Sbjct  681  TAWAMMGLIHSGQAKRDPTPLHCAAKLLINSQLENGDFPQQ  721



>gb|AGG09938.1| beta-amyrin synthase, partial [Panax quinquefolius]
 gb|AGK27803.1| beta-amyrin synthase, partial [Panax quinquefolius]
Length=692

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ-VSQLF  10
            T WA++GL+++G A+RD TPLH+A KLLIN+Q+EDGDFPQQ +S +F
Sbjct  612  TGWALMGLIHSGQAKRDPTPLHRAAKLLINSQMEDGDFPQQEISGVF  658



>gb|KHG28038.1| Beta-amyrin synthase [Gossypium arboreum]
Length=693

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD  PLH+A KL+IN+QLEDGDFPQQ
Sbjct  617  TAWAMMGLIHAGQAERDPRPLHRAAKLIINSQLEDGDFPQQ  657



>ref|XP_010531952.1| PREDICTED: camelliol C synthase-like isoform X2 [Tarenaya hassleriana]
Length=706

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL+++G AERD  PLH+A KL+IN+QLE GDFPQQ
Sbjct  628  TSWAMMGLLHSGQAERDPNPLHRAAKLIINSQLEKGDFPQQ  668



>ref|NP_001234604.1| beta-amyrin synthase [Solanum lycopersicum]
 sp|E7DN63.1|BAMS_SOLLC RecName: Full=Beta-amyrin synthase; AltName: Full=Triterpenoid 
synthase 1; Short=SlTTS1 [Solanum lycopersicum]
 gb|ADU52574.1| beta-amyrin synthase [Solanum lycopersicum]
Length=761

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+++G A+RD  PLH+A KLLIN+Q+EDGDFPQQ
Sbjct  681  TAWALMGLIHSGQADRDPKPLHRAAKLLINSQMEDGDFPQQ  721



>gb|ACZ02441.1| 2,3-oxidosqualene cyclase [Diospyros kaki]
Length=98

 Score = 64.3 bits (155),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WAML L+  G AERD TPLH+A ++LIN+Q+E+GDFPQ+
Sbjct  21   TGWAMLALIDAGQAERDATPLHRAARVLINSQMENGDFPQE  61



>ref|XP_009344148.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=760

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KL+IN+Q+E+GDFPQQ
Sbjct  682  TAWAMMGLIHVGQAERDPTPLHRAAKLIINSQMENGDFPQQ  722



>ref|XP_002269328.2| PREDICTED: beta-Amyrin Synthase 1-like [Vitis vinifera]
Length=773

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+ +G AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  685  TGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDGDFPQQ  725



>ref|XP_002265019.2| PREDICTED: beta-amyrin synthase-like [Vitis vinifera]
Length=767

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+ +G AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  679  TGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDGDFPQQ  719



>sp|A8C981.1|TARS_RHISY RecName: Full=Taraxerol synthase; Short=RsM2 [Rhizophora stylosa]
 dbj|BAF80442.1| multifunctional triterpene synthase [Rhizophora stylosa]
Length=771

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQVS  19
            T+WA++GL+++G AERD TPLH++ KLLIN+Q  DGDFPQQ S
Sbjct  684  TAWALMGLIHSGQAERDPTPLHRSAKLLINSQTSDGDFPQQDS  726



>gb|AIK21791.1| beta-amyrin synthase, partial [Panax notoginseng]
Length=709

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ-VSQLF  10
            T WA++GL+++G A+RD TPLH+A KLLIN+Q+EDGDFPQQ +S +F
Sbjct  629  TGWALMGLIHSGQAKRDPTPLHRAAKLLINSQMEDGDFPQQEISGVF  675



>ref|XP_002449432.1| hypothetical protein SORBIDRAFT_05g011020 [Sorghum bicolor]
 gb|EES08420.1| hypothetical protein SORBIDRAFT_05g011020 [Sorghum bicolor]
Length=351

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WAML L+YT  AERD  PLH+A K+LIN QLEDG+FPQQ
Sbjct  273  TGWAMLALIYTEQAERDPAPLHRAAKVLINLQLEDGEFPQQ  313



>ref|XP_008353809.1| PREDICTED: LOW QUALITY PROTEIN: beta-amyrin synthase-like [Malus 
domestica]
Length=699

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KL+IN+Q+E+GDFPQQ
Sbjct  621  TAWAMMGLIHAGQAERDPTPLHRAAKLIINSQMENGDFPQQ  661



>ref|XP_010245752.1| PREDICTED: taraxerol synthase-like [Nelumbo nucifera]
 ref|XP_010245753.1| PREDICTED: taraxerol synthase-like [Nelumbo nucifera]
 ref|XP_010245754.1| PREDICTED: taraxerol synthase-like [Nelumbo nucifera]
Length=764

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL++ G AERD TPLH+A KLLIN+Q+E+GDFPQ+
Sbjct  682  TAWALMGLIHGGQAERDTTPLHRAAKLLINSQMENGDFPQE  722



>ref|XP_008362478.1| PREDICTED: beta-amyrin synthase [Malus domestica]
Length=750

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KL+IN+Q+E+GDFPQQ
Sbjct  682  TAWAMMGLIHAGQAERDPTPLHRAAKLIINSQMENGDFPQQ  722



>emb|CBI18393.3| unnamed protein product [Vitis vinifera]
Length=872

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+ +G AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  759  TGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDGDFPQQ  799



>ref|XP_010532332.1| PREDICTED: camelliol C synthase-like [Tarenaya hassleriana]
Length=740

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL+++G AERD  PLH+A KL+IN+QLE GDFPQQ
Sbjct  662  TSWAMMGLLHSGQAERDPEPLHRAAKLIINSQLESGDFPQQ  702



>ref|XP_010539600.1| PREDICTED: camelliol C synthase-like isoform X3 [Tarenaya hassleriana]
Length=683

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQV  22
            T+WA++GL++ G AERD TPLH AVKL+IN+QLE+GDFPQQ 
Sbjct  596  TAWAVMGLLHAGQAERDPTPLHPAVKLIINSQLENGDFPQQC  637



>ref|XP_008365698.1| PREDICTED: beta-amyrin synthase-like [Malus domestica]
Length=760

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KL+IN+Q+E+GDFPQQ
Sbjct  682  TAWAMMGLIHAGQAERDPTPLHRAAKLIINSQMENGDFPQQ  722



>gb|KCW70929.1| hypothetical protein EUGRSUZ_F04042 [Eucalyptus grandis]
Length=587

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH A KLLIN+Q+EDGD+PQQ
Sbjct  507  TAWAMMGLIHAGQAERDPTPLHHAAKLLINSQMEDGDYPQQ  547



>emb|CBI20812.3| unnamed protein product [Vitis vinifera]
Length=156

 Score = 65.1 bits (157),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+W+++GL+  G AERD  PLH+A KLLIN+Q+E+GDFPQQ
Sbjct  61   TAWSLMGLIPAGQAERDPPPLHRAAKLLINSQMENGDFPQQ  101



>ref|XP_006436398.1| hypothetical protein CICLE_v10033377mg, partial [Citrus clementina]
 gb|ESR49638.1| hypothetical protein CICLE_v10033377mg, partial [Citrus clementina]
Length=705

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+ L++ G  E+D TPLH+A KLLIN+QLEDGDFPQQ
Sbjct  665  TAWAMMSLIHAGQMEKDPTPLHRAAKLLINSQLEDGDFPQQ  705



>ref|XP_010520561.1| PREDICTED: lanosterol synthase isoform X1 [Tarenaya hassleriana]
Length=769

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAML L+  G A RD TPLH+  KLLIN+Q+EDGDFPQQ
Sbjct  688  TSWAMLALIEAGQASRDWTPLHRGAKLLINSQMEDGDFPQQ  728



>ref|XP_010520562.1| PREDICTED: lanosterol synthase isoform X2 [Tarenaya hassleriana]
Length=761

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAML L+  G A RD TPLH+  KLLIN+Q+EDGDFPQQ
Sbjct  680  TSWAMLALIEAGQASRDWTPLHRGAKLLINSQMEDGDFPQQ  720



>ref|XP_010539597.1| PREDICTED: camelliol C synthase-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010539598.1| PREDICTED: camelliol C synthase-like isoform X1 [Tarenaya hassleriana]
Length=719

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQV  22
            T+WA++GL++ G AERD TPLH AVKL+IN+QLE+GDFPQQ 
Sbjct  632  TAWAVMGLLHAGQAERDPTPLHPAVKLIINSQLENGDFPQQC  673



>gb|ACM89978.1| putative beta amyrin synthase [Malus domestica]
Length=762

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KL+IN+Q+E+GDFPQQ
Sbjct  682  TAWAMMGLIHAGQAERDPTPLHRAAKLIINSQMENGDFPQQ  722



>gb|KGN63900.1| hypothetical protein Csa_1G025820 [Cucumis sativus]
Length=80

 Score = 63.9 bits (154),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQVSQLF  10
            TSW +L L+ T  A+RD +PLH+A  +LIN+Q++DGDFPQQV  LF
Sbjct  25   TSWVLLALIQTDQAQRDPSPLHRAAMVLINSQMDDGDFPQQVFSLF  70



>gb|KCW83375.1| hypothetical protein EUGRSUZ_B00308 [Eucalyptus grandis]
Length=706

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+  G AERD TPLH+A KLLIN+Q+EDGD+PQQ
Sbjct  626  TAWAMMGLIQAGQAERDPTPLHRAAKLLINSQMEDGDYPQQ  666



>ref|XP_008380417.1| PREDICTED: beta-amyrin synthase-like [Malus domestica]
Length=599

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQVSQL  13
            T+WAM+GL+Y G AERD  PLH+A KL+ N+Q+E+GDF QQVS L
Sbjct  552  TAWAMMGLIYAGQAERDPAPLHRAAKLIXNSQMENGDFXQQVSCL  596



>sp|O82140.1|BAMS1_PANGI RecName: Full=Beta-Amyrin Synthase 1 [Panax ginseng]
 dbj|BAA33461.1| beta-Amyrin Synthase [Panax ginseng]
Length=763

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ-VSQLF  10
            T WA++GL+++  AERD TPLH+A KLLIN+Q+EDGDFPQQ +S +F
Sbjct  683  TGWALMGLIHSEQAERDPTPLHRAAKLLINSQMEDGDFPQQEISGVF  729



>dbj|BAD94022.1| putative lupeol synthase [Arabidopsis thaliana]
Length=362

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KL+I +QLE+GDFPQQ
Sbjct  282  TAWAMMGLIHAGQAERDPTPLHRAAKLIITSQLENGDFPQQ  322



>ref|XP_010027785.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW83384.1| hypothetical protein EUGRSUZ_B00318 [Eucalyptus grandis]
Length=761

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+  G AERD TPLH+A KLLIN+Q+EDGD+PQQ
Sbjct  681  TAWAMMGLIQAGQAERDPTPLHRAAKLLINSQMEDGDYPQQ  721



>ref|XP_010065064.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
Length=698

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH A KLLIN+Q+EDGD+PQQ
Sbjct  618  TAWAMMGLIHAGQAERDPTPLHHAAKLLINSQMEDGDYPQQ  658



>ref|XP_010027664.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
Length=761

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+  G AERD TPLH+A KLLIN+Q+EDGD+PQQ
Sbjct  681  TAWAMMGLIQAGQAERDPTPLHRAAKLLINSQMEDGDYPQQ  721



>ref|XP_010696136.1| PREDICTED: beta-amyrin synthase-like [Beta vulgaris subsp. vulgaris]
Length=764

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL++ G  ERDLTPL +A KLLIN+QLE+GDFPQQ
Sbjct  682  TGWALMGLLHAGQVERDLTPLRRAAKLLINSQLENGDFPQQ  722



>ref|XP_010539599.1| PREDICTED: camelliol C synthase-like isoform X2 [Tarenaya hassleriana]
Length=709

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL++ G AERD TPLH AVKL+IN+QLE+GDFPQQ
Sbjct  632  TAWAVMGLLHAGQAERDPTPLHPAVKLIINSQLENGDFPQQ  672



>ref|XP_010027674.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Eucalyptus grandis]
Length=755

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+  G AERD TPLH+A KLLIN+Q+EDGD+PQQ
Sbjct  675  TAWAMMGLIQAGQAERDPTPLHRAAKLLINSQMEDGDYPQQ  715



>ref|XP_010063688.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW70933.1| hypothetical protein EUGRSUZ_F04050 [Eucalyptus grandis]
Length=761

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH A KLLIN+Q+EDGD+PQQ
Sbjct  681  TAWAMMGLIHAGQAERDPTPLHHAAKLLINSQMEDGDYPQQ  721



>gb|AAO33580.1|AF478455_1 multifunctional beta-amyrin synthase [Lotus japonicus]
Length=762

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL++ G AERD TPLH+A KLLIN+QLEDGD+PQQ
Sbjct  682  TAWALMGLIHAGQAERDPTPLHRAAKLLINSQLEDGDWPQQ  722



>sp|E2IUA6.1|TARS_KALDA RecName: Full=Taraxerol synthase; Short=KdTAS [Kalanchoe daigremontiana]
 gb|ADK35123.1| taraxerol synthase [Kalanchoe daigremontiana]
Length=779

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+++  AERD+TPLH+A KLLIN+QLE+GDFPQQ
Sbjct  701  TAWALMGLIHSRQAERDITPLHRAAKLLINSQLENGDFPQQ  741



>ref|XP_010655249.1| PREDICTED: beta-amyrin synthase [Vitis vinifera]
 ref|XP_010655250.1| PREDICTED: beta-amyrin synthase [Vitis vinifera]
 ref|XP_010655251.1| PREDICTED: beta-amyrin synthase [Vitis vinifera]
Length=757

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T W ++GL+++G AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  681  TGWTLMGLLHSGQAERDPTPLHRAAKLLINSQMEDGDFPQQ  721



>emb|CBI18395.3| unnamed protein product [Vitis vinifera]
Length=512

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+ +G AERD TPLH+A KL IN+Q+EDGDFPQQ
Sbjct  424  TGWALMGLLSSGQAERDPTPLHRAAKLFINSQMEDGDFPQQ  464



>ref|XP_004305792.1| PREDICTED: beta-amyrin synthase-like [Fragaria vesca subsp. vesca]
Length=764

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A K +IN+QLE+GDFPQQ
Sbjct  685  TAWAMMGLIHAGQAERDPTPLHRAAKFIINSQLENGDFPQQ  725



>emb|CAN65908.1| hypothetical protein VITISV_001241 [Vitis vinifera]
Length=754

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T W ++GL+++G AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  678  TGWTLMGLLHSGQAERDPTPLHRAAKLLINSQMEDGDFPQQ  718



>ref|XP_010537757.1| PREDICTED: camelliol C synthase-like isoform X3 [Tarenaya hassleriana]
Length=706

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G  ERD  PLH+A KL+IN+QLE+GDFPQQ
Sbjct  627  TAWAMMGLIHAGQGERDPVPLHRAAKLIINSQLENGDFPQQ  667



>ref|XP_007224874.1| hypothetical protein PRUPE_ppa022710mg [Prunus persica]
 gb|EMJ26073.1| hypothetical protein PRUPE_ppa022710mg [Prunus persica]
Length=793

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WAMLGL+  G AERD  PLH+A KLLIN+Q+E+GDFPQQ
Sbjct  683  TGWAMLGLIEAGQAERDPIPLHRAAKLLINSQMENGDFPQQ  723



>emb|CBI18408.3| unnamed protein product [Vitis vinifera]
Length=814

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T W ++GL+++G AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  738  TGWTLMGLLHSGQAERDPTPLHRAAKLLINSQMEDGDFPQQ  778



>ref|XP_003627087.1| Beta-amyrin synthase [Medicago truncatula]
Length=819

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQV  22
            TSWA++ L++ G AERD TPLH+AVKL+IN QL++GD+PQQV
Sbjct  775  TSWALMALIHAGQAERDATPLHRAVKLIINLQLKEGDWPQQV  816



>ref|XP_009149097.1| PREDICTED: amyrin synthase LUP2-like [Brassica rapa]
Length=757

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+ TG AERD  PLH+A KL+IN+QLE+GD+PQQ
Sbjct  684  TAWALMGLIQTGQAERDPVPLHRAAKLIINSQLENGDYPQQ  724



>ref|XP_010063692.1| PREDICTED: beta-amyrin synthase [Eucalyptus grandis]
 ref|XP_010063693.1| PREDICTED: beta-amyrin synthase [Eucalyptus grandis]
 gb|KCW70922.1| hypothetical protein EUGRSUZ_F04038 [Eucalyptus grandis]
 gb|KCW70923.1| hypothetical protein EUGRSUZ_F04038 [Eucalyptus grandis]
Length=761

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G  ERD TPLH+A KLLIN+Q+EDGD+PQQ
Sbjct  681  TAWAMMGLIHAGQTERDPTPLHRAAKLLINSQMEDGDYPQQ  721



>emb|CAB72151.1| oxidosqualene cyclase-like protein [Arabidopsis thaliana]
Length=742

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQVSQLF  10
            TSWA+L L+  G A RD  PLH+  K LIN+Q+EDGD+PQQVS++F
Sbjct  672  TSWALLALIEAGQASRDPMPLHRGAKSLINSQMEDGDYPQQVSKMF  717



>ref|XP_009104558.1| PREDICTED: amyrin synthase LUP2-like [Brassica rapa]
Length=767

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAMLGL++ G A RD  PLH+A KL+IN+Q+EDGDFPQQ
Sbjct  683  TAWAMLGLIHAGQAGRDPIPLHRAAKLIINSQMEDGDFPQQ  723



>ref|XP_004251564.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Solanum lycopersicum]
Length=761

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+++G A+RD  PLH+A +LLIN+Q+EDGDFPQQ
Sbjct  681  TAWALMGLIHSGQADRDPKPLHRAARLLINSQMEDGDFPQQ  721



>ref|XP_010537756.1| PREDICTED: camelliol C synthase-like isoform X2 [Tarenaya hassleriana]
Length=712

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G  ERD  PLH+A KL+IN+QLE+GDFPQQ
Sbjct  633  TAWAMMGLIHAGQGERDPVPLHRAAKLIINSQLENGDFPQQ  673



>ref|XP_010537755.1| PREDICTED: camelliol C synthase-like isoform X1 [Tarenaya hassleriana]
Length=762

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G  ERD  PLH+A KL+IN+QLE+GDFPQQ
Sbjct  683  TAWAMMGLIHAGQGERDPVPLHRAAKLIINSQLENGDFPQQ  723



>ref|XP_002305339.1| putative oxidosqualene cyclase family protein [Populus trichocarpa]
 gb|EEE85850.1| putative oxidosqualene cyclase family protein [Populus trichocarpa]
Length=728

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQV  22
            T+WAM+GL+Y G AE+D  PLH+A +LLIN+Q+E+G+FPQQV
Sbjct  680  TAWAMMGLIYAGQAEKDPAPLHQAARLLINSQMENGEFPQQV  721



>ref|XP_006436396.1| hypothetical protein CICLE_v10033368mg, partial [Citrus clementina]
 gb|ESR49636.1| hypothetical protein CICLE_v10033368mg, partial [Citrus clementina]
Length=710

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAML L++ G  ER+ TPLH+A KLLIN+QL+DGDFPQQ
Sbjct  670  TAWAMLSLIHAGQMERNPTPLHRAAKLLINSQLQDGDFPQQ  710



>emb|CDY35103.1| BnaA06g11130D [Brassica napus]
Length=788

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+ TG AERD  PLH+A KL+IN+QLE+GD+PQQ
Sbjct  715  TAWALMGLIQTGQAERDPVPLHRAAKLIINSQLENGDYPQQ  755



>ref|XP_006656974.1| PREDICTED: achilleol B synthase-like [Oryza brachyantha]
Length=754

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAML L+Y G AERDLTPL+ A K LIN QLE G+FPQQ
Sbjct  676  TAWAMLALIYAGQAERDLTPLYDAAKELINMQLESGEFPQQ  716



>gb|KDP25033.1| hypothetical protein JCGZ_22568 [Jatropha curcas]
Length=766

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAMLGLM  G  ERD TPLH   KLLIN+QLEDG FPQQ
Sbjct  680  TAWAMLGLMSGGQMERDPTPLHSGAKLLINSQLEDGSFPQQ  720



>gb|ABL07607.1| beta-amyrin synthase [Polygala tenuifolia]
Length=762

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G A+RD TPLH+A KLLINAQLE+GD+PQQ
Sbjct  682  TAWAMMGLIHAGQADRDPTPLHRAAKLLINAQLENGDWPQQ  722



>sp|O82146.1|BAMS2_PANGI RecName: Full=Beta-Amyrin Synthase 2 [Panax ginseng]
 dbj|BAA33722.1| beta-Amyrin Synthase [Panax ginseng]
Length=761

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAM+GL+++  AERD TPLH+A KLLIN+Q+E GDFPQQ
Sbjct  681  TSWAMMGLIHSRQAERDPTPLHRAAKLLINSQMESGDFPQQ  721



>ref|XP_008223939.1| PREDICTED: LOW QUALITY PROTEIN: cycloartenol Synthase-like [Prunus 
mume]
Length=742

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WAMLGL+  G AERD  PLH+A KLLIN+Q+E+GDFPQQ
Sbjct  654  TGWAMLGLIEAGQAERDPIPLHRAAKLLINSQMENGDFPQQ  694



>dbj|BAG82628.1| beta-amyrin synthase [Arabidopsis thaliana]
Length=759

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+++G AERD  PLH+A KL+IN+QLE GDFPQQ
Sbjct  683  TAWALMGLIHSGQAERDPIPLHRAAKLIINSQLESGDFPQQ  723



>ref|NP_178016.2| beta-amyrin synthase [Arabidopsis thaliana]
 sp|B6EXY6.2|LUP4_ARATH RecName: Full=Beta-amyrin synthase; Short=AtBAS; AltName: Full=Lupeol 
synthase 4; Short=AtLUP4 [Arabidopsis thaliana]
 gb|AEE36183.1| beta-amyrin synthase [Arabidopsis thaliana]
Length=759

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+++G AERD  PLH+A KL+IN+QLE GDFPQQ
Sbjct  683  TAWALMGLIHSGQAERDPIPLHRAAKLIINSQLESGDFPQQ  723



>emb|CDY72111.1| BnaCnng76020D, partial [Brassica napus]
Length=412

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+ TG AERD  PLH+A KL+IN+QLE+GD+PQQ
Sbjct  372  TAWALMGLIKTGQAERDPLPLHRAAKLIINSQLENGDYPQQ  412



>ref|XP_010655316.1| PREDICTED: beta-Amyrin Synthase 1-like [Vitis vinifera]
Length=518

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+ +G AERD TPL++A KLLIN+Q+EDGDFPQQ
Sbjct  430  TGWALMGLLSSGQAERDPTPLYRAAKLLINSQMEDGDFPQQ  470



>ref|XP_002445263.1| hypothetical protein SORBIDRAFT_07g007030 [Sorghum bicolor]
 gb|EES14758.1| hypothetical protein SORBIDRAFT_07g007030 [Sorghum bicolor]
Length=753

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAML L+Y G  ERD TPL+KA K+LIN QLE GDFPQQ
Sbjct  675  TAWAMLALVYGGQVERDPTPLYKAAKVLINMQLESGDFPQQ  715



>emb|CAN73194.1| hypothetical protein VITISV_028269 [Vitis vinifera]
Length=630

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WAML L+  G AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  563  TRWAMLALIGAGQAERDPTPLHRATKLLINSQMEDGDFPQQ  603



>gb|AAO33579.1|AF478454_1 putative beta-amyrin synthase [Lotus japonicus]
Length=750

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+++G AERD TPLH+A KLLIN+QLE+GD+PQQ
Sbjct  670  TAWALMGLIHSGQAERDPTPLHRAAKLLINSQLEEGDWPQQ  710



>emb|CDX88494.1| BnaC06g39380D [Brassica napus]
Length=776

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL++ G AERD TPLH+A K++IN+Q+E+GDFPQQ
Sbjct  694  TAWAVMGLVHAGQAERDPTPLHRAAKIIINSQMENGDFPQQ  734



>dbj|BAE53429.1| beta-amyrin synthase [Lotus japonicus]
Length=762

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+++G AERD TPLH+A KLLIN+QLE+GD+PQQ
Sbjct  682  TAWALMGLIHSGQAERDPTPLHRAAKLLINSQLEEGDWPQQ  722



>gb|ABC33922.1| beta-amyrin synthase, partial [Gypsophila paniculata]
Length=594

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+YT   ERD TPLH+A KLLIN+QLE GDFPQQ
Sbjct  516  TAWALMGLIYTRQMERDPTPLHRAAKLLINSQLESGDFPQQ  556



>ref|XP_006488698.1| PREDICTED: beta-amyrin synthase-like [Citrus sinensis]
Length=829

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+W M+GL++ G AERD  PLH+A KLLIN+QLEDGDFPQ+
Sbjct  689  TAWGMMGLLHAGQAERDPAPLHRAAKLLINSQLEDGDFPQE  729



>gb|ACA13386.1| beta-amyrin synthase [Artemisia annua]
Length=761

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+++  AERD TPLH+A KLLIN+QLE GDFPQQ
Sbjct  681  TAWAMMGLIHSRQAERDATPLHRAAKLLINSQLETGDFPQQ  721



>ref|XP_009379200.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=756

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KL+IN+++E+GDFPQQ
Sbjct  677  TAWAMMGLIHAGQAERDPTPLHRAAKLIINSKMENGDFPQQ  717



>dbj|BAF01935.1| putative lupeol synthase [Arabidopsis thaliana]
Length=555

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KL+I +QLE+GDFPQQ
Sbjct  475  TAWAMMGLIHAGQAERDPTPLHRAAKLIITSQLENGDFPQQ  515



>gb|ACB87531.1| beta-amyrin synthase [Artemisia annua]
Length=761

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+++  AERD TPLH+A KLLIN+QLE GDFPQQ
Sbjct  681  TAWAMMGLIHSRQAERDATPLHRAAKLLINSQLETGDFPQQ  721



>ref|NP_001234597.1| delta-amyrin synthase [Solanum lycopersicum]
 sp|E7DN64.1|DAMS_SOLLC RecName: Full=Delta-amyrin synthase; AltName: Full=Alpha-amyrin 
synthase; AltName: Full=Beta-amyrin synthase; AltName: Full=Triterpenoid 
synthase 2; Short=SlTTS2 [Solanum lycopersicum]
 gb|ADU52575.1| multifunctional triterpenoid synthase [Solanum lycopersicum]
Length=763

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+++G  ERD  PLH+A KLLIN Q+EDGDFPQQ
Sbjct  681  TAWALMGLIHSGQVERDPRPLHRAAKLLINFQMEDGDFPQQ  721



>gb|ABK76265.1| beta-amyrin synthase [Vaccaria hispanica]
Length=760

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+YT   ERD TPLH+A KLLIN+QLE GDFPQQ
Sbjct  682  TAWALMGLIYTRQMERDPTPLHRAAKLLINSQLESGDFPQQ  722



>ref|NP_178017.2| lupeol synthase 2 [Arabidopsis thaliana]
 sp|Q8RWT0.1|LUP2_ARATH RecName: Full=Amyrin synthase LUP2; AltName: Full=Alpha-amyrin 
synthase; AltName: Full=Beta-amyrin synthase; AltName: Full=Lupeol 
synthase 2; Short=AtLUP2 [Arabidopsis thaliana]
 gb|AAM14080.1| putative lupeol synthase [Arabidopsis thaliana]
 gb|AAM45087.1| putative lupeol synthase [Arabidopsis thaliana]
 gb|AEE36185.1| lupeol synthase 2 [Arabidopsis thaliana]
Length=763

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KL+I +QLE+GDFPQQ
Sbjct  683  TAWAMMGLIHAGQAERDPTPLHRAAKLIITSQLENGDFPQQ  723



>ref|XP_010052732.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010052734.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010052735.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010052736.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 gb|KCW76806.1| hypothetical protein EUGRSUZ_D01163 [Eucalyptus grandis]
Length=761

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL++ G AERD TPLH+A KLLIN+Q EDGD+PQQ
Sbjct  681  TAWAVMGLIHAGQAERDPTPLHRAAKLLINSQTEDGDYPQQ  721



>ref|XP_006364889.1| PREDICTED: delta-amyrin synthase-like [Solanum tuberosum]
Length=760

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+++G  +RD  PLH+A KLLIN+Q+EDGDFPQQ
Sbjct  680  TAWALMGLIHSGQVDRDPRPLHRAAKLLINSQMEDGDFPQQ  720



>ref|XP_010429761.1| PREDICTED: beta-amyrin synthase [Camelina sativa]
Length=759

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL++ G AERD  PLH+A KL+IN+QLE GDFPQQ
Sbjct  683  TAWALMGLIHAGQAERDPLPLHRAAKLIINSQLESGDFPQQ  723



>ref|XP_009779991.1| PREDICTED: beta-amyrin synthase-like [Nicotiana sylvestris]
Length=761

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL+++G  +RD  PLH+A +LLIN+QLEDGDFPQQ
Sbjct  681  TAWALMGLIHSGQVDRDPRPLHRAARLLINSQLEDGDFPQQ  721



>ref|XP_002887763.1| ATLUP2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64022.1| ATLUP2 [Arabidopsis lyrata subsp. lyrata]
Length=763

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G AERD TPLH+A KL+I +QLE+GDFPQQ
Sbjct  683  TAWAMMGLIHAGQAERDPTPLHRAAKLIITSQLENGDFPQQ  723



>ref|NP_001172793.1| Os02g0139500 [Oryza sativa Japonica Group]
 dbj|BAH91522.1| Os02g0139500, partial [Oryza sativa Japonica Group]
Length=141

 Score = 63.2 bits (152),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAML L+  G  ERD  PLH+A ++LIN QLEDG+FPQQ
Sbjct  53   TSWAMLALIDAGQGERDPAPLHRAARILINLQLEDGEFPQQ  93



>ref|XP_007023625.1| Cycloartenol synthase 1 [Theobroma cacao]
 gb|EOY26247.1| Cycloartenol synthase 1 [Theobroma cacao]
Length=761

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWA+L L+  G AERD TPLH+A ++LIN+Q+EDGDFPQ+
Sbjct  684  TSWALLALIEAGQAERDPTPLHRAARILINSQMEDGDFPQE  724



>dbj|BAE43642.1| beta-amyrin synthase [Euphorbia tirucalli]
Length=762

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWA++GL+  G  +RD TPLH+A KLLIN+QLEDGDFPQQ
Sbjct  682  TSWALMGLISAGQMDRDPTPLHRAAKLLINSQLEDGDFPQQ  722



>ref|XP_003604121.1| Beta-amyrin synthase [Medicago truncatula]
 emb|CAD23247.1| beta-amyrin synthase [Medicago truncatula]
 gb|AES86318.1| beta-amyrin synthase [Medicago truncatula]
Length=762

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL++ G AERD TPLH+A KLLIN+QLE+GD+PQQ
Sbjct  682  TAWALMGLIHAGQAERDPTPLHRAAKLLINSQLEEGDWPQQ  722



>gb|AAO33578.1|AF478453_1 beta-amyrin synthase [Medicago truncatula]
Length=762

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL++ G AERD TPLH+A KLLIN+QLE+GD+PQQ
Sbjct  682  TAWALMGLIHAGQAERDPTPLHRAAKLLINSQLEEGDWPQQ  722



>ref|XP_007014076.1| Cycloartenol synthase 1 [Theobroma cacao]
 gb|EOY31695.1| Cycloartenol synthase 1 [Theobroma cacao]
Length=872

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAML LM  G AERD TPLH+A K+L+N+QLE+G+FPQQ
Sbjct  788  TAWAMLALMEAGQAERDPTPLHRAAKVLLNSQLENGEFPQQ  828



>ref|XP_010106930.1| Cycloartenol synthase [Morus notabilis]
 gb|EXC12812.1| Cycloartenol synthase [Morus notabilis]
Length=762

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WAML L+  G A+RD TPLH+A KLLIN+Q+E+GDFPQQ
Sbjct  678  TGWAMLALIEAGQAQRDPTPLHRAAKLLINSQMENGDFPQQ  718



>ref|XP_006340479.1| PREDICTED: cycloartenol Synthase-like [Solanum tuberosum]
Length=757

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ-VSQLF  10
            T+WAML L+  G  ERD TPLH+A K+LIN+QLE+GDFPQQ +S +F
Sbjct  680  TAWAMLALIEAGQGERDPTPLHRAAKVLINSQLENGDFPQQEISGVF  726



>gb|ADK12003.1| beta-amyrin synthase [Aralia elata]
Length=763

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WA++GL+++  AERD TPLH+A KLLIN+Q+EDGDFPQQ
Sbjct  683  TGWALMGLIHSEQAERDPTPLHRAAKLLINSQMEDGDFPQQ  723



>ref|XP_011031246.1| PREDICTED: beta-amyrin synthase-like [Populus euphratica]
Length=759

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAMLGL+++G A+RD TPLH+  KLLIN+Q EDG +PQQ
Sbjct  679  TAWAMLGLIHSGQADRDPTPLHRGAKLLINSQAEDGSYPQQ  719



>ref|XP_008384950.1| PREDICTED: camelliol C synthase-like [Malus domestica]
Length=126

 Score = 62.8 bits (151),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA++GL++   AERD TPLH+A KLLIN+Q+E+G FPQQ
Sbjct  43   TAWALMGLIHAQQAERDPTPLHRAAKLLINSQMENGGFPQQ  83



>emb|CDP08999.1| unnamed protein product [Coffea canephora]
Length=759

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+++G A+RD  PLH+A KLLIN+Q+E+GDFPQQ
Sbjct  681  TAWAMMGLIHSGQADRDPRPLHRAAKLLINSQMENGDFPQQ  721



>sp|Q2XPU6.1|CAS1_RICCO RecName: Full=Cycloartenol synthase; Short=RcCAS [Ricinus communis]
 gb|ABB76767.1| cycloartenol synthase [Ricinus communis]
Length=759

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAML L+  G AERD TPLH+A + LINAQ+E+GDFPQQ
Sbjct  682  TAWAMLSLIDAGQAERDPTPLHRAARYLINAQMENGDFPQQ  722



>ref|XP_002527812.1| Cycloartenol synthase, putative [Ricinus communis]
 gb|EEF34564.1| Cycloartenol synthase, putative [Ricinus communis]
Length=753

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAML L+  G AERD TPLH+A + LINAQ+E+GDFPQQ
Sbjct  676  TAWAMLSLIDAGQAERDPTPLHRAARYLINAQMENGDFPQQ  716



>gb|AFZ93646.1| cycloartenol synthase, partial [Euphorbia lathyris]
Length=587

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWAML L+  G AERD TPLH+A + LIN+Q+E+GDFPQQ
Sbjct  508  TSWAMLSLIDAGQAERDPTPLHRAARCLINSQMENGDFPQQ  548



>ref|XP_006374736.1| hypothetical protein POPTR_0014s00370g [Populus trichocarpa]
 gb|ERP52533.1| hypothetical protein POPTR_0014s00370g [Populus trichocarpa]
Length=757

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            ++WAMLGL++ G A+RD TPLH+A KLLIN+Q EDG +PQQ
Sbjct  677  SAWAMLGLIHAGQADRDPTPLHRAAKLLINSQAEDGSYPQQ  717



>ref|XP_006374737.1| hypothetical protein POPTR_0014s00370g [Populus trichocarpa]
 gb|ERP52534.1| hypothetical protein POPTR_0014s00370g [Populus trichocarpa]
Length=759

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            ++WAMLGL++ G A+RD TPLH+A KLLIN+Q EDG +PQQ
Sbjct  679  SAWAMLGLIHAGQADRDPTPLHRAAKLLINSQAEDGSYPQQ  719



>dbj|BAA85267.1| oxidosqualene cyclase [Luffa aegyptiaca]
Length=760

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWA+L L+  G A+RDLTPLH+A  +LIN+QL DGDFPQQ
Sbjct  680  TSWALLALIKAGQAQRDLTPLHRAAMVLINSQLHDGDFPQQ  720



>ref|XP_009337925.1| PREDICTED: beta-amyrin synthase-like, partial [Pyrus x bretschneideri]
Length=722

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G A+RD TPLH+A KL+IN Q+E+GDFPQQ
Sbjct  682  TAWAMMGLIHAGQAKRDPTPLHRAAKLIINTQMENGDFPQQ  722



>ref|XP_008362067.1| PREDICTED: cycloartenol synthase-like [Malus domestica]
Length=280

 Score = 64.3 bits (155),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WAML L+  G AERD TPLH A + LIN+Q+E+GDFPQ+
Sbjct  203  TGWAMLALIDAGQAERDPTPLHHAARFLINSQMENGDFPQE  243



>ref|XP_007147805.1| hypothetical protein PHAVU_006G156500g [Phaseolus vulgaris]
 gb|ESW19799.1| hypothetical protein PHAVU_006G156500g [Phaseolus vulgaris]
Length=760

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WA+L L+ +G AERD TPLH+A KLLIN+QLEDGD+PQQ
Sbjct  682  TAWALLALILSGQAERDPTPLHRAAKLLINSQLEDGDWPQQ  722



>gb|KHG27893.1| Cycloartenol synthase [Gossypium arboreum]
Length=767

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSW ML L+  G AERD TPLH+A ++LIN+Q+EDGDFPQ+
Sbjct  690  TSWTMLALIEAGQAERDPTPLHRAARILINSQMEDGDFPQE  730



>ref|XP_011009935.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Populus euphratica]
Length=747

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQV  22
            T+WAM+GL+Y G AE+D  PLH+A +LLIN+Q+E+G+FPQQ+
Sbjct  680  TAWAMMGLIYAGQAEKDPAPLHQAARLLINSQMENGEFPQQL  721



>ref|XP_004301515.1| PREDICTED: beta-amyrin synthase-like [Fragaria vesca subsp. vesca]
Length=483

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+  ++GL++ G AERDLTP+H+A KLLIN+QLE+GDFPQQ
Sbjct  407  TAMGLMGLIHGGQAERDLTPIHRAAKLLINSQLENGDFPQQ  447



>ref|XP_002888561.1| hypothetical protein ARALYDRAFT_475791 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64820.1| hypothetical protein ARALYDRAFT_475791 [Arabidopsis lyrata subsp. 
lyrata]
Length=764

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAMLGL++ G ++RD+TPLH+A KL+I +QLE GDFPQQ
Sbjct  684  TAWAMLGLIHAGQSKRDITPLHRAAKLIITSQLEKGDFPQQ  724



>gb|ADE75873.1| unknown [Picea sitchensis]
Length=238

 Score = 63.5 bits (153),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAML L+Y G A RD  PLH+A  +L+N+Q+E+GDFPQQ
Sbjct  162  TAWAMLALIYAGQALRDPKPLHRAAIVLVNSQMENGDFPQQ  202



>ref|XP_006371457.1| hypothetical protein POPTR_0019s10800g [Populus trichocarpa]
 gb|ERP49254.1| hypothetical protein POPTR_0019s10800g [Populus trichocarpa]
Length=748

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAMLGL++ G  +RD TPLH+A KLLIN+Q EDG +PQQ
Sbjct  668  TAWAMLGLIHAGQGDRDPTPLHRAAKLLINSQAEDGSYPQQ  708



>gb|KHN33083.1| Beta-amyrin synthase [Glycine soja]
Length=744

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 39/47 (83%), Gaps = 1/47 (2%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ-VSQLF  10
            T+WA++ L++ G AE+D TP+H A KLLIN+QLEDGD+PQQ V+ LF
Sbjct  664  TAWALMALIHAGQAEKDPTPIHNAAKLLINSQLEDGDWPQQEVTGLF  710



>ref|XP_011009936.1| PREDICTED: beta-amyrin synthase-like isoform X3 [Populus euphratica]
Length=728

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQVSQL  13
            T+WAM+GL+Y G AE+D  PLH+A +LLIN+Q+E+G+FPQQ  Q 
Sbjct  680  TAWAMMGLIYAGQAEKDPAPLHQAARLLINSQMENGEFPQQDFQF  724



>ref|XP_007025071.1| Beta-Amyrin Synthase, putative [Theobroma cacao]
 gb|EOY27693.1| Beta-Amyrin Synthase, putative [Theobroma cacao]
Length=750

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQVSQLF  10
            TSWAM+GL++ G AE D  PLHKA +LLIN+Q+E G FPQQV + +
Sbjct  665  TSWAMMGLIHAGQAELDPQPLHKAARLLINSQMESGKFPQQVCKTY  710



>ref|XP_002310351.1| hypothetical protein POPTR_0007s15210g [Populus trichocarpa]
 gb|EEE90801.1| hypothetical protein POPTR_0007s15210g [Populus trichocarpa]
Length=759

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WAMLGL+++G A+RD TPLH+  KLLIN+Q EDG +PQQ
Sbjct  679  TGWAMLGLIHSGQADRDPTPLHRGAKLLINSQAEDGSYPQQ  719



>ref|XP_009345284.1| PREDICTED: cycloartenol synthase 2-like [Pyrus x bretschneideri]
Length=757

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T WAMLGL+  G AERD TPLH+A + LIN+Q+E+GDFPQ+
Sbjct  680  TGWAMLGLIDAGQAERDPTPLHRAARFLINSQMENGDFPQE  720



>ref|XP_009344149.1| PREDICTED: camelliol C synthase-like [Pyrus x bretschneideri]
Length=75

 Score = 61.2 bits (147),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  135  MLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            M+GL++ G AERD TPLH+A KL+IN+Q+E+GDFPQQ
Sbjct  1    MMGLIHVGQAERDPTPLHRAAKLIINSQMENGDFPQQ  37



>gb|AET01563.2| beta-amyrin synthase [Medicago truncatula]
Length=757

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWA++ L++ G AERD TPLH+AVKL+IN QL++GD+PQQ
Sbjct  677  TSWALMALIHAGQAERDATPLHRAVKLIINLQLKEGDWPQQ  717



>ref|XP_011009937.1| PREDICTED: beta-amyrin synthase-like isoform X4 [Populus euphratica]
Length=634

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+Y G AE+D  PLH+A +LLIN+Q+E+G+FPQQ
Sbjct  556  TAWAMMGLIYAGQAEKDPAPLHQAARLLINSQMENGEFPQQ  596



>ref|XP_008661275.1| PREDICTED: achilleol B synthase-like isoform X4 [Zea mays]
Length=676

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAML L+YTG  ERD TPLH+A K+LIN QLE GD+ QQ
Sbjct  598  TAWAMLALIYTGQMERDPTPLHRAAKVLINMQLETGDYAQQ  638



>ref|XP_011009932.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Populus euphratica]
 ref|XP_011009933.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Populus euphratica]
Length=758

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL+Y G AE+D  PLH+A +LLIN+Q+E+G+FPQQ
Sbjct  680  TAWAMMGLIYAGQAEKDPAPLHQAARLLINSQMENGEFPQQ  720



>ref|XP_011031247.1| PREDICTED: beta-amyrin synthase [Populus euphratica]
 ref|XP_011031248.1| PREDICTED: beta-amyrin synthase [Populus euphratica]
Length=760

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            T+WAM+GL++ G  +RD  PLH+A KL+IN+QLEDGDFPQQ
Sbjct  682  TAWAMMGLIHAGQMDRDSAPLHRAAKLIINSQLEDGDFPQQ  722



>ref|XP_007148271.1| hypothetical protein PHAVU_006G1942000g, partial [Phaseolus vulgaris]
 gb|ESW20265.1| hypothetical protein PHAVU_006G1942000g, partial [Phaseolus vulgaris]
Length=633

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWA++ L+    AERD TPLH+A KLLIN+QLEDGD+PQQ
Sbjct  553  TSWALMALILAQQAERDSTPLHRAAKLLINSQLEDGDWPQQ  593



>ref|XP_007148270.1| hypothetical protein PHAVU_006G1942000g [Phaseolus vulgaris]
 gb|ESW20264.1| hypothetical protein PHAVU_006G1942000g [Phaseolus vulgaris]
Length=588

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  147  TSWAMLGLMYTGHAERDLTPLHKAVKLLINAQLEDGDFPQQ  25
            TSWA++ L+    AERD TPLH+A KLLIN+QLEDGD+PQQ
Sbjct  508  TSWALMALILAQQAERDSTPLHRAAKLLINSQLEDGDWPQQ  548



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525616678368