BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14630_g1_i2 len=1018 path=[1:0-516 518:517-1017]

Length=1018
                                                                      Score     E

ref|XP_009772119.1|  PREDICTED: leucine-rich repeat receptor prot...    498   1e-168   
ref|XP_006347874.1|  PREDICTED: LRR receptor-like serine/threonin...    494   5e-167   
ref|XP_004229807.1|  PREDICTED: probable LRR receptor-like serine...    493   1e-166   
ref|XP_009629432.1|  PREDICTED: LRR receptor-like serine/threonin...    492   2e-166   
ref|XP_011093359.1|  PREDICTED: LRR receptor-like serine/threonin...    487   3e-164   
emb|CDO97695.1|  unnamed protein product                                476   2e-160   
ref|XP_010255622.1|  PREDICTED: somatic embryogenesis receptor ki...    447   5e-149   
gb|EYU30556.1|  hypothetical protein MIMGU_mgv1a002343mg                447   7e-149   
ref|XP_010276701.1|  PREDICTED: probable leucine-rich repeat rece...    430   4e-142   
emb|CAN72186.1|  hypothetical protein VITISV_012898                     423   4e-139   Vitis vinifera
ref|XP_006445272.1|  hypothetical protein CICLE_v10019056mg             419   8e-138   
ref|XP_007220017.1|  hypothetical protein PRUPE_ppa002366mg             419   1e-137   
ref|XP_008232645.1|  PREDICTED: protein NSP-INTERACTING KINASE 2 ...    417   5e-137   
ref|XP_002279998.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        416   1e-136   Vitis vinifera
ref|XP_006374656.1|  hypothetical protein POPTR_0015s14480g             409   2e-135   
gb|KDP22393.1|  hypothetical protein JCGZ_26224                         412   2e-135   
ref|XP_010101735.1|  Leucine-rich repeat receptor protein kinase EXS    412   2e-135   
ref|XP_007052072.1|  Leucine-rich repeat receptor protein kinase        412   5e-135   
gb|KHF99663.1|  nsp-interacting kinase 2 -like protein                  411   7e-135   
gb|KDO65398.1|  hypothetical protein CISIN_1g044913mg                   400   2e-134   
ref|XP_011041704.1|  PREDICTED: LRR receptor-like serine/threonin...    410   2e-134   
ref|XP_009346807.1|  PREDICTED: probable LRR receptor-like serine...    408   7e-134   
ref|XP_009338105.1|  PREDICTED: somatic embryogenesis receptor ki...    407   2e-133   
ref|XP_002267632.1|  PREDICTED: probable LRR receptor-like serine...    406   6e-133   Vitis vinifera
ref|XP_010098918.1|  LRR receptor-like serine/threonine-protein k...    404   4e-132   
ref|XP_006490241.1|  PREDICTED: somatic embryogenesis receptor ki...    403   1e-131   
ref|XP_007038448.1|  Leucine-rich repeat protein kinase family pr...    402   1e-131   
ref|XP_007220018.1|  hypothetical protein PRUPE_ppa002373mg             403   1e-131   
ref|XP_007038447.1|  Leucine-rich repeat protein kinase family pr...    402   2e-131   
ref|XP_008234364.1|  PREDICTED: somatic embryogenesis receptor ki...    401   4e-131   
ref|XP_002511706.1|  leucine rich repeat receptor kinase, putative      399   6e-131   Ricinus communis
ref|XP_006421744.1|  hypothetical protein CICLE_v10004478mg             400   1e-130   
ref|XP_011029975.1|  PREDICTED: probable LRR receptor-like serine...    399   6e-130   
ref|XP_009791302.1|  PREDICTED: somatic embryogenesis receptor ki...    399   6e-130   
ref|XP_008376456.1|  PREDICTED: somatic embryogenesis receptor ki...    398   1e-129   
ref|XP_006445273.1|  hypothetical protein CICLE_v10019056mg             399   1e-129   
gb|KDP28763.1|  hypothetical protein JCGZ_14534                         397   1e-129   
ref|XP_008343327.1|  PREDICTED: probable LRR receptor-like serine...    397   2e-129   
ref|XP_008354209.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    397   2e-129   
ref|XP_009374517.1|  PREDICTED: probable LRR receptor-like serine...    397   2e-129   
ref|XP_004170265.1|  PREDICTED: probable leucine-rich repeat rece...    396   4e-129   
ref|XP_007152413.1|  hypothetical protein PHAVU_004G128100g             395   9e-129   
ref|XP_008467276.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    395   1e-128   
ref|XP_010053898.1|  PREDICTED: LRR receptor-like serine/threonin...    395   1e-128   
ref|XP_002320058.2|  leucine-rich repeat transmembrane protein ki...    393   2e-128   Populus trichocarpa [western balsam poplar]
ref|XP_009370496.1|  PREDICTED: somatic embryogenesis receptor ki...    394   2e-128   
ref|XP_008356288.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    394   3e-128   
ref|XP_009382934.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    394   3e-128   
ref|XP_004308453.1|  PREDICTED: LRR receptor-like serine/threonin...    392   2e-127   
ref|XP_009593156.1|  PREDICTED: probable LRR receptor-like serine...    391   4e-127   
ref|XP_003534047.1|  PREDICTED: somatic embryogenesis receptor ki...    390   9e-127   
ref|XP_011034207.1|  PREDICTED: LRR receptor-like serine/threonin...    390   1e-126   
ref|XP_004143652.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    390   1e-126   
ref|XP_002301282.2|  hypothetical protein POPTR_0002s14800g             389   2e-126   Populus trichocarpa [western balsam poplar]
ref|XP_002318874.2|  hypothetical protein POPTR_0012s14430g             389   3e-126   Populus trichocarpa [western balsam poplar]
ref|XP_004234946.1|  PREDICTED: LRR receptor-like serine/threonin...    389   3e-126   
ref|XP_011076309.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    388   4e-126   
ref|XP_006365244.1|  PREDICTED: somatic embryogenesis receptor ki...    387   1e-125   
ref|XP_011017487.1|  PREDICTED: probable leucine-rich repeat rece...    386   2e-125   
ref|XP_010941035.1|  PREDICTED: probable leucine-rich repeat rece...    386   5e-125   
ref|XP_003548248.1|  PREDICTED: LRR receptor-like serine/threonin...    386   5e-125   
gb|EPS73352.1|  hypothetical protein M569_01401                         385   6e-125   
ref|XP_008803990.1|  PREDICTED: somatic embryogenesis receptor ki...    385   1e-124   
gb|KHN24426.1|  Protein NSP-INTERACTING KINASE 2                        382   2e-123   
ref|XP_004309271.1|  PREDICTED: probable LRR receptor-like serine...    381   4e-123   
ref|XP_004512590.1|  PREDICTED: leucine-rich repeat receptor-like...    381   4e-123   
ref|XP_010671985.1|  PREDICTED: probable LRR receptor-like serine...    381   5e-123   
ref|XP_010910517.1|  PREDICTED: somatic embryogenesis receptor ki...    379   1e-122   
gb|KHG05851.1|  protein strubbelig-receptor family 8                    378   5e-122   
ref|XP_003536190.1|  PREDICTED: somatic embryogenesis receptor ki...    377   1e-121   
ref|XP_010692238.1|  PREDICTED: LRR receptor-like serine/threonin...    375   1e-120   
gb|AES75836.2|  LRR receptor-like kinase                                374   2e-120   
ref|XP_010934669.1|  PREDICTED: leucine-rich repeat receptor prot...    374   2e-120   
ref|XP_007143904.1|  hypothetical protein PHAVU_007G112100g             373   3e-120   
emb|CBI24527.3|  unnamed protein product                                372   8e-120   
ref|XP_003619618.1|  Receptor-like protein kinase                       373   2e-119   
ref|XP_010524368.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    371   4e-119   
ref|XP_009372936.1|  PREDICTED: probable LRR receptor-like serine...    370   4e-119   
ref|XP_003556401.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    370   7e-119   
ref|XP_008794535.1|  PREDICTED: LRR receptor-like serine/threonin...    368   3e-118   
emb|CDP05303.1|  unnamed protein product                                364   5e-117   
gb|KHG09358.1|  Leucine-rich repeat receptor protein kinase EXS         363   3e-116   
ref|XP_008438170.1|  PREDICTED: LRR receptor-like serine/threonin...    357   1e-115   
ref|XP_004133916.1|  PREDICTED: probable LRR receptor-like serine...    358   3e-114   
ref|XP_008438169.1|  PREDICTED: probable LRR receptor-like serine...    357   7e-114   
gb|KEH22283.1|  LRR receptor-like kinase                                354   8e-113   
ref|XP_006368702.1|  leucine-rich repeat transmembrane protein ki...    354   9e-113   
gb|AES78411.2|  LRR receptor-like kinase                                353   1e-112   
ref|XP_008658219.1|  PREDICTED: uncharacterized protein LOC100272...    353   2e-112   
ref|XP_006397716.1|  hypothetical protein EUTSA_v10001341mg             353   3e-112   
ref|XP_002303531.2|  leucine-rich repeat transmembrane protein ki...    351   4e-112   Populus trichocarpa [western balsam poplar]
ref|XP_002510917.1|  leucine rich repeat receptor kinase, putative      350   4e-112   Ricinus communis
dbj|BAD68873.1|  putative somatic embryogenesis protein kinase 1        350   1e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010518150.1|  PREDICTED: probable LRR receptor-like serine...    351   1e-111   
ref|NP_001056717.1|  Os06g0134700                                       350   2e-111   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99548.1|  hypothetical protein OsI_21521                          350   3e-111   Oryza sativa Indica Group [Indian rice]
ref|XP_003622193.1|  Receptor-like protein kinase                       348   7e-111   
ref|NP_182059.1|  putative leucine-rich repeat transmembrane prot...    349   9e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009142330.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    349   1e-110   
ref|XP_011042292.1|  PREDICTED: probable LRR receptor-like serine...    348   1e-110   
ref|XP_002880173.1|  hypothetical protein ARALYDRAFT_346338             348   2e-110   
gb|KFK37319.1|  hypothetical protein AALP_AA4G241600                    348   3e-110   
ref|XP_004964453.1|  PREDICTED: probable LRR receptor-like serine...    348   3e-110   
ref|XP_007210306.1|  hypothetical protein PRUPE_ppa002356mg             348   3e-110   
emb|CDY57103.1|  BnaC04g56910D                                          348   3e-110   
gb|EYU24995.1|  hypothetical protein MIMGU_mgv1a002428mg                342   4e-110   
ref|XP_006293447.1|  hypothetical protein CARUB_v10022725mg             348   6e-110   
ref|XP_003561214.1|  PREDICTED: leucine-rich repeat receptor prot...    347   7e-110   
ref|XP_010512840.1|  PREDICTED: probable LRR receptor-like serine...    350   1e-109   
ref|XP_006655759.1|  PREDICTED: somatic embryogenesis receptor ki...    345   2e-109   
ref|XP_004300723.1|  PREDICTED: probable leucine-rich repeat rece...    345   3e-109   
ref|XP_009143131.1|  PREDICTED: probable LRR receptor-like serine...    345   3e-109   
ref|XP_010506476.1|  PREDICTED: probable LRR receptor-like serine...    345   4e-109   
gb|KCW49798.1|  hypothetical protein EUGRSUZ_K03279                     341   4e-109   
gb|EYU24994.1|  hypothetical protein MIMGU_mgv1a002428mg                344   5e-109   
ref|XP_006857826.1|  hypothetical protein AMTR_s00069p00033900          344   8e-109   
emb|CDY37035.1|  BnaA04g26130D                                          344   1e-108   
ref|XP_010532258.1|  PREDICTED: somatic embryogenesis receptor ki...    343   2e-108   
ref|XP_008345369.1|  PREDICTED: probable leucine-rich repeat rece...    342   7e-108   
ref|XP_010056327.1|  PREDICTED: probable LRR receptor-like serine...    341   9e-108   
ref|XP_010037998.1|  PREDICTED: probable LRR receptor-like serine...    341   1e-107   
ref|XP_010056326.1|  PREDICTED: probable LRR receptor-like serine...    342   1e-107   
ref|XP_009362126.1|  PREDICTED: probable leucine-rich repeat rece...    341   1e-107   
emb|CDX74732.1|  BnaA05g04780D                                          339   7e-107   
ref|XP_004495431.1|  PREDICTED: probable leucine-rich repeat rece...    337   4e-106   
ref|XP_002862982.1|  hypothetical protein ARALYDRAFT_920855             337   6e-106   
ref|NP_199969.1|  leucine-rich repeat protein kinase                    335   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006440406.1|  hypothetical protein CICLE_v10019076mg             335   3e-105   
gb|KFK26770.1|  hypothetical protein AALP_AA8G291500                    334   5e-105   
ref|XP_008238646.1|  PREDICTED: probable LRR receptor-like serine...    334   5e-105   
emb|CDY51809.1|  BnaC04g53150D                                          334   6e-105   
ref|XP_006401961.1|  hypothetical protein EUTSA_v10012874mg             333   7e-105   
ref|XP_010482493.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    333   8e-105   
gb|KDO63769.1|  hypothetical protein CISIN_1g005586mg                   333   2e-104   
ref|XP_004513505.1|  PREDICTED: probable leucine-rich repeat rece...    332   2e-104   
ref|XP_007039978.1|  Leucine-rich repeat protein kinase family pr...    332   2e-104   
gb|AAM62629.1|  receptor-like protein kinase                            332   3e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010662200.1|  PREDICTED: probable leucine-rich repeat rece...    332   5e-104   
ref|XP_006477275.1|  PREDICTED: probable LRR receptor-like serine...    332   5e-104   
gb|KDP25598.1|  hypothetical protein JCGZ_20754                         330   7e-104   
ref|XP_007140941.1|  hypothetical protein PHAVU_008G154200g             330   9e-104   
ref|XP_006279482.1|  hypothetical protein CARUB_v10026012mg             329   3e-103   
ref|XP_002509606.1|  leucine rich repeat receptor kinase, putative      330   3e-103   Ricinus communis
ref|XP_010442662.1|  PREDICTED: probable leucine-rich repeat rece...    328   1e-102   
emb|CDY00487.1|  BnaA10g07860D                                          322   3e-100   
ref|XP_009107333.1|  PREDICTED: somatic embryogenesis receptor ki...    322   3e-100   
ref|XP_002522411.1|  leucine rich repeat receptor kinase, putative      321   3e-100   Ricinus communis
ref|XP_009382007.1|  PREDICTED: probable LRR receptor-like serine...    320   1e-99    
ref|XP_008448908.1|  PREDICTED: LRR receptor-like serine/threonin...    319   4e-99    
emb|CDX99903.1|  BnaC09g28020D                                          318   5e-99    
gb|KHG14855.1|  nsp-interacting kinase 2 -like protein                  318   6e-99    
ref|XP_004147946.1|  PREDICTED: LRR receptor-like serine/threonin...    318   1e-98    
ref|XP_009383987.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    317   1e-98    
ref|XP_011081121.1|  PREDICTED: LRR receptor-like serine/threonin...    317   2e-98    
emb|CBI38873.3|  unnamed protein product                                303   2e-97    
ref|XP_004973001.1|  PREDICTED: probable LRR receptor-like serine...    314   3e-97    
ref|XP_010443441.1|  PREDICTED: probably inactive leucine-rich re...    310   6e-96    
ref|XP_010024716.1|  PREDICTED: LRR receptor-like serine/threonin...    309   1e-95    
ref|XP_010676667.1|  PREDICTED: probable LRR receptor-like serine...    310   1e-95    
ref|XP_009789637.1|  PREDICTED: probable leucine-rich repeat rece...    309   2e-95    
ref|XP_006573733.1|  PREDICTED: somatic embryogenesis receptor ki...    308   3e-95    
ref|XP_002443773.1|  hypothetical protein SORBIDRAFT_07g001690          308   5e-95    Sorghum bicolor [broomcorn]
gb|KHN34965.1|  Protein NSP-INTERACTING KINASE 2                        308   5e-95    
ref|XP_007157320.1|  hypothetical protein PHAVU_002G060200g             308   6e-95    
ref|XP_003517433.1|  PREDICTED: somatic embryogenesis receptor ki...    308   7e-95    
ref|XP_003538634.1|  PREDICTED: LRR receptor-like serine/threonin...    308   8e-95    
ref|XP_003573305.1|  PREDICTED: leucine-rich repeat receptor prot...    306   8e-94    
ref|XP_003611243.1|  Receptor-like protein kinase                       305   1e-93    
ref|XP_010108139.1|  LRR receptor-like serine/threonine-protein k...    304   2e-93    
ref|XP_010529507.1|  PREDICTED: probable LRR receptor-like serine...    301   2e-92    
ref|XP_010055541.1|  PREDICTED: probable leucine-rich repeat rece...    300   2e-92    
emb|CDP09887.1|  unnamed protein product                                301   3e-92    
emb|CDM83247.1|  unnamed protein product                                300   6e-92    
emb|CDX79173.1|  BnaA01g12400D                                          299   2e-91    
ref|XP_006363735.1|  PREDICTED: leucine-rich repeat receptor prot...    298   3e-91    
ref|XP_006413630.1|  hypothetical protein EUTSA_v10024592mg             298   4e-91    
gb|KFK28836.1|  hypothetical protein AALP_AA7G055200                    296   2e-90    
ref|NP_194004.1|  leucine-rich repeat protein kinase-like protein       296   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003569250.1|  PREDICTED: LOW QUALITY PROTEIN: somatic embr...    296   3e-90    
ref|XP_004245714.1|  PREDICTED: probable LRR receptor-like serine...    294   9e-90    
ref|NP_001043393.1|  Os01g0577600                                       294   1e-89    Oryza sativa Japonica Group [Japonica rice]
emb|CDX82961.1|  BnaC01g14110D                                          294   1e-89    
ref|XP_010448856.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    294   1e-89    
ref|XP_004511651.1|  PREDICTED: LRR receptor-like serine/threonin...    294   1e-89    
ref|XP_006646028.1|  PREDICTED: LRR receptor-like serine/threonin...    290   6e-89    
ref|XP_006285866.1|  hypothetical protein CARUB_v10007360mg             292   6e-89    
ref|XP_010434007.1|  PREDICTED: somatic embryogenesis receptor ki...    291   1e-88    
ref|XP_009593141.1|  PREDICTED: leucine-rich repeat receptor-like...    290   4e-88    
ref|XP_002869809.1|  hypothetical protein ARALYDRAFT_492596             290   4e-88    
ref|XP_002458036.1|  hypothetical protein SORBIDRAFT_03g025880          290   5e-88    Sorghum bicolor [broomcorn]
gb|EMT04404.1|  Leucine-rich repeat receptor protein kinase EXS         288   5e-87    
ref|XP_008660396.1|  PREDICTED: somatic embryogenesis receptor ki...    286   2e-86    
ref|XP_008647994.1|  PREDICTED: uncharacterized protein LOC100304...    286   2e-86    
ref|XP_010439303.1|  PREDICTED: somatic embryogenesis receptor ki...    285   3e-86    
gb|EYU30450.1|  hypothetical protein MIMGU_mgv1a026158mg                277   7e-86    
gb|EMT10973.1|  Leucine-rich repeat receptor protein kinase EXS         285   1e-85    
ref|XP_002436427.1|  hypothetical protein SORBIDRAFT_10g002300          280   2e-85    Sorghum bicolor [broomcorn]
ref|XP_010100886.1|  putative LRR receptor-like serine/threonine-...    280   6e-85    
gb|KCW82134.1|  hypothetical protein EUGRSUZ_C035232                    273   8e-85    
ref|XP_006659770.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    280   2e-84    
ref|XP_003550887.1|  PREDICTED: probable leucine-rich repeat rece...    280   4e-84    
ref|XP_009136073.1|  PREDICTED: somatic embryogenesis receptor ki...    280   5e-84    
ref|XP_003525760.1|  PREDICTED: probable leucine-rich repeat rece...    276   7e-83    
ref|XP_007155588.1|  hypothetical protein PHAVU_003G214800g             271   9e-81    
gb|AFW83078.1|  putative leucine-rich repeat protein kinase famil...    268   1e-79    
ref|XP_008656611.1|  PREDICTED: probable leucine-rich repeat rece...    268   5e-79    
gb|EMT21475.1|  Putative LRR receptor-like serine/threonine-prote...    254   4e-76    
gb|KEH22284.1|  LRR receptor-like kinase                                257   4e-76    
ref|NP_001060863.1|  Os08g0117700                                       258   5e-76    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001146186.1|  uncharacterized LOC100279756 precursor             256   4e-75    Zea mays [maize]
ref|XP_004969430.1|  PREDICTED: LRR receptor-like serine/threonin...    256   5e-75    
gb|EMS50357.1|  Leucine-rich repeat receptor protein kinase EXS         252   6e-74    
ref|XP_008377897.1|  PREDICTED: probable LRR receptor-like serine...    242   1e-71    
gb|EAZ41323.1|  hypothetical protein OsJ_25834                          236   1e-67    Oryza sativa Japonica Group [Japonica rice]
gb|KEH27456.1|  LRR receptor-like kinase                                234   3e-67    
ref|XP_008791357.1|  PREDICTED: somatic embryogenesis receptor ki...    229   1e-66    
ref|XP_008232646.1|  PREDICTED: putative receptor-like protein ki...    226   9e-66    
ref|NP_001140286.1|  uncharacterized protein LOC100272330               221   2e-63    Zea mays [maize]
gb|EPS72502.1|  hypothetical protein M569_02256                         212   2e-63    
gb|KDO63770.1|  hypothetical protein CISIN_1g005586mg                   219   4e-62    
ref|XP_002985490.1|  hypothetical protein SELMODRAFT_122408             218   7e-61    
gb|EPS61496.1|  hypothetical protein M569_13300                         217   9e-61    
ref|XP_002987081.1|  hypothetical protein SELMODRAFT_125338             218   1e-60    
gb|ACN31808.1|  unknown                                                 205   1e-58    Zea mays [maize]
gb|AFW74368.1|  putative leucine-rich repeat protein kinase famil...    199   5e-58    
ref|XP_010676668.1|  PREDICTED: protein NSP-INTERACTING KINASE 2 ...    205   5e-57    
ref|XP_006590549.1|  PREDICTED: LRR receptor-like serine/threonin...    191   3e-51    
ref|XP_001772778.1|  predicted protein                                  182   5e-48    
ref|XP_002880175.1|  hypothetical protein ARALYDRAFT_346342             177   2e-47    
ref|XP_002880174.1|  hypothetical protein ARALYDRAFT_346340             177   3e-47    
ref|XP_001785536.1|  predicted protein                                  176   6e-46    
gb|KEH27457.1|  LRR receptor-like kinase                                171   1e-44    
dbj|BAJ93229.1|  predicted protein                                      150   5e-39    
ref|XP_009334232.1|  PREDICTED: somatic embryogenesis receptor ki...    141   6e-37    
ref|XP_009342747.1|  PREDICTED: leucine-rich repeat receptor-like...    142   2e-36    
ref|XP_002509720.1|  leucine rich repeat receptor kinase, putative      137   6e-33    Ricinus communis
gb|AGO88092.1|  hypothetical protein                                    132   2e-32    
gb|AFK46209.1|  unknown                                                 128   4e-32    
gb|KDO63771.1|  hypothetical protein CISIN_1g005586mg                   133   1e-31    
dbj|BAP57509.1|  hypothetical protein THII_3212                         132   4e-31    
ref|XP_002511696.1|  leucine rich repeat receptor kinase, putative      125   3e-29    Ricinus communis
emb|CBJ27111.1|  Hypothetical leucine rich repeat protein               124   6e-29    
gb|KCW62655.1|  hypothetical protein EUGRSUZ_G00190                     127   2e-28    
ref|XP_010061931.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    122   2e-28    
ref|XP_010061930.1|  PREDICTED: probable leucine-rich repeat rece...    122   2e-28    
ref|WP_039116704.1|  hypothetical protein                               121   4e-28    
ref|WP_011429901.1|  hypothetical protein                               120   8e-28    
ref|XP_006493670.1|  PREDICTED: probable LRR receptor-like serine...    125   8e-28    
gb|KDO64898.1|  hypothetical protein CISIN_1g043316mg                   125   9e-28    
gb|EAZ17906.1|  hypothetical protein OsJ_33453                          123   1e-27    Oryza sativa Japonica Group [Japonica rice]
gb|ABZ07819.1|  putative leucine-rich repeat protein                    124   1e-27    uncultured marine microorganism HF4000_ANIW141I9
ref|WP_036157731.1|  hypothetical protein                               118   1e-27    
gb|EDN70504.1|  conserved hypothetical protein                          124   2e-27    Beggiatoa sp. PS
ref|WP_030001613.1|  hypothetical protein                               120   2e-27    
ref|XP_002891200.1|  hypothetical protein ARALYDRAFT_473694             124   2e-27    
ref|XP_010269438.1|  PREDICTED: probable leucine-rich repeat rece...    124   2e-27    
emb|CBN79590.1|  LRR-GTPase of the ROCO family                          124   2e-27    
ref|XP_006494754.1|  PREDICTED: probable LRR receptor-like serine...    120   3e-27    
emb|CBN79778.1|  LRR-GTPase of the ROCO family, putative pseudogene     123   5e-27    
gb|KCW54202.1|  hypothetical protein EUGRSUZ_I00188                     122   6e-27    
ref|NP_001067561.1|  Os11g0232100                                       122   6e-27    Oryza sativa Japonica Group [Japonica rice]
gb|EAY80442.1|  hypothetical protein OsI_35624                          122   6e-27    Oryza sativa Indica Group [Indian rice]
ref|XP_006424098.1|  hypothetical protein CICLE_v10030255mg             122   6e-27    
ref|XP_010030332.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    122   6e-27    
ref|XP_008351826.1|  PREDICTED: LRR receptor-like serine/threonin...    119   6e-27    
emb|CDP19287.1|  unnamed protein product                                122   6e-27    
gb|AGO88094.1|  hypothetical protein                                    119   6e-27    
gb|KCW54192.1|  hypothetical protein EUGRSUZ_I00181                     122   7e-27    
ref|XP_006648220.1|  PREDICTED: leucine-rich repeat receptor-like...    122   7e-27    
ref|XP_010030336.1|  PREDICTED: probable leucine-rich repeat rece...    122   8e-27    
emb|CBN75997.1|  LRR-GTPase of the ROCO family                          122   1e-26    
emb|CBN80251.1|  Putative leucine rich repeat protein                   121   1e-26    
ref|XP_008219738.1|  PREDICTED: probable LRR receptor-like serine...    122   1e-26    
emb|CBJ26389.1|  LRR-GTPase of the ROCO family                          122   1e-26    
gb|KCW54188.1|  hypothetical protein EUGRSUZ_I00176                     119   1e-26    
ref|XP_004295710.1|  PREDICTED: probable LRR receptor-like serine...    119   1e-26    
ref|WP_026712274.1|  hypothetical protein                               116   1e-26    
gb|KCW45345.1|  hypothetical protein EUGRSUZ_L00983                     120   2e-26    
ref|XP_010065309.1|  PREDICTED: leucine-rich repeat receptor-like...    121   2e-26    
gb|EAZ17908.1|  hypothetical protein OsJ_33455                          121   2e-26    
gb|EMT08468.1|  LRR receptor-like serine/threonine-protein kinase...    121   2e-26    
ref|XP_011041520.1|  PREDICTED: probable inactive leucine-rich re...    120   2e-26    
gb|EEC68365.1|  hypothetical protein OsI_36500                          118   2e-26    
emb|CBJ29199.1|  LRR-GTPase of the ROCO family                          121   2e-26    
gb|AEX11208.1|  hypothetical protein 0_12538_02                         113   2e-26    
dbj|BAJ97909.1|  predicted protein                                      121   2e-26    
ref|XP_006489781.1|  PREDICTED: probable leucine-rich repeat rece...    121   3e-26    
gb|EAZ21469.1|  hypothetical protein OsJ_05076                          120   3e-26    
gb|EAY84170.1|  hypothetical protein OsI_05549                          120   3e-26    
ref|NP_001045656.1|  Os02g0111800                                       120   3e-26    
ref|XP_010910120.1|  PREDICTED: probable leucine-rich repeat rece...    120   3e-26    
ref|XP_003548995.1|  PREDICTED: receptor-like protein 12-like iso...    120   3e-26    
emb|CDY36706.1|  BnaC02g31270D                                          120   3e-26    
gb|ACN59243.1|  leucine-rich repeat receptor-like protein kinase        120   3e-26    
ref|XP_008393009.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...    120   4e-26    
ref|XP_007214221.1|  hypothetical protein PRUPE_ppa020335mg             120   4e-26    
ref|XP_003552276.1|  PREDICTED: probable inactive leucine-rich re...    119   4e-26    
ref|XP_008219734.1|  PREDICTED: probable LRR receptor-like serine...    120   4e-26    
ref|XP_006340921.1|  PREDICTED: probable leucine-rich repeat rece...    120   4e-26    
ref|NP_174809.1|  putative leucine-rich repeat receptor-like prot...    120   4e-26    
ref|XP_008339062.1|  PREDICTED: probable leucine-rich repeat rece...    119   4e-26    
ref|XP_007036300.1|  Leucine-rich repeat transmembrane protein ki...    120   4e-26    
ref|XP_009409684.1|  PREDICTED: putative receptor-like protein ki...    120   5e-26    
emb|CBI15574.3|  unnamed protein product                                119   5e-26    
ref|XP_006367120.1|  PREDICTED: probable LRR receptor-like serine...    120   5e-26    
ref|XP_008353647.1|  PREDICTED: probable leucine-rich repeat rece...    120   6e-26    
ref|XP_008779587.1|  PREDICTED: probable LRR receptor-like serine...    119   6e-26    
ref|XP_005834528.1|  hypothetical protein GUITHDRAFT_162646             115   6e-26    
gb|KHF98929.1|  hypothetical protein F383_16784                         119   6e-26    
ref|XP_006361350.1|  PREDICTED: probable leucine-rich repeat rece...    119   7e-26    
ref|XP_002315618.1|  leucine-rich repeat family protein                 117   7e-26    
ref|XP_009372104.1|  PREDICTED: probable leucine-rich repeat rece...    119   7e-26    
gb|AEX11206.1|  hypothetical protein 0_12538_02                         112   7e-26    
ref|XP_004301322.1|  PREDICTED: probable leucine-rich repeat rece...    119   8e-26    
ref|XP_006361349.1|  PREDICTED: probable leucine-rich repeat rece...    119   8e-26    
ref|WP_007041629.1|  Lecithin:cholesterol acyltransferase               120   8e-26    
gb|AAS48159.1|  LRR protein WM1.7                                       119   8e-26    
gb|KDO39583.1|  hypothetical protein CISIN_1g040974mg                   115   9e-26    
ref|WP_038338156.1|  hypothetical protein                               117   9e-26    
ref|XP_010906400.1|  PREDICTED: DNA-damage-repair/toleration prot...    118   9e-26    
ref|XP_010030328.1|  PREDICTED: probable leucine-rich repeat rece...    119   9e-26    
gb|KFK24158.1|  hypothetical protein AALP_AAs61366U000100               119   1e-25    
emb|CDY26403.1|  BnaA02g23670D                                          118   1e-25    
emb|CDP06824.1|  unnamed protein product                                119   1e-25    
gb|KFK24159.1|  hypothetical protein AALP_AAs61366U000100               119   1e-25    
ref|XP_010651393.1|  PREDICTED: LRR receptor-like serine/threonin...    115   1e-25    
gb|KDO36144.1|  hypothetical protein CISIN_1g036674mg                   114   1e-25    
ref|WP_011433037.1|  hypothetical protein                               114   1e-25    
ref|XP_009783221.1|  PREDICTED: probable leucine-rich repeat rece...    117   2e-25    
ref|XP_009123620.1|  PREDICTED: putative receptor-like protein ki...    118   2e-25    
ref|XP_010557548.1|  PREDICTED: probable LRR receptor-like serine...    118   2e-25    
ref|XP_010557549.1|  PREDICTED: probable LRR receptor-like serine...    118   2e-25    
ref|XP_003596246.1|  hypothetical protein MTR_2g075070                  114   2e-25    
ref|XP_002891202.1|  hypothetical protein ARALYDRAFT_891227             118   2e-25    
ref|XP_010522433.1|  PREDICTED: probable leucine-rich repeat rece...    118   2e-25    
emb|CBJ31628.1|  Putative Leucine Rich Repeat Protein                   118   2e-25    
ref|XP_007227628.1|  hypothetical protein PRUPE_ppa024924mg             118   2e-25    
ref|XP_004301913.1|  PREDICTED: probable LRR receptor-like serine...    118   2e-25    
ref|XP_008446051.1|  PREDICTED: probable inactive leucine-rich re...    117   3e-25    
ref|XP_006480345.1|  PREDICTED: probable LRR receptor-like serine...    118   3e-25    
ref|XP_006480344.1|  PREDICTED: probable LRR receptor-like serine...    118   3e-25    
ref|XP_008378548.1|  PREDICTED: probable leucine-rich repeat rece...    118   3e-25    
ref|XP_006480343.1|  PREDICTED: probable LRR receptor-like serine...    118   3e-25    
ref|XP_002318299.1|  putative leucine-rich repeat transmembrane p...    117   3e-25    
emb|CBI15575.3|  unnamed protein product                                118   3e-25    
ref|XP_006279948.1|  hypothetical protein CARUB_v10025818mg             117   3e-25    
ref|XP_009599063.1|  PREDICTED: receptor-like protein kinase HSL1       117   3e-25    
ref|WP_034565246.1|  hypothetical protein                               113   3e-25    
ref|XP_002267065.1|  PREDICTED: probable LRR receptor-like serine...    117   4e-25    
ref|XP_010030775.1|  PREDICTED: probable LRR receptor-like serine...    116   4e-25    
ref|XP_008810065.1|  PREDICTED: probable leucine-rich repeat rece...    117   4e-25    
ref|XP_002512112.1|  serine-threonine protein kinase, plant-type,...    112   4e-25    
gb|AAB82756.1|  receptor kinase-like protein                            117   4e-25    
ref|XP_010544027.1|  PREDICTED: probable leucine-rich repeat rece...    117   5e-25    
emb|CDP22122.1|  unnamed protein product                                112   5e-25    
gb|AAB82755.1|  receptor kinase-like protein                            117   5e-25    
ref|XP_009786287.1|  PREDICTED: receptor-like protein kinase HSL1       117   5e-25    
emb|CDP16927.1|  unnamed protein product                                117   5e-25    
ref|XP_008227225.1|  PREDICTED: probable leucine-rich repeat rece...    117   5e-25    
ref|XP_002460722.1|  hypothetical protein SORBIDRAFT_02g033810          117   6e-25    
ref|XP_009335485.1|  PREDICTED: receptor-like protein kinase HSL1       116   6e-25    
ref|XP_009337416.1|  PREDICTED: probable leucine-rich repeat rece...    117   6e-25    
ref|XP_006424103.1|  hypothetical protein CICLE_v10027723mg             116   6e-25    
ref|XP_010030330.1|  PREDICTED: probable leucine-rich repeat rece...    113   6e-25    
ref|WP_030001882.1|  hypothetical protein                               112   6e-25    
gb|KCW56172.1|  hypothetical protein EUGRSUZ_I01922                     115   6e-25    
ref|XP_010909427.1|  PREDICTED: probable leucine-rich repeat rece...    115   7e-25    
ref|XP_010320165.1|  PREDICTED: probable LRR receptor-like serine...    114   7e-25    
gb|KDO46595.1|  hypothetical protein CISIN_1g001440mg                   116   7e-25    
ref|WP_030001770.1|  hypothetical protein                               112   7e-25    
ref|XP_006494332.1|  PREDICTED: probable leucine-rich repeat rece...    116   7e-25    
gb|KCW56525.1|  hypothetical protein EUGRSUZ_I02250                     116   7e-25    
ref|XP_004963245.1|  PREDICTED: putative receptor-like protein ki...    116   7e-25    
emb|CDP20273.1|  unnamed protein product                                116   8e-25    
ref|XP_002518162.1|  BRASSINOSTEROID INSENSITIVE 1 precursor, put...    116   8e-25    
ref|XP_010688659.1|  PREDICTED: LRR receptor-like serine/threonin...    116   8e-25    
gb|KCW54189.1|  hypothetical protein EUGRSUZ_I00178                     113   8e-25    
gb|KDP33341.1|  hypothetical protein JCGZ_12890                         116   8e-25    
ref|XP_009387212.1|  PREDICTED: receptor-like protein kinase 2          113   8e-25    
ref|XP_008801280.1|  PREDICTED: probable leucine-rich repeat rece...    113   8e-25    
ref|XP_002460231.1|  hypothetical protein SORBIDRAFT_02g025040          116   9e-25    
ref|NP_001176608.1|  Os11g0559200                                       116   9e-25    
ref|XP_006494899.1|  PREDICTED: probable leucine-rich repeat rece...    116   9e-25    
ref|XP_008378550.1|  PREDICTED: probable leucine-rich repeat rece...    116   9e-25    
ref|XP_002276923.2|  PREDICTED: probable LRR receptor-like serine...    115   9e-25    
ref|XP_007213080.1|  hypothetical protein PRUPE_ppa021211mg             116   9e-25    
ref|XP_010661041.1|  PREDICTED: probable leucine-rich repeat rece...    115   9e-25    
ref|XP_006354068.1|  PREDICTED: probable leucine-rich repeat rece...    116   9e-25    
ref|XP_002277606.1|  PREDICTED: probable leucine-rich repeat rece...    115   1e-24    
ref|XP_010663893.1|  PREDICTED: probable LRR receptor-like serine...    116   1e-24    
ref|XP_002530120.1|  Leucine-rich repeat receptor protein kinase ...    116   1e-24    
ref|XP_008226058.1|  PREDICTED: probable LRR receptor-like serine...    116   1e-24    
ref|XP_008810064.1|  PREDICTED: probable leucine-rich repeat rece...    116   1e-24    
emb|CBJ26402.1|  LRR-GTPase of the ROCO family                          116   1e-24    
emb|CBI35045.3|  unnamed protein product                                115   1e-24    
ref|XP_004238525.1|  PREDICTED: probable LRR receptor-like serine...    115   1e-24    
emb|CAN59750.1|  hypothetical protein VITISV_033634                     114   1e-24    
ref|XP_010320170.1|  PREDICTED: probable leucine-rich repeat rece...    115   1e-24    
ref|XP_009784945.1|  PREDICTED: probable leucine-rich repeat rece...    115   1e-24    
ref|XP_006494898.1|  PREDICTED: probable leucine-rich repeat rece...    115   1e-24    
ref|XP_010509921.1|  PREDICTED: probable leucine-rich repeat rece...    115   1e-24    
ref|XP_008219741.1|  PREDICTED: probable leucine-rich repeat rece...    115   1e-24    
ref|XP_007201562.1|  hypothetical protein PRUPE_ppa017960mg             115   1e-24    
ref|XP_011000226.1|  PREDICTED: probable LRR receptor-like serine...    115   1e-24    
ref|XP_010069577.1|  PREDICTED: probable LRR receptor-like serine...    115   1e-24    
gb|KCW57968.1|  hypothetical protein EUGRSUZ_H00705                     115   1e-24    
emb|CDP11195.1|  unnamed protein product                                115   1e-24    
ref|XP_006442129.1|  hypothetical protein CICLE_v10024387mg             115   1e-24    
ref|XP_011029917.1|  PREDICTED: probable LRR receptor-like serine...    115   1e-24    
ref|XP_004298963.1|  PREDICTED: LRR receptor-like serine/threonin...    115   1e-24    
ref|XP_008339061.1|  PREDICTED: probable leucine-rich repeat rece...    115   1e-24    
ref|XP_007034485.1|  Leucine-rich repeat receptor-like protein ki...    114   1e-24    
gb|KDO49388.1|  hypothetical protein CISIN_1g039650mg                   112   1e-24    
ref|XP_008229253.1|  PREDICTED: probable LRR receptor-like serine...    115   1e-24    
ref|XP_001777689.1|  predicted protein                                  115   1e-24    
emb|CBJ26403.1|  Putative Leucine Rich Repeat Protein                   111   1e-24    
emb|CDP19285.1|  unnamed protein product                                115   2e-24    
gb|EEC70577.1|  hypothetical protein OsI_01776                          115   2e-24    
ref|XP_008795782.1|  PREDICTED: LRR receptor-like serine/threonin...    115   2e-24    
ref|WP_030001877.1|  hypothetical protein                               115   2e-24    
ref|XP_006442932.1|  hypothetical protein CICLE_v10024069mg             115   2e-24    
emb|CDX96089.1|  BnaA07g26420D                                          114   2e-24    
ref|XP_008378530.1|  PREDICTED: probable LRR receptor-like serine...    115   2e-24    
ref|XP_009336150.1|  PREDICTED: probable leucine-rich repeat rece...    115   2e-24    
ref|XP_006494393.1|  PREDICTED: probable LRR receptor-like serine...    115   2e-24    
ref|XP_004247815.1|  PREDICTED: probable leucine-rich repeat rece...    115   2e-24    
ref|WP_012022692.1|  two component regulator                            115   2e-24    
ref|XP_010262428.1|  PREDICTED: probable LRR receptor-like serine...    115   2e-24    
ref|XP_009362981.1|  PREDICTED: LRR receptor-like serine/threonin...    115   2e-24    
gb|KDO49387.1|  hypothetical protein CISIN_1g0429581mg                  115   2e-24    
ref|XP_010469512.1|  PREDICTED: probable leucine-rich repeat rece...    115   2e-24    
ref|XP_006493152.1|  PREDICTED: probable LRR receptor-like serine...    115   2e-24    
ref|XP_009141291.1|  PREDICTED: probable leucine-rich repeat rece...    115   2e-24    
gb|EMT22704.1|  LRR receptor-like serine/threonine-protein kinase...    115   2e-24    
gb|EAZ09141.1|  hypothetical protein OsI_31411                          115   2e-24    
ref|NP_001175843.1|  Os09g0423000                                       115   2e-24    
ref|XP_007018791.1|  Receptor protein kinase, putative                  115   2e-24    
dbj|BAD33417.1|  putative protein kinase Xa21, receptor type prec...    115   2e-24    
ref|XP_007045046.1|  Leucine-rich repeat protein kinase family pr...    114   2e-24    
ref|XP_010268650.1|  PREDICTED: receptor-like protein kinase HSL1       114   2e-24    
ref|XP_010933230.1|  PREDICTED: probable LRR receptor-like serine...    115   3e-24    
dbj|GAK59691.1|  receptor protein kinase                                114   3e-24    
ref|XP_010102525.1|  LRR receptor-like serine/threonine-protein k...    114   3e-24    
gb|KDO43020.1|  hypothetical protein CISIN_1g002679mg                   114   3e-24    
ref|XP_008378674.1|  PREDICTED: receptor-like protein kinase HSL1       114   3e-24    
gb|AGO88046.1|  hypothetical protein                                    108   3e-24    
gb|KCW48464.1|  hypothetical protein EUGRSUZ_K02160                     114   3e-24    
ref|XP_009345997.1|  PREDICTED: probable LRR receptor-like serine...    114   3e-24    
ref|XP_010320169.1|  PREDICTED: probable LRR receptor-like serine...    114   3e-24    
ref|XP_007034487.1|  Leucine-rich repeat receptor-like protein ki...    114   3e-24    
gb|EPS71094.1|  hypothetical protein M569_03661                         110   3e-24    
gb|KDO46289.1|  hypothetical protein CISIN_1g001434mg                   114   3e-24    
ref|XP_008655670.1|  PREDICTED: probable LRR receptor-like serine...    114   3e-24    
ref|XP_004488998.1|  PREDICTED: probable leucine-rich repeat rece...    114   3e-24    
ref|XP_010441796.1|  PREDICTED: putative receptor-like protein ki...    114   3e-24    
ref|XP_006428841.1|  hypothetical protein CICLE_v10011171mg             114   3e-24    
ref|XP_001778749.1|  predicted protein                                  114   3e-24    
ref|XP_008232234.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    114   4e-24    
ref|XP_009384784.1|  PREDICTED: probably inactive leucine-rich re...    114   4e-24    
ref|NP_187719.1|  receptor like protein 35                              114   4e-24    
emb|CDY23764.1|  BnaC04g43580D                                          114   4e-24    
ref|XP_006465579.1|  PREDICTED: probable LRR receptor-like serine...    114   4e-24    
ref|XP_007219286.1|  hypothetical protein PRUPE_ppa018504mg             114   4e-24    
ref|XP_002963765.1|  hypothetical protein SELMODRAFT_405170             113   4e-24    
ref|XP_004299842.1|  PREDICTED: receptor-like protein kinase HSL1...    114   4e-24    
ref|XP_006420529.1|  hypothetical protein CICLE_v10004196mg             114   4e-24    
ref|XP_006465577.1|  PREDICTED: probable LRR receptor-like serine...    114   4e-24    
gb|KDO43353.1|  hypothetical protein CISIN_1g018826mg                   110   4e-24    
ref|XP_003628785.1|  Receptor protein kinase-like protein               114   4e-24    
ref|WP_035091656.1|  hypothetical protein                               109   4e-24    
ref|XP_008245567.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    114   4e-24    
gb|KDP41372.1|  hypothetical protein JCGZ_15779                         114   4e-24    
ref|XP_008383191.1|  PREDICTED: probable LRR receptor-like serine...    114   4e-24    
ref|XP_006465576.1|  PREDICTED: probable LRR receptor-like serine...    114   4e-24    
ref|XP_010555502.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...    114   5e-24    
emb|CBI22182.3|  unnamed protein product                                114   5e-24    
gb|EMT15641.1|  Putative LRR receptor-like serine/threonine-prote...    114   5e-24    
ref|XP_008347921.1|  PREDICTED: leucine-rich repeat receptor-like...    114   5e-24    
ref|XP_004301907.1|  PREDICTED: leucine-rich repeat receptor-like...    114   5e-24    
ref|XP_006442652.1|  hypothetical protein CICLE_v10023370mg             114   5e-24    
gb|KDO45553.1|  hypothetical protein CISIN_1g0380032mg                  113   5e-24    
gb|KHN40544.1|  Putative LRR receptor-like serine/threonine-prote...    114   5e-24    
ref|XP_010038995.1|  PREDICTED: probable leucine-rich repeat rece...    114   5e-24    
ref|XP_006465573.1|  PREDICTED: probable LRR receptor-like serine...    114   5e-24    
ref|XP_009618083.1|  PREDICTED: probable leucine-rich repeat rece...    114   5e-24    
ref|XP_010249537.1|  PREDICTED: probably inactive leucine-rich re...    114   5e-24    
emb|CDP21299.1|  unnamed protein product                                113   5e-24    
ref|XP_008245003.1|  PREDICTED: LRR receptor-like serine/threonin...    114   5e-24    
ref|XP_002965420.1|  hypothetical protein SELMODRAFT_406781             114   6e-24    
ref|XP_010911723.1|  PREDICTED: probable LRR receptor-like serine...    111   6e-24    
ref|NP_001042043.1|  Os01g0152000                                       114   6e-24    
ref|XP_010249536.1|  PREDICTED: probably inactive leucine-rich re...    114   6e-24    
gb|AFW59133.1|  putative leucine-rich repeat receptor-like protei...    114   6e-24    
gb|AAX19036.1|  Hcr2-p7.7                                               111   6e-24    
ref|XP_010064209.1|  PREDICTED: probable LRR receptor-like serine...    114   6e-24    
gb|AAX19037.1|  Hcr2-p7.8                                               111   6e-24    
ref|XP_007224790.1|  hypothetical protein PRUPE_ppa023834mg             113   6e-24    
gb|KDO74191.1|  hypothetical protein CISIN_1g002069mg                   113   6e-24    
ref|XP_010039042.1|  PREDICTED: probable leucine-rich repeat rece...    114   6e-24    
ref|XP_007025138.1|  Leucine-rich receptor-like protein kinase fa...    114   6e-24    



>ref|XP_009772119.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Nicotiana 
sylvestris]
Length=684

 Score =   498 bits (1282),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 265/339 (78%), Positives = 295/339 (87%), Gaps = 2/339 (1%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNELGQVVNISLQGK L GKIPPEI Q+++LSGLYLHFN LHG VP+EIANLT L
Sbjct  67    FEGIACNELGQVVNISLQGKDLSGKIPPEIGQLQSLSGLYLHFNKLHGVVPKEIANLTQL  126

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP E+ N+++LQVLQLCYN+L+G+IPNQ+G+LK L+VLALQ N LTG
Sbjct  127   SDLYLNVNNLSGVIPTEVGNMSNLQVLQLCYNQLTGSIPNQIGALKKLSVLALQVNQLTG  186

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +LTRLDLSFN+ FGSIP KLANA KLE+LDIRNNTLSGNVPLALKRLNEG
Sbjct  187   AIPASLGDLEMLTRLDLSFNNFFGSIPVKLANAPKLEVLDIRNNTLSGNVPLALKRLNEG  246

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKPR  721
             FQY NNP LCGI FSSLKLCT S LN ++P+PF PGSN LPTKDIPESANVQ   +++ R
Sbjct  247   FQYANNPDLCGIEFSSLKLCTVSGLNQNRPQPFQPGSNRLPTKDIPESANVQAKQMSQSR  306

Query  722   KPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRSA  901
             K QTA VVVGV+ L VA   TGLFTFSWYRRRKQKIG T+DSSD RLSTD+ KEVSRRSA
Sbjct  307   KSQTA-VVVGVIALFVAVAVTGLFTFSWYRRRKQKIGGTLDSSDRRLSTDEVKEVSRRSA  365

Query  902   SPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             SPLI+LEYSNGWDPL K R G +AFSQEV ESFMFNLDE
Sbjct  366   SPLISLEYSNGWDPLGKGR-GGSAFSQEVFESFMFNLDE  403



>ref|XP_006347874.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Solanum tuberosum]
Length=686

 Score =   494 bits (1271),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 263/339 (78%), Positives = 296/339 (87%), Gaps = 2/339 (1%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNELGQVVNISLQGK L GKIPPEI Q+++LSGLYLHFN LHG VP+EIANLT L
Sbjct  69    FEGIACNELGQVVNISLQGKDLTGKIPPEIGQLQSLSGLYLHFNKLHGVVPKEIANLTQL  128

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPE+ N++SLQVLQLCYN+L+G+IPNQLG++K L+VLALQ N LTG
Sbjct  129   SDLYLNVNNLSGVIPPEVGNMSSLQVLQLCYNQLTGSIPNQLGAVKKLSVLALQVNQLTG  188

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +LTRLDLSFN+LFGSIP KLA+A KLE+LDIRNNTLSGNVP ALKRLNEG
Sbjct  189   AIPASLGDLEMLTRLDLSFNNLFGSIPVKLADALKLEVLDIRNNTLSGNVPQALKRLNEG  248

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKPR  721
             FQY NNP LCGI FSSLKLCT S+LN ++P+PF PGSN LPTKDIPESANVQ   +++ R
Sbjct  249   FQYANNPDLCGIEFSSLKLCTVSSLNQNRPQPFEPGSNRLPTKDIPESANVQTKQMSQSR  308

Query  722   KPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRSA  901
             K QTA VVVGV+ L VA   TGLFTFS YRRRKQKIG T+D+SD RLSTD+ KE+SRRSA
Sbjct  309   KSQTA-VVVGVIALFVAVAVTGLFTFSLYRRRKQKIGGTLDTSDRRLSTDEVKEISRRSA  367

Query  902   SPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             SPLI+LEYSNGWDPL K R G +AFSQEV ESFMFNLDE
Sbjct  368   SPLISLEYSNGWDPLGKGR-GGSAFSQEVFESFMFNLDE  405



>ref|XP_004229807.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Solanum lycopersicum]
Length=686

 Score =   493 bits (1269),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 264/339 (78%), Positives = 294/339 (87%), Gaps = 2/339 (1%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNELGQVVNISLQGK L GKIPPEI Q+++LSGLYLHFN LHG VP+EIANLT L
Sbjct  69    FEGIACNELGQVVNISLQGKDLTGKIPPEIGQLQSLSGLYLHFNKLHGVVPKEIANLTQL  128

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPE+ N++SLQVLQLCYN+L+G+IPNQLG LK L+VLALQ N LTG
Sbjct  129   SDLYLNVNNLSGVIPPEVGNMSSLQVLQLCYNQLTGSIPNQLGVLKKLSVLALQVNQLTG  188

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +LTRLDLSFN+LFGSIP KLA+A KLE+LDIRNNTLSGNVP ALKRLNEG
Sbjct  189   AIPASLGDLEMLTRLDLSFNNLFGSIPVKLADAPKLEVLDIRNNTLSGNVPQALKRLNEG  248

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKPR  721
             FQY NNP LCGI FSSLKLCT S+LN ++P+PF PGSN LPTKDIPESANVQ    ++ R
Sbjct  249   FQYANNPDLCGIEFSSLKLCTVSSLNQNRPQPFEPGSNRLPTKDIPESANVQTKQTSQSR  308

Query  722   KPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRSA  901
             K QTA VVVGV+ L VA   TGLFTFS YRRRKQKIG T+D+SD RLSTD+ KE+SRRSA
Sbjct  309   KSQTA-VVVGVIALFVAVAVTGLFTFSLYRRRKQKIGGTLDTSDRRLSTDEVKEISRRSA  367

Query  902   SPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             SPLI+LEYSNGWDPL K R G +AFSQEV ESFMFNLDE
Sbjct  368   SPLISLEYSNGWDPLGKGR-GGSAFSQEVFESFMFNLDE  405



>ref|XP_009629432.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nicotiana tomentosiformis]
Length=684

 Score =   492 bits (1267),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 262/339 (77%), Positives = 294/339 (87%), Gaps = 2/339 (1%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNELGQVVNISLQGK L GKIPPEI Q+++LSGLYLHFN LHG VP+EIANLT L
Sbjct  67    FEGIACNELGQVVNISLQGKDLSGKIPPEIGQLQSLSGLYLHFNKLHGVVPKEIANLTQL  126

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LS  IP E+ N+++LQVLQLCYN+L+G+IPNQ+G+LK L+VLALQ N LTG
Sbjct  127   SDLYLNVNNLSSVIPTEVGNMSNLQVLQLCYNQLTGSIPNQIGALKKLSVLALQVNQLTG  186

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +LTRLDLSFN+ FGSIP KLANA KLE+LDIRNNTLSGNVPLALKRLN+G
Sbjct  187   AIPASLGDLEMLTRLDLSFNNFFGSIPVKLANAPKLEVLDIRNNTLSGNVPLALKRLNKG  246

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKPR  721
             FQY NNP LCGI FSSLKLCT S LN ++P+PF PGSN LPTKDIPESANVQ   +++ R
Sbjct  247   FQYANNPDLCGIEFSSLKLCTVSGLNQNRPQPFQPGSNRLPTKDIPESANVQAKQMSQSR  306

Query  722   KPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRSA  901
             K QTA VVVGV+ L VA   TGLFTFSWYRRRKQKIG T+DS+D RLSTD+ KEVSRRSA
Sbjct  307   KSQTA-VVVGVIALFVAVAVTGLFTFSWYRRRKQKIGGTLDSADRRLSTDEVKEVSRRSA  365

Query  902   SPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             SPLI+LEYSNGWDPL K R+G  AFSQEV ESFMFNLDE
Sbjct  366   SPLISLEYSNGWDPLGKGRDG-TAFSQEVFESFMFNLDE  403



>ref|XP_011093359.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Sesamum indicum]
Length=681

 Score =   487 bits (1253),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 260/339 (77%), Positives = 296/339 (87%), Gaps = 2/339 (1%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNE GQVVNISLQGKGL G+IPPEI Q+K+LSGLYLHFN LHG VP+E+ANLT L
Sbjct  65    FEGIACNEYGQVVNISLQGKGLSGQIPPEIGQLKSLSGLYLHFNKLHGLVPKELANLTEL  124

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI ++++LQV+QLCYNKL+GNIP Q GSLK L VLALQSN LTG
Sbjct  125   SDLYLNVNNLSGDIPPEIGDMSNLQVMQLCYNKLTGNIPTQFGSLKKLNVLALQSNQLTG  184

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG L +LTRLDLS+NHLFGSIP KLA    L++LDIRNNTLSGNVPLALKRL+EG
Sbjct  185   AIPASLGGLMMLTRLDLSYNHLFGSIPLKLAGLPMLKVLDIRNNTLSGNVPLALKRLDEG  244

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKPR  721
             FQY NN GLCGIGF  L++C+ S  N +KPEPFGPG++HLP+KDIPESANV+ + +NK R
Sbjct  245   FQYENNTGLCGIGFPPLQICSASGKNSNKPEPFGPGTSHLPSKDIPESANVEQNGVNKSR  304

Query  722   KPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRSA  901
             KPQ A VVVG+LGLIVAF   GLFTFSWYRR+KQKIGST DSSDSRLSTDQ++EV RRSA
Sbjct  305   KPQPA-VVVGILGLIVAFAVVGLFTFSWYRRQKQKIGSTFDSSDSRLSTDQSREVCRRSA  363

Query  902   SPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             SPLI+LEYSNGWDPLAK ++ N +FSQEVLES MFNLDE
Sbjct  364   SPLISLEYSNGWDPLAKRQDVN-SFSQEVLESHMFNLDE  401



>emb|CDO97695.1| unnamed protein product [Coffea canephora]
Length=679

 Score =   476 bits (1226),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 247/343 (72%), Positives = 287/343 (84%), Gaps = 10/343 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F GIACN  GQV+NISLQGKGL GKIPPEI Q+K+LSGLYLHFN LHG VP+EIANLT L
Sbjct  63    FVGIACNGNGQVLNISLQGKGLAGKIPPEIGQLKSLSGLYLHFNQLHGGVPKEIANLTEL  122

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+L+G IPPE+ N+ SLQV+QLCYNKL+G+IP QLG LK L VLALQ N L+G
Sbjct  123   SDLYLNVNNLTGEIPPELGNMPSLQVMQLCYNKLTGSIPTQLGFLKKLNVLALQYNQLSG  182

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG L  LTR+DLSFN LFGSIP KLAN+  LE LDIRNNTLSGNVP+ALKRLNEG
Sbjct  183   AIPASLGGLVNLTRMDLSFNGLFGSIPVKLANSPNLEFLDIRNNTLSGNVPIALKRLNEG  242

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKPR  721
             FQ+ NNPGLCGIGFS+L +CTDS +NP+KPEPFGPGS+ LP+K IPESANVQP++LN+ R
Sbjct  243   FQFANNPGLCGIGFSTLNVCTDSGINPNKPEPFGPGSSRLPSKAIPESANVQPNSLNQSR  302

Query  722   KPQTAvvvvgvlglivAFFAT----GLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
             +PQTA     ++  ++  FA     G+FTF WYRR+KQKIGST D+SDSRLSTDQ KEV 
Sbjct  303   RPQTA-----IIVGLIGLFAVVAVIGVFTFFWYRRQKQKIGSTYDASDSRLSTDQVKEVC  357

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             RRSASPLI+LEYS+GWDPLA+ + G+  FSQE  +SFMFNLDE
Sbjct  358   RRSASPLISLEYSHGWDPLARRQIGH-GFSQEEFDSFMFNLDE  399



>ref|XP_010255622.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Nelumbo 
nucifera]
Length=681

 Score =   447 bits (1151),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 241/345 (70%), Positives = 281/345 (81%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNELG+V NISL GKGL G++PP +A +K+LSGLYLHFN L G +PREI+NLT L
Sbjct  59    FEGVACNELGKVANISLVGKGLTGRLPPAVAGLKSLSGLYLHFNSLSGGIPREISNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+ SG+IP EI N+ SLQVLQLCYN+L+G+IP QLGSLK LTVLALQ N L+G
Sbjct  119   SDLYLNVNNFSGNIPSEIGNMASLQVLQLCYNQLTGSIPTQLGSLKRLTVLALQFNQLSG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLSFN LFGSIP KLA+   LE+LD+RNNTLSGNVP ALKRLNEG
Sbjct  179   AIPASLGDLEMLMRLDLSFNRLFGSIPVKLADVPTLEVLDVRNNTLSGNVPPALKRLNEG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQP-----H  703
             FQY NN  LCG+GFS+L++C+ S  LNP++PEPFGPG+N L T+DIPESAN+Q      H
Sbjct  239   FQYGNNSNLCGVGFSTLQVCSASDHLNPNRPEPFGPGTNGLATRDIPESANLQAHCNQTH  298

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
              LN  +  Q A V VGV+ + VA   TGL TFSWYRRRKQKIGS  DS DSRLSTDQAKE
Sbjct  299   CLNSTKTSQIA-VTVGVVSVTVALAVTGLLTFSWYRRRKQKIGSAFDSLDSRLSTDQAKE  357

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             V R+SASPLI+LEYSNGWDPLA  R+G + FSQE L++F FNLDE
Sbjct  358   VYRKSASPLISLEYSNGWDPLADERSG-SGFSQESLKTFRFNLDE  401



>gb|EYU30556.1| hypothetical protein MIMGU_mgv1a002343mg [Erythranthe guttata]
Length=686

 Score =   447 bits (1151),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 241/339 (71%), Positives = 280/339 (83%), Gaps = 2/339 (1%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNE GQVVNISLQGKGLYG+IPPEI Q+ +LSGLYLHFN LHG VP+E+ANLT L
Sbjct  69    FEGIACNEYGQVVNISLQGKGLYGQIPPEIGQLNSLSGLYLHFNKLHGVVPKELANLTQL  128

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP+I  + +LQVLQLCYNKLSGNIP Q+GSLK L VLALQSN L+G
Sbjct  129   SDLYLNVNNLSGHIPPQIGLMPNLQVLQLCYNKLSGNIPTQVGSLKKLNVLALQSNQLSG  188

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L LL RLDLSFNHLFGSIP KLA+   L++LDIRNNTLSGNVPLALK+L+EG
Sbjct  189   AIPASLGELLLLNRLDLSFNHLFGSIPLKLADLPLLKVLDIRNNTLSGNVPLALKKLDEG  248

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKPR  721
             FQY+NN  LCG GF SL++C+ S  N +KPEPFG  +NHLP+K+IPESANV+ + LN  R
Sbjct  249   FQYSNNAELCGSGFPSLQICSASTPNSNKPEPFGADTNHLPSKNIPESANVRDNKLNNSR  308

Query  722   KPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRSA  901
             K  +AVVV     +I    A GL TF+W+RR+KQKIGST D+ DSRLSTD   EV RRSA
Sbjct  309   KSLSAVVVGVAGVIIALAVA-GLLTFTWHRRQKQKIGSTCDNGDSRLSTDDVMEVRRRSA  367

Query  902   SPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             SPLI+LEYSNGWDPL K R+  ++FSQEV ES+MFNLDE
Sbjct  368   SPLISLEYSNGWDPLGK-RDEVSSFSQEVFESYMFNLDE  405



>ref|XP_010276701.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Nelumbo nucifera]
Length=682

 Score =   430 bits (1105),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 232/345 (67%), Positives = 276/345 (80%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ CNE G+V NISL GKGL G+IPP +A +K LSGLYLHFN L G +PREI+NLT L
Sbjct  60    FEGVVCNEHGKVANISLVGKGLSGRIPPAVAGLKCLSGLYLHFNSLSGEIPREISNLTEL  119

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSGSIPPEI N+ SLQVLQLCYN+L+G++P QLGSLK L+VLALQ NHL+G
Sbjct  120   SDLYLNVNNLSGSIPPEIGNMASLQVLQLCYNQLTGSVPTQLGSLKKLSVLALQFNHLSG  179

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLSFN LFGSIP KLA+   LE+LD+RNN+LSGNVP ALKRLNEG
Sbjct  180   AIPASLGDLEMLMRLDLSFNRLFGSIPVKLADIPALEVLDVRNNSLSGNVPPALKRLNEG  239

Query  542   FQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFGPGSNHLPTKDIPESANV-----QPH  703
             FQY NN  LCG+GFS+L +C+ S  LNP++PEPFGP  N L T+ IPESAN+       H
Sbjct  240   FQYGNNSDLCGVGFSTLSVCSASDRLNPNRPEPFGPSKNGLATRAIPESANLPQHCNGTH  299

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
               +  R  Q A VV GV+ ++++  ATGLFTF WYRRRKQKIGS  D+SD RLS DQ KE
Sbjct  300   CSSSSRTSQIA-VVGGVIVVVISLTATGLFTFMWYRRRKQKIGSAFDNSDCRLSIDQTKE  358

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             V R+SASPLI+LEYSNGWDPLA  R+G + FS+EVL++F FNL+E
Sbjct  359   VYRKSASPLISLEYSNGWDPLADGRSG-SGFSKEVLQTFRFNLEE  402



>emb|CAN72186.1| hypothetical protein VITISV_012898 [Vitis vinifera]
Length=702

 Score =   423 bits (1087),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 235/344 (68%), Positives = 273/344 (79%), Gaps = 10/344 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G VVNISLQGKGL G+IP EIA++K+LSGL+LHFN L G +P+EI+ L  L
Sbjct  59    FEGVACNEYGHVVNISLQGKGLMGQIPKEIAELKSLSGLFLHFNSLXGEIPKEISALAEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG I P I N+++LQVLQLCYNKL+G IP QLGSLK L+VLALQSN LTG
Sbjct  119   SDLYLNVNNLSGVIHPGIGNMSNLQVLQLCYNKLTGGIPTQLGSLKKLSVLALQSNELTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +LTRLDLSFN+LFG IP KLANA  LEILDIRNNTLSGNVP ALKRLN+G
Sbjct  179   AIPASLGDLEMLTRLDLSFNNLFGPIPVKLANAPMLEILDIRNNTLSGNVPQALKRLNDG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----  706
             FQY NNPGLCG GF +L +C+ S  LNP++PEPFGP  N      +PESAN+QP      
Sbjct  239   FQYRNNPGLCGDGFLALDVCSASDQLNPNRPEPFGP--NGTDKNGLPESANLQPDCSKTH  296

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              + P K      V GV+G+I AF  +GLF FSWYRRRKQKIGS  D+SDSRLSTDQ KEV
Sbjct  297   CSTPSKTSQIAXVCGVIGVIXAFTVSGLFAFSWYRRRKQKIGSAFDASDSRLSTDQVKEV  356

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              R+SASPLI+LEYS+GWDPL ++ NG   FSQEV  SFMFNL++
Sbjct  357   YRKSASPLISLEYSHGWDPLGQSGNG---FSQEVPGSFMFNLED  397



>ref|XP_006445272.1| hypothetical protein CICLE_v10019056mg [Citrus clementina]
 ref|XP_006490913.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Citrus sinensis]
 gb|ESR58512.1| hypothetical protein CICLE_v10019056mg [Citrus clementina]
 gb|KDO85808.1| hypothetical protein CISIN_1g005859mg [Citrus sinensis]
Length=673

 Score =   419 bits (1076),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 230/345 (67%), Positives = 274/345 (79%), Gaps = 10/345 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+E G+V NISLQGKGL G+IP  +  +K+L+GLYLHFN L+G +P+EIA+L+ L
Sbjct  56    FDGVACDENGRVANISLQGKGLSGEIPAAVGGLKSLTGLYLHFNALNGVIPKEIASLSEL  115

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP +I N+T+LQVLQLCYNKL+GNIP QLGSL+ L+VLALQ N LTG
Sbjct  116   SDLYLNVNNLSGKIPSQIGNMTNLQVLQLCYNKLTGNIPTQLGSLRKLSVLALQYNQLTG  175

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLSFN+LFG +P KLAN  KLE+LDIRNN+ SGNVP ALKRLN G
Sbjct  176   AIPASLGDLGMLMRLDLSFNNLFGPVPVKLANVPKLEVLDIRNNSFSGNVPPALKRLNGG  235

Query  542   FQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDIPESANV-----QPH  703
             FQY NN  LCG GF++LK CT S    P KPEPF P  N L TKDIPESA +     QP 
Sbjct  236   FQYDNNAALCGTGFTNLKNCTASDHPTPGKPEPFEP--NGLSTKDIPESAKLPANCGQPG  293

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
               +  R+P T  V VGV+ + +    TGLFTF+WYRRRKQKIG+  D+SDSRLSTDQ KE
Sbjct  294   CSSPARRPHTG-VFVGVIAVFIILTVTGLFTFTWYRRRKQKIGNAFDNSDSRLSTDQVKE  352

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             V RR++SPLI+LEYSNGWDPLAK ++GN  FSQEVLESFMFNL+E
Sbjct  353   VCRRNSSPLISLEYSNGWDPLAKGQSGN-GFSQEVLESFMFNLEE  396



>ref|XP_007220017.1| hypothetical protein PRUPE_ppa002366mg [Prunus persica]
 gb|EMJ21216.1| hypothetical protein PRUPE_ppa002366mg [Prunus persica]
Length=681

 Score =   419 bits (1076),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 228/351 (65%), Positives = 279/351 (79%), Gaps = 15/351 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G V NISLQGKGL+G+IPP +  +K+L+GLYLHFN L G +P+EIA L  L
Sbjct  55    FEGVACNEQGLVTNISLQGKGLWGQIPPAVGGLKSLTGLYLHFNALSGKIPKEIARLNQL  114

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP EI N+ +LQVLQLCYNKL+G +P QLG LK L+VLA+QSN LTG
Sbjct  115   SDLYLNVNNLSGGIPREIGNMPNLQVLQLCYNKLTGGLPTQLGDLKRLSVLAVQSNQLTG  174

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L  LTRLDLSFN  FG IPA+LA+A  L++LD+R+N+LSGN+PLALKRLN G
Sbjct  175   AIPASLGELGTLTRLDLSFNSFFGPIPARLAHAPMLQVLDVRSNSLSGNIPLALKRLNGG  234

Query  542   FQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPG---SNHLP----TKDIPESANVQ  697
             FQY NNP LCG+GFS LK+CT +   NP+KP+PF PG   + +LP     K+IPESAN++
Sbjct  235   FQYENNPSLCGVGFSGLKICTATTTRNPNKPQPFEPGNFSAKNLPDSPTAKEIPESANLE  294

Query  698   PHA----LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLS  865
              +      ++  K Q   +V GV+G+I A   +GLF FSWYRRRKQKIGST+D+SDSR S
Sbjct  295   SNCSQTHCSRASKSQQIGIVFGVIGVIAALAVSGLFAFSWYRRRKQKIGSTLDTSDSRHS  354

Query  866   TDQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             TDQAKEV +++ASPLINLEYSNGWDPLAK   G+A +SQEVLESFMFNL+E
Sbjct  355   TDQAKEVYKKNASPLINLEYSNGWDPLAK---GSAGYSQEVLESFMFNLEE  402



>ref|XP_008232645.1| PREDICTED: protein NSP-INTERACTING KINASE 2 isoform X1 [Prunus 
mume]
Length=681

 Score =   417 bits (1071),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 227/351 (65%), Positives = 279/351 (79%), Gaps = 15/351 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G V NISLQGKGL+G+IPP +  +K+L+GLYLHFN L G +P+EIA L  L
Sbjct  55    FEGVACNEQGLVTNISLQGKGLWGQIPPAVGGLKSLTGLYLHFNALSGKIPKEIARLNQL  114

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP EI N+ +LQVLQLCYNKL+G +P QLG LK L+VLA+QSN LTG
Sbjct  115   SDLYLNVNNLSGGIPREIGNMPNLQVLQLCYNKLTGGLPTQLGDLKRLSVLAVQSNQLTG  174

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L  LTRLDLSFN  FG IPA+LA+A  L++LD+R+N+LSGN+P  LKRLN G
Sbjct  175   AIPASLGELGTLTRLDLSFNSFFGPIPARLAHAPMLQVLDVRSNSLSGNIPPDLKRLNGG  234

Query  542   FQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPG---SNHLP----TKDIPESANVQ  697
             FQY NNP LCG+GFS LK+CT +   NP+KP+PF PG   + +LP     ++IPESAN++
Sbjct  235   FQYENNPSLCGVGFSGLKVCTATTTRNPNKPQPFEPGNFTAKNLPDSPTAREIPESANLE  294

Query  698   PHA----LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLS  865
              +      ++  K Q   +V GV+G+I A   +GLFTFSWYRRRKQKIGST+D+SDSRLS
Sbjct  295   SNCSQTHCSRASKSQQIGIVFGVIGVIAALAVSGLFTFSWYRRRKQKIGSTLDTSDSRLS  354

Query  866   TDQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             TDQAKEV +++ASPLINLEYSNGWDPLAK   G+A +SQEVLESFMFNL+E
Sbjct  355   TDQAKEVYKKNASPLINLEYSNGWDPLAK---GSAGYSQEVLESFMFNLEE  402



>ref|XP_002279998.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Vitis vinifera]
Length=677

 Score =   416 bits (1069),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 233/344 (68%), Positives = 273/344 (79%), Gaps = 10/344 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G VVNISLQGKGL G+IP EIA++K+LSGL+LHFN L+G +P+EI+ L  L
Sbjct  59    FEGVACNEYGHVVNISLQGKGLMGQIPKEIAELKSLSGLFLHFNSLYGEIPKEISALAEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG I P I N+++LQVLQLCYNKL+G IP QLGSLK L+VLALQSN LTG
Sbjct  119   SDLYLNVNNLSGVIHPGIGNMSNLQVLQLCYNKLTGGIPTQLGSLKKLSVLALQSNELTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +LTRLDLSFN+LFG IP KLANA  LEILDIRNNTLSGNVP ALKRLN+G
Sbjct  179   AIPASLGDLEMLTRLDLSFNNLFGPIPVKLANAPMLEILDIRNNTLSGNVPQALKRLNDG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----  706
             FQY NNP LCG GF +L +C+ S  LNP++PEPFGP  N      +PESAN+QP      
Sbjct  239   FQYRNNPSLCGDGFLALDVCSASDQLNPNRPEPFGP--NGTDKNGLPESANLQPDCSKTH  296

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              + P K     +V GV+G+IVA   +GLF FSWYRRRKQKIGS  D+SDSRLSTDQ KEV
Sbjct  297   CSTPSKTSQIAIVCGVIGVIVALTVSGLFAFSWYRRRKQKIGSAFDASDSRLSTDQVKEV  356

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              R+SASPLI+LEYS+GWDPL ++ NG   FSQEV  S MFNL++
Sbjct  357   YRKSASPLISLEYSHGWDPLGQSGNG---FSQEVPGSVMFNLED  397



>ref|XP_006374656.1| hypothetical protein POPTR_0015s14480g [Populus trichocarpa]
 gb|ERP52453.1| hypothetical protein POPTR_0015s14480g [Populus trichocarpa]
Length=546

 Score =   409 bits (1050),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 223/346 (64%), Positives = 264/346 (76%), Gaps = 12/346 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV NISLQGKGLYGK+ P IA +K L+GLYLHFN L+G VPREIANLT L
Sbjct  57    FEGVACNEKGQVANISLQGKGLYGKVSPAIAGLKHLTGLYLHFNSLYGDVPREIANLTEL  116

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI  + +LQVLQLCYN+ +G+IP ++GSL+ L+VL LQSNHLTG
Sbjct  117   SDLYLNVNNLSGDIPPEIGIMANLQVLQLCYNQFTGSIPTEMGSLEKLSVLTLQSNHLTG  176

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG L +L RLDLS+NHLFGSIP K+A+A  LE LDIRNNTLSGNVPLALKRLN+G
Sbjct  177   AIPASLGGLGMLMRLDLSYNHLFGSIPTKVADAPLLEFLDIRNNTLSGNVPLALKRLNDG  236

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANV-----QPHA  706
             F Y NN GLCG GF SL  C  S LNPS+PEPFG G N LP ++IPE+A++     Q H 
Sbjct  237   FLYENNLGLCGAGFVSLNACNASELNPSRPEPFGTGVNGLP-REIPETASLPLLCNQTHC  295

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              N P K   A   V  + + +   A G+ TF+ YRRRKQK+ S+ + SDSRLSTDQAK  
Sbjct  296   SN-PSKSHHASAAVATVVITILLAAIGILTFTQYRRRKQKLASSYEVSDSRLSTDQAKGA  354

Query  887   SRRSASPLINLEYSNGWDPLAKARN--GNAAFSQEVLESFMFNLDE  1018
              R++ SPLI+LEY NGWDPLA  RN  GNA   Q+V +SF FNL+E
Sbjct  355   YRKNGSPLISLEYPNGWDPLADGRNLSGNA---QDVFQSFRFNLEE  397



>gb|KDP22393.1| hypothetical protein JCGZ_26224 [Jatropha curcas]
Length=679

 Score =   412 bits (1060),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 222/345 (64%), Positives = 270/345 (78%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV NISLQGKGL+GK+   +A +K L+GLYLH+N L+G +PREIANLT L
Sbjct  57    FEGVACNEKGQVANISLQGKGLHGKLSSSVAGLKNLTGLYLHYNSLYGEIPREIANLTEL  116

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+ SG IPPEI N+ +LQVLQLCYN+ +G+IP QLG+LK L VLALQSN  TG
Sbjct  117   SDLYLNVNNFSGEIPPEIGNMGNLQVLQLCYNQFTGSIPTQLGTLKKLNVLALQSNKFTG  176

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L +L RLDLSFNH FGSIP KLA+A  LE LD+RNN+LSGNVPLALKRLN+G
Sbjct  177   AIPASLGNLGVLMRLDLSFNHFFGSIPTKLADAPLLEALDVRNNSLSGNVPLALKRLNDG  236

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKP  718
             F Y NN GLCG GF  L+ C DS  LNPS+PEPFGPGS+ +P+++IPE+AN+Q H  N+ 
Sbjct  237   FLYGNNLGLCGAGFMYLQACNDSDHLNPSRPEPFGPGSSGMPSREIPETANLQLHC-NQT  295

Query  719   R-----KPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
             R     K   A VVVG + + VA  A G+ +F+ YRRRKQK+GS+ + SDSRLSTDQAK 
Sbjct  296   RCSNSSKSHQASVVVGTVVVTVALLAMGILSFTQYRRRKQKLGSSFEISDSRLSTDQAKG  355

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             V R++ SPLI+LEY NGWDPLA  RN    + Q+V ++F FNLDE
Sbjct  356   VYRKNGSPLISLEYPNGWDPLADGRN-FIGYEQDVFQNFRFNLDE  399



>ref|XP_010101735.1| Leucine-rich repeat receptor protein kinase EXS [Morus notabilis]
 gb|EXB89490.1| Leucine-rich repeat receptor protein kinase EXS [Morus notabilis]
Length=679

 Score =   412 bits (1060),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 223/345 (65%), Positives = 273/345 (79%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACN +G V NISLQGKGL GK+ P IA++K L+GLYLH+N L+G +PREIANLT L
Sbjct  57    FEGVACNGMGHVANISLQGKGLSGKLSPAIAELKHLTGLYLHYNSLYGEIPREIANLTDL  116

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+L+G IPPEI    +LQVLQLCYN+L G+IP QLGSLK LTVLALQSN LTG
Sbjct  117   GDLYLNVNNLTGEIPPEIGTTVNLQVLQLCYNQLIGSIPTQLGSLKKLTVLALQSNQLTG  176

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L R+DLSFNHLFGSIP KLA+   LEILDIRNNTLSG+VPLALK+LNEG
Sbjct  177   AIPASLGDLEMLMRVDLSFNHLFGSIPTKLADTPLLEILDIRNNTLSGSVPLALKKLNEG  236

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANV-----QPH  703
             F Y NN GLCG+GF+SL  C  S  ++PS+PEP+G G+N + T++IPE+ANV     Q  
Sbjct  237   FAYQNNLGLCGVGFASLNPCNFSVHVDPSRPEPYGSGANGISTRNIPETANVNLPCRQTG  296

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
               N  +  Q A VVVG + + +A  A G+ +F+ YRRRKQK+G++ D SD+RLSTDQAK 
Sbjct  297   CANAAKSHQ-ASVVVGTIAVTIALLAIGILSFTQYRRRKQKLGTSFDVSDARLSTDQAKG  355

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             V+R++ SPLI+LEY+NGWDPLA  RN  +AF+QEV  SF FNL+E
Sbjct  356   VTRKNGSPLISLEYANGWDPLADGRN-LSAFAQEVFHSFRFNLEE  399



>ref|XP_007052072.1| Leucine-rich repeat receptor protein kinase [Theobroma cacao]
 gb|EOX96229.1| Leucine-rich repeat receptor protein kinase [Theobroma cacao]
Length=677

 Score =   412 bits (1058),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 226/345 (66%), Positives = 265/345 (77%), Gaps = 9/345 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+ACNE G V NISLQGKGL G+IP  +  +K+L+GLYLHFN L G +P+EIA L+ L
Sbjct  56    FDGVACNEEGHVANISLQGKGLSGQIPAALGGLKSLTGLYLHFNALSGGIPKEIATLSQL  115

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN LSG IP +I N+ +LQVLQLCYNKL+G+IP QLGSLK L VLALQ N LTG
Sbjct  116   SDLYLNVNDLSGEIPSQIGNMANLQVLQLCYNKLTGSIPTQLGSLKKLNVLALQYNRLTG  175

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +LTRLDLSFN LFG +P KLA+A  L++LDIRNNTLSGNVP  LKRLN G
Sbjct  176   AIPASLGDLEMLTRLDLSFNSLFGPVPVKLADAPMLKVLDIRNNTLSGNVPPVLKRLNSG  235

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQPHALNK-  715
             FQY NN GLCG+GFS LK C DS  +   +PEPF P  + L   DIPESA++QP   +K 
Sbjct  236   FQYENNLGLCGVGFSDLKDCADSGKIYRDRPEPFKP--SGLNRTDIPESADLQPADCSKT  293

Query  716   ----PRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
                   K  T  V+ G++G+++      LFTF+WYRRRKQKIGS  D+SD RLSTDQAKE
Sbjct  294   NCSRSSKSLTIGVISGMVGVVLVLTVAALFTFAWYRRRKQKIGSAFDTSDGRLSTDQAKE  353

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             V RRSASPLI+LEYSNGWDPL K R+GN  FSQEV ESFMFNL+E
Sbjct  354   VYRRSASPLISLEYSNGWDPLDKGRSGN-GFSQEVFESFMFNLEE  397



>gb|KHF99663.1| nsp-interacting kinase 2 -like protein [Gossypium arboreum]
Length=674

 Score =   411 bits (1056),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 226/344 (66%), Positives = 268/344 (78%), Gaps = 8/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+ACN  G+VVNISLQGKGL G+IPP +  +K+L+GLYLHFN L G +P+EI +L+ L
Sbjct  54    FDGVACNGQGRVVNISLQGKGLSGQIPPALGGLKSLTGLYLHFNALSGEIPKEIVSLSQL  113

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP I N+T LQVLQLCYN+L+G +P QLGSL  LTVLALQ N LTG
Sbjct  114   TDLYLNVNNLSGEIPPYIGNLTDLQVLQLCYNRLTGGLPTQLGSLHKLTVLALQDNRLTG  173

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +LTRLDLSFN+LFGS+P KLANA  L++LDIRNNTLSGNVP  LKRL+ G
Sbjct  174   AIPASLGDLGMLTRLDLSFNNLFGSVPVKLANAPMLKVLDIRNNTLSGNVPPVLKRLHAG  233

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQPHA----  706
             FQY NN GLCG+GF +LK C DS+ +  S+PEPF P  N L  K+IPESA++        
Sbjct  234   FQYENNLGLCGVGFPNLKDCADSSKIYRSRPEPFKP--NGLNQKNIPESADLPTECSKAN  291

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              + P       VV G++G+ +      LFTF+WYRRRKQKIGS  DSSDSRLSTDQ KEV
Sbjct  292   CSSPSGSTKIGVVSGIVGVALVLTVAALFTFAWYRRRKQKIGSAFDSSDSRLSTDQVKEV  351

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             +RRSASPLI+LEYSNGWDPL K R+GN  FSQEV ESFMFNL+E
Sbjct  352   NRRSASPLISLEYSNGWDPLDKGRSGN-GFSQEVFESFMFNLEE  394



>gb|KDO65398.1| hypothetical protein CISIN_1g044913mg, partial [Citrus sinensis]
Length=395

 Score =   400 bits (1029),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 226/345 (66%), Positives = 273/345 (79%), Gaps = 9/345 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNE GQV NISLQGKGL GK+ P IA +K L+GLYLH+N L+G +PREIANLT L
Sbjct  54    FEGIACNEKGQVANISLQGKGLNGKVSPAIAGLKHLTGLYLHYNSLYGQIPREIANLTEL  113

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI  + SLQVLQLCYN+L+G+IP QLGSL+ L+VLALQSN LTG
Sbjct  114   SDLYLNVNNLSGDIPPEIGYMGSLQVLQLCYNQLTGSIPTQLGSLRKLSVLALQSNQLTG  173

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA LGDL +L RLDLSFNHLFGSIP KLA+A  LE+LDIRNNTLSG+VP ALKRLNEG
Sbjct  174   AIPANLGDLGMLMRLDLSFNHLFGSIPRKLADAPLLEVLDIRNNTLSGSVPPALKRLNEG  233

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANV-----QPH  703
             F Y NN  LCG+GFS+LK C+ S+ +NPS+PEP+G  + H  T++IPE+ANV     Q  
Sbjct  234   FLYENNLELCGVGFSALKTCSASSNINPSRPEPYGAATTH-STRNIPETANVNLPCNQTQ  292

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
               +  +  Q A VV G++ ++VA  A G+  F+ YRRRKQK+GS+ +++DSRLSTDQAK 
Sbjct  293   CSSSSKSHQ-ASVVAGIIVVVVALSAIGILAFTQYRRRKQKLGSSFNAADSRLSTDQAKG  351

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             V R++ SPLI+LEY NGWDPLA  RN N  F+QEV +SF FNL+E
Sbjct  352   VYRKNGSPLISLEYGNGWDPLADGRNLN-VFAQEVFQSFRFNLEE  395



>ref|XP_011041704.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Populus euphratica]
Length=677

 Score =   410 bits (1054),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 223/346 (64%), Positives = 265/346 (77%), Gaps = 12/346 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV NISLQGKGLYGK+ P IA ++ L+GLYLHFN L+G VPREIANLT L
Sbjct  57    FEGVACNEKGQVANISLQGKGLYGKVSPAIAGLRHLTGLYLHFNSLYGDVPREIANLTEL  116

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI N+ +LQVLQLCYN+ +G+IP ++GSL+ LTVL LQSNHLTG
Sbjct  117   SDLYLNVNNLSGEIPPEIGNMANLQVLQLCYNQFTGSIPTEMGSLEKLTVLTLQSNHLTG  176

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG L +L RLDLS+NHLFGSIP K+A+A  LE LDIRNNTLSGNVPLALKRLN+G
Sbjct  177   AIPASLGGLGMLMRLDLSYNHLFGSIPTKVADAPLLEFLDIRNNTLSGNVPLALKRLNDG  236

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANV-----QPHA  706
             F Y NN GLCG GF SL  C  S LNPS+P+PFG G N  P ++IPE+A++     Q H 
Sbjct  237   FLYENNLGLCGAGFVSLNACNASELNPSRPQPFGTGVNGQP-REIPETASLPLLCNQTHC  295

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              N P K   A   V  + + +   A G+ TF+ YRRRKQK+ S+ + SDSRLSTDQAK V
Sbjct  296   SN-PSKSHHASAAVATVVITILLAAIGILTFTQYRRRKQKLASSYEVSDSRLSTDQAKGV  354

Query  887   SRRSASPLINLEYSNGWDPLAKARN--GNAAFSQEVLESFMFNLDE  1018
              R++ SPLI+LEY NGWDPLA  RN  GNA   Q+V +SF FNL+E
Sbjct  355   YRKNGSPLISLEYPNGWDPLADGRNFSGNA---QDVFQSFRFNLEE  397



>ref|XP_009346807.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Pyrus x bretschneideri]
Length=653

 Score =   408 bits (1048),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 224/351 (64%), Positives = 272/351 (77%), Gaps = 16/351 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G+V NISLQGKGL G+IPP +  +K L+GLYLHFN L G +P++IA+L  L
Sbjct  28    FEGVACNEQGRVTNISLQGKGLCGQIPPAVGGLKNLTGLYLHFNALTGKIPKQIADLNQL  87

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG+IP EI  + +LQVLQLCYNKL+G IP +LG LK L+VLA+QSN LTG
Sbjct  88    ADLYLNVNNLSGAIPREIGKMPNLQVLQLCYNKLTGGIPTELGQLKRLSVLAVQSNQLTG  147

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L  LTRLDLSFN  FG IPAKLA+A  LE+LD+R+NTLSGN+P ALKRLNEG
Sbjct  148   AIPASLGELGTLTRLDLSFNSFFGPIPAKLADASMLEVLDVRSNTLSGNIPPALKRLNEG  207

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGS---NHLPT----KDIPESANV--  694
             FQY NNP LCG+GFS L+ CT +A NP+ P+PF P +     LP     K+IPE+AN+  
Sbjct  208   FQYENNPNLCGVGFSGLEPCTATARNPNMPQPFEPSNFSGKGLPDSSTPKEIPETANIHS  267

Query  695   ---QPHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLS  865
                Q H       P+   +V GV+G++VA   +GLF F WYRR+KQKIGST DSSDSRLS
Sbjct  268   NCSQTHCSEASNSPEIG-LVFGVIGVVVALTVSGLFLFCWYRRQKQKIGSTFDSSDSRLS  326

Query  866   TDQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             TDQAKEV ++S SPLINLEYSNGWDPLA+   G++ +SQEVLESFM NL+E
Sbjct  327   TDQAKEVHKKSVSPLINLEYSNGWDPLAR---GSSGYSQEVLESFMINLEE  374



>ref|XP_009338105.1| PREDICTED: somatic embryogenesis receptor kinase 4-like [Pyrus 
x bretschneideri]
Length=653

 Score =   407 bits (1045),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 222/351 (63%), Positives = 273/351 (78%), Gaps = 16/351 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G+V NISLQGKGL+G+IPP +  ++ L+GLYLHFN L G +P++IA+L  L
Sbjct  28    FEGVACNEQGRVTNISLQGKGLWGQIPPAVGGLRNLTGLYLHFNALTGKIPKQIADLNQL  87

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG+IP EI  + +LQVLQLCYNKL+G IP +LG LK L+VLA+QSN LTG
Sbjct  88    ADLYLNVNNLSGAIPREIGKMPNLQVLQLCYNKLTGGIPTELGQLKRLSVLAVQSNQLTG  147

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L  LTRLDLSFN  FG IPAKLA+A  LE+LD+R+NTLSGN+P ALKRLNEG
Sbjct  148   AIPASLGELGTLTRLDLSFNSFFGPIPAKLADASMLEVLDVRSNTLSGNIPPALKRLNEG  207

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGS---NHLPT----KDIPESANV--  694
             FQY NNP LCG+GFS L+ CT +A NP+ P+PF P +     LP     K+IPE+AN+  
Sbjct  208   FQYENNPNLCGVGFSGLEPCTATARNPNMPQPFEPSNFSGKGLPDSSTPKEIPETANIHS  267

Query  695   ---QPHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLS  865
                Q H       P+   +V GV+G++VA   +GLF F WYRR+KQKIGST DSSDSRLS
Sbjct  268   NCSQTHCSEASNSPEIG-LVFGVIGVVVALTVSGLFLFCWYRRQKQKIGSTFDSSDSRLS  326

Query  866   TDQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             TDQAKE+ ++S SPLINLEYSNGWDPLA+   G++ +SQEVLESFM NL+E
Sbjct  327   TDQAKELHKKSVSPLINLEYSNGWDPLAR---GSSGYSQEVLESFMINLEE  374



>ref|XP_002267632.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 [Vitis vinifera]
Length=681

 Score =   406 bits (1044),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 223/344 (65%), Positives = 265/344 (77%), Gaps = 6/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV NISLQGKGL GK+ P IA +K L+GLYLH+N L+G +P EIANLT L
Sbjct  59    FEGVACNERGQVANISLQGKGLTGKLSPAIAGLKHLTGLYLHYNSLYGEIPVEIANLTQL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG+IP E+  + +LQVLQLCYN+L+G+IP QLGSLK L+VLALQSN LTG
Sbjct  119   SDLYLNVNNLSGTIPAELGKMATLQVLQLCYNQLTGSIPTQLGSLKKLSVLALQSNQLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLSFN LFGSIP +LA+   LE+LDIRNNTLSG +P ALKRLN G
Sbjct  179   AIPASLGDLGMLVRLDLSFNRLFGSIPRRLADVVSLEVLDIRNNTLSGKIPPALKRLNGG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDIPESANVQPHA----  706
             FQY NN  LCG GFS LK+C    L N S+PEP+G GSN   T DIPE+ANVQ H     
Sbjct  239   FQYKNNARLCGDGFSYLKVCNSLDLTNQSRPEPYGAGSNTQSTGDIPETANVQLHCDKAH  298

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              + P K   A VVVG++ + +A  A G+ +F+ YRRRKQK+GS+ D SDSRLSTDQ KEV
Sbjct  299   CSNPSKSSHAPVVVGMVVVTIALSAIGILSFAQYRRRKQKLGSSFDISDSRLSTDQGKEV  358

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              R++ SPL++LEYSNGWDPLA  RN    F QEV +SF FNL+E
Sbjct  359   YRKNGSPLVSLEYSNGWDPLADGRN-YGGFPQEVFQSFRFNLEE  401



>ref|XP_010098918.1| LRR receptor-like serine/threonine-protein kinase RCH1 [Morus 
notabilis]
 gb|EXB76220.1| LRR receptor-like serine/threonine-protein kinase RCH1 [Morus 
notabilis]
Length=691

 Score =   404 bits (1039),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 226/355 (64%), Positives = 276/355 (78%), Gaps = 19/355 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+AC+E G+VVNISLQGKGL+G+IP  +  +K+L+GLYLHFN L+G +P+EI NL+ L
Sbjct  61    FEGVACDERGRVVNISLQGKGLWGRIPAAVGGLKSLTGLYLHFNSLNGEIPKEITNLSEL  120

Query  182   LDLYLNVNHLSGSIPPEISNITSLQ-VLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLT  358
              DLYLNVN+LSG IPP+ +N+ +LQ VLQLCYN L+G+IP QL +LK L+VLALQ N LT
Sbjct  121   TDLYLNVNNLSGEIPPQFANMPNLQGVLQLCYNTLTGSIPLQLRNLKRLSVLALQYNQLT  180

Query  359   GAIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNE  538
             GAIPA+LG+L  LTRLDLSFN LFGS+PAKLA+A  L++LDIRNN+LSG VP ALKRLN 
Sbjct  181   GAIPASLGELKALTRLDLSFNSLFGSVPAKLADAPMLQVLDIRNNSLSGTVPQALKRLNG  240

Query  539   GFQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFGP---GSNHLP-------TKDIPES  685
             GFQY NNP LCG+GFS L +C+ S   +P++PEP+ P    +N  P        +D+PES
Sbjct  241   GFQYKNNPHLCGVGFSDLHVCSASDGWDPNRPEPYQPSNLSANGFPHSAQNRTAEDLPES  300

Query  686   ANVQPH----ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSD  853
              N+ P     + +K  K     V +GV+GL VAF  +GLFTFSWYRRRKQKIGS  DSSD
Sbjct  301   VNLNPDCSRTSCSKTSKSPQVGVALGVIGLFVAFTVSGLFTFSWYRRRKQKIGSAFDSSD  360

Query  854   SRLSTDQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             SRLSTDQAKEV  +SASPLI+LEYSNGWDP+AK   G + FSQEVLESFMFNL+E
Sbjct  361   SRLSTDQAKEVYMKSASPLISLEYSNGWDPVAK---GCSGFSQEVLESFMFNLEE  412



>ref|XP_006490241.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Citrus 
sinensis]
Length=675

 Score =   403 bits (1035),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 224/345 (65%), Positives = 273/345 (79%), Gaps = 9/345 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV NISLQGKGLYGK+ P IA +K L+GLYLH+N L+G +PREIANLT L
Sbjct  54    FEGVACNEKGQVANISLQGKGLYGKVSPAIAGLKHLTGLYLHYNSLYGEIPREIANLTEL  113

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI  + SLQVLQLCYN+L+G+IP QLGSL+ L+VLALQSN LTG
Sbjct  114   SDLYLNVNNLSGDIPPEIGYMGSLQVLQLCYNRLTGSIPTQLGSLRKLSVLALQSNQLTG  173

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA LGDL +L RLDLSFNHLFGSIP KLA+A  LE+LDIRNNTLSG+VP ALKRLNEG
Sbjct  174   AIPANLGDLGMLMRLDLSFNHLFGSIPRKLADAPLLEVLDIRNNTLSGSVPPALKRLNEG  233

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKP  718
             F Y NN  LCG+GFS+LK C+ S+ +NPS+ EP+G  + H  T++IPE+ANV     N+ 
Sbjct  234   FLYENNLELCGVGFSALKTCSASSNINPSRAEPYGAATTH-STRNIPETANVN-FPCNQT  291

Query  719   R-----KPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
             R     K   A VV G++ +++A  A G+  F+ YRRRKQK+ S+ +++DSRLSTDQAK 
Sbjct  292   RCSSSSKSHQASVVAGIIVVVIALSAIGILAFAQYRRRKQKLVSSFNAADSRLSTDQAKG  351

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             V R++ SPLI+LEY+NGWDPLA  RN N  F+QEV +SF FNL+E
Sbjct  352   VYRKNGSPLISLEYANGWDPLADGRNLN-VFAQEVFQSFRFNLEE  395



>ref|XP_007038448.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY22949.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
Length=636

 Score =   402 bits (1032),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 217/344 (63%), Positives = 270/344 (78%), Gaps = 7/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ CN+ GQ+ NISLQGKGL GK+   I  +K L+GLYLH+N L+G +PREIANLT L
Sbjct  57    FEGVGCNQKGQIANISLQGKGLSGKVSSAITGLKHLTGLYLHYNSLYGDIPREIANLTLL  116

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLN+N+LSG IPPEI N+ SLQVLQLCYN+L+G+IP QLGSLK L VLALQSN LTG
Sbjct  117   SDLYLNMNNLSGEIPPEIGNMGSLQVLQLCYNQLTGSIPTQLGSLKKLNVLALQSNQLTG  176

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGD+  L RLDLSFN LFGSIP K+A+A  LE+LDIRNN+LSGNVPLALKRLN+G
Sbjct  177   AIPASLGDVGTLMRLDLSFNRLFGSIPMKIADAPLLEVLDIRNNSLSGNVPLALKRLNDG  236

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPGSNHLPTKDIPESANVQ----PHA  706
             F + NN GLCG GFSSL+ C T   +NP++PE +GPG+   P ++IPE+AN+Q    P  
Sbjct  237   FLFQNNLGLCGSGFSSLEACNTSDHINPNRPEAYGPGTTGRP-REIPETANLQLPCEPTQ  295

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              +KP K Q   ++VG++ + VA  A G+ TF+ YRRRKQK+GS+ + SD RLSTDQAK V
Sbjct  296   CSKPSKSQRGPILVGLIVVTVALSAIGILTFTQYRRRKQKLGSSFEISDRRLSTDQAKGV  355

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              R++ SPLI+LEY+NGWDPLA +RN    F+Q+V +SF FNL+E
Sbjct  356   YRKNGSPLISLEYANGWDPLADSRN-FTGFAQDVFQSFRFNLEE  398



>ref|XP_007220018.1| hypothetical protein PRUPE_ppa002373mg [Prunus persica]
 gb|EMJ21217.1| hypothetical protein PRUPE_ppa002373mg [Prunus persica]
Length=680

 Score =   403 bits (1035),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 227/348 (65%), Positives = 268/348 (77%), Gaps = 13/348 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGI CNE GQV NISLQGKGL GK+ P IA +K L+GLY+H+N L+G +PREIANLT L
Sbjct  57    FEGIGCNEAGQVANISLQGKGLSGKLSPAIAGLKHLTGLYMHYNSLYGEIPREIANLTEL  116

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI ++ SLQVLQLCYN+L+G+IP QLGSLKNLTVLALQSN LTG
Sbjct  117   SDLYLNVNNLSGEIPPEIGSMGSLQVLQLCYNQLTGSIPTQLGSLKNLTVLALQSNRLTG  176

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS NHLFGSIP KLA+A  LE+LD+RNNTLSGNVPLALKRLNEG
Sbjct  177   AIPASLGDLEMLMRLDLSVNHLFGSIPTKLADAPVLEVLDVRNNTLSGNVPLALKRLNEG  236

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANV-----QPH  703
             F Y NN GLCG GF SL  C+ S  LN ++PEPFG G+   PT+DIPE+ANV     Q  
Sbjct  237   FSYENNLGLCGAGFMSLTACSASGHLNANRPEPFGAGA---PTRDIPETANVPLPCNQTR  293

Query  704   ALNKPRKPQTAvvvvgvlgliv-AFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQA-  877
               N  +  Q +V VV  + ++  A  A G+  F+ +RRRKQK+GS+ D SD RLSTD+A 
Sbjct  294   CSNLSKSHQASVAVVVGVLVVTIALSAIGVLFFTQHRRRKQKLGSSFDISDGRLSTDEAK  353

Query  878   -KEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              K V R++ SPLI+LEYSNGWDPLA  RN  + F+QEV  SF FNL+E
Sbjct  354   GKGVYRKNGSPLISLEYSNGWDPLADGRN-LSLFAQEVFHSFRFNLEE  400



>ref|XP_007038447.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY22948.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=678

 Score =   402 bits (1033),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 217/344 (63%), Positives = 270/344 (78%), Gaps = 7/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ CN+ GQ+ NISLQGKGL GK+   I  +K L+GLYLH+N L+G +PREIANLT L
Sbjct  57    FEGVGCNQKGQIANISLQGKGLSGKVSSAITGLKHLTGLYLHYNSLYGDIPREIANLTLL  116

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLN+N+LSG IPPEI N+ SLQVLQLCYN+L+G+IP QLGSLK L VLALQSN LTG
Sbjct  117   SDLYLNMNNLSGEIPPEIGNMGSLQVLQLCYNQLTGSIPTQLGSLKKLNVLALQSNQLTG  176

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGD+  L RLDLSFN LFGSIP K+A+A  LE+LDIRNN+LSGNVPLALKRLN+G
Sbjct  177   AIPASLGDVGTLMRLDLSFNRLFGSIPMKIADAPLLEVLDIRNNSLSGNVPLALKRLNDG  236

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPGSNHLPTKDIPESANVQ----PHA  706
             F + NN GLCG GFSSL+ C T   +NP++PE +GPG+   P ++IPE+AN+Q    P  
Sbjct  237   FLFQNNLGLCGSGFSSLEACNTSDHINPNRPEAYGPGTTGRP-REIPETANLQLPCEPTQ  295

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              +KP K Q   ++VG++ + VA  A G+ TF+ YRRRKQK+GS+ + SD RLSTDQAK V
Sbjct  296   CSKPSKSQRGPILVGLIVVTVALSAIGILTFTQYRRRKQKLGSSFEISDRRLSTDQAKGV  355

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              R++ SPLI+LEY+NGWDPLA +RN    F+Q+V +SF FNL+E
Sbjct  356   YRKNGSPLISLEYANGWDPLADSRN-FTGFAQDVFQSFRFNLEE  398



>ref|XP_008234364.1| PREDICTED: somatic embryogenesis receptor kinase 4 [Prunus mume]
Length=680

 Score =   401 bits (1031),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 227/348 (65%), Positives = 266/348 (76%), Gaps = 13/348 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGI CNE GQV NISLQGKGL GK+ P IA +K L+GLY+H+N L+G +PREIANLT L
Sbjct  57    FEGIGCNEAGQVANISLQGKGLSGKLSPAIAGLKHLTGLYMHYNSLYGEIPREIANLTEL  116

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI ++ SLQVLQLCYN+L+G+IP QLGSLKNLTVLALQSN LTG
Sbjct  117   SDLYLNVNNLSGEIPPEIGSMGSLQVLQLCYNQLTGSIPTQLGSLKNLTVLALQSNRLTG  176

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS NHLFGSIP KLA+A  LE+LD+RNNTLSGNVPLALKRLNEG
Sbjct  177   AIPASLGDLEMLMRLDLSVNHLFGSIPTKLADAPVLEVLDVRNNTLSGNVPLALKRLNEG  236

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANV-----QPH  703
             F Y NN GLCG GF SL  C+ S  LN S+PEPFG  +   PT+DIPE+ANV     Q H
Sbjct  237   FSYENNLGLCGSGFMSLTACSASGHLNASRPEPFGAAA---PTRDIPETANVPLPCNQTH  293

Query  704   ALNKPRKPQTAvvvvgvlgliv-AFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQA-  877
               N  +  Q +V VV  + ++  A  A G+  F  +RRRKQK+GS+ D  D RLSTD+A 
Sbjct  294   CSNLSKSHQASVAVVVGVLVVTIALSAIGVLFFIQHRRRKQKLGSSFDICDGRLSTDEAK  353

Query  878   -KEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              K V R++ SPLI+LEYSNGWDPLA  RN  + F+QEV  SF FNL+E
Sbjct  354   GKGVYRKNGSPLISLEYSNGWDPLADGRN-LSLFAQEVFHSFRFNLEE  400



>ref|XP_002511706.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
 gb|EEF50375.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
Length=627

 Score =   399 bits (1026),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 221/345 (64%), Positives = 263/345 (76%), Gaps = 10/345 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACN  G V NISLQGKGL G+IP  +  +K+L+GLYLHFN L+G +P+EIA LT L
Sbjct  56    FEGVACNGQGNVANISLQGKGLSGQIPAALGGLKSLTGLYLHFNALNGEIPKEIAELTEL  115

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP +I N+++LQVLQLCYNKL+G+IP QLGSL+ L VLALQ N LT 
Sbjct  116   SDLYLNVNNLSGEIPSQIGNMSNLQVLQLCYNKLTGSIPTQLGSLRKLNVLALQYNQLTS  175

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  LTRLDLSFN LFGS+P KLA+A  L++LDIRNN+LSGN+P AL+RL+ G
Sbjct  176   AIPASLGDLKFLTRLDLSFNGLFGSVPVKLASAPMLQVLDIRNNSLSGNLPAALRRLDNG  235

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANV-----QPH  703
             FQY NNP LCGIGF +L+ CT S  LNP++PEPF P  N    +DIPESAN      Q H
Sbjct  236   FQYDNNPDLCGIGFPNLETCTASGNLNPNRPEPFKP--NGTLQRDIPESANFTSNCGQTH  293

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
               N  + PQ  ++   +   IV      LFTF+WYRR+KQKIGS  D+SD RLSTDQAKE
Sbjct  294   CSNSSKNPQFGIIFGVIGVFIVLTIIV-LFTFTWYRRQKQKIGSAFDASDGRLSTDQAKE  352

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             V R+SASPLI+LEYSNGWDPLA  +N N   SQE LESFMFNL+E
Sbjct  353   VYRKSASPLISLEYSNGWDPLAIGQNKN-GLSQEFLESFMFNLEE  396



>ref|XP_006421744.1| hypothetical protein CICLE_v10004478mg [Citrus clementina]
 gb|ESR34984.1| hypothetical protein CICLE_v10004478mg [Citrus clementina]
Length=675

 Score =   400 bits (1028),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 225/345 (65%), Positives = 272/345 (79%), Gaps = 9/345 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNE GQV NISLQGKGL GK+ P IA +K L+GLYLH+N L+G +PREIANLT L
Sbjct  54    FEGIACNEKGQVANISLQGKGLNGKVSPAIAGLKHLTGLYLHYNSLYGQIPREIANLTEL  113

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI  + SLQVLQLCYN+L+G+IP QLGSL+ L+VLALQSN LTG
Sbjct  114   SDLYLNVNNLSGDIPPEIGYMGSLQVLQLCYNQLTGSIPTQLGSLRKLSVLALQSNQLTG  173

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA LGDL +L RLDLSFNHLFGSIP KLA+A  LE+LDIRNNTLSG+VP ALKRLNEG
Sbjct  174   AIPANLGDLGMLMRLDLSFNHLFGSIPRKLADAPLLEVLDIRNNTLSGSVPPALKRLNEG  233

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANV-----QPH  703
             F Y NN  LCG+GFS+LK C+ S+ +NPS+PEP+G  + H  T++IPE+ANV     Q  
Sbjct  234   FLYENNLELCGVGFSALKTCSASSNINPSRPEPYGAATTH-STRNIPETANVNLPCNQTQ  292

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
               +  +  Q A VV G++ ++VA  A G+  F+ Y RRKQK+GS+ +++DSRLSTDQAK 
Sbjct  293   CSSSSKSHQ-ASVVAGIIVVVVALSAIGILAFTQYHRRKQKLGSSFNAADSRLSTDQAKG  351

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             V R++ SPLI+LEY NGWDPLA  RN N  F+QEV +SF FNL+E
Sbjct  352   VYRKNGSPLISLEYGNGWDPLADGRNLN-VFAQEVFQSFRFNLEE  395



>ref|XP_011029975.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Populus euphratica]
Length=677

 Score =   399 bits (1024),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 217/345 (63%), Positives = 262/345 (76%), Gaps = 10/345 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV NISLQGKGL GK+ P +A +K L+GLYLH+N L+G +PREIANLT L
Sbjct  57    FEGVACNEKGQVANISLQGKGLNGKVSPAVAGLKYLTGLYLHYNSLYGEIPREIANLTAL  116

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI N+ +LQVLQLCYN+ +G+IP++LGSL+ L+VLALQSNHLTG
Sbjct  117   SDLYLNVNNLSGEIPPEIGNMANLQVLQLCYNQFTGSIPSELGSLERLSVLALQSNHLTG  176

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS+NHLFGS+P K+A+A  LE LDIRNN+LSGNVPLALKRL++G
Sbjct  177   AIPASLGDLGMLMRLDLSYNHLFGSVPTKVADAPLLEFLDIRNNSLSGNVPLALKRLDDG  236

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----L  709
             F Y NN GLCG GF SLK C  S L PS+PEP+G   N LP ++IPE+AN+Q        
Sbjct  237   FLYENNLGLCGAGFMSLKACNASGLMPSRPEPYGTKVNGLP-REIPETANLQLRCNQSQC  295

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
             +   K   A   V    + +   A G+ TF  YRRRKQK+ S  + SDSRLSTDQAK V 
Sbjct  296   SNQSKAHHASAAVVTFVVTILLAAIGILTFIQYRRRKQKLASPYEISDSRLSTDQAKGVY  355

Query  890   RRSASPLINLEYSNGWDPLAKARN--GNAAFSQEVLESFMFNLDE  1018
             R++ SPLI+LEY NGWDPLA  RN  GNA   Q+V +SF FNL+E
Sbjct  356   RKNGSPLISLEYPNGWDPLADGRNLSGNA---QDVFQSFRFNLEE  397



>ref|XP_009791302.1| PREDICTED: somatic embryogenesis receptor kinase 4 [Nicotiana 
sylvestris]
Length=681

 Score =   399 bits (1024),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 217/344 (63%), Positives = 267/344 (78%), Gaps = 6/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV NISLQGK L GK+ P IA +  L+GLYLH+N L+G +PREI++L  L
Sbjct  59    FEGVACNEKGQVANISLQGKRLSGKLSPAIAGLSHLTGLYLHYNSLYGEIPREISSLIEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPE+ N++SLQVLQLCYN+ SG+IP QLG+LK L VLALQSN LTG
Sbjct  119   SDLYLNVNNLSGEIPPELGNMSSLQVLQLCYNQFSGSIPTQLGTLKKLNVLALQSNQLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L +L R+DLS NHLFGSIP KLA+A  LE+LDIR+N LSGNVPLALKRL  G
Sbjct  179   AIPASLGELGVLMRVDLSSNHLFGSIPTKLADAPLLEVLDIRSNKLSGNVPLALKRLVGG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDIPESANV----QPHA  706
             FQY NNPGLCG+GF SL++CT     NP++PEP+G GS+ L T+DIPE+AN+      + 
Sbjct  239   FQYENNPGLCGVGFPSLRVCTSLDRSNPNRPEPYGGGSSGLSTRDIPETANLNLNCSGNG  298

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
               K  K   A VVVGV+ + V   A G+ TF+ YRRRKQK+G  +D  DSRLSTDQ KEV
Sbjct  299   CAKSSKTSQASVVVGVIVVTVIASAIGVLTFTHYRRRKQKLGGGLDMCDSRLSTDQTKEV  358

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             +R++ SPL++LEYS+GWDPLA+ R      SQEVL+S+ FNL+E
Sbjct  359   NRKNGSPLVSLEYSSGWDPLAEGRR-YGGVSQEVLQSYRFNLEE  401



>ref|XP_008376456.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Malus domestica]
Length=680

 Score =   398 bits (1022),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 222/348 (64%), Positives = 268/348 (77%), Gaps = 13/348 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGI CNE GQV NISLQGK L GK+ P IA++K L+G+Y+H+N L G +PREIANLT L
Sbjct  57    FEGIGCNEAGQVANISLQGKRLSGKLSPAIAELKHLTGIYMHYNSLQGEIPREIANLTEL  116

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI +++SLQVLQLCYN+L+G+IP QLGSLKNL+VLALQSN LTG
Sbjct  117   SDLYLNVNNLSGVIPPEIGSMSSLQVLQLCYNQLTGSIPTQLGSLKNLSVLALQSNQLTG  176

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS NHLFGSIP KLA+A  LE+LD+RNNTLSGNVPLALKRLNEG
Sbjct  177   AIPASLGDLEMLMRLDLSVNHLFGSIPTKLADAPVLEVLDVRNNTLSGNVPLALKRLNEG  236

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANV-----QPH  703
             F Y NN GLCG GF SL  CT S  LN S+PEPFG G   +PT+DIPE+A+V     Q  
Sbjct  237   FSYENNLGLCGAGFMSLTACTTSGHLNTSRPEPFGAG---VPTRDIPETAHVPLPCNQTR  293

Query  704   ALNKPRKPQTAvvvvgvlgliv-AFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
               N  +  Q +V VV  L ++  A    G   F+ +RRRKQK+G++ D++D RLSTD+AK
Sbjct  294   CSNLSKSHQASVAVVVGLIVVTIALSGVGFLFFAQHRRRKQKLGNSFDTADGRLSTDEAK  353

Query  881   E--VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
                V R++ SPLI+LEY+NGWDPLA  RN  + F+QEV +SF FNL+E
Sbjct  354   ANGVYRKNGSPLISLEYANGWDPLADGRN-LSVFAQEVFQSFRFNLEE  400



>ref|XP_006445273.1| hypothetical protein CICLE_v10019056mg [Citrus clementina]
 gb|ESR58513.1| hypothetical protein CICLE_v10019056mg [Citrus clementina]
Length=714

 Score =   399 bits (1024),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 229/386 (59%), Positives = 271/386 (70%), Gaps = 51/386 (13%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+E G+V NISLQGKGL G+IP  +  +K+L+GLYLHFN L+G +P+EIA+L+ L
Sbjct  56    FDGVACDENGRVANISLQGKGLSGEIPAAVGGLKSLTGLYLHFNALNGVIPKEIASLSEL  115

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP +I N+T+LQVLQLCYNKL+GNIP QLGSL+ L+VLALQ N LTG
Sbjct  116   SDLYLNVNNLSGKIPSQIGNMTNLQVLQLCYNKLTGNIPTQLGSLRKLSVLALQYNQLTG  175

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVP---------  514
             AIPA+LGDL +L RLDLSFN+LFG +P KLAN  KLE+LDIRNN+ SGNVP         
Sbjct  176   AIPASLGDLGMLMRLDLSFNNLFGPVPVKLANVPKLEVLDIRNNSFSGNVPPGIMVFPNI  235

Query  515   --------------------------------LALKRLNEGFQYTNNPGLCGIGFSSLKL  598
                                              ALKRLN GFQY NN  LCG GF++LK 
Sbjct  236   SCSVMGFSISFVKRKLGCIKFNLDFLPLVHGYEALKRLNGGFQYDNNAALCGTGFTNLKN  295

Query  599   CTDSAL-NPSKPEPFGPGSNHLPTKDIPESANV-----QPHALNKPRKPQTAvvvvgvlg  760
             CT S    P KPEPF P  N L TKDIPESA +     QP   +  R+P T V V  +  
Sbjct  296   CTASDHPTPGKPEPFEP--NGLSTKDIPESAKLPANCGQPGCSSPARRPHTGVFVGVIAV  353

Query  761   livAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRSASPLINLEYSNGWD  940
              I     TGLFTF+WYRRRKQKIG+  D+SDSRLSTDQ KEV RR++SPLI+LEYSNGWD
Sbjct  354   FI-ILTVTGLFTFTWYRRRKQKIGNAFDNSDSRLSTDQVKEVCRRNSSPLISLEYSNGWD  412

Query  941   PLAKARNGNAAFSQEVLESFMFNLDE  1018
             PLAK ++GN  FSQEVLESFMFNL+E
Sbjct  413   PLAKGQSGN-GFSQEVLESFMFNLEE  437



>gb|KDP28763.1| hypothetical protein JCGZ_14534 [Jatropha curcas]
Length=673

 Score =   397 bits (1021),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 226/345 (66%), Positives = 268/345 (78%), Gaps = 10/345 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G+V NISLQGKGL G+IP  +  +K+L+GLYLHFN L G +P+EIA L+ L
Sbjct  53    FEGVACNEEGRVANISLQGKGLSGRIPAALGGLKSLTGLYLHFNALTGDIPKEIAQLSQL  112

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP +I N+++LQVLQLCYNKL+G+IP QLGSLK L VLALQ N LT 
Sbjct  113   SDLYLNVNNLSGQIPHQIGNMSNLQVLQLCYNKLTGSIPTQLGSLKKLNVLALQYNQLTS  172

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL LLTRLDLSFN LFGSIP KLA+A  L+ LDIRNN+LSGNVP ALKRL+ G
Sbjct  173   AIPASLGDLGLLTRLDLSFNGLFGSIPVKLADAPMLQALDIRNNSLSGNVPPALKRLSSG  232

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANV-----QPH  703
             FQYTNNP LCG GF++L+ CT S  LN ++PEPF P  N    KDIPESAN+     Q H
Sbjct  233   FQYTNNPELCGDGFANLQTCTASGQLNANRPEPFKP--NGTLQKDIPESANIPSNCSQTH  290

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
              L+  +  Q   VV G++G+ +    TGLFTFSWYRR+KQKIGS +D SD RLST+Q KE
Sbjct  291   CLSSSKNSQYG-VVFGIIGVFIVLTGTGLFTFSWYRRQKQKIGSALDISDGRLSTEQVKE  349

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             V R++ SPLI+LEYSNGWDPLA  +N N   SQE LESFMFNL+E
Sbjct  350   VYRKNVSPLISLEYSNGWDPLAVGQNKN-GLSQEFLESFMFNLEE  393



>ref|XP_008343327.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
Length=681

 Score =   397 bits (1021),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 221/351 (63%), Positives = 268/351 (76%), Gaps = 16/351 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G+V NISLQGKGL+G+IPP +  +K+L+GLYLHFN L G +P+++A L  L
Sbjct  56    FEGVACNEQGRVTNISLQGKGLWGQIPPTVGGLKSLTGLYLHFNALSGKIPKQLAGLNQL  115

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG+IP EI  + +LQVLQLCYNKL+G IP QLG LK L+VLA+QSN LTG
Sbjct  116   ADLYLNVNNLSGAIPREIGKMPNLQVLQLCYNKLTGGIPTQLGQLKRLSVLAVQSNQLTG  175

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L  LTRLDLSFN LFG IPA+LA+A  LE+LD+R N LSGNVP ALKRLNEG
Sbjct  176   AIPASLGELGTLTRLDLSFNSLFGPIPARLADAPMLEVLDVRTNILSGNVPPALKRLNEG  235

Query  542   FQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFGPGS------NHLPTKDIPESANV--  694
             F Y NNP LCG+GFS L+LCT +   NP+ P+PF P +      +    K+IP+SAN+  
Sbjct  236   FLYENNPSLCGVGFSGLELCTATNTRNPNIPQPFEPSNLSAKDPDSSTAKEIPKSANIHS  295

Query  695   ---QPHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLS  865
                Q       + PQ   ++ GV+G+IVA   +GLF F W RR+KQKIGST DSSDSRLS
Sbjct  296   NCSQTRCSEASKSPQIG-IIFGVIGVIVALTVSGLFLFFWCRRQKQKIGSTFDSSDSRLS  354

Query  866   TDQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             TDQAKEV ++S SPLINLEYSNGWDPLAK   G + +SQEVLESFM NL+E
Sbjct  355   TDQAKEVYKKSVSPLINLEYSNGWDPLAK---GGSGYSQEVLESFMINLEE  402



>ref|XP_008354209.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1-like [Malus domestica]
Length=680

 Score =   397 bits (1020),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 222/348 (64%), Positives = 266/348 (76%), Gaps = 13/348 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGI CNE GQV NISLQGKGL GK+ P IA +K L+G+YLH+N LHG +PREIANLT L
Sbjct  57    FEGIXCNEAGQVXNISLQGKGLTGKLSPAIAGLKHLTGIYLHYNSLHGEIPREIANLTEL  116

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI N+++LQVLQLCYN+L+G+IP QLGSLKNL+VLALQSNHLTG
Sbjct  117   SDLYLNVNNLSGVIPPEIGNMSNLQVLQLCYNQLTGSIPTQLGSLKNLSVLALQSNHLTG  176

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS NHLFGSIP KLA+A  LE+LD+RNNTLSGNVPLALKRLNEG
Sbjct  177   AIPASLGDLXMLMRLDLSVNHLFGSIPTKLADAPVLEVLDVRNNTLSGNVPLALKRLNEG  236

Query  542   FQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDIPESANV-----QPH  703
             F Y NN GLCG GF SL  CT S   N S+PEPFG G   +PT+D PE+ANV     Q  
Sbjct  237   FSYENNLGLCGAGFMSLTACTTSGHPNASRPEPFGAG---VPTRDFPETANVPLPCNQTR  293

Query  704   ALNKPRKPQTAvvvvgvlgliv-AFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
               N  +  Q +V VV  + ++  A    G   F+ +RRRKQK+G++ D+++ R STD+AK
Sbjct  294   CSNLSKSHQASVAVVVGVIVVTIALSGVGFVFFTQHRRRKQKLGNSFDTAEGRFSTDEAK  353

Query  881   E--VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
                V R++ SPLI+LEY+NGWDPLA  RN  + F+QEV  SF FNL+E
Sbjct  354   ANGVYRKNGSPLISLEYANGWDPLANGRN-LSVFAQEVFGSFRFNLEE  400



>ref|XP_009374517.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 [Pyrus x bretschneideri]
Length=680

 Score =   397 bits (1020),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 221/348 (64%), Positives = 266/348 (76%), Gaps = 13/348 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGI CNE GQV NISLQGKG  GK+ P IA +K L+G+YLH+N LHG +PREIANLT L
Sbjct  57    FEGIGCNEAGQVANISLQGKGFTGKLSPSIAGLKHLTGIYLHYNSLHGEIPREIANLTEL  116

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI N+++LQVLQLCYN+L+G+IP QLGSLKNL+VLALQSNHLTG
Sbjct  117   SDLYLNVNNLSGVIPPEIGNMSNLQVLQLCYNQLTGSIPTQLGSLKNLSVLALQSNHLTG  176

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS NHLFGSIP KLA+A  LE+LD+RNN+LSGNVPLALKRLNEG
Sbjct  177   AIPASLGDLEMLMRLDLSVNHLFGSIPTKLADAPVLEVLDVRNNSLSGNVPLALKRLNEG  236

Query  542   FQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDIPESANV-----QPH  703
             F Y NN GLCG GF SL  CT S   N S+PEPFG G   +PT+D PE+ANV     Q H
Sbjct  237   FSYENNLGLCGAGFMSLTACTTSGHPNASRPEPFGAG---VPTRDFPETANVPLPCNQTH  293

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFT-FSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
               N  +  Q +V VV  + ++    +  +F  F+ +RRRKQK+G++ D +D R STD+AK
Sbjct  294   CSNLSKSHQASVAVVVGVIVVTIALSGVVFVFFTQHRRRKQKLGNSFDIADGRFSTDEAK  353

Query  881   E--VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
                V R++ SPLI+LEY+NGWDPLA  RN  +AF+QEV   F FNL+E
Sbjct  354   ANGVYRKNGSPLISLEYANGWDPLANGRN-LSAFAQEVFGGFRFNLEE  400



>ref|XP_004170265.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Cucumis sativus]
 gb|KGN50379.1| hypothetical protein Csa_5G171130 [Cucumis sativus]
Length=679

 Score =   396 bits (1018),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 212/344 (62%), Positives = 261/344 (76%), Gaps = 7/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGI CNE GQV N+SLQGKGL GK+ P IA +K L+GLYLH+N L G +P+EIANLT L
Sbjct  58    FEGIGCNEKGQVTNMSLQGKGLSGKLSPAIAGLKHLTGLYLHYNSLFGDIPKEIANLTLL  117

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+ SG IP EI N+ SLQVLQLCYN+LSG+IP QL SLK LTV+ALQ+N LTG
Sbjct  118   SDLYLNVNNFSGEIPSEIGNMESLQVLQLCYNQLSGSIPTQLSSLKKLTVIALQTNQLTG  177

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG L LL R+DLS NHLFGS+P++LA+A  LE+LD+RNNTLSGNVP ALKRLNEG
Sbjct  178   AIPASLGRLDLLVRVDLSSNHLFGSVPSRLADAPSLEVLDVRNNTLSGNVPPALKRLNEG  237

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKP  718
             F Y NN GLCG+GF SLK C  S+ +N ++PEPF   +  +PT+DIPE+ANVQ    N  
Sbjct  238   FLYENNLGLCGVGFPSLKDCAGSSHVNQNQPEPFAGSAGSMPTRDIPETANVQLPC-NHT  296

Query  719   RKPQTAvvvvgv----lglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
             R P ++          + + +A  A G+ TF+ YRRRKQK+GS+ D  D RLSTDQAK  
Sbjct  297   RCPSSSKSRNASIVGVVVVTIALSAIGILTFTQYRRRKQKLGSSFDICDHRLSTDQAKAT  356

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              R++ SPL++LEY+NGWDPLA  + G + F+QEV +SF FNL+E
Sbjct  357   YRKNGSPLVSLEYANGWDPLADGQ-GLSIFAQEVFQSFRFNLEE  399



>ref|XP_007152413.1| hypothetical protein PHAVU_004G128100g [Phaseolus vulgaris]
 gb|ESW24407.1| hypothetical protein PHAVU_004G128100g [Phaseolus vulgaris]
Length=684

 Score =   395 bits (1016),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 210/345 (61%), Positives = 261/345 (76%), Gaps = 7/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE+GQV N+SLQGKGL G++ P IA +K L+GLYLH+N L+G +PRE+ANLT L
Sbjct  61    FEGVACNEMGQVANVSLQGKGLSGRLSPAIAGLKHLTGLYLHYNSLYGEIPREVANLTEL  120

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVNHLSG IPPEI  + +LQVLQLCYN+L+G+IP QLG LK L+VLALQSN L G
Sbjct  121   SDLYLNVNHLSGEIPPEIGRMENLQVLQLCYNQLTGSIPTQLGDLKKLSVLALQSNQLAG  180

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA LGDL +LTRLDLS N LFGSIP KLAN   L++LD+ NNTLSGNVP ALKRL  G
Sbjct  181   AIPAILGDLGMLTRLDLSSNSLFGSIPTKLANLPSLQVLDVHNNTLSGNVPTALKRLEGG  240

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQ-----PH  703
             F Y +N GLCG+GFSSLK CT S  +N ++PEP+G G     T+DIPE+ANV+      H
Sbjct  241   FVYEHNVGLCGVGFSSLKACTASGNVNLTRPEPYGAGVGSSITRDIPETANVKSPCNTSH  300

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
               N  +  Q   + VG++   +A  A G+ TF+ YRR+KQK+GS  D S+ RLST+QAK 
Sbjct  301   CQNPSKSKQATSITVGIVLATIAISAIGILTFTMYRRQKQKLGSAFDISEGRLSTEQAKS  360

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + R++ SPL++LEYSNGWDPLA +RN N    Q++ +SF FNL+E
Sbjct  361   IYRKNGSPLVSLEYSNGWDPLADSRNFNGD-KQDLFQSFRFNLEE  404



>ref|XP_008467276.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1 [Cucumis melo]
Length=679

 Score =   395 bits (1015),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 212/344 (62%), Positives = 260/344 (76%), Gaps = 7/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGI CNE GQV N+SLQGKGL GK+ P IA +K L+GLYLH+N L G +P+EIANLT L
Sbjct  58    FEGIGCNEKGQVTNMSLQGKGLSGKLSPAIAGLKHLTGLYLHYNSLFGDIPKEIANLTLL  117

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+ SG IP EI N+ SLQVLQLCYN+LSG+IP QL SLK LTV+ALQSN LTG
Sbjct  118   SDLYLNVNNFSGEIPSEIGNMESLQVLQLCYNQLSGSIPTQLSSLKKLTVIALQSNQLTG  177

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG L LL R+DLS NHLFGS+P++LA+A  LE+LD+RNNTLSGNVP ALKRL EG
Sbjct  178   AIPASLGRLDLLVRVDLSSNHLFGSVPSRLADAPSLEVLDVRNNTLSGNVPPALKRLKEG  237

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKP  718
             F Y NN GLCG+GF SLK C  S+ +N ++PEPF   +  +PT+DIPE+ANVQ    N  
Sbjct  238   FLYENNLGLCGVGFPSLKDCAGSSHVNQNQPEPFAGSAGSMPTRDIPETANVQLPC-NHT  296

Query  719   RKPQTAvvvvgv----lglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
             R P ++          + + +A  A G+ TF+ YRRRKQK+GS+ D  D RLSTDQAK  
Sbjct  297   RCPSSSKSRNASIVGVVVVTIALSAIGILTFTQYRRRKQKLGSSFDICDHRLSTDQAKAT  356

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              R++ SPL++LEY+NGWDPLA  + G + F+QEV +SF FNL+E
Sbjct  357   YRKNGSPLVSLEYANGWDPLADGQ-GLSIFAQEVFQSFRFNLEE  399



>ref|XP_010053898.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Eucalyptus grandis]
 gb|KCW78275.1| hypothetical protein EUGRSUZ_D02458 [Eucalyptus grandis]
Length=673

 Score =   395 bits (1014),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 222/344 (65%), Positives = 265/344 (77%), Gaps = 10/344 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+AC+ +G+V N+SLQGKGL G++P  +  +++L+GLYLHFN L G +P+EI  L+ L
Sbjct  58    FEGVACDGMGRVTNVSLQGKGLTGRLPAAVGGLRSLTGLYLHFNGLSGEIPKEIGELSSL  117

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI N+++LQVLQLCYNKL G++P QLGS+K L+VLA Q N L G
Sbjct  118   SDLYLNVNNLSGEIPPEIGNLSNLQVLQLCYNKLEGSLPTQLGSMKKLSVLAFQYNQLAG  177

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPATLGDL  LTRLD+SFN+LFGSIP +LA+   LE LDIRNN+LSGNV  ALKRLN G
Sbjct  178   AIPATLGDLENLTRLDMSFNNLFGSIPTRLADVPLLEFLDIRNNSLSGNVSPALKRLNAG  237

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----  706
             F+Y NN GLCG GF  L++C +   +NP++PE FGP  NH  TKDIPESA V  +     
Sbjct  238   FRYENNYGLCGNGFPDLEICGSPDLINPNRPEAFGP-KNH-STKDIPESAKVPSNCSEAR  295

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              + P K   A +VVGV+G IVA    GLF FS YRRRKQKIGST D+SDSRLSTDQ KEV
Sbjct  296   CSNPSKSPQASLVVGVIGTIVALTVIGLFAFSAYRRRKQKIGSTFDTSDSRLSTDQVKEV  355

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              RRSASPLINLEYS+GWDPLAK   G   FSQEV ESFMFNL++
Sbjct  356   YRRSASPLINLEYSSGWDPLAK---GGTGFSQEVFESFMFNLED  396



>ref|XP_002320058.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE98373.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=644

 Score =   393 bits (1010),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 221/343 (64%), Positives = 265/343 (77%), Gaps = 10/343 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNELG V NISLQGKGL G+IP  +  +K+L+GLYLHFN L+G +P+EIA L+ L
Sbjct  28    FEGVACNELGHVANISLQGKGLLGQIPAALGGLKSLTGLYLHFNALNGVIPKEIAELSEL  87

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP + N+++LQVLQLCYNKL+G+IP QLGSL+ L+VLALQ N LTG
Sbjct  88    SDLYLNVNNLSGEIPPHVGNMSNLQVLQLCYNKLTGSIPTQLGSLEKLSVLALQYNQLTG  147

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL LL+RLDLSFN LFG IP KLA A  L  LDIRNN+LSGN+P ALKRL  G
Sbjct  148   AIPASLGDLELLSRLDLSFNGLFGPIPVKLAKAPLLHSLDIRNNSLSGNIPPALKRLTTG  207

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESAN----VQPHAL  709
             FQY NNP LCG+GFS+L+ C  S  +P++PEP  P       KDIPESAN     +    
Sbjct  208   FQYGNNPDLCGVGFSNLETCATS--DPNRPEPSEP--RVATEKDIPESANPSYCSKSDCS  263

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
             N  + P+   ++ GV+G+ +A   TGL  FSW+RRRKQKIGS +D+ D RLSTDQAKEVS
Sbjct  264   NLSKTPRYG-IIFGVIGVFIAMSVTGLLMFSWHRRRKQKIGSALDTFDGRLSTDQAKEVS  322

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             RRSASPLI+LEY NGWDPLA  R+  + FSQEVLESFMFNL+E
Sbjct  323   RRSASPLISLEYPNGWDPLAIGRS-KSGFSQEVLESFMFNLEE  364



>ref|XP_009370496.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Pyrus 
x bretschneideri]
Length=680

 Score =   394 bits (1013),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 221/348 (64%), Positives = 267/348 (77%), Gaps = 13/348 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGI CN+ G V NISLQGK L GK+ P IAQ+K L+G+Y+H+N L G +PREIANLT L
Sbjct  57    FEGIGCNKAGHVANISLQGKRLSGKLSPAIAQLKHLTGIYMHYNSLQGEIPREIANLTEL  116

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI +++SLQVLQLCYN+L+G+IP QLGSLKNL+VLALQSN LTG
Sbjct  117   TDLYLNVNNLSGVIPPEIGSMSSLQVLQLCYNQLTGSIPTQLGSLKNLSVLALQSNQLTG  176

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS NHLFGSIP KLA+A  LE+LD+RNNTLSGNVPLALKRLNEG
Sbjct  177   AIPASLGDLEMLMRLDLSVNHLFGSIPTKLADAPVLEVLDVRNNTLSGNVPLALKRLNEG  236

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANV-----QPH  703
             F Y NN GLCG GF SL  CT S  LN S+PEPF  G   +PT+DIPE+A+V     Q  
Sbjct  237   FSYENNLGLCGAGFMSLTACTTSGHLNTSRPEPFRAG---VPTRDIPETAHVPLPCNQTR  293

Query  704   ALNKPRKPQTAvvvvgvlgliv-AFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
               N  +  Q +V VV  L ++  A    G   F+ +RRRKQK+G++ D++D RLSTD+AK
Sbjct  294   CSNLSKSHQASVAVVVGLIVVTIALSGVGFLFFAQHRRRKQKLGNSFDTADGRLSTDEAK  353

Query  881   --EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
                V R++ SPLI+LEY+NGWDPLA  RN  +AF+QEV +SF FNL+E
Sbjct  354   GNGVYRKNGSPLISLEYANGWDPLADGRN-LSAFAQEVFQSFRFNLEE  400



>ref|XP_008356288.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Malus domestica]
Length=683

 Score =   394 bits (1012),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 220/351 (63%), Positives = 264/351 (75%), Gaps = 16/351 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G+V NISLQGKGL+G+IPP +  +K L+GLYLHFN L G +P++IA L  L
Sbjct  58    FEGVACNEQGRVTNISLQGKGLWGQIPPAVGGLKNLTGLYLHFNALTGKIPKQIAALNQL  117

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LS  IP EI  + +LQVLQLCYNKL+G IP +LG LK L+VLA+QSN LTG
Sbjct  118   ADLYLNVNNLSXEIPREIGKMPNLQVLQLCYNKLTGGIPTELGQLKRLSVLAVQSNELTG  177

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L  LTRLDLSFN  FG IPAKLA+A  LE+LD+R+NTLSGN+P ALKRLNEG
Sbjct  178   AIPASLGELGTLTRLDLSFNSFFGPIPAKLADASMLEVLDVRSNTLSGNIPPALKRLNEG  237

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGS---NHLP----TKDIPESANV--  694
             FQY NNP LCG+GFS L+ CT +  NP+ P+PF P +     LP     K+IPE+AN+  
Sbjct  238   FQYENNPNLCGVGFSGLEPCTATTRNPNMPQPFEPSNFSGKGLPDSSTAKEIPETANIHS  297

Query  695   ---QPHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLS  865
                Q         P+    V GV+G +VA   +GLF FSW RR+KQKIGST DSSDSRLS
Sbjct  298   NCSQTQCSEASNSPEIG-FVFGVIGAVVALAVSGLFLFSWCRRQKQKIGSTFDSSDSRLS  356

Query  866   TDQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             T QAK V ++S SPLINLEYSNGWDPLAK   G++ +SQEVLESFM NL+E
Sbjct  357   TGQAKAVYKKSVSPLINLEYSNGWDPLAK---GSSGYSQEVLESFMINLEE  404



>ref|XP_009382934.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=677

 Score =   394 bits (1012),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 220/345 (64%), Positives = 262/345 (76%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G+V NISLQGKGL G I P +A +K LSGLYLH+N + G +P EIANLT L
Sbjct  59    FEGVACNEHGKVANISLQGKGLTGSISPAVAGLKCLSGLYLHYNAISGKIPTEIANLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSGSIP E+  +TSLQVLQLCYN+L+G+IP QLG LK L+VLALQSN L+G
Sbjct  119   SDLYLNVNNLSGSIPVELGTMTSLQVLQLCYNQLTGSIPTQLGRLKKLSVLALQSNQLSG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDLT LTRLDLSFN LFGSIP KLA   +L +LD+RNN+LSGNVP  L+RL+ G
Sbjct  179   AIPASLGDLTQLTRLDLSFNRLFGSIPVKLARIPQLTVLDVRNNSLSGNVPSGLRRLSGG  238

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPGSNHLPTKDIPESANVQ-----PH  703
             F Y NN GLCG+GF+SL +C +D  L P+KPEPFGP S     + IPESAN+        
Sbjct  239   FHYGNNKGLCGVGFASLGVCDSDDPLMPNKPEPFGPDSRGFRPQQIPESANLNSNCNASR  298

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
              LN P K  +  V+VG++ + V     GLF F WYRRRKQKIGS ++ S+SR STDQ KE
Sbjct  299   CLNSP-KAFSGTVIVGIVVVAVGVMVCGLFAFVWYRRRKQKIGSALEVSNSRCSTDQPKE  357

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + R+SASPLI+LEYSNGWDPLA  R+G   FSQEV  SF FNL+E
Sbjct  358   MFRKSASPLISLEYSNGWDPLADGRSG-VGFSQEVSRSFRFNLEE  401



>ref|XP_004308453.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Fragaria vesca subsp. vesca]
Length=683

 Score =   392 bits (1007),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 217/350 (62%), Positives = 265/350 (76%), Gaps = 14/350 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G V NISLQGKGL+G+IP  +  +K+L+GLYLHFN L G +P+EIA+L  L
Sbjct  58    FEGVACNEQGLVTNISLQGKGLWGQIPSSVGDLKSLTGLYLHFNALSGKIPKEIADLDQL  117

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSGSIP +I N+ +LQVLQLCYNKL+G IP +LG +++LTVLALQSN LTG
Sbjct  118   SDLYLNVNNLSGSIPRQIGNMPNLQVLQLCYNKLTGGIPTELGHIRSLTVLALQSNQLTG  177

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L  LTRLDLSFN  FG IPA+LA+A  +++LDIRNN LSGNVP AL+RLN G
Sbjct  178   AIPASLGELEALTRLDLSFNSFFGPIPARLADAPMIQVLDIRNNILSGNVPPALRRLNGG  237

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGS-------NHLPTKDIPESANVQP  700
             FQY NNP LCG+GFS LK+C  +A NP+ P+PF P +       N  P K IPESANVQ 
Sbjct  238   FQYENNPRLCGVGFSDLKVCNVNAQNPNMPQPFEPNNLSAKDLPNSPPAKIIPESANVQS  297

Query  701   HALNKPRKPQTAvvv----vgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLST  868
                       +        +GV+G++VA    GLF FSWYRRRKQKIG++ D+ D RLST
Sbjct  298   SCSQSRCSGSSKSSQVGIVLGVIGVVVALTGAGLFMFSWYRRRKQKIGNSFDTFDIRLST  357

Query  869   DQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             DQ KEV ++S SPLI+LEYS+GWDPLAK   GN  +SQEVLESFMF+L+E
Sbjct  358   DQTKEVYKKSVSPLISLEYSSGWDPLAK---GNGGYSQEVLESFMFSLEE  404



>ref|XP_009593156.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Nicotiana tomentosiformis]
Length=681

 Score =   391 bits (1005),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 215/344 (63%), Positives = 265/344 (77%), Gaps = 6/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV NISLQGK L GK+ P I+ +  L+GLYLH+N L+G +PREI++L  L
Sbjct  59    FEGVACNEKGQVANISLQGKRLSGKLSPAISGLSHLTGLYLHYNSLYGEIPREISSLIEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP E+ N++SLQVLQLCYN+ SG+IP QLG+LK L VLALQSN LTG
Sbjct  119   TDLYLNVNNLSGEIPSELGNMSSLQVLQLCYNQFSGSIPTQLGTLKKLNVLALQSNQLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L +L R+DLS NHLFGSIP+KLA+A  LE LDIRNN LSGNVPLALKRL  G
Sbjct  179   AIPASLGELGVLMRVDLSSNHLFGSIPSKLADAPLLEALDIRNNKLSGNVPLALKRLVGG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDIPESANV----QPHA  706
             FQY NNPGLCG+GF SL++CT     NP++PEP+G GS+ L T+DIPE+AN+      + 
Sbjct  239   FQYENNPGLCGVGFPSLRVCTSLDRSNPNRPEPYGGGSSGLSTRDIPETANLNLNCSGNG  298

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
               K  K   A VVVGV+ + V   A G+ TF+ YRRR QK+   +D  DSRLSTDQAKEV
Sbjct  299   CAKSSKTSQASVVVGVIVVTVIASAIGVLTFTHYRRRNQKLRGGLDMCDSRLSTDQAKEV  358

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             +R++ SPL++LEYS+GWDPLA+ R      SQEVL+S+ FNL+E
Sbjct  359   NRKNGSPLVSLEYSSGWDPLAEGRR-YGGVSQEVLQSYRFNLEE  401



>ref|XP_003534047.1| PREDICTED: somatic embryogenesis receptor kinase 4-like [Glycine 
max]
 gb|KHN27862.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=683

 Score =   390 bits (1003),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 212/345 (61%), Positives = 262/345 (76%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV N+SLQGKGL GK+ P IA +K L+GLYLH+N L+G +PRE+ANLT L
Sbjct  61    FEGVACNEKGQVANVSLQGKGLSGKLSPAIAGLKHLTGLYLHYNSLYGEIPRELANLTEL  120

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVNHLSG IPPEI  + SLQVLQLCYN+L+G+IP QL  LK L+VLALQSN   G
Sbjct  121   SDLYLNVNHLSGEIPPEIGMMESLQVLQLCYNQLTGSIPTQLSDLKKLSVLALQSNQFAG  180

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS N+LFGSIP KLA+   L++LD+ NNTLSGNVP ALKRL EG
Sbjct  181   AIPASLGDLGMLMRLDLSSNNLFGSIPTKLADLPLLQVLDVHNNTLSGNVPPALKRLEEG  240

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQ-----PH  703
             F + +N GLCG+GFSSLK CT S   N ++PEP+G G   L ++DIPE+ANV+       
Sbjct  241   FVFEHNVGLCGVGFSSLKACTASDHANLTRPEPYGAGVGGL-SRDIPETANVKLPCNTTQ  299

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
               N  R  Q A + VG++ + +A  A G+FTF+ YRRRKQK+GST D S+ RLSTDQAK 
Sbjct  300   CRNPSRSKQAASITVGIVLVTIAVSAIGIFTFTMYRRRKQKLGSTFDISEGRLSTDQAKS  359

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + R++ SPL++LEYSNGWDPLA  +N N    Q++ +SF FNL+E
Sbjct  360   IYRKNGSPLVSLEYSNGWDPLADGKNVNGD-RQDMFQSFRFNLEE  403



>ref|XP_011034207.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Populus euphratica]
Length=671

 Score =   390 bits (1001),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 219/344 (64%), Positives = 266/344 (77%), Gaps = 12/344 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNELG V NISLQGKGL G+IP  +  +K+L+GLYLHFN L+G +P+EIA L+ L
Sbjct  55    FEGVACNELGHVANISLQGKGLLGQIPAALGGLKSLTGLYLHFNALNGVIPKEIAELSEL  114

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP++ N+++LQVLQLCYNKL+G+IP +LGSL+ L+VLALQ N LTG
Sbjct  115   SDLYLNVNNLSGEIPPQVGNMSNLQVLQLCYNKLTGSIPTELGSLEKLSVLALQYNQLTG  174

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL LL+RLDLSFN LFG IP KLA A  L  LDIRNN+LSGN+P ALKRL  G
Sbjct  175   AIPASLGDLELLSRLDLSFNDLFGPIPVKLAKAPLLRTLDIRNNSLSGNIPPALKRLTTG  234

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPT-KDIPESAN----VQPHA  706
             FQY NNP LCG+GFS+L+ C  S  +P++PEP  P   H+   KDIPESAN     +   
Sbjct  235   FQYGNNPDLCGVGFSNLETCATS--DPNRPEPSEP---HVAMEKDIPESANPSYCSKSDC  289

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              N  + P+   ++ GV+G+ +A   TGL  FSW+RR KQKIGS  D+ D RLSTDQAKEV
Sbjct  290   SNLSKTPRYG-IIFGVIGVFIAMSVTGLLMFSWHRRHKQKIGSASDTFDGRLSTDQAKEV  348

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             SRRSASPLI+LEY NGWDP+A  R+  + FSQEVLESFMFNL+E
Sbjct  349   SRRSASPLISLEYPNGWDPMAIGRS-KSGFSQEVLESFMFNLEE  391



>ref|XP_004143652.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-INTERACTING KINASE 
3-like [Cucumis sativus]
Length=684

 Score =   390 bits (1002),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 212/349 (61%), Positives = 261/349 (75%), Gaps = 12/349 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGI CNE GQV N+SLQGKGL GK+ P IA +K L+GLYLH+N L G +P+EIANLT L
Sbjct  58    FEGIGCNEKGQVTNMSLQGKGLSGKLSPAIAGLKHLTGLYLHYNSLFGDIPKEIANLTLL  117

Query  182   LD-----LYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQS  346
              D     LYLNVN+ SG IP EI N+ SLQVLQLCYN+LSG+IP QL SLK LTV+ALQ+
Sbjct  118   SDVFECYLYLNVNNFSGEIPSEIGNMESLQVLQLCYNQLSGSIPTQLSSLKKLTVIALQT  177

Query  347   NHLTGAIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALK  526
             N LTGAIPA+LG L LL R+DLS NHLFGS+P++LA+A  LE+LD+RNNTLSGNVP ALK
Sbjct  178   NQLTGAIPASLGRLDLLVRVDLSSNHLFGSVPSRLADAPSLEVLDVRNNTLSGNVPPALK  237

Query  527   RLNEGFQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQPH  703
             RLNEGF Y NN GLCG+GF SLK C  S+ +N ++PEPF   +  +PT+DIPE+ANVQ  
Sbjct  238   RLNEGFLYENNLGLCGVGFPSLKDCAGSSHVNQNQPEPFAGSAGSMPTRDIPETANVQLP  297

Query  704   ALNKPRKPQTAvvvvgv----lglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD  871
               N  R P ++          + + +A  A G+ TF+ YRRRKQK+GS+ D  D RLSTD
Sbjct  298   C-NHTRCPSSSKSRNASIVGVVVVTIALSAIGILTFTQYRRRKQKLGSSFDICDHRLSTD  356

Query  872   QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             QAK   R++ SPL++LEY+NGWDPLA  + G + F+QEV +SF FNL+E
Sbjct  357   QAKATYRKNGSPLVSLEYANGWDPLADGQ-GLSIFAQEVFQSFRFNLEE  404



>ref|XP_002301282.2| hypothetical protein POPTR_0002s14800g [Populus trichocarpa]
 gb|EEE80555.2| hypothetical protein POPTR_0002s14800g [Populus trichocarpa]
Length=671

 Score =   389 bits (1000),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 220/346 (64%), Positives = 260/346 (75%), Gaps = 16/346 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G V NISLQGKGL G+IP  +  +K+LSGL+LHFN L+GA+P+EIA L+ L
Sbjct  55    FEGVACNEQGHVANISLQGKGLSGQIPAALGGLKSLSGLFLHFNALNGAIPKEIAELSEL  114

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP+I N+++LQVLQLCYNKL+G+IP QLGSL+ L+VLALQ N LTG
Sbjct  115   SDLYLNVNNLSGEIPPQIGNMSNLQVLQLCYNKLAGSIPTQLGSLEKLSVLALQYNQLTG  174

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  L+ L LSFN LFG IP KLA A  L+ LDIRNN+LSGNVP ALKRL  G
Sbjct  175   AIPASLGDLEFLSTLVLSFNGLFGPIPVKLARAPLLKTLDIRNNSLSGNVPPALKRLTTG  234

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQ-------P  700
             FQY NNP LCG+GFS+L+ C  S  +P+KPEP  P  N    KDIPESAN          
Sbjct  235   FQYGNNPDLCGVGFSNLETCVTS--DPNKPEPSKP--NVALPKDIPESANPSNCSKSDCS  290

Query  701   HALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
             H    PR      ++ GV+G+ +A   +G   FSWYRR KQKIGS  D+ DSRLSTDQAK
Sbjct  291   HLTKTPRY----GIIFGVIGVFIAMSVSGFLMFSWYRRHKQKIGSASDTLDSRLSTDQAK  346

Query  881   EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             EV R+S SPLI+LEYSNGWDPLA  R+  + FSQEVLESFMFNL+E
Sbjct  347   EVYRKSVSPLISLEYSNGWDPLAIDRS-KSGFSQEVLESFMFNLEE  391



>ref|XP_002318874.2| hypothetical protein POPTR_0012s14430g [Populus trichocarpa]
 gb|EEE97094.2| hypothetical protein POPTR_0012s14430g [Populus trichocarpa]
Length=677

 Score =   389 bits (999),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 215/346 (62%), Positives = 259/346 (75%), Gaps = 12/346 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV NISLQGKGL GK+ P I  +K L+GLYLH+N L+G +PREIANLT L
Sbjct  57    FEGVACNENGQVANISLQGKGLNGKVSPAITGLKYLTGLYLHYNSLYGEIPREIANLTAL  116

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI N+ +LQVLQLCYN+ +G+IP++LGSL+ L VLALQSNHLTG
Sbjct  117   SDLYLNVNNLSGEIPPEIGNMANLQVLQLCYNQFTGSIPSELGSLERLGVLALQSNHLTG  176

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS+NH FGS+P K+A+A  LE LDIRNN+LSGNVPLALKRL++G
Sbjct  177   AIPASLGDLGMLMRLDLSYNHFFGSVPTKVADAPLLEFLDIRNNSLSGNVPLALKRLDDG  236

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANV-----QPHA  706
             F Y NN GLCG GF SLK C  S L P +PEP+G   N LP ++IPE+AN+     Q   
Sbjct  237   FLYENNLGLCGAGFMSLKACNASGLMPGRPEPYGTKVNGLP-REIPETANLRLPCNQSQC  295

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              N+  K   A   V    + +   A G+ TF   RRRKQK+ S+ + SDSRLSTDQAK V
Sbjct  296   SNQS-KAHHASAAVVTFVVTILLAAIGILTFIQCRRRKQKLASSFEISDSRLSTDQAKGV  354

Query  887   SRRSASPLINLEYSNGWDPLAKARN--GNAAFSQEVLESFMFNLDE  1018
              R++ SPLI+LEY NGWDPLA  RN  GNA   Q+V +SF FNL+E
Sbjct  355   YRKNGSPLISLEYPNGWDPLADGRNLSGNA---QDVFQSFRFNLEE  397



>ref|XP_004234946.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Solanum lycopersicum]
Length=678

 Score =   389 bits (998),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 211/344 (61%), Positives = 263/344 (76%), Gaps = 6/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNE GQV NISLQGKGL GK+ P IA +  L+GLYLH+N L+G +PREI+NL  L
Sbjct  56    FEGIACNEKGQVANISLQGKGLKGKLSPAIAGLTHLTGLYLHYNSLYGEIPREISNLVEL  115

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN LSG IP E+ N+++LQVLQLCYN  +G+IP QLG+L  L VLALQSN LTG
Sbjct  116   SDLYLNVNDLSGEIPQELGNMSNLQVLQLCYNHFTGSIPTQLGTLTKLNVLALQSNQLTG  175

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L R+DLS+N LFGSIP+KLA+A  LE+LDIRNN +SGNVPLALKRL  G
Sbjct  176   AIPASLGDLGVLMRVDLSYNSLFGSIPSKLADAPLLEVLDIRNNKISGNVPLALKRLVGG  235

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDIPESANV----QPHA  706
             FQY NNPGLCG+GF SL++CT     NP++PEP+G GS+ L T+DIPE+AN+      +A
Sbjct  236   FQYENNPGLCGVGFPSLRVCTSFDRSNPNRPEPYGVGSSGLSTRDIPETANLNLNCSGNA  295

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
                  K   A VVVGV+ + +   A G+ +F+ YRRRKQK+G  ++  DSRLS DQAKEV
Sbjct  296   CTTSSKTSQASVVVGVIVVTIIASAIGILSFTHYRRRKQKLGGGLEMCDSRLSIDQAKEV  355

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             +R++ SPL++LEYS GWDPLA+ R      SQE+L+ + FNL+E
Sbjct  356   NRKNGSPLVSLEYSIGWDPLAEGRR-YGGVSQEILQRYRFNLEE  398



>ref|XP_011076309.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1 [Sesamum indicum]
Length=671

 Score =   388 bits (997),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 212/344 (62%), Positives = 256/344 (74%), Gaps = 7/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV NISLQGKGL GK+ P +  +K L+GLYLH+N L+G +P EIANLT L
Sbjct  56    FEGVACNEKGQVANISLQGKGLAGKLSPAVGGLKHLTGLYLHYNSLYGEIPVEIANLTEL  115

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP + N+ +LQVLQLCYN+ +G+IP QL  LK L VLALQSN LTG
Sbjct  116   TDLYLNVNNLSGEIPPVLGNMANLQVLQLCYNQFTGSIPTQLSYLKKLNVLALQSNLLTG  175

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L +L RLDLSFN LFGSIPAKLA+A  LE+LD+RNNTLSGNVPLALKRL +G
Sbjct  176   AIPASLGNLGVLMRLDLSFNQLFGSIPAKLADAPMLEVLDVRNNTLSGNVPLALKRLVDG  235

Query  542   FQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDIPESA----NVQPHA  706
             F Y NNPGLCG GFSSL+ C+DS   N  +PEP+  G+  LPT+DIPE+A    N     
Sbjct  236   FLYENNPGLCGSGFSSLRSCSDSGRPNSDRPEPYAGGATGLPTRDIPETADLNLNCNGSP  295

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              +K  K   A V VGV+   V   A G+ +F  YRRRKQK+GS  D S+SRLSTD  KE 
Sbjct  296   CSKKSKTSQASVAVGVIVATVILSALGIMSFLLYRRRKQKLGSAFDISESRLSTDHVKET  355

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              R++ SPL++LEY+NGWDPLA+ R      SQEV+++F  NL E
Sbjct  356   YRKNGSPLVSLEYANGWDPLAEGR--RFGVSQEVMQNFRLNLQE  397



>ref|XP_006365244.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Solanum 
tuberosum]
Length=678

 Score =   387 bits (995),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 210/344 (61%), Positives = 261/344 (76%), Gaps = 6/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNE GQV NISLQGKGL GK+ P IA +  L+GLYLH+N L+G +PREI+NL  L
Sbjct  56    FEGIACNEKGQVANISLQGKGLKGKLSPAIAGLTHLTGLYLHYNSLYGEIPREISNLVEL  115

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN LSG IP E+  ++ LQVLQLCYN  +G+IP QLG+L  L VLALQSN LTG
Sbjct  116   TDLYLNVNDLSGEIPQELGTMSKLQVLQLCYNHFTGSIPTQLGTLTKLNVLALQSNQLTG  175

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L R+DLS+N LFGSIP+KLA+A  LE+LDIRNN +SGNVPLALKRL  G
Sbjct  176   AIPASLGDLGVLMRVDLSYNSLFGSIPSKLADAPLLEVLDIRNNKISGNVPLALKRLVGG  235

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDIPESANV----QPHA  706
             FQY NNPGLCG+GF SL++CT     NP++PEP+G GS+ L T+DIPE+AN+      +A
Sbjct  236   FQYENNPGLCGVGFPSLRVCTSLDRSNPNRPEPYGVGSSGLSTRDIPETANLNLNCSGNA  295

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
                  K   A VVVGV+ + +   A G+ +F+ YRRRKQK+G  ++  DSRLS DQAKEV
Sbjct  296   CTTSSKTSQASVVVGVIVVTIIASAIGILSFTHYRRRKQKLGGGLEMCDSRLSIDQAKEV  355

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             +R++ SPL++LEYS GWDPLA+ R      SQE+L+ + FNL+E
Sbjct  356   NRKNGSPLVSLEYSIGWDPLAEGRR-YGGVSQEILQRYRFNLEE  398



>ref|XP_011017487.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
Length=671

 Score =   386 bits (992),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 218/346 (63%), Positives = 259/346 (75%), Gaps = 16/346 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G V NISLQGKGL G+IP  +  +K+LSGL+LHFN L+G +P+EIA L+ L
Sbjct  55    FEGVACNEQGHVANISLQGKGLSGQIPAALGGLKSLSGLFLHFNALNGVIPKEIAELSEL  114

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP+I N+++LQVLQLCYNKL+G+IP QLGSL+ ++VLALQ N LTG
Sbjct  115   SDLYLNVNNLSGEIPPQIGNMSNLQVLQLCYNKLAGSIPTQLGSLEKISVLALQYNQLTG  174

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  L+ L LSFN LFG IP KLA A  L+ LDIRNN+LSGNVP ALKRL  G
Sbjct  175   AIPASLGDLEFLSTLVLSFNGLFGPIPVKLARAPLLKTLDIRNNSLSGNVPPALKRLTTG  234

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQ-------P  700
             FQY NNP LCG+GFS+L+ C  S  +P+KPEP  P  N    KDIPESAN          
Sbjct  235   FQYGNNPDLCGVGFSNLETCVTS--DPNKPEPSKP--NVALPKDIPESANPSNCSKSDCS  290

Query  701   HALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
             H    PR      ++ GV+G+ +A   +G   FSWYRR KQKIGS  D+ DSRLSTDQAK
Sbjct  291   HLTKTPRN----GIIFGVIGVFIAMSGSGFLMFSWYRRHKQKIGSASDTLDSRLSTDQAK  346

Query  881   EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             EV R+SASPLI+LEYS GWDPLA  R+  + FSQEVLESFMFNL+E
Sbjct  347   EVYRKSASPLISLEYSTGWDPLAIDRS-RSGFSQEVLESFMFNLEE  391



>ref|XP_010941035.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Elaeis guineensis]
Length=682

 Score =   386 bits (991),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 212/344 (62%), Positives = 259/344 (75%), Gaps = 6/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE  +V NISLQGKGL G I P +A+++ LSGLYLH+N L G +PREI+NLT L
Sbjct  63    FEGVACNEQSKVANISLQGKGLSGFISPAVAELRCLSGLYLHYNALRGEIPREISNLTEL  122

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN LSG IP EI  + SLQVLQLCYN+L+G+IP QLG LK LTVLALQSNHLTG
Sbjct  123   SDLYLNVNDLSGRIPVEIGKMASLQVLQLCYNQLTGSIPPQLGLLKKLTVLALQSNHLTG  182

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPATLGDLT L RLDLSFNHLFGSIP KLA    + + D+RNN+LSG+VP  LKRLNEG
Sbjct  183   AIPATLGDLTQLMRLDLSFNHLFGSIPVKLAQLPHVVVFDLRNNSLSGSVPSDLKRLNEG  242

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----  706
             FQY+NN GLCG+GF+SL++C +D  L P KPEPFG  +  L   +IP+SAN+  H     
Sbjct  243   FQYSNNTGLCGVGFTSLEVCSSDDLLKPGKPEPFGSDATGLRQPEIPQSANLNAHCNDTH  302

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              +   K     VV+G++ + V      L   + +RRRKQKIGS ++++DSRLSTDQ +++
Sbjct  303   CSNSSKSSAGNVVIGIVAVAVGGMVIILLAIALHRRRKQKIGSALEATDSRLSTDQPRDL  362

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              R+ ASPLI+LEYSNGWDPLA  R+G   FSQEV +SF FNL+E
Sbjct  363   YRKCASPLISLEYSNGWDPLADGRSG-VGFSQEVSQSFRFNLEE  405



>ref|XP_003548248.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Glycine max]
Length=684

 Score =   386 bits (991),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 210/345 (61%), Positives = 264/345 (77%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV N+SLQGKGL GK+ P IA +K L+GLYLH+N L+G +PRE+ANLT L
Sbjct  62    FEGVACNEKGQVANVSLQGKGLSGKLSPAIAGLKHLTGLYLHYNSLYGEIPREVANLTEL  121

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVNHLSG IPPEI  + +LQVLQLCYN+L+G+IP QLG LK L+VLALQSN L G
Sbjct  122   SDLYLNVNHLSGEIPPEIGKMENLQVLQLCYNQLTGSIPTQLGDLKKLSVLALQSNLLGG  181

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS N+LFGSIP KLA+   L++LD+ NNTLSGNVP ALKRL EG
Sbjct  182   AIPASLGDLGMLMRLDLSSNNLFGSIPIKLADLPSLQVLDVHNNTLSGNVPPALKRLEEG  241

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQ-----PH  703
             F + +N GLCG+GFSSLK CT S  +N ++PEP+G G   L ++DIPE+ANV+      H
Sbjct  242   FVFEHNMGLCGVGFSSLKACTASDHVNLTRPEPYGAGVGGL-SRDIPETANVKLPCNTTH  300

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
               N  +  Q   + VG++ L +A  A G+ TF+ YRRRKQK+GST D S+  LSTDQAK 
Sbjct  301   CQNSSKSKQATSITVGIVLLTIAVSAIGILTFTVYRRRKQKLGSTFDISEGCLSTDQAKS  360

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + R++ SPL++LEYSNGWDPLA ++N +    Q++ +SF FNL+E
Sbjct  361   IYRKNGSPLVSLEYSNGWDPLADSKNFSGD-RQDMFQSFRFNLEE  404



>gb|EPS73352.1| hypothetical protein M569_01401, partial [Genlisea aurea]
Length=665

 Score =   385 bits (989),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 215/339 (63%), Positives = 255/339 (75%), Gaps = 2/339 (1%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIAC+  GQVVNISLQGK L G+IPPEI Q+K LSGLYLHFN LHG +PREIA+L  L
Sbjct  57    FEGIACDGFGQVVNISLQGKRLAGEIPPEIGQLKALSGLYLHFNELHGVIPREIADLNAL  116

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VN+L+G IPPEI  + +LQVLQLCYNKL+GNIP+QLG LKNLTVLALQSN L+G
Sbjct  117   TDLYLDVNNLTGDIPPEIGAMPNLQVLQLCYNKLTGNIPSQLGQLKNLTVLALQSNQLSG  176

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPATLG+L  LTRLDLSFN LFGSIP  L+    L+I DI NNTLSGNVP ALK L  G
Sbjct  177   AIPATLGELASLTRLDLSFNRLFGSIPLALSTLSSLKIFDITNNTLSGNVPQALKGLGVG  236

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKPR  721
             FQY+NNP LCG G+ SL  C+ S+ N    +PFG    H P+KDIPESANVQ +   + +
Sbjct  237   FQYSNNPDLCGNGYPSLLTCSKSSENSMNQQPFGTDPIHPPSKDIPESANVQRNQKKQAQ  296

Query  722   KPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRSA  901
               Q  +VV  +L L++   A G+FTF+ YRRRKQK+ +   SSD+R STD+  E  R + 
Sbjct  297   NSQ-PIVVFSILSLLLVLGAIGVFTFTRYRRRKQKVAAGYGSSDNRQSTDRIIEAGRNNV  355

Query  902   SPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             SPL+ LEYSN WDPLAK R   +  SQE+LES+MFNLDE
Sbjct  356   SPLVGLEYSNDWDPLAK-REEISTLSQEILESYMFNLDE  393



>ref|XP_008803990.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Phoenix dactylifera]
Length=683

 Score =   385 bits (988),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 216/345 (63%), Positives = 259/345 (75%), Gaps = 7/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G+V NISLQGKGL G I P +A+++ LSGLYLH+N L G +PREI+NLT L
Sbjct  63    FEGVACNEHGKVANISLQGKGLSGFISPAVAELRYLSGLYLHYNALRGEIPREISNLTDL  122

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP EI  + SLQVLQLCYN+L+G+IP QLG LK LTVLALQSNHLTG
Sbjct  123   FDLYLNVNNLSGRIPVEIGKMASLQVLQLCYNQLTGSIPPQLGLLKKLTVLALQSNHLTG  182

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPATLGDL  L RLDLSFN+LFGSIP K+A   +L + D+RNN+LSG+VP  LKRL EG
Sbjct  183   AIPATLGDLAQLMRLDLSFNNLFGSIPVKVAQLPRLAVFDLRNNSLSGSVPSDLKRLKEG  242

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPGSNH-LPTKDIPESANVQPHALN-  712
             FQY NN GLCG+GF+SL++C +D  L PSKPEPFGP S    P  +IP SAN+  H  + 
Sbjct  243   FQYRNNTGLCGVGFASLEVCSSDDILKPSKPEPFGPDSTGPRPQPEIPRSANLSAHCHDS  302

Query  713   ---KPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
                   K     V +GV+ + V     GL  F+ +RRRKQKIGS ++ ++SRLSTDQ KE
Sbjct  303   HCSNSSKSSAVNVAIGVVAVAVGGMVIGLSAFALHRRRKQKIGSALEVAESRLSTDQPKE  362

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               R+  SPLI+LEYSNGWDPLA  R+G A FSQEV +SF FNL+E
Sbjct  363   FCRKGGSPLISLEYSNGWDPLADGRSG-AGFSQEVSQSFRFNLEE  406



>gb|KHN24426.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=684

 Score =   382 bits (981),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 209/345 (61%), Positives = 263/345 (76%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV N+SLQGKGL GK+ P IA +K L+GLYLH+N L+G +PRE+ANLT L
Sbjct  62    FEGVACNEKGQVANVSLQGKGLSGKLSPAIAGLKHLTGLYLHYNSLYGEIPREVANLTEL  121

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVNHLSG IPPEI  + +LQVLQLCYN+L+G+IP QLG LK L+VLALQSN L G
Sbjct  122   SDLYLNVNHLSGEIPPEIGKMENLQVLQLCYNQLTGSIPTQLGDLKKLSVLALQSNLLGG  181

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS N+LFGSIP KLA+   L++LD+ NNTLSGNV  ALKRL EG
Sbjct  182   AIPASLGDLGMLMRLDLSSNNLFGSIPIKLADLPSLQVLDVHNNTLSGNVHPALKRLEEG  241

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQ-----PH  703
             F + +N GLCG+GFSSLK CT S  +N ++PEP+G G   L ++DIPE+ANV+      H
Sbjct  242   FVFEHNMGLCGVGFSSLKACTASDHVNLTRPEPYGAGVGGL-SRDIPETANVKLPCNTTH  300

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
               N  +  Q   + VG++ L +A  A G+ TF+ YRRRKQK+GST D S+  LSTDQAK 
Sbjct  301   CQNPSKSKQATSITVGIVLLTIAVSAIGILTFTMYRRRKQKLGSTFDISEGCLSTDQAKS  360

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + R++ SPL++LEYSNGWDPLA ++N +    Q++ +SF FNL+E
Sbjct  361   IYRKNGSPLVSLEYSNGWDPLADSKNFSGD-RQDMFQSFRFNLEE  404



>ref|XP_004309271.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g63710-like [Fragaria vesca subsp. vesca]
Length=682

 Score =   381 bits (978),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 216/349 (62%), Positives = 264/349 (76%), Gaps = 14/349 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G+V NISLQGKGL GK+ P I ++K L+G+Y+H+N L G +P+EIANLT L
Sbjct  58    FEGVACNEAGRVSNISLQGKGLDGKLSPAIGELKDLTGIYMHYNSLKGEIPKEIANLTQL  117

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI N+ SL+VLQLCYN+L+G+IP QLGSLKNL+VLALQSN LTG
Sbjct  118   SDLYLNVNNLSGEIPPEIGNMGSLEVLQLCYNQLTGSIPTQLGSLKNLSVLALQSNQLTG  177

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L +L RLDLS+N+LFGSIP K+A+A  LE+LDIRNNTLSGNVPLALKRLN+G
Sbjct  178   AIPASLGNLEMLMRLDLSYNNLFGSIPMKVADAPLLEVLDIRNNTLSGNVPLALKRLNDG  237

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPGSNHLPTKDIPESANV-----QPH  703
             F Y NN GLCG GF SL  C T S LN S+PEPFG       T+ IPE+ANV     Q  
Sbjct  238   FSYENNLGLCGAGFMSLTACNTSSHLNASRPEPFGSTGT---TRAIPETANVQLPCNQSR  294

Query  704   ALNKPRKPQTA-vvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
               N  +  Q +  VVVG++ L VA  A G+  F+ +RR+KQK+GS+ D SD+RLS D+ K
Sbjct  295   CSNMSKSHQASVAVVVGIVVLTVALSAIGILLFTQHRRQKQKLGSSFDVSDARLSVDETK  354

Query  881   E---VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
                   R+  SPL++LEYS GWDPLA  RN  +AF+Q+V  SF FNLDE
Sbjct  355   AKGVAHRKYGSPLMSLEYSQGWDPLADGRN-LSAFAQDVFHSFKFNLDE  402



>ref|XP_004512590.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230-like [Cicer arietinum]
Length=681

 Score =   381 bits (978),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 206/345 (60%), Positives = 263/345 (76%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV NISLQGKGL+GK+ P I  +K L+GLYLH+N L+G +PREIANLT L
Sbjct  59    FEGVACNEKGQVANISLQGKGLFGKLSPAIGDLKHLTGLYLHYNSLYGDIPREIANLTLL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVNHLSG IP EIS + +LQVLQLCYN+L+G+IP QLG LK L+VLALQSN LTG
Sbjct  119   SDLYLNVNHLSGEIPHEISKMENLQVLQLCYNQLTGSIPTQLGDLKKLSVLALQSNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +LTRLDLS N+LFGSIP +LA+   L +LD+ NNTLSGNVP ALKRL+EG
Sbjct  179   AIPASLGDLGMLTRLDLSSNNLFGSIPTRLADVPLLHVLDVHNNTLSGNVPPALKRLDEG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQ-----PH  703
             F Y  N GLCG GFSSLK C  S  +NP++PEP+G G   + +K+IPE+AN++       
Sbjct  239   FVYEYNLGLCGDGFSSLKACNASEHVNPNRPEPYGAGVGSI-SKEIPETANIKLPCNTTR  297

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
               N  +  + A + +G++   +A  A G+ +F+ YRRRKQK+GS  D ++SRLSTDQ K 
Sbjct  298   CQNSSKSKKAASITIGIVLATIAVSAIGILSFTMYRRRKQKLGSAFDITESRLSTDQTKG  357

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + R++ SPL++LEY+NGWDPLA +RN N    +++ +SF FNL+E
Sbjct  358   IYRKNGSPLVSLEYANGWDPLADSRNFNGD-REDMFQSFRFNLEE  401



>ref|XP_010671985.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 [Beta vulgaris subsp. vulgaris]
Length=691

 Score =   381 bits (978),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 207/350 (59%), Positives = 260/350 (74%), Gaps = 12/350 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ CNE GQV NISLQGKGL G++ P I+ +K L+G+YLH+N L G +P+EI++LTHL
Sbjct  61    FEGVGCNENGQVANISLQGKGLKGQLSPAISGLKHLTGIYLHYNSLFGEIPKEISSLTHL  120

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             +DLYL+VN+LSG IPP+I N+ +LQVLQLCYNKL+G+IP QLGSLK L+VLALQSN+LTG
Sbjct  121   VDLYLDVNNLSGVIPPQIGNMENLQVLQLCYNKLTGSIPTQLGSLKKLSVLALQSNNLTG  180

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG++  L RLDLSFNHLFGSIP  +A A  LE LDIRNNTLSGNVP AL RLNEG
Sbjct  181   AIPASLGEIETLLRLDLSFNHLFGSIPTPIAEAPLLESLDIRNNTLSGNVPPALLRLNEG  240

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPG---SNHLPTKDIPESANVQPHAL  709
             FQY NNPGLCG+GF +LK+C DS  +   +PEP+G G   SN LP K+IPE+ANV+    
Sbjct  241   FQYANNPGLCGVGFLTLKVCPDSDHIGQIRPEPYGGGVATSNGLPRKEIPETANVKLPDC  300

Query  710   NKPRKPQTAvvvvgvlglivAFFA-------TGLFTFSWYRRRKQKIGSTIDSSDSRLST  868
             N+   P  A        + V             +F F+ YRR KQK+GS+ + SD+RLST
Sbjct  301   NQTGCPNNARKSSHNASIAVGVVVVALAMSLISVFIFTKYRRTKQKLGSSFELSDTRLST  360

Query  869   DQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             DQ +E  R++ SPLI+LEY NGWDPL+  R+ N  FS +V++ F FNL+E
Sbjct  361   DQPREFGRKNGSPLISLEYPNGWDPLSDVRSFN-GFSNDVIQGFRFNLEE  409



>ref|XP_010910517.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Elaeis 
guineensis]
Length=675

 Score =   379 bits (974),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 214/343 (62%), Positives = 252/343 (73%), Gaps = 8/343 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G+V NISLQGKGL G I P +A ++ LSGLYLH+N L G +PREIA L  L
Sbjct  60    FEGVACNEHGKVANISLQGKGLAGSISPAVADLRCLSGLYLHYNALSGKIPREIAKLNEL  119

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VN+LSG IP EI N+ SLQVLQLC N+L+G+IP QLG LK LTVLALQSNHLTG
Sbjct  120   SDLYLDVNNLSGGIPEEIGNMASLQVLQLCCNQLTGSIPTQLGLLKKLTVLALQSNHLTG  179

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA LGDLT L RLDLSFN LFGSIP KLA   +L   D+RNNTLSG+VP  LKRL++G
Sbjct  180   AIPACLGDLTQLMRLDLSFNQLFGSIPVKLAQLSQLVAFDVRNNTLSGSVPSDLKRLDDG  239

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKP  718
             FQY NN  LCG GF SL++CT S  LNP +PEP+G G   LP +D P+SAN+  H  N  
Sbjct  240   FQYWNNADLCGDGFPSLRVCTSSDLLNPHRPEPYGAGI--LP-QDNPQSANLNVHCNNTH  296

Query  719   RKPQTAvvvvgvlglivAFFA---TGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
                 +   V  V+ +    F    + L  FSWYRRRKQKIGS ++ SD  LS DQ K+  
Sbjct  297   CSHSSKSAVAIVVAIAAVVFGGTISSLLAFSWYRRRKQKIGSPLEVSDRWLSIDQTKDFY  356

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             RRS+SPLI+LEYSNGWDPLA A++G   FSQEVL+SF FNL+E
Sbjct  357   RRSSSPLISLEYSNGWDPLADAKSG-IGFSQEVLQSFRFNLEE  398



>gb|KHG05851.1| protein strubbelig-receptor family 8 [Gossypium arboreum]
Length=669

 Score =   378 bits (970),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 210/344 (61%), Positives = 262/344 (76%), Gaps = 11/344 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ CNE GQ+ NISLQGKGL GK+ P IA++K L+GLYLH+N L+G +P+EIANLT L
Sbjct  57    FEGLCCNEKGQIANISLQGKGLSGKLSPAIAELKHLTGLYLHYNSLYGVIPKEIANLTLL  116

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLN+N+LSG IPP+I  + SL+VLQLCYN+L+G+IP Q+GSLK L VLALQSN LTG
Sbjct  117   TDLYLNMNNLSGQIPPQIGELGSLKVLQLCYNQLTGSIPTQVGSLKKLNVLALQSNQLTG  176

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  L RLDLSFN  FGSIP KLA+A  L++LDIRNN+LSGNVPLALKRLN+G
Sbjct  177   AIPASLGDLGTLIRLDLSFNSFFGSIPTKLADAPLLQVLDIRNNSLSGNVPLALKRLNDG  236

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQ----PHA  706
             F + NNPGLCG GF+SLK+C DS  +NPSKPE +G  +  + T++IPE+AN+Q       
Sbjct  237   FLFQNNPGLCGSGFASLKVCNDSDHINPSKPEVYGSEAAGV-TREIPETANLQLPCEQKP  295

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              +KP K Q   ++V ++ +IVA    GL TF  Y R+KQK+ S  +  ++RLSTDQ KE 
Sbjct  296   CSKPSKSQRGPILVALIVVIVALSVIGLVTFMQYHRQKQKLSSLSEVPENRLSTDQTKEF  355

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             SR++ SPLI+LEY+NGWDPLA  RN N        ESF FNL+E
Sbjct  356   SRKNGSPLISLEYANGWDPLADGRNYNG-----FAESFRFNLEE  394



>ref|XP_003536190.1| PREDICTED: somatic embryogenesis receptor kinase 5-like [Glycine 
max]
 gb|KHN30538.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=677

 Score =   377 bits (968),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 203/345 (59%), Positives = 262/345 (76%), Gaps = 12/345 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV NISLQGKGL+GK+   IA +K L+GLYLH+N L+G +PREIANLT L
Sbjct  59    FEGVACNEKGQVANISLQGKGLFGKLSAAIAGLKHLTGLYLHYNSLYGEIPREIANLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             +DLYLNVN+LSG IP +I+++ +LQVLQLCYN+L+G+IP QLG+L+ L V+ALQSN+LTG
Sbjct  119   VDLYLNVNNLSGEIPRKIASMENLQVLQLCYNQLTGSIPTQLGALEKLRVVALQSNNLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA LG+L +L RLDLS N+LFGSIP  LA+A  L++LD+ NNTLSGNVP ALKRL++G
Sbjct  179   AIPANLGELGMLVRLDLSSNNLFGSIPTSLADAPSLKVLDVHNNTLSGNVPPALKRLDDG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQ-----PH  703
             F Y  N GLCG+GFSSLK C  S  +NPS+PEP+G       T+DIPE+ANV+       
Sbjct  239   FLYEYNLGLCGVGFSSLKACNASDHVNPSRPEPYGAA-----TRDIPETANVKLPCRGAQ  293

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
              LN  +  Q+  + V +  +++A  A G+ TF+ YRRRKQK+G +   SDS LSTD+A  
Sbjct  294   CLNSSKSNQSTSITVSIFVVMIALCAIGVLTFTIYRRRKQKLGDSFHISDSHLSTDEAIG  353

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               R++ SPL++LEYS GWDPLA +RN N  +SQE+ +S  FNL+E
Sbjct  354   AYRKNGSPLVSLEYSTGWDPLADSRNFN-GYSQEMFQSLRFNLEE  397



>ref|XP_010692238.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Beta vulgaris subsp. vulgaris]
Length=676

 Score =   375 bits (962),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 206/343 (60%), Positives = 252/343 (73%), Gaps = 11/343 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNELG+V NISLQGKGL G +P  IA +K+LSGLYLHFN L G +P+EI  LT L
Sbjct  61    FEGVACNELGKVANISLQGKGLDGVLPAAIAGLKSLSGLYLHFNRLTGHIPKEIGGLTQL  120

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VN+ +G+IP  I N+++LQVLQLCYNKLSGN+P Q+GSLK L VLALQ N LTG
Sbjct  121   TDLYLDVNYFTGTIPDVIGNMSNLQVLQLCYNKLSGNVPTQIGSLKKLNVLALQYNQLTG  180

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L +LTRLDLSFN  FG IP KLA A  L ILD+RNNTLSGNVP AL RL++ 
Sbjct  181   AIPASLGELDMLTRLDLSFNKFFGPIPVKLAEAPLLRILDVRNNTLSGNVPAALHRLSDQ  240

Query  542   FQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKP  718
             FQY NN  LCG+GF+SL++CTDS   + +KPE F PGS    +KDIPESA +  +     
Sbjct  241   FQYANNQDLCGVGFASLRVCTDSNHQSKNKPEAFTPGSPGYGSKDIPESAALPSNCSKSQ  300

Query  719   RKPQTAvvvvgvlglivAF---FATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
                 +     G++  +V        GL TFSWYRRRKQKI S +D++D RLSTDQ K+  
Sbjct  301   CSNSSKSSHAGIISGVVVIALVTVIGLSTFSWYRRRKQKIASNLDTTDGRLSTDQGKDGY  360

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             RRSA+PLI+LEYSNGWDPLAK        S E+ E++MFNL++
Sbjct  361   RRSAAPLISLEYSNGWDPLAKG-------SHELFENYMFNLED  396



>gb|AES75836.2| LRR receptor-like kinase [Medicago truncatula]
Length=684

 Score =   374 bits (960),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 199/345 (58%), Positives = 259/345 (75%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV N+SLQGKGL GK+ P I  +K L+GLYLH+N L+G +P+EIANLT L
Sbjct  62    FEGVACNEKGQVANVSLQGKGLSGKLSPAIGDLKHLTGLYLHYNSLYGDIPKEIANLTQL  121

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVNHLSG IP EI  + +LQVLQLCYN+L+G+IP QLG LK L+VLALQSN L G
Sbjct  122   SDLYLNVNHLSGEIPSEIGKMENLQVLQLCYNQLTGSIPTQLGDLKKLSVLALQSNKLAG  181

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS N+LFGSIP KLA+   L++LD+ NNTLSGNVP  LK+L++ 
Sbjct  182   AIPASLGDLGMLMRLDLSSNNLFGSIPTKLADVPFLQVLDVHNNTLSGNVPPGLKKLDDK  241

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQ-----PH  703
             F Y  N GLCG+GFSSLK C  S  +NP++PEP+G G   + +K+IPE+A+++       
Sbjct  242   FMYEYNLGLCGVGFSSLKACNASDHVNPNRPEPYGAGVGSM-SKEIPETADIKLPCNTTR  300

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
               N  +  +TA + VG++   +A  A  + +F+ YRRRKQK+GS  D ++SRLSTDQ K 
Sbjct  301   CQNSSKSKKTASITVGIVLATIAVSAIAILSFTMYRRRKQKLGSAFDITESRLSTDQTKG  360

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + R++ SPL++LEY+NGWDPLA +RN N    Q++ +SF FNL+E
Sbjct  361   IYRKNGSPLVSLEYANGWDPLADSRNFNGD-KQDMFQSFRFNLEE  404



>ref|XP_010934669.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Elaeis 
guineensis]
Length=673

 Score =   374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 210/345 (61%), Positives = 251/345 (73%), Gaps = 16/345 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G+V NISLQGKGL G I P +A+++ LSGLYLH+N L G +PREI+NLT L
Sbjct  62    FEGVACNEYGKVANISLQGKGLSGFISPAVAELRCLSGLYLHYNALRGEIPREISNLTEL  121

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              +LYLN N+L G IP E+  + SLQVLQLCYN+L+G IP QLG LK LTVLALQ NHL G
Sbjct  122   SELYLNNNNLPGRIPVELGKMESLQVLQLCYNQLTGGIPPQLGLLKKLTVLALQCNHLNG  181

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPATLGDLT LTRLDLSFNHLFGSIP KLA   +L + D+RNN+LSGNVP  LKRLN G
Sbjct  182   AIPATLGDLTQLTRLDLSFNHLFGSIPVKLAQVPQLVVFDVRNNSLSGNVPSDLKRLNGG  241

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKP  718
             FQY NN  LCG+GF+SLK+C +D  LNPSKPEPFG        ++IP+SAN+  H  N  
Sbjct  242   FQYGNNTELCGVGFTSLKVCSSDDVLNPSKPEPFG--------QEIPQSANITAHC-NGS  292

Query  719   RKPQTAvvvvgvlglivAFFATG-----LFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
                +++      + + +   A G     L  F+ YRRRKQKIGS ++ SDSRLSTDQ K+
Sbjct  293   HCSKSSKSSAVKVVIGIVALAFGGLVISLLAFALYRRRKQKIGSALEVSDSRLSTDQPKD  352

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               R+SASPLI+LEYSNGWD L   R G    SQEV +SF FNL+E
Sbjct  353   FYRKSASPLISLEYSNGWDSLVDGR-GGVGLSQEVSQSFRFNLEE  396



>ref|XP_007143904.1| hypothetical protein PHAVU_007G112100g [Phaseolus vulgaris]
 gb|ESW15898.1| hypothetical protein PHAVU_007G112100g [Phaseolus vulgaris]
Length=676

 Score =   373 bits (958),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 204/345 (59%), Positives = 263/345 (76%), Gaps = 12/345 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV N+SLQGKGL GK+ P IA +K L+GLYLH+N L+G +PREIANLT L
Sbjct  58    FEGVACNEKGQVANVSLQGKGLSGKLSPAIAGLKHLTGLYLHYNSLYGDIPREIANLTEL  117

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             +DLYLNVN+LSG IP EI+++ +LQVLQLCYN+L+G+IP QLG+LK L+V+ALQSN LTG
Sbjct  118   VDLYLNVNNLSGEIPREIASMENLQVLQLCYNRLTGSIPTQLGALKKLSVVALQSNMLTG  177

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS N+LFGSIP  LA A  L +LD+ NNTLSGNVP ALKRL++G
Sbjct  178   AIPASLGDLGMLARLDLSSNNLFGSIPTSLAEAISLRVLDVHNNTLSGNVPPALKRLDDG  237

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQ-----PH  703
             F Y  N GLCG+GFSSLK C  S  + PS+PEP+G       T+DIPE+ANV+       
Sbjct  238   FLYEYNLGLCGVGFSSLKACNASDHVIPSRPEPYGAA-----TRDIPETANVKLPCNGTQ  292

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
              LN  +  Q+  + VG+  +I+A  A G+ TF+ YRRRKQK+G +   SD+R ST++A  
Sbjct  293   CLNSSKSNQSTSIAVGIFVVIIAMSAIGVLTFTLYRRRKQKLGGSFHISDNRQSTEEAMG  352

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             V R++ SPL++LEYS GWDPLA++RN  + +SQ++ +S  FNL+E
Sbjct  353   VYRKNGSPLVSLEYSTGWDPLAESRN-LSGYSQDMFQSLRFNLEE  396



>emb|CBI24527.3| unnamed protein product [Vitis vinifera]
Length=659

 Score =   372 bits (954),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 207/325 (64%), Positives = 248/325 (76%), Gaps = 6/325 (2%)
 Frame = +2

Query  59    KGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEIS  238
             KGL GK+ P IA +K L+GLYLH+N L+G +P EIANLT L DLYLNVN+LSG+IP E+ 
Sbjct  56    KGLTGKLSPAIAGLKHLTGLYLHYNSLYGEIPVEIANLTQLSDLYLNVNNLSGTIPAELG  115

Query  239   NITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSF  418
              + +LQVLQLCYN+L+G+IP QLGSLK L+VLALQSN LTGAIPA+LGDL +L RLDLSF
Sbjct  116   KMATLQVLQLCYNQLTGSIPTQLGSLKKLSVLALQSNQLTGAIPASLGDLGMLVRLDLSF  175

Query  419   NHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFSSLKL  598
             N LFGSIP +LA+   LE+LDIRNNTLSG +P ALKRLN GFQY NN  LCG GFS LK+
Sbjct  176   NRLFGSIPRRLADVVSLEVLDIRNNTLSGKIPPALKRLNGGFQYKNNARLCGDGFSYLKV  235

Query  599   CTDSAL-NPSKPEPFGPGSNHLPTKDIPESANVQPHA----LNKPRKPQTAvvvvgvlgl  763
             C    L N S+PEP+G GSN   T DIPE+ANVQ H      + P K   A VVVG++ +
Sbjct  236   CNSLDLTNQSRPEPYGAGSNTQSTGDIPETANVQLHCDKAHCSNPSKSSHAPVVVGMVVV  295

Query  764   ivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRSASPLINLEYSNGWDP  943
              +A  A G+ +F+ YRRRKQK+GS+ D SDSRLSTDQ KEV R++ SPL++LEYSNGWDP
Sbjct  296   TIALSAIGILSFAQYRRRKQKLGSSFDISDSRLSTDQGKEVYRKNGSPLVSLEYSNGWDP  355

Query  944   LAKARNGNAAFSQEVLESFMFNLDE  1018
             LA  RN    F QEV +SF FNL+E
Sbjct  356   LADGRN-YGGFPQEVFQSFRFNLEE  379



>ref|XP_003619618.1| Receptor-like protein kinase [Medicago truncatula]
Length=720

 Score =   373 bits (957),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 199/345 (58%), Positives = 259/345 (75%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV N+SLQGKGL GK+ P I  +K L+GLYLH+N L+G +P+EIANLT L
Sbjct  62    FEGVACNEKGQVANVSLQGKGLSGKLSPAIGDLKHLTGLYLHYNSLYGDIPKEIANLTQL  121

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVNHLSG IP EI  + +LQVLQLCYN+L+G+IP QLG LK L+VLALQSN L G
Sbjct  122   SDLYLNVNHLSGEIPSEIGKMENLQVLQLCYNQLTGSIPTQLGDLKKLSVLALQSNKLAG  181

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS N+LFGSIP KLA+   L++LD+ NNTLSGNVP  LK+L++ 
Sbjct  182   AIPASLGDLGMLMRLDLSSNNLFGSIPTKLADVPFLQVLDVHNNTLSGNVPPGLKKLDDK  241

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQ-----PH  703
             F Y  N GLCG+GFSSLK C  S  +NP++PEP+G G   + +K+IPE+A+++       
Sbjct  242   FMYEYNLGLCGVGFSSLKACNASDHVNPNRPEPYGAGVGSM-SKEIPETADIKLPCNTTR  300

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
               N  +  +TA + VG++   +A  A  + +F+ YRRRKQK+GS  D ++SRLSTDQ K 
Sbjct  301   CQNSSKSKKTASITVGIVLATIAVSAIAILSFTMYRRRKQKLGSAFDITESRLSTDQTKG  360

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + R++ SPL++LEY+NGWDPLA +RN N    Q++ +SF FNL+E
Sbjct  361   IYRKNGSPLVSLEYANGWDPLADSRNFNGD-KQDMFQSFRFNLEE  404



>ref|XP_010524368.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor 
protein kinase EXS [Tarenaya hassleriana]
Length=683

 Score =   371 bits (952),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 206/346 (60%), Positives = 259/346 (75%), Gaps = 9/346 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+E G+V NISLQG GL G IP  + ++  L+GLYLHFN LHG +P+EI++L  L
Sbjct  59    FDGVACDEHGRVANISLQGMGLSGNIPAAVGRLTGLTGLYLHFNSLHGEIPKEISHLPLL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN LSG IPPEI N+ +LQVLQ+CYNKLSG+IP QLGSLK ++VLALQSN L+G
Sbjct  119   SDLYLNVNDLSGEIPPEIGNLGNLQVLQICYNKLSGSIPTQLGSLKKISVLALQSNQLSG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG L  LTRLDLSFNHLFG +P KLA A  LE+LDIRNN+ SGNVP  LKRL  G
Sbjct  179   AIPASLGGLDSLTRLDLSFNHLFGPVPVKLAEAPLLEVLDIRNNSFSGNVPTGLKRLENG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNK-  715
             FQ+ NNP LCG+GF  LK C  S  +N ++P+P  P S    T   PESA++Q    +  
Sbjct  239   FQFANNPALCGVGFLGLKACAVSDGMNLNRPDPSNPKS--FSTDIKPESADLQRRNCSNS  296

Query  716   ---PRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD-QAKE  883
                 +  ++  V+VG++  ++A  A G FTF+W+RRRKQKIGS +D  D RLST+ Q KE
Sbjct  297   GRCSKSSKSFGVIVGLIITVIAVAAFGGFTFAWHRRRKQKIGSNLDPVDGRLSTEYQFKE  356

Query  884   VSR-RSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             VSR + ASPLI+LEY++GWDPLA+ +N N+A SQEV ESFMFNL++
Sbjct  357   VSRKKGASPLISLEYASGWDPLARGQNSNSALSQEVFESFMFNLED  402



>ref|XP_009372936.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 [Pyrus x bretschneideri]
Length=668

 Score =   370 bits (950),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 213/348 (61%), Positives = 258/348 (74%), Gaps = 25/348 (7%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGI CN            K L GK+ P IAQ+K L+G+Y+H+N L G +PREIANLT L
Sbjct  57    FEGIGCN------------KRLSGKLSPAIAQLKHLTGIYMHYNSLQGEIPREIANLTEL  104

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI +++SLQVLQLCYN+L+G+IP QLGSLKNL+VLALQSN LTG
Sbjct  105   TDLYLNVNNLSGVIPPEIGSMSSLQVLQLCYNQLTGSIPTQLGSLKNLSVLALQSNQLTG  164

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS NHLFGSIP KLA+A  LE+LD+RNNTLSGNVPLALKRLNEG
Sbjct  165   AIPASLGDLEMLMRLDLSVNHLFGSIPTKLADAPVLEVLDVRNNTLSGNVPLALKRLNEG  224

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANV-----QPH  703
             F Y NN GLCG GF SL  CT S  LN S+PEPF  G   +PT+DIPE+A+V     Q  
Sbjct  225   FSYENNLGLCGAGFMSLTACTTSGHLNTSRPEPFRAG---VPTRDIPETAHVPLPCNQTR  281

Query  704   ALNKPRKPQTAvvvvgvlgliv-AFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
               N  +  Q +V VV  L ++  A    G   F+ +RRRKQK+G++ D++D RLSTD+AK
Sbjct  282   CSNLSKSHQASVAVVVGLIVVTIALSGVGFLFFAQHRRRKQKLGNSFDTADGRLSTDEAK  341

Query  881   --EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
                V R++ SPLI+LEY+NGWDPLA  RN  +AF+QEV +SF FNL+E
Sbjct  342   GNGVYRKNGSPLISLEYANGWDPLADGRN-LSAFAQEVFQSFRFNLEE  388



>ref|XP_003556401.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Glycine 
max]
 gb|KHN05033.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=677

 Score =   370 bits (950),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 204/345 (59%), Positives = 263/345 (76%), Gaps = 12/345 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNE GQV N+SLQGKGL GK+ P IA +K L+GLYLH+N L+G +PREI NLT L
Sbjct  59    FEGIACNEKGQVANVSLQGKGLLGKLSPAIAGLKHLTGLYLHYNSLYGEIPREIGNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             +DLYLNVN+LSG IP EI+++ +LQVLQLCYN+L+G+IP QLG+L+ L V+ALQSN+LTG
Sbjct  119   VDLYLNVNNLSGEIPREIASMENLQVLQLCYNQLTGSIPTQLGALEKLRVVALQSNNLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS N+LFGSIP  LA+A  L++LD+ NNTLSGNVP ALKRL++G
Sbjct  179   AIPASLGDLGMLVRLDLSSNNLFGSIPTSLADALSLKVLDVHNNTLSGNVPPALKRLDDG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFGPGSNHLPTKDIPESANVQ-----PH  703
             F Y  N GLCG+GFSSLK C  S  +NPS+PEP+G       T+DIPE+ANV+       
Sbjct  239   FLYEYNLGLCGVGFSSLKACNASDRVNPSRPEPYGAA-----TRDIPETANVKLPCRGTQ  293

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
              LN  +  Q+  V  G+  +I+A  A G++TF+ YRRRKQK+G +   SDS L+TD+A  
Sbjct  294   CLNSSKSSQSTSVTAGIFVVIIALCAIGVWTFAIYRRRKQKLGDSFHISDSHLNTDEAIG  353

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               R++ SPL++LEYS GWDPLA +RN N  ++Q++ +S  FNL+E
Sbjct  354   AYRKNGSPLVSLEYSTGWDPLADSRNFN-GYNQDIFQSLRFNLEE  397



>ref|XP_008794535.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Phoenix dactylifera]
Length=672

 Score =   368 bits (945),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 210/343 (61%), Positives = 250/343 (73%), Gaps = 11/343 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G+V NISLQGKGL G I P +A+++ LSGLYLH+N L G +PREIANL  L
Sbjct  60    FEGVACNENGKVANISLQGKGLAGSISPAVAELRYLSGLYLHYNALSGKIPREIANLNEL  119

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VN+LSG IP EI N+ SLQVLQLC N+LSG+IP QLG LK + VLALQSNHLTG
Sbjct  120   SDLYLDVNNLSGVIPEEIGNMASLQVLQLCCNQLSGSIPTQLGLLKKINVLALQSNHLTG  179

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDLT L RLDLSFN LFGSIP KLA   +L + D+RNNTLSG+VP  LKRL +G
Sbjct  180   AIPASLGDLTQLMRLDLSFNQLFGSIPVKLAQLSQLVVFDVRNNTLSGSVPSDLKRLADG  239

Query  542   FQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDIPESANVQPHALNKP  718
             FQY NN  LCG GF SL++CT S L NP++     PG+  LP ++ P SAN+  H  N  
Sbjct  240   FQYGNNADLCGNGFPSLRVCTSSDLFNPNR-----PGAGILPQEN-PYSANLNVHCNNTH  293

Query  719   RKPQTAvvvvgvlglivAFFA---TGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
                 +   V  V+ +    F    +GL  FSWYRRRKQKIGS  + SD RLS DQ K+  
Sbjct  294   CSNSSKSAVAIVVAIAAVVFGGTISGLLAFSWYRRRKQKIGSPSEVSDRRLSADQTKDFY  353

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             +RS SPLI+LEYSNGWDPLA  R+ +  FSQEVL+SF FNL+E
Sbjct  354   QRSVSPLISLEYSNGWDPLADGRS-SVGFSQEVLQSFRFNLEE  395



>emb|CDP05303.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   364 bits (935),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 207/344 (60%), Positives = 258/344 (75%), Gaps = 7/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ACN  GQV NISLQGKGL GK+ P +A+++ L+GLYLH+N L+G +PREI++L+ L
Sbjct  28    FVGVACNRRGQVANISLQGKGLSGKLCPAVAELRHLTGLYLHYNALYGEIPREISSLSEL  87

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPE+ N+ SLQVLQLCYN+ +G+IP QLG+LK L VLALQ N LTG
Sbjct  88    TDLYLNVNNLSGEIPPELGNMDSLQVLQLCYNQFTGSIPTQLGALKKLNVLALQFNELTG  147

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  L RLDLSFN LFGSIP KLA+A  LE+LD+RNN+LSGNVP ALKRL  G
Sbjct  148   AIPASLGDLGSLMRLDLSFNRLFGSIPTKLADAPILEVLDVRNNSLSGNVPNALKRLIGG  207

Query  542   FQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDIPESANVQPHA----  706
             FQY NNPGLCG GFSSL+ CT S   NPS+PEP+G G   L T+DIPE+AN++ +     
Sbjct  208   FQYENNPGLCGAGFSSLRACTASDRPNPSRPEPYGGGPTGLSTRDIPETANLRLNCSETH  267

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              +K  K   A V+VGVL + +     G+ +FS Y  RKQK+ +  D+ DSRL TD AK  
Sbjct  268   CSKSSKALQASVIVGVLVVCIIVLVIGILSFSHY-HRKQKLENASDAQDSRLPTDHAKGA  326

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              R++ SPLI+LEY +GWDPLA+ R+     SQE ++SF FNL+E
Sbjct  327   QRKNGSPLISLEYPSGWDPLAEGRH-FGDVSQEFMQSFRFNLEE  369



>gb|KHG09358.1| Leucine-rich repeat receptor protein kinase EXS [Gossypium arboreum]
Length=672

 Score =   363 bits (932),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 203/344 (59%), Positives = 258/344 (75%), Gaps = 14/344 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV NISLQGKGL GKI P IA+++ L+GL+LH+N L+G VPREIANLT L
Sbjct  58    FEGLACNEQGQVANISLQGKGLSGKISPAIAELQNLTGLFLHYNSLYGEVPREIANLTQL  117

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLN+N+LSG IPPEI+ + SL+VLQLCYN+L+G+IP Q GSLK L VLALQSN LTG
Sbjct  118   ADLYLNMNNLSGEIPPEIAQMDSLRVLQLCYNQLTGSIPTQFGSLKKLNVLALQSNQLTG  177

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  L RLDLSFN LFGSIP KLA+A  LE+LDIRNN+LSGNVPLALKRLN+G
Sbjct  178   AIPASLGDLGTLIRLDLSFNDLFGSIPTKLADAPLLEVLDIRNNSLSGNVPLALKRLNDG  237

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPGSNHLPTKDIPESANV----QPHA  706
             F + NN GLCG GF+SL+ C T    NP++PE +G G   + +++IPE+AN+    +   
Sbjct  238   FLFQNNLGLCGSGFASLEPCNTSYQTNPTRPEAYGQGVTGM-SREIPETANLRLPCEQSQ  296

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              +KP K +   ++VG++ + VA  A GL  F  YR RK K+G++ +         +AKE 
Sbjct  297   CSKPSKSRKGPILVGLVVVTVALSAIGLLIFKQYRNRKPKLGTSFEEP-------EAKEG  349

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              R+  SPL++ EY+NGWDPL  +RN N  F+Q+VL+SF FNL+E
Sbjct  350   YRKKGSPLVSFEYTNGWDPLDGSRNFN-GFTQDVLQSFRFNLEE  392



>ref|XP_008438170.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 isoform X2 [Cucumis melo]
Length=531

 Score =   357 bits (916),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 200/346 (58%), Positives = 252/346 (73%), Gaps = 8/346 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G+VVNISLQG GL G IP  +A +++L+GLYLHFN L G +P+EIA+L  L
Sbjct  60    FEGVACNEQGKVVNISLQGMGLSGYIPAAVAGLRSLTGLYLHFNALIGEIPKEIASLNQL  119

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN LSG IP EI N+ +LQVLQLCYNKL+G IP+Q+G++K L+VLALQ N LTG
Sbjct  120   TDLYLNVNQLSGEIPFEIGNMANLQVLQLCYNKLTGGIPSQVGNMKVLSVLALQYNQLTG  179

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+LT LTRL+LS N  FG IP  LA+A  LE+ ++ NN+L+GNVP   KRL E 
Sbjct  180   AIPASLGNLTALTRLNLSNNKFFGPIPVILADAPALEVFNVENNSLTGNVPPGFKRLKEK  239

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPG--SNHLPTKDIPESANVQPHA--  706
             F Y NNP LCG+GF  L  C+   +LNPS+PEPF P    N    +DIPESAN++ +   
Sbjct  240   FMYLNNPSLCGVGFQDLNPCSKLKSLNPSRPEPFLPQLPGNDPSARDIPESANLRSNCNG  299

Query  707   --LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
                ++  K     V +GV+G+  AF A GL TFSWYRR + K GST +    R+ T Q +
Sbjct  300   GNCSRQSKSSRVGVALGVIGVFAAFSAIGLATFSWYRRNEHKFGSTSNGISRRIITSQVR  359

Query  881   EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             EV RR+ASPLINLEYSNGWDPLAK   G+A+ S+E+ +SFMFNL++
Sbjct  360   EVYRRNASPLINLEYSNGWDPLAKDHGGSAS-SREIFKSFMFNLED  404



>ref|XP_004133916.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Cucumis sativus]
 ref|XP_004155789.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Cucumis sativus]
 gb|KGN56604.1| hypothetical protein Csa_3G126190 [Cucumis sativus]
Length=691

 Score =   358 bits (919),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 201/347 (58%), Positives = 254/347 (73%), Gaps = 10/347 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G+VVNISLQG GL G IP  +A +++L+GLYLHFN L G +P+EIA+L  L
Sbjct  60    FEGVACNEQGKVVNISLQGMGLSGNIPSAVAGLRSLTGLYLHFNALVGEIPKEIASLNQL  119

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN LSG IP EI N+ +LQVLQLCYNKL+G IP+Q+G++K L VLALQ N LTG
Sbjct  120   TDLYLNVNQLSGEIPFEIGNMANLQVLQLCYNKLTGGIPSQVGNMKVLNVLALQYNQLTG  179

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+LT LTRL+LS N  FG IP  LA+A  LE+ ++ NN+L+GNVP   KRL E 
Sbjct  180   AIPASLGNLTALTRLNLSNNKFFGPIPVILADAPALEVFNVENNSLTGNVPPGFKRLKEK  239

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPF---GPGSNHLPTKDIPESANVQPHA-  706
             F Y NNP LCG+GF  L  C+   +LNPS+PEPF    PG++H   +DIPESAN+  +  
Sbjct  240   FMYLNNPSLCGVGFQDLNPCSKLKSLNPSRPEPFLPQLPGNDH-SARDIPESANLGSNCN  298

Query  707   ---LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQA  877
                 ++  K     V +GV+G+  AF A GL TFSWYRR + K GST +    R+ T Q 
Sbjct  299   GGNCSRQSKSSRVGVALGVIGVFAAFSAIGLATFSWYRRNEHKFGSTSNGISRRIITSQV  358

Query  878   KEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             +EV RR+ASPLINLEYSNGWDPLAK + G+A+ S+E+ +SFMFNL++
Sbjct  359   REVYRRNASPLINLEYSNGWDPLAKDQGGSAS-SREIFKSFMFNLED  404



>ref|XP_008438169.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 isoform X1 [Cucumis melo]
Length=691

 Score =   357 bits (917),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 200/346 (58%), Positives = 252/346 (73%), Gaps = 8/346 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G+VVNISLQG GL G IP  +A +++L+GLYLHFN L G +P+EIA+L  L
Sbjct  60    FEGVACNEQGKVVNISLQGMGLSGYIPAAVAGLRSLTGLYLHFNALIGEIPKEIASLNQL  119

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN LSG IP EI N+ +LQVLQLCYNKL+G IP+Q+G++K L+VLALQ N LTG
Sbjct  120   TDLYLNVNQLSGEIPFEIGNMANLQVLQLCYNKLTGGIPSQVGNMKVLSVLALQYNQLTG  179

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+LT LTRL+LS N  FG IP  LA+A  LE+ ++ NN+L+GNVP   KRL E 
Sbjct  180   AIPASLGNLTALTRLNLSNNKFFGPIPVILADAPALEVFNVENNSLTGNVPPGFKRLKEK  239

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPG--SNHLPTKDIPESANVQPHA--  706
             F Y NNP LCG+GF  L  C+   +LNPS+PEPF P    N    +DIPESAN++ +   
Sbjct  240   FMYLNNPSLCGVGFQDLNPCSKLKSLNPSRPEPFLPQLPGNDPSARDIPESANLRSNCNG  299

Query  707   --LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
                ++  K     V +GV+G+  AF A GL TFSWYRR + K GST +    R+ T Q +
Sbjct  300   GNCSRQSKSSRVGVALGVIGVFAAFSAIGLATFSWYRRNEHKFGSTSNGISRRIITSQVR  359

Query  881   EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             EV RR+ASPLINLEYSNGWDPLAK   G+A+ S+E+ +SFMFNL++
Sbjct  360   EVYRRNASPLINLEYSNGWDPLAKDHGGSAS-SREIFKSFMFNLED  404



>gb|KEH22283.1| LRR receptor-like kinase [Medicago truncatula]
Length=669

 Score =   354 bits (908),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 201/343 (59%), Positives = 249/343 (73%), Gaps = 7/343 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+ACNE G V NISLQGKGL G+IP  I ++K+L+GLYLHFN L+G +P+EIA LT L
Sbjct  53    FDGVACNEQGLVTNISLQGKGLSGEIPSVIGKLKSLTGLYLHFNALNGILPKEIAGLTQL  112

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP EI N+++LQVLQLC+N+L+G+IP +LG LK L+VLALQ NHL+G
Sbjct  113   SDLYLNVNNLSGFIPHEIGNMSNLQVLQLCHNELNGSIPTELGKLKRLSVLALQYNHLSG  172

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L  L RLDLSFN L G IP  LANA KLE LDIRNN+LSG+VP  LKRL EG
Sbjct  173   AIPASLGELETLERLDLSFNTLLGPIPVTLANAPKLETLDIRNNSLSGSVPTDLKRLKEG  232

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGP---GSNHLPTKDIPESANVQPHAL  709
             FQY NN GLCG GF+ L  C   S  +P +PEP+ P    +   PT   P S N      
Sbjct  233   FQYFNNHGLCGTGFAHLDSCQIVSNSDPVRPEPYDPSNISTIEFPTTPEPTSKNCGNSGC  292

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
              +     T  +V  V+G++     TGLF    +RR KQKIG+T++ SD+RLSTD+ KEV 
Sbjct  293   RRRSDSSTIGLVFAVIGVVSVSALTGLFLILRHRRLKQKIGNTVEISDNRLSTDKIKEVY  352

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             R+ ASPLINLEYS+GWDPL+K      ++SQE L+SFMFNL+E
Sbjct  353   RKKASPLINLEYSSGWDPLSKDL---GSYSQEFLQSFMFNLEE  392



>ref|XP_006368702.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP65271.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=682

 Score =   354 bits (909),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 199/345 (58%), Positives = 246/345 (71%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV NISLQGKGL G I P +A++K+LSGLYLH+N L G +P+EI NL  L
Sbjct  60    FEGVACNEHGQVANISLQGKGLSGTISPAVAELKSLSGLYLHYNSLSGEIPKEIVNLVGL  119

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSGSIPPEI ++ SLQVL+LC N+L+G IP ++GSLK L+VLALQ N L G
Sbjct  120   SDLYLNVNNLSGSIPPEIGSMASLQVLELCCNQLAGYIPTEMGSLKRLSVLALQYNRLVG  179

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IPA+LG L +L RLD+SFN+L G+IP  +AN  +LE+LD+RNN+LSG VP ALKRLN G
Sbjct  180   QIPASLGTLGMLKRLDMSFNYLSGTIPQGIANIPRLEVLDVRNNSLSGTVPFALKRLNGG  239

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDIPESANVQP-----H  703
             FQ+ NN GLCG GF  L+ C+    +N ++    GP +N+   K  P+SA +Q      H
Sbjct  240   FQFENNQGLCGTGFHPLRACSAFDNMNINQVGSLGPIANNSAKKVTPQSAILQAHCNQTH  299

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
               N  + PQ A+V   ++  I    A  L  F  YRR+KQKIG+T DSSD RLSTDQAKE
Sbjct  300   CSNSSKLPQAAIVAGVIIVTITLMGAGFLIIFC-YRRKKQKIGNTSDSSDGRLSTDQAKE  358

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               R  ASPL +LEYSNGWDPL  +RNG   FS E L +F FNL+E
Sbjct  359   FHRAGASPLASLEYSNGWDPLGDSRNG-IEFSVEHLNNFRFNLEE  402



>gb|AES78411.2| LRR receptor-like kinase [Medicago truncatula]
Length=653

 Score =   353 bits (906),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 201/343 (59%), Positives = 249/343 (73%), Gaps = 7/343 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+ACNE G V NISLQGKGL G+IP  I ++K+L+GLYLHFN L+G +P+EIA LT L
Sbjct  53    FDGVACNEQGLVTNISLQGKGLSGEIPSVIGKLKSLTGLYLHFNALNGILPKEIAGLTQL  112

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP EI N+++LQVLQLC+N+L+G+IP +LG LK L+VLALQ NHL+G
Sbjct  113   SDLYLNVNNLSGFIPHEIGNMSNLQVLQLCHNELNGSIPTELGKLKRLSVLALQYNHLSG  172

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L  L RLDLSFN L G IP  LANA KLE LDIRNN+LSG+VP  LKRL EG
Sbjct  173   AIPASLGELETLERLDLSFNTLLGPIPVTLANAPKLETLDIRNNSLSGSVPTDLKRLKEG  232

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGP---GSNHLPTKDIPESANVQPHAL  709
             FQY NN GLCG GF+ L  C   S  +P +PEP+ P    +   PT   P S N      
Sbjct  233   FQYFNNHGLCGTGFAHLDSCQIVSNSDPVRPEPYDPSNISTIEFPTTPEPTSKNCGNSGC  292

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
              +     T  +V  V+G++     TGLF    +RR KQKIG+T++ SD+RLSTD+ KEV 
Sbjct  293   RRRSDSSTIGLVFAVIGVVSVSALTGLFLILRHRRLKQKIGNTVEISDNRLSTDKIKEVY  352

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             R+ ASPLINLEYS+GWDPL+K      ++SQE L+SFMFNL+E
Sbjct  353   RKKASPLINLEYSSGWDPLSKDL---GSYSQEFLQSFMFNLEE  392



>ref|XP_008658219.1| PREDICTED: uncharacterized protein LOC100272330 isoform X1 [Zea 
mays]
 gb|AFW85974.1| putative leucine-rich repeat protein kinase family protein [Zea 
mays]
Length=682

 Score =   353 bits (906),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 195/346 (56%), Positives = 249/346 (72%), Gaps = 8/346 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ C   G+V  +SLQG+GL G +PP +A ++ L GLYLH+N + G +PREI  L+ L
Sbjct  58    FVGLTCGRDGRVTAVSLQGRGLSGTLPPAVAGLRRLQGLYLHYNGIKGPIPREIGKLSEL  117

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VNHL+G +P EI+ I +LQVLQL YN+L+G+IP QLG+L  LTVLA+QSN L G
Sbjct  118   TDLYLDVNHLTGPVPVEIAAIANLQVLQLGYNQLTGSIPPQLGNLNKLTVLAMQSNQLDG  177

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPATLG+LT L RLDLSFN LFGSIP+K+A    LE+ D+RNNTLSG+VP+ L+RLN G
Sbjct  178   AIPATLGELTQLRRLDLSFNSLFGSIPSKIAEVPLLEVFDVRNNTLSGSVPVGLRRLNGG  237

Query  542   FQYTNNPGLCGIGFSSLKLC--TDSALNPSKPEPFGPGSNHLPTKDIPESAN---VQPHA  706
             FQY NN GLCG GFS L+LC  ++  L PSKPEPFGP    + T+ +P+SAN       +
Sbjct  238   FQYMNNKGLCGAGFSLLELCLSSEDGLKPSKPEPFGP-DGTVKTRQVPQSANPDGCSGAS  296

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD--QAK  880
              +K       V++V V+  ++     GLF FSWYRR+KQKIGS+++ SDSRLSTD  Q K
Sbjct  297   CSKSANASQGVLIVAVVAAVIGAAFCGLFAFSWYRRQKQKIGSSLEVSDSRLSTDHFQQK  356

Query  881   EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             E  RRSASPLI++EYSN WDPL+    G  +  Q V +SF FNL+E
Sbjct  357   EACRRSASPLISVEYSNSWDPLSAGGAGVGSPGQVVGDSFRFNLEE  402



>ref|XP_006397716.1| hypothetical protein EUTSA_v10001341mg [Eutrema salsugineum]
 gb|ESQ39169.1| hypothetical protein EUTSA_v10001341mg [Eutrema salsugineum]
Length=693

 Score =   353 bits (906),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 207/353 (59%), Positives = 258/353 (73%), Gaps = 15/353 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+   +V NISLQG GL G IPP I  + +L+GLYLHFN L G +P++I+NL  L
Sbjct  60    FDGVACDGNRRVANISLQGMGLTGTIPPSIGLLTSLTGLYLHFNSLTGQIPKDISNLPLL  119

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP+I N+ +LQVLQLCYNKLSG+IP QLGSLK +TVLALQ N L+G
Sbjct  120   ADLYLNVNNLSGEIPPQIGNLDNLQVLQLCYNKLSGSIPTQLGSLKKITVLALQYNQLSG  179

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGD+  LTRLDLSFN LFG +P KLA A  LE+LDIRNN+ SG VP ALKRLN G
Sbjct  180   AIPASLGDIDTLTRLDLSFNDLFGPVPVKLAGAPLLEVLDIRNNSFSGFVPSALKRLNNG  239

Query  542   FQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFGPGSNHLPTKDI-PESANVQ------  697
             FQY+NN GLCG GF+ LK CT S   N ++P+P  P  N   T D+ PESA++Q      
Sbjct  240   FQYSNNHGLCGDGFTDLKACTGSNDPNLNRPDPTNP-KNFRTTDDVKPESADLQRNNCSN  298

Query  698   PHALNKPRKPQTAvvvvgvlglivAFFATGLF---TFSWYRRRKQKIGSTIDSSDSRLST  868
              +      K   +  +  V+GLI +  A  +F   TF+WYRRRKQKIGS++D+ D R+ST
Sbjct  299   NNNGGCSSKTSKSSPLGIVMGLIGSILAVAIFGGSTFTWYRRRKQKIGSSLDAMDGRIST  358

Query  869   D-QAKEVSRR-SASPLINLEYSNGWDPLAKARNG-NAAFSQEVLESFMFNLDE  1018
             +   KE SRR S+SPLI+LEY++GWDPL + +N  N+A SQEV ESFMFNL+E
Sbjct  359   EYNFKEASRRKSSSPLISLEYASGWDPLGRGQNSNNSALSQEVFESFMFNLEE  411



>ref|XP_002303531.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE78510.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=631

 Score =   351 bits (901),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 194/344 (56%), Positives = 246/344 (72%), Gaps = 8/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G V NISLQGKGL G + P +A++K+LSGLYLH+N L G +P+EIA+LT L
Sbjct  28    FEGVACNEHGNVANISLQGKGLSGTLSPAVAELKSLSGLYLHYNSLSGEIPKEIADLTEL  87

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN++SGSIPPE+ N+ SLQVL+LC N+L+GNIP ++GSLK L+VLALQ N LT 
Sbjct  88    SDLYLNVNNISGSIPPEMGNMASLQVLELCCNQLAGNIPPEMGSLKRLSVLALQYNRLTD  147

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IPA+LG L +L  L +SFNHL GSIP  +AN  ++E+LD+RNN+LSG VP ALKRLN G
Sbjct  148   QIPASLGTLGMLKMLYMSFNHLSGSIPQGIANIPQMEVLDVRNNSLSGIVPSALKRLNGG  207

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQP-----HA  706
             FQ+ NNPGLCG GF  L+ C ++  + ++  P GP +N+   K IP+S  +Q      H 
Sbjct  208   FQFENNPGLCGTGFPLLRAC-NAVFDINQVGPLGPIANNTAQKVIPQSEILQAHCNLTHC  266

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              N  + PQ A +V GV+ + V     G      YRR+KQKIG+T D S+ RLST QAKE 
Sbjct  267   SNSSKLPQAA-IVAGVITVTVTLMGAGFMIIFLYRRKKQKIGNTSDFSEGRLSTHQAKEF  325

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              R  ASPL++LEYSNGWDPL  +RNG    S E L +F FNL+E
Sbjct  326   HRAGASPLVSLEYSNGWDPLGDSRNG-IEISGEHLNNFRFNLEE  368



>ref|XP_002510917.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
 gb|EEF51519.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
Length=603

 Score =   350 bits (898),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 240/312 (77%), Gaps = 12/312 (4%)
 Frame = +2

Query  107   LSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLS  286
             L GLYLH+N L+G +P+E+ANLT L DLYLNVN+LSG IPPE+  + +LQVLQLCYN+ +
Sbjct  16    LKGLYLHYNSLYGEIPKELANLTELSDLYLNVNNLSGEIPPEVGKMENLQVLQLCYNQFT  75

Query  287   GNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNHLFGSIPAKLANAQK  466
             G+IP  +GSLK LTVL+LQSN LTGAIPA+LGDL +L RLDLSFNH FGSIP KLA+A  
Sbjct  76    GSIPTHIGSLKKLTVLSLQSNQLTGAIPASLGDLGMLMRLDLSFNHFFGSIPTKLADAPV  135

Query  467   LEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFG  643
             LE+LD+RNN+LSGNVPLALKRLNEGF Y NN GLCG GF  L  C  S  LNPS+PEPFG
Sbjct  136   LEVLDVRNNSLSGNVPLALKRLNEGFLYGNNLGLCGAGFRHLNACNVSDRLNPSRPEPFG  195

Query  644   PGSNHLPTKDIPESANVQ-----PHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWY  808
             PGS  LPT++IPE+AN++      H  +  +  Q A VVVG + L +AF   G+ TF+ Y
Sbjct  196   PGSTGLPTREIPETANLRLACNHTHCSSSSKSHQ-ASVVVGTIILTIAFIVIGILTFTQY  254

Query  809   RRRKQKIGSTIDSSDSRLSTDQAKEVSRRSASPLINLEYSNGWDPLAKAR--NGNAAFSQ  982
             RRRKQ++GS+++ SD+ +S DQAK V R++ SPLI+LEYSNGWDPLA  R  +GN    Q
Sbjct  255   RRRKQRLGSSLEVSDNHVSIDQAKGVYRKNGSPLISLEYSNGWDPLADGRSFSGN---EQ  311

Query  983   EVLESFMFNLDE  1018
             +V +SF FNLDE
Sbjct  312   DVFQSFRFNLDE  323


 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  71   GKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNITS  250
            G IP  I  +K L+ L L  N L GA+P  + +L  L+ L L+ NH  GSIP ++++   
Sbjct  76   GSIPTHIGSLKKLTVLSLQSNQLTGAIPASLGDLGMLMRLDLSFNHFFGSIPTKLADAPV  135

Query  251  LQVLQLCYNKLSGNIPNQLGSL  316
            L+VL +  N LSGN+P  L  L
Sbjct  136  LEVLDVRNNSLSGNVPLALKRL  157



>dbj|BAD68873.1| putative somatic embryogenesis protein kinase 1 [Oryza sativa 
Japonica Group]
Length=647

 Score =   350 bits (899),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 201/347 (58%), Positives = 254/347 (73%), Gaps = 12/347 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ C+  G+V  ISLQG+GL G +PP IA ++ L+GLYLH+N + GA+PREI +L+ L
Sbjct  28    FVGVTCDSGGRVTAISLQGRGLSGTLPPAIAGLRRLTGLYLHYNGIKGAIPREIGSLSEL  87

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VNHL+G +P EI+ + +LQVLQL YN+L+G+IP QLG L  L VLALQSN LTG
Sbjct  88    TDLYLDVNHLTGPLPVEIAAMENLQVLQLGYNQLTGSIPPQLGKLNKLAVLALQSNQLTG  147

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPATLGDLT L RLDLSFN LFGSIP+K+A    LE+ D+RNN+LSG+VP  L+RLN G
Sbjct  148   AIPATLGDLTQLARLDLSFNSLFGSIPSKIAEVPLLEVFDVRNNSLSGSVPAGLRRLNGG  207

Query  542   FQYTNNPGLCGIGFSSLKLC--TDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA---  706
             FQY NN GLCG+GFS L LC  ++  L PSKPEPFGP    + T+ +P+SAN   H    
Sbjct  208   FQYVNNKGLCGVGFSLLDLCLSSEDGLKPSKPEPFGP-DGTVKTRQVPQSANTDNHCEGS  266

Query  707   -LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD--QA  877
               +K       V+VVGV+ +++     G+F FS+YRR+KQKIGS+++ SDSRLSTD  Q 
Sbjct  267   GCSKSSNASVGVLVVGVVAVVIGAAFCGIFAFSYYRRQKQKIGSSLEVSDSRLSTDHYQQ  326

Query  878   KEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             KEV RRSASPLI++EYSNGWDPL+         S EV +SF FNL+E
Sbjct  327   KEVCRRSASPLISVEYSNGWDPLSGG---GVGSSGEVGDSFRFNLEE  370



>ref|XP_010518150.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 isoform X1 [Camelina sativa]
 ref|XP_010518151.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 isoform X2 [Camelina sativa]
Length=690

 Score =   351 bits (901),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 204/353 (58%), Positives = 255/353 (72%), Gaps = 16/353 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+   +V NISLQG GL G IPP I  + +L+GLYLHFN L G +P+ I+NL  L
Sbjct  58    FDGVACDGNHRVANISLQGMGLTGTIPPSIGLLTSLTGLYLHFNSLTGQIPKAISNLPLL  117

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP+I N+ +LQV+QLCYNKLSG+IP QLGSLK +TVLALQ N L+G
Sbjct  118   TDLYLNVNNLSGEIPPQIGNLDNLQVVQLCYNKLSGSIPTQLGSLKKVTVLALQYNQLSG  177

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGD+  LTRLDLSFNHLFG +P KLA A  LE+LDIRNN+ SG VP ALKRLN G
Sbjct  178   AIPASLGDINTLTRLDLSFNHLFGPVPVKLAGAPLLEVLDIRNNSFSGFVPSALKRLNNG  237

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDI-PESANVQPHALNK  715
             FQY+NN GLCG GF+ LK CT  +  N  +P+P  P   +  T D+ PESA++Q    + 
Sbjct  238   FQYSNNHGLCGDGFTDLKACTGLNGPNLDRPDPTNP--KNFTTVDVKPESADLQRSNCSN  295

Query  716   -----PRKPQTAvvvvgvlglivAFFATGLF---TFSWYRRRKQKIGSTIDSSDSRLSTD  871
                    K   +     V+GL  +  A  +F   TF+WYRRRKQKIGS++D+ D R+ST+
Sbjct  296   NNGGCSSKTSKSSPFGIVMGLTGSILAVAIFGGSTFTWYRRRKQKIGSSLDAMDGRISTE  355

Query  872   -QAKEVSRR-SASPLINLEYSNGWDPLAKARNG--NAAFSQEVLESFMFNLDE  1018
                KE SRR S+SPLI+LEY++GWDPL + +N   N+A SQEV ESFMFNL+E
Sbjct  356   YNFKEASRRKSSSPLISLEYASGWDPLGRGQNSNNNSALSQEVFESFMFNLEE  408



>ref|NP_001056717.1| Os06g0134700 [Oryza sativa Japonica Group]
 dbj|BAF18631.1| Os06g0134700, partial [Oryza sativa Japonica Group]
Length=672

 Score =   350 bits (899),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 201/347 (58%), Positives = 254/347 (73%), Gaps = 12/347 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ C+  G+V  ISLQG+GL G +PP IA ++ L+GLYLH+N + GA+PREI +L+ L
Sbjct  53    FVGVTCDSGGRVTAISLQGRGLSGTLPPAIAGLRRLTGLYLHYNGIKGAIPREIGSLSEL  112

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VNHL+G +P EI+ + +LQVLQL YN+L+G+IP QLG L  L VLALQSN LTG
Sbjct  113   TDLYLDVNHLTGPLPVEIAAMENLQVLQLGYNQLTGSIPPQLGKLNKLAVLALQSNQLTG  172

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPATLGDLT L RLDLSFN LFGSIP+K+A    LE+ D+RNN+LSG+VP  L+RLN G
Sbjct  173   AIPATLGDLTQLARLDLSFNSLFGSIPSKIAEVPLLEVFDVRNNSLSGSVPAGLRRLNGG  232

Query  542   FQYTNNPGLCGIGFSSLKLC--TDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA---  706
             FQY NN GLCG+GFS L LC  ++  L PSKPEPFGP    + T+ +P+SAN   H    
Sbjct  233   FQYVNNKGLCGVGFSLLDLCLSSEDGLKPSKPEPFGP-DGTVKTRQVPQSANTDNHCEGS  291

Query  707   -LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD--QA  877
               +K       V+VVGV+ +++     G+F FS+YRR+KQKIGS+++ SDSRLSTD  Q 
Sbjct  292   GCSKSSNASVGVLVVGVVAVVIGAAFCGIFAFSYYRRQKQKIGSSLEVSDSRLSTDHYQQ  351

Query  878   KEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             KEV RRSASPLI++EYSNGWDPL+         S EV +SF FNL+E
Sbjct  352   KEVCRRSASPLISVEYSNGWDPLSGG---GVGSSGEVGDSFRFNLEE  395



>gb|EAY99548.1| hypothetical protein OsI_21521 [Oryza sativa Indica Group]
 gb|EAZ35739.1| hypothetical protein OsJ_20030 [Oryza sativa Japonica Group]
Length=678

 Score =   350 bits (899),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 201/347 (58%), Positives = 254/347 (73%), Gaps = 12/347 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ C+  G+V  ISLQG+GL G +PP IA ++ L+GLYLH+N + GA+PREI +L+ L
Sbjct  59    FVGVTCDSGGRVTAISLQGRGLSGTLPPAIAGLRRLTGLYLHYNGIKGAIPREIGSLSEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VNHL+G +P EI+ + +LQVLQL YN+L+G+IP QLG L  L VLALQSN LTG
Sbjct  119   TDLYLDVNHLTGPLPVEIAAMENLQVLQLGYNQLTGSIPPQLGKLNKLAVLALQSNQLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPATLGDLT L RLDLSFN LFGSIP+K+A    LE+ D+RNN+LSG+VP  L+RLN G
Sbjct  179   AIPATLGDLTQLARLDLSFNSLFGSIPSKIAEVPLLEVFDVRNNSLSGSVPAGLRRLNGG  238

Query  542   FQYTNNPGLCGIGFSSLKLC--TDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA---  706
             FQY NN GLCG+GFS L LC  ++  L PSKPEPFGP    + T+ +P+SAN   H    
Sbjct  239   FQYVNNKGLCGVGFSLLDLCLSSEDGLKPSKPEPFGP-DGTVKTRQVPQSANTDNHCEGS  297

Query  707   -LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD--QA  877
               +K       V+VVGV+ +++     G+F FS+YRR+KQKIGS+++ SDSRLSTD  Q 
Sbjct  298   GCSKSSNASVGVLVVGVVAVVIGAAFCGIFAFSYYRRQKQKIGSSLEVSDSRLSTDHYQQ  357

Query  878   KEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             KEV RRSASPLI++EYSNGWDPL+         S EV +SF FNL+E
Sbjct  358   KEVCRRSASPLISVEYSNGWDPLSGG---GVGSSGEVGDSFRFNLEE  401



>ref|XP_003622193.1| Receptor-like protein kinase [Medicago truncatula]
Length=656

 Score =   348 bits (894),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 201/346 (58%), Positives = 249/346 (72%), Gaps = 10/346 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+ACNE G V NISLQGKGL G+IP  I ++K+L+GLYLHFN L+G +P+EIA LT L
Sbjct  53    FDGVACNEQGLVTNISLQGKGLSGEIPSVIGKLKSLTGLYLHFNALNGILPKEIAGLTQL  112

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP EI N+++LQVLQLC+N+L+G+IP +LG LK L+VLALQ NHL+G
Sbjct  113   SDLYLNVNNLSGFIPHEIGNMSNLQVLQLCHNELNGSIPTELGKLKRLSVLALQYNHLSG  172

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLA---LKRL  532
             AIPA+LG+L  L RLDLSFN L G IP  LANA KLE LDIRNN+LSG+VP     LKRL
Sbjct  173   AIPASLGELETLERLDLSFNTLLGPIPVTLANAPKLETLDIRNNSLSGSVPTGNKNLKRL  232

Query  533   NEGFQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGP---GSNHLPTKDIPESANVQP  700
              EGFQY NN GLCG GF+ L  C   S  +P +PEP+ P    +   PT   P S N   
Sbjct  233   KEGFQYFNNHGLCGTGFAHLDSCQIVSNSDPVRPEPYDPSNISTIEFPTTPEPTSKNCGN  292

Query  701   HALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
                 +     T  +V  V+G++     TGLF    +RR KQKIG+T++ SD+RLSTD+ K
Sbjct  293   SGCRRRSDSSTIGLVFAVIGVVSVSALTGLFLILRHRRLKQKIGNTVEISDNRLSTDKIK  352

Query  881   EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             EV R+ ASPLINLEYS+GWDPL+K      ++SQE L+SFMFNL+E
Sbjct  353   EVYRKKASPLINLEYSSGWDPLSKDL---GSYSQEFLQSFMFNLEE  395



>ref|NP_182059.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAB82629.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 gb|ACN59309.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC10541.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
Length=691

 Score =   349 bits (896),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 205/353 (58%), Positives = 259/353 (73%), Gaps = 16/353 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+   +V NISLQG GL G IPP I  + +L+GLYLHFN L G +P++I+NL  L
Sbjct  59    FDGVACDGNRRVANISLQGMGLTGTIPPSIGLLTSLTGLYLHFNSLTGHIPKDISNLPLL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP I N+ +LQV+QLCYNKLSG+IP Q GSLK +TVLALQ N L+G
Sbjct  119   TDLYLNVNNLSGEIPPLIGNLDNLQVIQLCYNKLSGSIPTQFGSLKKITVLALQYNQLSG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGD+  LTRLDLSFN+LFG +P KLA A  LE+LDIRNN+ SG VP ALKRLN G
Sbjct  179   AIPASLGDIDTLTRLDLSFNNLFGPVPVKLAGAPLLEVLDIRNNSFSGFVPSALKRLNNG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDI-PESANVQPHALNK  715
             FQY+NN GLCG GF+ LK CT  +  NP++P+P  P   +  T D+ PESA++Q    + 
Sbjct  239   FQYSNNHGLCGDGFTDLKACTGLNGPNPNRPDPTNP--TNFTTVDVKPESADLQRSNCSN  296

Query  716   -----PRKPQTAvvvvgvlglivAFFATGLF---TFSWYRRRKQKIGSTIDSSDSRLSTD  871
                    K   +  +  V+GLI +  A  +F   TF+WYRRRKQKIGS++D+ D R+ST+
Sbjct  297   NNGGCSSKSLKSSPLGIVMGLIGSILAVAIFGGSTFTWYRRRKQKIGSSLDAMDGRISTE  356

Query  872   -QAKEVSRR-SASPLINLEYSNGWDPLAKAR--NGNAAFSQEVLESFMFNLDE  1018
                KEVSRR S+SPLI+LEY++GWDPL + +  N N+A SQEV ESFMFNL+E
Sbjct  357   YNFKEVSRRKSSSPLISLEYASGWDPLGRGQSSNNNSALSQEVFESFMFNLEE  409



>ref|XP_009142330.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Brassica rapa]
Length=693

 Score =   349 bits (895),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 205/354 (58%), Positives = 258/354 (73%), Gaps = 16/354 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+   +V NISLQG GL G IPP I  + +L+GLYLHFN L G +P++I+NL  L
Sbjct  59    FDGVACDGNRRVANISLQGMGLTGTIPPSIGLLTSLTGLYLHFNSLTGQIPKDISNLPLL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP+I N+ +LQVLQLCYNKLSG+IP QLGSLK +TVLALQ N L+G
Sbjct  119   TDLYLNVNNLSGEIPPQIGNLDNLQVLQLCYNKLSGSIPTQLGSLKKITVLALQYNQLSG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             A+PA+LGD+  LTRLDLSFN LFG +P KLA A  L++LDIRNN+ SG VP ALKRLN G
Sbjct  179   AVPASLGDVGTLTRLDLSFNDLFGPVPVKLAAAPSLQVLDIRNNSFSGFVPSALKRLNNG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDI-PESANVQPHALNK  715
             FQY+NN GLCG GF+ LK CT S + N ++P+P  P S  + T D+ PESA VQ      
Sbjct  239   FQYSNNHGLCGDGFTDLKPCTGSNVPNLNRPDPTNPKS-FITTNDVKPESAVVQRSNCTN  297

Query  716   ------PRKPQTAvvvvgvlglivAFFATGLF---TFSWYRRRKQKIGSTIDSSDSRLST  868
                     K   +  +  V+GL+ +  A  +F   TF+WYRRRKQ+IGS++D+ D R+ST
Sbjct  298   NNNGACSSKASKSSSLGIVMGLLGSILAVAVFGGSTFTWYRRRKQRIGSSLDAIDGRVST  357

Query  869   D-QAKEVSRR-SASPLINLEYSNGWDPLAKARNG--NAAFSQEVLESFMFNLDE  1018
             +   KE SRR S+SPLI+LEY+NGWDPL + +N   N+A SQEV ESFMFNL+E
Sbjct  358   EYNFKEASRRKSSSPLISLEYANGWDPLGRGQNSGNNSALSQEVFESFMFNLEE  411



>ref|XP_011042292.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Populus euphratica]
Length=682

 Score =   348 bits (894),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 199/345 (58%), Positives = 248/345 (72%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE GQV NISLQGKGL G I P +A++K+LSGLYLH+N L G +P+EI NL  L
Sbjct  60    FEGVACNEHGQVANISLQGKGLSGTISPAVAELKSLSGLYLHYNSLSGEIPKEIVNLAGL  119

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSGSIPPEI ++ SLQVL+LC N+L+G IP ++GSLK L+VLALQ N L+G
Sbjct  120   SDLYLNVNNLSGSIPPEIGSMASLQVLELCCNQLAGYIPTEMGSLKKLSVLALQYNRLSG  179

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IPA+LG L +L RLD+SFN+L G+IP  +AN  +LE+LD+RNN+LSG VP  LKRLN G
Sbjct  180   QIPASLGTLGMLKRLDMSFNYLSGTIPQGIANIPRLEVLDVRNNSLSGTVPFPLKRLNGG  239

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDIPESANVQPH-----  703
             FQ+ NN GLCG GF  L+ C+    +N ++     P +N+   K IP+SA +Q H     
Sbjct  240   FQFENNEGLCGTGFPLLRACSAFDNMNINQVGSLEPIANNSARKVIPQSAILQAHCNQTL  299

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
               N  + PQ A +V GV+ +I+   A G      YRR+KQKIG+T DSSD RLSTDQAKE
Sbjct  300   CSNSSKLPQAA-IVAGVIIVIITLMAAGFLIIFCYRRKKQKIGNTSDSSDGRLSTDQAKE  358

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               R  ASPL +LEYSNGWDPL  +RNG   FS E L +F FNL+E
Sbjct  359   FHRAGASPLASLEYSNGWDPLGDSRNG-IEFSVEHLNNFRFNLEE  402



>ref|XP_002880173.1| hypothetical protein ARALYDRAFT_346338 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56432.1| hypothetical protein ARALYDRAFT_346338 [Arabidopsis lyrata subsp. 
lyrata]
Length=692

 Score =   348 bits (894),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 202/353 (57%), Positives = 260/353 (74%), Gaps = 16/353 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+   +V NISLQG GL G IPP I  + +L+GLYLHFN L G +P++I+NL  L
Sbjct  60    FDGVACDGNRRVANISLQGMGLTGTIPPSIGLLTSLTGLYLHFNSLTGHIPKDISNLPLL  119

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP+I N+ +LQV+QLCYNKLSG+IP QLGSL+ +TVLALQ N L+G
Sbjct  120   TDLYLNVNNLSGEIPPQIGNLDNLQVIQLCYNKLSGSIPTQLGSLQKITVLALQYNQLSG  179

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGD++ LTRLDLSFN+LFG +P KLA A  LE+LDIRNN+ SG VP ALKRLN G
Sbjct  180   AIPASLGDISTLTRLDLSFNNLFGPVPVKLAGAPLLEVLDIRNNSFSGFVPSALKRLNNG  239

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDI-PESANVQPHALNK  715
             FQY+NN GLCG GF+ L  CT  +  N ++P+P  P   +  T D+ PESA++Q    + 
Sbjct  240   FQYSNNHGLCGDGFTDLNACTGLNGPNLNRPDPTNP--TNFTTVDVKPESADLQRSNCSN  297

Query  716   -----PRKPQTAvvvvgvlglivAFFATGLF---TFSWYRRRKQKIGSTIDSSDSRLSTD  871
                    K   +  +  V+GL+ +  A  +F   TF+WYRRRKQKIGS++D+ D R+ST+
Sbjct  298   NNGGCSSKTSKSSPLGIVMGLMGSILAVAIFGGSTFTWYRRRKQKIGSSLDAMDGRISTE  357

Query  872   -QAKEVSRR-SASPLINLEYSNGWDPLAKAR--NGNAAFSQEVLESFMFNLDE  1018
                KEVSRR S+SPLI+LEY++GWDPL + +  N N+A SQEV ESFMFNL+E
Sbjct  358   YNFKEVSRRKSSSPLISLEYASGWDPLGRGQSSNNNSALSQEVFESFMFNLEE  410



>gb|KFK37319.1| hypothetical protein AALP_AA4G241600 [Arabis alpina]
Length=694

 Score =   348 bits (893),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 206/357 (58%), Positives = 261/357 (73%), Gaps = 18/357 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+   +V NISLQG GL G IPP I  + +L+GLYLHFN L G +P++I+NL  L
Sbjct  56    FDGVACDGNHRVANISLQGMGLTGTIPPSIGLLTSLTGLYLHFNSLTGQIPKDISNLPLL  115

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP+I N+ +LQV+QLCYNKLSG+IP QLGSLK +TVLALQ N L+G
Sbjct  116   TDLYLNVNNLSGEIPPQIGNLENLQVVQLCYNKLSGSIPTQLGSLKKITVLALQYNQLSG  175

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGD+  LTRLDLSFNHLFG +P KLA A  LE+LDIRNN+ SG VP ALKRLN G
Sbjct  176   AIPASLGDIFTLTRLDLSFNHLFGPVPVKLAGAPLLEVLDIRNNSFSGFVPSALKRLNNG  235

Query  542   FQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFGPGSNHLPTK--DI-PESANVQ----  697
             FQY+NN GLCG  F+ LK CT S   N ++P+P  P S    T   D+ PESA++Q    
Sbjct  236   FQYSNNHGLCGEDFTDLKPCTGSNEPNLNRPDPTNPKSFTTTTDNNDVKPESADLQRSNC  295

Query  698   ------PHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSR  859
                       +K  K  +  +V+G++G I+A    G  TF+WYRRRKQ+IG+++D+ DSR
Sbjct  296   TSNNGGTKCSSKASKSTSFGIVIGLIGSILAIAIFGGSTFTWYRRRKQRIGTSLDTMDSR  355

Query  860   LSTD-QAKEVSRR-SASPLINLEYSNGWDPLAKARN--GNAAFSQEVLESFMFNLDE  1018
             +ST+   KE SRR S+SPLI+LEY++GWDPL + +N   N+A SQEV ESFMFNL+E
Sbjct  356   VSTEYNFKEASRRKSSSPLISLEYASGWDPLGRGQNNSNNSALSQEVFESFMFNLEE  412



>ref|XP_004964453.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Setaria italica]
Length=676

 Score =   348 bits (892),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 197/348 (57%), Positives = 252/348 (72%), Gaps = 15/348 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ C+  G+V  +SLQG+GL G +PP +A ++ L GLYLH+N + G +PREI  L+ L
Sbjct  59    FVGVTCDTAGRVTAVSLQGRGLSGSLPPAVAGLRRLQGLYLHYNGIKGPIPREIGKLSEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VNHL+G +P EI+++ +LQVLQL YN+L+G+IP QLG+L  LTVLA+QSN LTG
Sbjct  119   TDLYLDVNHLTGPVPVEIASMANLQVLQLGYNQLTGSIPPQLGNLNKLTVLAMQSNQLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPATLG+LT L RLDLSFN LFGSIP+K+A    LE+ DIRNNTLSG+VP+ L+R+N G
Sbjct  179   AIPATLGELTQLRRLDLSFNSLFGSIPSKIAEVPLLEVFDIRNNTLSGSVPVGLRRMNGG  238

Query  542   FQYTNNPGLCGIGFSSLKLC--TDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNK  715
             FQY NN GLCG+GFS L+LC  ++  L PSKPEPFGP    + T+++P+S N  P   + 
Sbjct  239   FQYMNNKGLCGVGFSLLELCPSSEDGLKPSKPEPFGP-DGTVKTREVPQSVN--PENCSG  295

Query  716   PRKPQTAvvvvgvlglivAFFA-----TGLFTFSWYRRRKQKIGSTIDSSDSRLSTD--Q  874
              R  ++A    GVL + V          GLF FSWYRR+KQKIGS+++ SDSRLSTD  Q
Sbjct  296   SRCSKSANGSEGVLIVAVVAVVIGAAFCGLFAFSWYRRQKQKIGSSLEVSDSRLSTDHFQ  355

Query  875   AKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              KE  RRSASPLI++EYSN WDPL+         S EV +SF FNL+E
Sbjct  356   QKEACRRSASPLISVEYSNSWDPLSGG---GVGSSGEVGDSFRFNLEE  400



>ref|XP_007210306.1| hypothetical protein PRUPE_ppa002356mg [Prunus persica]
 gb|EMJ11505.1| hypothetical protein PRUPE_ppa002356mg [Prunus persica]
Length=682

 Score =   348 bits (892),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 198/346 (57%), Positives = 246/346 (71%), Gaps = 9/346 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE  +V NISLQGKGLYG++ P +A++K LSGLYLH+N+L G +P+EI+ LT L
Sbjct  59    FEGVACNEHRKVANISLQGKGLYGEVSPAVAELKCLSGLYLHYNNLSGEIPKEISYLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP EI ++TSLQVLQLC N+L+GNIP Q+G LK L+VLALQ N LTG
Sbjct  119   NDLYLNVNNLSGGIPSEIGDMTSLQVLQLCCNQLTGNIPTQMGFLKRLSVLALQHNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IPA+LGDL +L RLDLSFN  FG+IPAKLA+   LE+LDI++N+LSG  PL LKRL E 
Sbjct  179   QIPASLGDLGMLKRLDLSFNKFFGTIPAKLASVPSLEVLDIQSNSLSGVAPLDLKRLKER  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPE--PFGPGSNHLPTKDIPESANV-----QP  700
             FQ  NNP LCG+GFS+L+ CT   ++    +  P GP     P K  P+ A+      Q 
Sbjct  239   FQCKNNPHLCGVGFSTLRACTAFDMDKVNVDGLPLGPNITDSPPKANPKPADFKAPCSQT  298

Query  701   HALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
             H     + PQ A VV GV+ L V   A        YRR KQK+ +T D SD RLSTDQAK
Sbjct  299   HCTKSTKLPQAA-VVAGVISLSVTLAAAVFLALIRYRRHKQKVSNTSDPSDGRLSTDQAK  357

Query  881   EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             +  R++ASPL++LEYSNGWDPLA  RNG  AFSQE L  + FN+++
Sbjct  358   DFYRKTASPLVSLEYSNGWDPLADGRNG-IAFSQEYLSKYWFNMED  402



>emb|CDY57103.1| BnaC04g56910D [Brassica napus]
Length=695

 Score =   348 bits (893),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 206/355 (58%), Positives = 261/355 (74%), Gaps = 17/355 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+   +V NISLQG GL G IPP I  + +L+GLYLHFN L G +P++I+NL  L
Sbjct  59    FDGVACDGNRRVANISLQGMGLTGTIPPSIGLLTSLTGLYLHFNSLTGQIPKDISNLPLL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP+I N+ +LQVLQLCYNKLSG+IP QLGSLK +TVLALQ N L+G
Sbjct  119   TDLYLNVNNLSGEIPPQIGNLDNLQVLQLCYNKLSGSIPTQLGSLKKITVLALQYNQLSG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             A+PA+LGD+  LTRLDLSFN+LFG +P KLA A  L++LDIRNN+ SG VP ALKRLN G
Sbjct  179   AVPASLGDVGTLTRLDLSFNNLFGPVPVKLAAAPSLQVLDIRNNSFSGFVPSALKRLNSG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDI-PESANVQPHALNK  715
             FQY+NN GLCG GF+ LK CT S + N ++P+P  P S  + T D+ PESA VQ    + 
Sbjct  239   FQYSNNLGLCGDGFTDLKACTGSNVPNLNRPDPTNPKS-FITTNDVKPESAVVQRSNCSN  297

Query  716   ------PRKPQTAvvvvgvlglivAFFATGLF---TFSWYRRRKQKIGSTIDSS-DSRLS  865
                     K   +  +  V+GLI +  A  +F   TF+WYRRRKQ+IGS++D++ D R+S
Sbjct  298   NNNGACSSKTSKSSSLGIVMGLIGSILAVAIFGGSTFTWYRRRKQRIGSSLDATMDGRVS  357

Query  866   TD-QAKEVSRR-SASPLINLEYSNGWDPLAKARNG--NAAFSQEVLESFMFNLDE  1018
             T+   KE SRR S+SPLI+LEY+NGWDPL + +N   N+A SQEV ESFMFNL+E
Sbjct  358   TEYNFKEASRRKSSSPLISLEYANGWDPLGRGQNSGNNSALSQEVFESFMFNLEE  412



>gb|EYU24995.1| hypothetical protein MIMGU_mgv1a002428mg [Erythranthe guttata]
Length=521

 Score =   342 bits (878),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 198/349 (57%), Positives = 249/349 (71%), Gaps = 14/349 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE  QV NISLQGKGL GK+ P +  +K L+GLYLH+N L+G +P EIA+LT L
Sbjct  56    FEGVACNEKRQVANISLQGKGLAGKLSPAVGGLKHLTGLYLHYNSLYGEIPLEIADLTEL  115

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP + ++ +LQVLQLCYN L+G+IP QL SL  L VLA+QSN LTG
Sbjct  116   SDLYLNVNNLSGEIPPALEHMQNLQVLQLCYNHLTGSIPTQLASLTKLNVLAIQSNQLTG  175

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLSFN LFGSIP KLA+A  LE+LD+RNNTLSGNVPLALKRL +G
Sbjct  176   AIPASLGDLPVLMRLDLSFNRLFGSIPTKLADAPLLEVLDVRNNTLSGNVPLALKRLVDG  235

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQ------PH  703
             F Y NNP LCG GFSSL+ C     N  +PEP+  GS    TK+IPE+A++         
Sbjct  236   FHYENNPELCGSGFSSLQTC---GPNSERPEPYSGGSMGSTTKNIPETADLNLNCSQSSC  292

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGS-TIDSSDSRLSTDQA-  877
             +    +  Q +V V  ++  ++  FA  + TFS YRRRKQK+GS   D+S+SRLSTD   
Sbjct  293   SNKSSKTSQASVAVGIIVITVMVSFA-AILTFSIYRRRKQKLGSAAFDASESRLSTDNHV  351

Query  878   --KEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               +  +R++ SPL++LEYSNGWDPL+  R      S EV+++F  NL E
Sbjct  352   NNETYNRKNGSPLVSLEYSNGWDPLSDDRRFLGFVSHEVVKNFRLNLQE  400



>ref|XP_006293447.1| hypothetical protein CARUB_v10022725mg [Capsella rubella]
 gb|EOA26345.1| hypothetical protein CARUB_v10022725mg [Capsella rubella]
Length=723

 Score =   348 bits (893),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 203/353 (58%), Positives = 256/353 (73%), Gaps = 16/353 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+   +V NISLQG GL G IPP I  + +L+GLYLHFN L G +P+ I+NL  L
Sbjct  91    FDGVACDGNHRVANISLQGMGLTGTIPPSIGLLTSLTGLYLHFNSLTGQIPKAISNLPLL  150

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP+I N+ +LQV+QLCYNKLSG+IP QLGSLK +TVLALQ N L+G
Sbjct  151   ADLYLNVNNLSGEIPPQIGNLDNLQVVQLCYNKLSGSIPTQLGSLKKVTVLALQYNQLSG  210

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG++  LTRLDLSFN+LFG +P KLA A  LE+LDIRNN+ SG VP ALKRLN G
Sbjct  211   AIPASLGNINTLTRLDLSFNNLFGPVPVKLAGAPLLEVLDIRNNSFSGFVPSALKRLNNG  270

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDI-PESANVQPHALNK  715
             FQY+NN GLCG GF+ LK CT  +  N  +P+P  P   +  T D+ PESA++Q    + 
Sbjct  271   FQYSNNHGLCGDGFTDLKACTGLNGPNLDRPDPTNP--KNFTTVDVKPESADLQRSNCSN  328

Query  716   -----PRKPQTAvvvvgvlglivAFFATGLF---TFSWYRRRKQKIGSTIDSSDSRLSTD  871
                    K   +     V+GLI +  A  +F   TF+WYRRRKQKIGS++D+ D R+ST+
Sbjct  329   NNGGCSSKTSKSSPFGIVMGLIGSILAVAIFGGSTFTWYRRRKQKIGSSLDAMDGRISTE  388

Query  872   -QAKEVSRR-SASPLINLEYSNGWDPLAKARNG--NAAFSQEVLESFMFNLDE  1018
                KE SRR S+SPLI+LEY++GWDPL + +N   N+A SQEV ESFMFNL+E
Sbjct  389   YNFKEASRRKSSSPLISLEYASGWDPLGRGQNSNNNSALSQEVFESFMFNLEE  441



>ref|XP_003561214.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Brachypodium 
distachyon]
Length=674

 Score =   347 bits (889),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 202/345 (59%), Positives = 247/345 (72%), Gaps = 13/345 (4%)
 Frame = +2

Query  2     FEGIACNEL--GQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLT  175
             F G+ C+    G+V  +SLQG+GL G +PP IA ++ L GLYLH+N + GA+PREI  L+
Sbjct  62    FVGVTCDRGAGGRVTGVSLQGRGLSGTLPPAIAGLRRLKGLYLHYNGIKGAIPREIGKLS  121

Query  176   HLLDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHL  355
              L DLYL+VNHLSG +P EI+ + +LQVLQL YN+L+G+IP QLG+L  L VLALQSN L
Sbjct  122   ELADLYLDVNHLSGPVPVEIAAMGNLQVLQLGYNQLTGSIPPQLGNLNKLAVLALQSNQL  181

Query  356   TGAIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLN  535
             TGAIPATLGDLT LTRLDLSFN LFGSIP+K+A A  LE+ D+RNNTLSG+VP  LKRLN
Sbjct  182   TGAIPATLGDLTRLTRLDLSFNRLFGSIPSKIAEAPLLEVFDVRNNTLSGSVPAGLKRLN  241

Query  536   EGFQYTNNPGLCGIGFSSLKLCTDS--ALNPSKPEPFGPGSNHLPTKDIPESANVQPHAL  709
              GFQY NN  LCG+ FS L LCT S   LNPSKPEPFGP    +    +P+S N  P   
Sbjct  242   GGFQYVNNRELCGVDFSLLDLCTSSENGLNPSKPEPFGP-DGTIKRGQVPQSVN--PDTT  298

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD--QAKE  883
                +     ++V  V  +I A F  G+F FS+YRR+KQKIGS+++ SDSRLSTD  Q KE
Sbjct  299   RSSKASSGVLIVGIVAVVIGAAFC-GIFAFSYYRRQKQKIGSSLEVSDSRLSTDHYQQKE  357

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               RRSASPLI++EYSNGWDPL+         S EV +SF FNL+E
Sbjct  358   ACRRSASPLISIEYSNGWDPLSSG---GCGSSGEVGDSFRFNLEE  399



>ref|XP_010512840.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Camelina sativa]
Length=835

 Score =   350 bits (898),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 207/356 (58%), Positives = 258/356 (72%), Gaps = 21/356 (6%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+   +V NISLQG GL G IPP I  + +L+GLYLHFN L G +P+ I+NL  L
Sbjct  59    FDGVACDGNHRVANISLQGMGLTGTIPPSIGFLTSLTGLYLHFNSLTGQIPKAISNLPLL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP+I N+ +LQV+QLCYNKLSG+IP QLGSLK +TVLALQ N L+G
Sbjct  119   TDLYLNVNNLSGEIPPQIGNLDNLQVVQLCYNKLSGSIPTQLGSLKKVTVLALQYNQLSG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGD+  LTRLDLSFNHLFG +P KLA A  LE+LDIRNN+ SG VP ALKRLN G
Sbjct  179   AIPASLGDINTLTRLDLSFNHLFGPVPVKLAGAPLLEVLDIRNNSFSGFVPSALKRLNNG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNP---SKPEPFGPGSNHLPTKDI-PESANVQ----  697
             FQY+NN GLCG GF+ LK CT  ALN     +P+P  P   +L T D+ PESA++Q    
Sbjct  239   FQYSNNHGLCGEGFTDLKACT--ALNGPNLDRPDPTNP--KNLTTVDVKPESADLQRSNC  294

Query  698   --PHALNKPRKPQTAvvvvgvlglivAFFATGLF---TFSWYRRRKQKIGSTIDSSDSRL  862
                +      K   +     V+GLI +  A  +F   TF+WYRRRKQKIG+++D+ D R+
Sbjct  295   SNNNNGGCSSKASKSSPFGIVMGLIGSILAVAIFGGSTFTWYRRRKQKIGNSLDAMDGRI  354

Query  863   STD-QAKEVSRR-SASPLINLEYSNGWDPLAKARNG--NAAFSQEVLESFMFNLDE  1018
             ST+   KE SRR S+SPLI+LEY++GWDPL + +N   N+A SQEV ESFMFNL+E
Sbjct  355   STEYNFKEASRRKSSSPLISLEYASGWDPLGRGQNSNNNSALSQEVFESFMFNLEE  410



>ref|XP_006655759.1| PREDICTED: somatic embryogenesis receptor kinase 4-like [Oryza 
brachyantha]
Length=646

 Score =   345 bits (884),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 200/346 (58%), Positives = 255/346 (74%), Gaps = 11/346 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ C+  G V  ISLQG+GL G +PP I+ ++ L+GLYLH+N + G++PREI +L+ L
Sbjct  28    FVGVTCDRGGHVTAISLQGRGLSGTLPPAISGLRRLAGLYLHYNGIKGSIPREIGSLSEL  87

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VNHLSG +P EI+ + +LQVLQL YN+L+G+IP QLG L NL VLALQSN LTG
Sbjct  88    TDLYLDVNHLSGPVPVEIAAMANLQVLQLGYNQLTGSIPPQLGKLNNLAVLALQSNQLTG  147

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPATLGDL LLTRLDLSFN LFGSIP+K+A    LE+ D+RNN+LSG+VP  L RLN G
Sbjct  148   AIPATLGDLALLTRLDLSFNSLFGSIPSKIAEVPLLEVFDVRNNSLSGSVPAGLGRLNGG  207

Query  542   FQYTNNPGLCGIGFSSLKLC--TDSALNPSKPEPFGPGSNHLPTKDIPESAN---VQPHA  706
             FQY NN GLCG+GFS L LC  ++  L PSKPEPFGP    + T+++P+SAN    +   
Sbjct  208   FQYVNNKGLCGVGFSLLDLCLSSEDGLKPSKPEPFGP-DGTVKTREVPQSANTDHCEGSR  266

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD--QAK  880
              ++     T V++VGV+ +++     G F FS+YRR+KQKIGS+++ SDSRLSTD  Q K
Sbjct  267   CSRSSNSSTGVLIVGVVAVVIGAAFCGTFAFSYYRRQKQKIGSSLEVSDSRLSTDHYQQK  326

Query  881   EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             EV RRSASPLI++EYSNGWDPL+         S EV +SF FNL+E
Sbjct  327   EVCRRSASPLISVEYSNGWDPLSSG---GVGSSGEVGDSFRFNLEE  369



>ref|XP_004300723.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930-like [Fragaria vesca subsp. vesca]
Length=687

 Score =   345 bits (885),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 193/351 (55%), Positives = 246/351 (70%), Gaps = 14/351 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE  +V N+SLQGKGL G++ P +A+++ LSGLYLH+N+L G +P+EI  LT L
Sbjct  59    FEGVACNEHSKVANVSLQGKGLSGQVSPAVAELRCLSGLYLHYNNLSGEIPKEIGALTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN LSG IP EI N+TSLQVLQLC N+L+G+IP Q+GSL  L+VLALQ N +TG
Sbjct  119   TDLYLNVNSLSGGIPHEIGNMTSLQVLQLCCNQLNGSIPTQMGSLTRLSVLALQYNRITG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IPA+LG+L +L RLDL FN  FG+IPAKLA+   LE+LD+RNN+LSG V  A KRLNEG
Sbjct  179   QIPASLGNLGMLKRLDLGFNKFFGTIPAKLASIPSLEVLDVRNNSLSGVVSPAFKRLNEG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPE--PFGPGSN----HLPTKDIPESANVQPH  703
             F+  NNPGLCG+GFS+L+ CT   ++    +  P GP  N      P K  PES ++  H
Sbjct  239   FESANNPGLCGVGFSTLRACTAFDMDRVNVDGLPLGPNLNGTASTAPPKANPESVDINAH  298

Query  704   ALNKPRK----PQTAvvvvgvlglivAFFATGLF-TFSWYRRRKQKIGSTIDSSDSRLST  868
                   K    PQ AV+   +   I    + G+F    W RR+KQKIG+T D SD +LST
Sbjct  299   CKQNCTKSTKFPQAAVIAGVISLTIT--LSVGVFLALVWNRRKKQKIGNTSDPSDGQLST  356

Query  869   DQAKEVSRRSASPLINLEYSNGWDPLAKARNG-NAAFSQEVLESFMFNLDE  1018
             DQAKE  RRS SPL++LEYSN WDPLA  +NG   +FSQE L+ + FN+++
Sbjct  357   DQAKEFYRRSPSPLVSLEYSNAWDPLADGQNGLGFSFSQEYLKGYWFNMED  407



>ref|XP_009143131.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Brassica rapa]
Length=690

 Score =   345 bits (885),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 201/352 (57%), Positives = 252/352 (72%), Gaps = 13/352 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+   +V NISLQG GL G IPP I  + +L+GLYLHFN L G +P++I+NL  L
Sbjct  60    FDGVACDGNRRVANISLQGMGLTGTIPPSIGLLTSLTGLYLHFNSLTGQIPKDISNLPFL  119

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP+I ++ +LQVLQLCYNKLSG+IP QLGSL  +TVLALQ N L+G
Sbjct  120   ADLYLNVNNLSGEIPPQIGDLDNLQVLQLCYNKLSGSIPTQLGSLNKITVLALQYNQLSG  179

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGD+  LTRLDLSFN LFG +P KLA A  LE+LDIRNN+ SG VP  LKRLN G
Sbjct  180   AIPASLGDIRTLTRLDLSFNDLFGPVPVKLAGAPLLEVLDIRNNSFSGFVPSGLKRLNNG  239

Query  542   FQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNK-  715
             F YTNN GLCG GF+ LK CT S   N ++P+P  P +        PESA++Q    +  
Sbjct  240   FHYTNNHGLCGDGFTDLKPCTGSNEPNLNRPDPTNPKTFRTTDDVKPESADLQRSNCSNN  299

Query  716   ----PRKPQTAvvvvgvlglivAFFATGLF---TFSWYRRRKQKIGSTIDSSDSRLSTD-  871
                   K   +  +  V+GLI +  A  +F   TF+WYRRRKQ+IGS++D+ DSR+ST+ 
Sbjct  300   NGGCSSKASKSAPLGVVMGLIGSLLAVAVFAGSTFTWYRRRKQRIGSSLDAMDSRVSTEY  359

Query  872   QAKEVSRR-SASPLINLEYSNGWDPLAKARNG--NAAFSQEVLESFMFNLDE  1018
               KE SRR S+SPLI+LEYS GWDPL + +N   N+A SQEV +SFMFNL+E
Sbjct  360   NFKEPSRRKSSSPLISLEYSRGWDPLGRGQNSNNNSALSQEVFDSFMFNLEE  411



>ref|XP_010506476.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Camelina sativa]
Length=690

 Score =   345 bits (885),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 203/353 (58%), Positives = 256/353 (73%), Gaps = 16/353 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+   +V NISLQG GL G IPP I  + +L+GLYLHFN L G +P+ I+NL  L
Sbjct  58    FDGVACDGNHRVANISLQGMGLTGTIPPSIGLLTSLTGLYLHFNSLTGQIPKAISNLPLL  117

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP++ N+ +LQV+QLCYNKLSG+IP QLGSLK +TVLALQ N L+G
Sbjct  118   TDLYLNVNNLSGEIPPQVGNLDNLQVVQLCYNKLSGSIPTQLGSLKKVTVLALQYNQLSG  177

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGD+  LTRLDLSFNHLFG +P KLA A  LE+L+IRNN+ SG VP ALKRLN G
Sbjct  178   AIPASLGDINTLTRLDLSFNHLFGPVPVKLAGAPLLEVLNIRNNSFSGFVPSALKRLNNG  237

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDI-PESANVQPHALNK  715
             FQY+NN GLCG GF+ LK CT  +  N  +P+P  P   +  T D+ PESA++Q    + 
Sbjct  238   FQYSNNHGLCGDGFTDLKACTGLNGPNLDRPDPTNP--KNFTTVDVKPESADLQRSNCSN  295

Query  716   -----PRKPQTAvvvvgvlglivAFFATGLF---TFSWYRRRKQKIGSTIDSSDSRLSTD  871
                    K   +     V+GLI +  A  +F   TF+WYRRRKQKIGS++D+ D R+ST+
Sbjct  296   NNGGCSSKASKSSPSGIVMGLIGSILAVAIFGGSTFTWYRRRKQKIGSSLDAMDGRISTE  355

Query  872   -QAKEVSRR-SASPLINLEYSNGWDPLAKARNG--NAAFSQEVLESFMFNLDE  1018
                KE SRR S+SPLI+LEY++GWDPL + +N   N+A SQEV ESFMFNL+E
Sbjct  356   YNFKEASRRKSSSPLISLEYASGWDPLGRGQNSNNNSALSQEVFESFMFNLEE  408



>gb|KCW49798.1| hypothetical protein EUGRSUZ_K03279 [Eucalyptus grandis]
Length=550

 Score =   341 bits (874),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 192/344 (56%), Positives = 249/344 (72%), Gaps = 7/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+ C++ G+V N+SLQG+ L G++ P IA +  L+GLYLH+N L G +PRE+ NL+ L
Sbjct  69    FQGVCCDDEGRVANVSLQGRRLTGRLSPAIAGLTHLTGLYLHYNSLCGEIPRELGNLSAL  128

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLN+N+LSG IPPE+++I SLQV+QL YN+L+G+IP +LGSLK L+VLALQSN LTG
Sbjct  129   SDLYLNMNNLSGQIPPEMADIASLQVMQLSYNQLTGSIPTKLGSLKKLSVLALQSNQLTG  188

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  LTRL LSFN LFGSIP K+A+   LE+LD++NNTLSGNVP ALKRLNEG
Sbjct  189   AIPASLGDLGTLTRLYLSFNRLFGSIPMKIADLPLLEVLDVQNNTLSGNVPPALKRLNEG  248

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDIPESANVQ-PHALNK  715
             F Y NN  LCG GF SL+ C       PS+P+P+G  +  +P+  IPE+ANV  P  L +
Sbjct  249   FLYENNFDLCGTGFLSLRTCNALEGRKPSQPQPYGAATT-VPSTSIPETANVVLPCNLTE  307

Query  716   PRK-PQTA--vvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
                 P++A    ++G +   VA  A G   F+ YRRRKQK+G + +  D  LSTDQ K  
Sbjct  308   CSSLPKSAHPSALIGSILATVALSAIGFLLFTHYRRRKQKLGFSAEVCDGHLSTDQPKSA  367

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              +++ SPL +LEYSNGWDPLA AR  N  FS+E  +SF FNL+E
Sbjct  368   YKKNGSPLASLEYSNGWDPLADARIFN-EFSEEAFQSFRFNLEE  410



>gb|EYU24994.1| hypothetical protein MIMGU_mgv1a002428mg [Erythranthe guttata]
Length=676

 Score =   344 bits (883),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 198/349 (57%), Positives = 249/349 (71%), Gaps = 14/349 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE  QV NISLQGKGL GK+ P +  +K L+GLYLH+N L+G +P EIA+LT L
Sbjct  56    FEGVACNEKRQVANISLQGKGLAGKLSPAVGGLKHLTGLYLHYNSLYGEIPLEIADLTEL  115

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP + ++ +LQVLQLCYN L+G+IP QL SL  L VLA+QSN LTG
Sbjct  116   SDLYLNVNNLSGEIPPALEHMQNLQVLQLCYNHLTGSIPTQLASLTKLNVLAIQSNQLTG  175

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLSFN LFGSIP KLA+A  LE+LD+RNNTLSGNVPLALKRL +G
Sbjct  176   AIPASLGDLPVLMRLDLSFNRLFGSIPTKLADAPLLEVLDVRNNTLSGNVPLALKRLVDG  235

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQ------PH  703
             F Y NNP LCG GFSSL+ C     N  +PEP+  GS    TK+IPE+A++         
Sbjct  236   FHYENNPELCGSGFSSLQTC---GPNSERPEPYSGGSMGSTTKNIPETADLNLNCSQSSC  292

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGS-TIDSSDSRLSTDQA-  877
             +    +  Q +V V  ++  ++  FA  + TFS YRRRKQK+GS   D+S+SRLSTD   
Sbjct  293   SNKSSKTSQASVAVGIIVITVMVSFA-AILTFSIYRRRKQKLGSAAFDASESRLSTDNHV  351

Query  878   --KEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               +  +R++ SPL++LEYSNGWDPL+  R      S EV+++F  NL E
Sbjct  352   NNETYNRKNGSPLVSLEYSNGWDPLSDDRRFLGFVSHEVVKNFRLNLQE  400



>ref|XP_006857826.1| hypothetical protein AMTR_s00069p00033900 [Amborella trichopoda]
 gb|ERN19293.1| hypothetical protein AMTR_s00069p00033900 [Amborella trichopoda]
Length=696

 Score =   344 bits (883),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 200/361 (55%), Positives = 249/361 (69%), Gaps = 28/361 (8%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+ACNE G+V NISLQGKGL G +P  I+ +K+L+GLYLH+N L G +P+E++NLT L
Sbjct  62    FQGVACNENGKVANISLQGKGLSGSVPAAISGLKSLTGLYLHYNSLTGPIPKELSNLTLL  121

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN LSGSIPP++ ++ +LQ L+LC N+L+G+IP +LGSLK L VLALQ NHL G
Sbjct  122   TDLYLNVNSLSGSIPPDLGSLPNLQALELCCNQLTGSIPKELGSLKKLNVLALQHNHLRG  181

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+++ LTRLDLSFN LFGSIP +L     L +LD+RNNTLSGNVP A KRLN+G
Sbjct  182   AIPASLGEISQLTRLDLSFNLLFGSIPGRLTALPLLNVLDVRNNTLSGNVPTAFKRLNDG  241

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSN---HLPTKDIPESANVQP----  700
             FQY NN  LCG  F  L+ C  S L P +P+ FGP S      PTK  PES NVQ     
Sbjct  242   FQYGNNSDLCGADFLGLQGCKSSDLQPIRPDAFGPDSTPNGVQPTK--PESVNVQTTPTI  299

Query  701   --------HALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDS  856
                     H  ++  K     +V+ V+ +       GL  FSWYRRRKQKIGS  + SDS
Sbjct  300   TGCEQGSGHCSSRSSKSPEIAIVMAVVAVTAGMILGGLLLFSWYRRRKQKIGSAFEPSDS  359

Query  857   RLSTDQ-AKEVS------RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLD  1015
             RLS+DQ AK+ S      R+SASPLI+LEY+NGWDPLA+        S E L+SF FNL+
Sbjct  360   RLSSDQVAKDFSITTTNNRKSASPLISLEYANGWDPLAE----QGGSSLEGLQSFRFNLE  415

Query  1016  E  1018
             E
Sbjct  416   E  416



>emb|CDY37035.1| BnaA04g26130D [Brassica napus]
Length=684

 Score =   344 bits (882),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 200/352 (57%), Positives = 255/352 (72%), Gaps = 21/352 (6%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+   +V NISLQG GL G IPP I  + +L+GLYLHFN L G +P++I+NL  L
Sbjct  59    FDGVACDGNRRVANISLQGMGLTGTIPPSIGLLTSLTGLYLHFNSLTGQIPKDISNLPLL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP+I N+ +LQVLQLCYNKLSG+IP QLGSLK +TVLALQ N L+G
Sbjct  119   TDLYLNVNNLSGEIPPQIGNLDNLQVLQLCYNKLSGSIPTQLGSLKKITVLALQYNQLSG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             A+PA+LGD+  LTRLDLSFN LFG +P KLA A  L++LDIRNN+ SG VP ALKRLN G
Sbjct  179   AVPASLGDVGTLTRLDLSFNDLFGPVPVKLAAAPSLQVLDIRNNSFSGFVPSALKRLNNG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDI-PESANVQPHALNK  715
             FQY+NN GLCG GF+ LK CT S + N ++P+P  P S  + T D+ PESA VQ    + 
Sbjct  239   FQYSNNHGLCGDGFTDLKPCTGSNVPNLNRPDPTNPKS-FITTNDVKPESAVVQRSNCSN  297

Query  716   ------PRKPQTAvvvvgvlglivAFFATGLF---TFSWYRRRKQKIGSTIDSSDSRLST  868
                     K   +  +  V+GL+ +  A  +F   TF+WYRRRKQ+IGS++D+ D R+ST
Sbjct  298   NNNGACSSKASKSSSLGIVMGLLGSILAVAVFGGSTFTWYRRRKQRIGSSLDAMDGRIST  357

Query  869   DQAKEVSRRSASPLINLEYSNGWDPLAKARNG--NAAFSQEVLESFMFNLDE  1018
             +       +S+SPLI+LEY+NGWDPL + +N   N+A SQEV ESFMFNL+E
Sbjct  358   E-------KSSSPLISLEYANGWDPLGRGQNSGNNSALSQEVFESFMFNLEE  402



>ref|XP_010532258.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Tarenaya 
hassleriana]
Length=688

 Score =   343 bits (880),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 198/349 (57%), Positives = 252/349 (72%), Gaps = 15/349 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ C+E G V NISLQGKGL GKI P I ++K L+GL+LH+N L G +PRE+ NL+ L
Sbjct  65    FEGVGCDENGHVSNISLQGKGLSGKISPTIGELKHLTGLFLHYNALVGEIPREMGNLSKL  124

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPEI  I SLQVLQLCYN L+G+IP +LGSLKNL+VLALQSN LTG
Sbjct  125   TDLYLNVNNLSGEIPPEIGKIESLQVLQLCYNHLTGSIPTELGSLKNLSVLALQSNKLTG  184

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG++  L RLDLSFN LFGSIP+KLA+   L +LDI+NN+LSGNVP +LKRLNEG
Sbjct  185   AIPASLGEINTLERLDLSFNRLFGSIPSKLADPALLRVLDIQNNSLSGNVPPSLKRLNEG  244

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPS-KPEPFGPGSNHLPTKDIPESANVQ-----PH  703
             F + NN GLCG  FS LK C D+    S KP+P+      LP +DI ESAN++      +
Sbjct  245   FAFENNLGLCGEQFSPLKSCNDTVQAESGKPKPYSASVTGLPARDISESANLRLPCNASN  304

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQA--  877
               + PR  Q AV+V  V+  I+   A G+  F+ YRRRKQ++ +  + SD   +TDQ   
Sbjct  305   CTDPPRSHQGAVLVGLVVMTIL-LSAIGVLLFTQYRRRKQRLSTPCEISD---TTDQFAK  360

Query  878   --KEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               +E  + + SPLI+LEY+NGWDPL+  +N N  F+QEV++SF FNL+E
Sbjct  361   GNREFRKNNGSPLISLEYTNGWDPLSDNKNLN-VFAQEVIQSFRFNLEE  408



>ref|XP_008345369.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Malus domestica]
Length=682

 Score =   342 bits (876),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 189/346 (55%), Positives = 240/346 (69%), Gaps = 9/346 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE  +V N+SL GKGL G++ P +A++K LSGLYLH+N+L G +P+EI+ LT L
Sbjct  59    FEGVACNEHRKVANVSLVGKGLSGRVSPAVAELKCLSGLYLHYNNLSGEIPKEISYLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLN+N+L+G +P EI N+TSLQVLQLC N+L+GNIP Q+GSLK L+V+ALQ N LTG
Sbjct  119   TDLYLNINNLTGGVPSEIGNMTSLQVLQLCCNQLTGNIPTQMGSLKRLSVIALQYNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IPA+LG+L +L RLDLSFN  FG+IPAKLA+   LE+LDIR+N+LSG  P ALKRL EG
Sbjct  179   QIPASLGNLGVLKRLDLSFNKFFGTIPAKLADIPSLEVLDIRSNSLSGVAPHALKRLKEG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPE--PFGPGSNHLPTKDIPESANVQP-----  700
             FQ  NNP LCG+GFS L+ CT   ++       P GP       K  PES +VQ      
Sbjct  239   FQCENNPRLCGVGFSKLRACTSFDMDNVNAHGLPLGPNITDSTPKANPESVDVQASCNQT  298

Query  701   HALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
             H     + P+ AVV   +   +    A        YR+RKQKIG+T D SD RLSTDQA+
Sbjct  299   HCRKSTKFPKGAVVAGVIALSVTLAGAV-FLALIRYRQRKQKIGNTSDPSDGRLSTDQAR  357

Query  881   EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             +  RRS SPL++LEY+NGWDPLA  RNG    SQE L  + FN+++
Sbjct  358   DFYRRSPSPLVSLEYANGWDPLADGRNG-IGLSQEYLNKYWFNMED  402



>ref|XP_010056327.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g30520 isoform X2 [Eucalyptus grandis]
 gb|KCW73007.1| hypothetical protein EUGRSUZ_E01442 [Eucalyptus grandis]
Length=687

 Score =   341 bits (875),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 193/345 (56%), Positives = 243/345 (70%), Gaps = 11/345 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+AC+E G+VVN+SLQGKGL G+IPPEI  + +L+GLYLHFN L G VP EI  L  L
Sbjct  68    FEGVACDERGRVVNVSLQGKGLRGRIPPEIGGLGSLTGLYLHFNALGGEVPGEIGGLRML  127

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VN  SG IP +I+N+T+LQVLQL YN+ SG IP QLGSL  LTVLALQ N LTG
Sbjct  128   TDLYLDVNGFSGEIPSDIANLTNLQVLQLGYNRFSGGIPRQLGSLPKLTVLALQYNRLTG  187

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGD   L RLDLS+N+ FGSIPA L NA  LE+LD+RNNTLSG VP  LKRL++G
Sbjct  188   AIPASLGDSASLKRLDLSYNNFFGSIPATLTNASSLEVLDVRNNTLSGYVPTGLKRLDDG  247

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANV-----QPHA  706
             FQY NNP LCG+GF +++ C    L+  +PEP  P  + L  K+IPESA++     + H 
Sbjct  248   FQYENNPDLCGVGFPNVRPCPTVYLD--RPEPLRP--DTLSKKNIPESADLNSTCGKAHC  303

Query  707   LNK-PRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
              N+   +    V+ V  +   + F   G  TFSW++ RKQ+  S++D  D R+   +A E
Sbjct  304   PNRLSGRRAGVVLGVVAVVAAIGFAVVGFLTFSWHQHRKQRNSSSLDVLDKRVRASRALE  363

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
                + AS LI+LEYSNGWDPLAK   G +AFSQEV E+FMFNL++
Sbjct  364   NRSKRASALISLEYSNGWDPLAKG-GGGSAFSQEVFENFMFNLED  407



>ref|XP_010037998.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Eucalyptus grandis]
 gb|KCW49797.1| hypothetical protein EUGRSUZ_K03279 [Eucalyptus grandis]
Length=690

 Score =   341 bits (875),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 192/344 (56%), Positives = 249/344 (72%), Gaps = 7/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+ C++ G+V N+SLQG+ L G++ P IA +  L+GLYLH+N L G +PRE+ NL+ L
Sbjct  69    FQGVCCDDEGRVANVSLQGRRLTGRLSPAIAGLTHLTGLYLHYNSLCGEIPRELGNLSAL  128

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLN+N+LSG IPPE+++I SLQV+QL YN+L+G+IP +LGSLK L+VLALQSN LTG
Sbjct  129   SDLYLNMNNLSGQIPPEMADIASLQVMQLSYNQLTGSIPTKLGSLKKLSVLALQSNQLTG  188

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  LTRL LSFN LFGSIP K+A+   LE+LD++NNTLSGNVP ALKRLNEG
Sbjct  189   AIPASLGDLGTLTRLYLSFNRLFGSIPMKIADLPLLEVLDVQNNTLSGNVPPALKRLNEG  248

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDIPESANVQ-PHALNK  715
             F Y NN  LCG GF SL+ C       PS+P+P+G  +  +P+  IPE+ANV  P  L +
Sbjct  249   FLYENNFDLCGTGFLSLRTCNALEGRKPSQPQPYGAATT-VPSTSIPETANVVLPCNLTE  307

Query  716   PRK-PQTA--vvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
                 P++A    ++G +   VA  A G   F+ YRRRKQK+G + +  D  LSTDQ K  
Sbjct  308   CSSLPKSAHPSALIGSILATVALSAIGFLLFTHYRRRKQKLGFSAEVCDGHLSTDQPKSA  367

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              +++ SPL +LEYSNGWDPLA AR  N  FS+E  +SF FNL+E
Sbjct  368   YKKNGSPLASLEYSNGWDPLADARIFN-EFSEEAFQSFRFNLEE  410



>ref|XP_010056326.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g30520 isoform X1 [Eucalyptus grandis]
Length=715

 Score =   342 bits (876),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 193/345 (56%), Positives = 243/345 (70%), Gaps = 11/345 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+AC+E G+VVN+SLQGKGL G+IPPEI  + +L+GLYLHFN L G VP EI  L  L
Sbjct  68    FEGVACDERGRVVNVSLQGKGLRGRIPPEIGGLGSLTGLYLHFNALGGEVPGEIGGLRML  127

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VN  SG IP +I+N+T+LQVLQL YN+ SG IP QLGSL  LTVLALQ N LTG
Sbjct  128   TDLYLDVNGFSGEIPSDIANLTNLQVLQLGYNRFSGGIPRQLGSLPKLTVLALQYNRLTG  187

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGD   L RLDLS+N+ FGSIPA L NA  LE+LD+RNNTLSG VP  LKRL++G
Sbjct  188   AIPASLGDSASLKRLDLSYNNFFGSIPATLTNASSLEVLDVRNNTLSGYVPTGLKRLDDG  247

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANV-----QPHA  706
             FQY NNP LCG+GF +++ C    L+  +PEP  P  + L  K+IPESA++     + H 
Sbjct  248   FQYENNPDLCGVGFPNVRPCPTVYLD--RPEPLRP--DTLSKKNIPESADLNSTCGKAHC  303

Query  707   LNK-PRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
              N+   +    V+ V  +   + F   G  TFSW++ RKQ+  S++D  D R+   +A E
Sbjct  304   PNRLSGRRAGVVLGVVAVVAAIGFAVVGFLTFSWHQHRKQRNSSSLDVLDKRVRASRALE  363

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
                + AS LI+LEYSNGWDPLAK   G +AFSQEV E+FMFNL++
Sbjct  364   NRSKRASALISLEYSNGWDPLAKG-GGGSAFSQEVFENFMFNLED  407



>ref|XP_009362126.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009362127.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 isoform X2 [Pyrus x bretschneideri]
Length=682

 Score =   341 bits (874),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 191/346 (55%), Positives = 238/346 (69%), Gaps = 9/346 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE  +V N+SL GKGL G++ P +A++K LSGLYLH+N L G +P+EI+ LT L
Sbjct  59    FEGVACNEHRKVANVSLVGKGLSGRVSPAVAKLKCLSGLYLHYNSLSGEIPKEISYLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+L+G IP EI N+TSLQVLQLC N+L+GNIP Q+GSLK L+V+ALQ N LTG
Sbjct  119   TDLYLNVNNLTGGIPSEIGNMTSLQVLQLCCNQLTGNIPTQMGSLKRLSVIALQHNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IPA+LG+L +L RLDLSFN  FG+IPAKLA+   LE LDIR+N+LSG  PLALKRL EG
Sbjct  179   QIPASLGNLGVLKRLDLSFNKFFGTIPAKLADIPSLEALDIRSNSLSGVAPLALKRLKEG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPE--PFGPGSNHLPTKDIPESANVQP-----  700
             FQ  NNP LCG+GFS L+ CT   ++       P GP       K  PES + Q      
Sbjct  239   FQCENNPTLCGVGFSKLRACTPFDMDNVNVHGLPLGPNITDSTPKANPESVDFQASCNQT  298

Query  701   HALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
             H     + P+ AVV   +   +    A        YR+RKQKIG+T D SD RLSTDQA+
Sbjct  299   HCRKSTKFPKAAVVAGVIALSVTLAGAV-FLALIRYRQRKQKIGNTSDPSDGRLSTDQAR  357

Query  881   EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             +  RRS SPL++LEY+NGWDPLA  RNG    SQE L  + FN+++
Sbjct  358   DFYRRSPSPLVSLEYANGWDPLADGRNG-IGLSQEYLNKYWFNMED  402



>emb|CDX74732.1| BnaA05g04780D [Brassica napus]
Length=680

 Score =   339 bits (869),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 195/350 (56%), Positives = 248/350 (71%), Gaps = 18/350 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+   +V NISLQG GL G IPP I  + +L+GLYLHFN L G +P++I+NL  L
Sbjct  59    FDGVACDGNRRVANISLQGMGLTGTIPPSIGLLTSLTGLYLHFNSLTGQIPKDISNLPFL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP+I ++ +LQVLQLCYN+LSG+IP QLGSL  +TVLALQ N L+G
Sbjct  119   ADLYLNVNNLSGEIPPQIGDLDNLQVLQLCYNQLSGSIPTQLGSLNKITVLALQYNQLSG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGD+  LTRLDLSFN LFG +P KLA A  LE+LDIRNN+ SG VP  LKRLN G
Sbjct  179   AIPASLGDIRTLTRLDLSFNDLFGPVPVKLAGAPLLEVLDIRNNSFSGFVPSGLKRLNNG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNK-  715
             F YTNN GLCG GF+ LK CT S   N ++P+P  P +        PESA++Q    +  
Sbjct  239   FHYTNNHGLCGDGFTDLKPCTGSNEPNLNRPDPTNPKTFKTTDDVKPESADLQRSNCSNN  298

Query  716   ----PRKPQTAvvvvgvlglivAFFATGLF---TFSWYRRRKQKIGSTIDSSDSRLSTDQ  874
                   K   +  +  V+GLI +  A  +F   TF+WYRRRKQ+IGS++D+ DSR+ST+ 
Sbjct  299   NGGCSSKASKSAPLGVVMGLIGSLLAVAVFAGSTFTWYRRRKQRIGSSLDAMDSRVSTE-  357

Query  875   AKEVSRRSASPLINLEYSNGWDPLAKARNG--NAAFSQEVLESFMFNLDE  1018
                   +S+SPLI+LEYS GWDPL + +N   N+A SQEV +SFMFNL+E
Sbjct  358   ------KSSSPLISLEYSRGWDPLGRGQNSNNNSALSQEVFDSFMFNLEE  401



>ref|XP_004495431.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930-like [Cicer arietinum]
Length=676

 Score =   337 bits (863),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 195/347 (56%), Positives = 249/347 (72%), Gaps = 21/347 (6%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACN+ GQV NISLQGKGL GK+ P I  +K L+GLYLH+N L+G +PREI+NLT L
Sbjct  63    FEGVACNKEGQVANISLQGKGLSGKLSPTIVALKHLTGLYLHYNSLNGEIPREISNLTQL  122

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              +LYLNVNHLSG IPPEI ++ SLQVLQLCYN+L+G+IP QLG+LK L+V+ALQSN LTG
Sbjct  123   GELYLNVNHLSGEIPPEIGSMESLQVLQLCYNQLTGSIPAQLGALKKLSVVALQSNQLTG  182

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL +L RLDLS N+LFGSIP  LA+   L++LD+ NN+LSGNVP ALKRLN+G
Sbjct  183   AIPASLGDLGMLVRLDLSSNNLFGSIPTGLASVSSLKVLDVHNNSLSGNVPPALKRLNDG  242

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANV-----QPHA  706
             F Y +N GLCG+GF  LK C     N SK        +  PT++IPE+ANV     +   
Sbjct  243   FLYKHNLGLCGVGFPFLKTC-----NTSK--------DGAPTRNIPETANVKLPCNETQC  289

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWY-RRRKQKIGSTIDSSDSRLSTDQAKE  883
              +  +  Q   + +GV  +I+A  A  + TF+ Y RRRKQK+G++    DSR STD+AK 
Sbjct  290   FHSSKSNQATPITLGVSVVIIAVLAIVILTFTLYMRRRKQKLGNSTHILDSRPSTDEAKV  349

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAA--FSQEVLESFMFNLDE  1018
             + R+S SPL +LEY+ GWDPLA  RN N     +Q+   +F FNL+E
Sbjct  350   IYRKSGSPLASLEYTTGWDPLAYYRNFNVENQEAQDRFHNFRFNLEE  396



>ref|XP_002862982.1| hypothetical protein ARALYDRAFT_920855 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39241.1| hypothetical protein ARALYDRAFT_920855 [Arabidopsis lyrata subsp. 
lyrata]
Length=680

 Score =   337 bits (863),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 246/343 (72%), Gaps = 8/343 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ C+  G+V NISLQGKGL GKI P IA++K L+GL+LH+N L G +PRE+ NL+ L
Sbjct  62    FEGVGCDWKGRVSNISLQGKGLSGKISPNIAKLKHLTGLFLHYNALVGDIPRELGNLSEL  121

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP  I  +  LQVLQLCYN L+G+IP +LGSL+ L+VLALQSN LTG
Sbjct  122   TDLYLNVNNLSGEIPSNIGKMQGLQVLQLCYNNLTGSIPRELGSLRKLSVLALQSNKLTG  181

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+++ L RLDLS+NHLFGS+P KLA+   L +LDIRNN+L+GNVP  LKRLNEG
Sbjct  182   AIPASLGEISALERLDLSYNHLFGSVPGKLASPPLLRVLDIRNNSLTGNVPPVLKRLNEG  241

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----L  709
             F + NN GLCG  FS LK C  +A  P +P+P+G      P++DIPESAN++        
Sbjct  242   FSFENNLGLCGAEFSPLKSCNGTA--PEEPKPYGATVFGFPSRDIPESANLRSPCNGTNC  299

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
             N P K     +++G++   +A  A  +  F+ YRRRKQK+ +  + SD+R++T       
Sbjct  300   NAPPKSHQGAILIGLVVSTIALSAISILLFTHYRRRKQKLSTAYEMSDTRVNT-VGGGFR  358

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + + SPL +LEY+NGWDPL+  RN  + F+QEV++SF FNL+E
Sbjct  359   KNNGSPLASLEYTNGWDPLSDNRN-LSVFAQEVIQSFRFNLEE  400



>ref|NP_199969.1| leucine-rich repeat protein kinase [Arabidopsis thaliana]
 dbj|BAB08672.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|ACN59391.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED96098.1| leucine-rich repeat protein kinase [Arabidopsis thaliana]
Length=680

 Score =   335 bits (859),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 187/343 (55%), Positives = 245/343 (71%), Gaps = 8/343 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ C+  G+V NISLQGKGL GKI P I ++K L+GL+LH+N L G +PRE+ NL+ L
Sbjct  62    FEGVGCDWKGRVSNISLQGKGLSGKISPNIGKLKHLTGLFLHYNALVGDIPRELGNLSEL  121

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP  I  +  LQVLQLCYN L+G+IP +L SL+ L+VLALQSN LTG
Sbjct  122   TDLYLNVNNLSGEIPSNIGKMQGLQVLQLCYNNLTGSIPRELSSLRKLSVLALQSNKLTG  181

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL+ L RLDLS+NHLFGS+P KLA+   L +LDIRNN+L+GNVP  LKRLNEG
Sbjct  182   AIPASLGDLSALERLDLSYNHLFGSVPGKLASPPLLRVLDIRNNSLTGNVPPVLKRLNEG  241

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----L  709
             F + NN GLCG  FS LK C  +A  P +P+P+G      P++DIPESAN++        
Sbjct  242   FSFENNLGLCGAEFSPLKSCNGTA--PEEPKPYGATVFGFPSRDIPESANLRSPCNGTNC  299

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
             N P K     +++G++   +A  A  +  F+ YRRRKQK+ +T + SD+RL+T       
Sbjct  300   NTPPKSHQGAILIGLVVSTIALSAISILLFTHYRRRKQKLSTTYEMSDNRLNT-VGGGFR  358

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + + SPL +LEY+NGWDPL+  RN  + F+QEV++SF FNL+E
Sbjct  359   KNNGSPLASLEYTNGWDPLSDNRN-LSVFAQEVIQSFRFNLEE  400



>ref|XP_006440406.1| hypothetical protein CICLE_v10019076mg [Citrus clementina]
 gb|ESR53646.1| hypothetical protein CICLE_v10019076mg [Citrus clementina]
Length=708

 Score =   335 bits (860),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 198/349 (57%), Positives = 244/349 (70%), Gaps = 14/349 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNE  +V NISLQGKGL GK+ P ++ +K LSGLYLH+N L G +P+EI NLT L
Sbjct  78    FEGIACNEHRKVANISLQGKGLTGKLSPSLSGLKCLSGLYLHYNSLSGEIPKEIRNLTEL  137

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VN+LSG+IPPEI ++ SLQVLQLC N+L+GNIP Q+GSLK+L+VL LQ N L G
Sbjct  138   TDLYLDVNNLSGNIPPEIGSMASLQVLQLCCNQLTGNIPAQIGSLKSLSVLTLQHNRLNG  197

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG+L  L RLDLSFN LFG+IP  LAN  +L  LD++NNTLSG VP ALKRLN G
Sbjct  198   GIPDSLGNLGKLKRLDLSFNSLFGTIPESLANNAELLFLDVQNNTLSGIVPSALKRLNGG  257

Query  542   FQYTNNPGLCGIGFSSLKLCT---DSALNPSKPEPFGPGSNHLPTKDIPESANVQPH---  703
             FQ+ NNPGLCG G +SL+ CT   ++ +NP K  PFG  SN     DI E +  + H   
Sbjct  258   FQFQNNPGLCGDGIASLRACTVYDNTQINPVK--PFGSHSNDTTPIDISEPSGFKEHCNQ  315

Query  704   --ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD--  871
                 N  + PQ A V+  V  + V    TG+  F  YRRRKQKIG+T +SSD +LSTD  
Sbjct  316   SQCSNSSKFPQIA-VLAAVTSVTVILAGTGILIFFRYRRRKQKIGNTSESSDWQLSTDLT  374

Query  872   QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              AK+ +R  ASPL++LEY +GWDPL    NG   FS+E L SF  NL+E
Sbjct  375   LAKDFNRNGASPLVSLEYCHGWDPLGDYLNG-TGFSREHLNSFRLNLEE  422



>gb|KFK26770.1| hypothetical protein AALP_AA8G291500 [Arabis alpina]
Length=680

 Score =   334 bits (857),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 191/344 (56%), Positives = 245/344 (71%), Gaps = 8/344 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ C+  GQV NI+LQGKGL GKI P IA++K L+GL+LH+N L G +P+EI NL+ L
Sbjct  60    FEGVGCDWKGQVSNITLQGKGLPGKISPAIAELKHLTGLFLHYNALVGDIPKEIGNLSEL  119

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP  I  +  LQVLQLCYN L+G+IP ++GSLK L+VLALQSN LTG
Sbjct  120   TDLYLNVNNLSGEIPSHIGKMQGLQVLQLCYNNLTGSIPREIGSLKKLSVLALQSNKLTG  179

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPATLGDL +L RLDLSFNHLFGS+P KLA    L +LDIRNN+LSGNVP  LKRLN+G
Sbjct  180   AIPATLGDLDVLERLDLSFNHLFGSVPGKLAGPPLLRVLDIRNNSLSGNVPPVLKRLNDG  239

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQ----PHAL  709
             F + NN GLCG  FS LK C  +A  P +P+P+       P++DIPESAN++        
Sbjct  240   FAFENNLGLCGAEFSPLKSCNGTA--PEQPKPYSATVTGFPSRDIPESANLRLPCNGTDC  297

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
             N P +     ++VG++   +A  A  +  F+ YRRRKQK+ +  + S++RL+T       
Sbjct  298   NAPPQSHQGSILVGLVVSTIALSAISILLFTHYRRRKQKLSTAYEMSETRLNTLGGGGGF  357

Query  890   RR-SASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             R+ S SPL +LEYSNGWDPL+  RN  + F+QEV++SF FNL+E
Sbjct  358   RKNSGSPLASLEYSNGWDPLSDNRN-LSVFAQEVIQSFRFNLEE  400



>ref|XP_008238646.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Prunus mume]
Length=681

 Score =   334 bits (857),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 196/346 (57%), Positives = 242/346 (70%), Gaps = 10/346 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE  +V NISLQGKGLYG++ P +A++K LSGLYLH+N+L G +P+EI+ LT L
Sbjct  59    FEGVACNEHRKVANISLQGKGLYGEVSPAVAELKCLSGLYLHYNNLSGEIPKEISYLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP EI ++TSLQVLQLC N+L+GNIP Q+G LK L+VLALQ N LTG
Sbjct  119   NDLYLNVNNLSGGIPSEIGDMTSLQVLQLCCNQLTGNIPTQMGFLKRLSVLALQHNELTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IPA+LGDL +L RLDLSFN  FG+IPAKLA+   LE+LDI++N+ SG  P  LKRL EG
Sbjct  179   QIPASLGDLGMLKRLDLSFNKFFGTIPAKLASVPSLELLDIQSNSFSGVAPRDLKRLKEG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPE--PFGPGSNHLPTKDIPESANV-----QP  700
             FQ  NNP LCG  FS+L+ CT   ++       P GP     P K  P+ A+      Q 
Sbjct  239   FQCKNNPRLCG-EFSTLRACTPFDMDNVNVNGLPRGPNITDSPPKSNPKPADFEAPCSQT  297

Query  701   HALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
             H     + PQ A VV GV+ L V   A        YRR KQK+ +T D SD RLSTDQAK
Sbjct  298   HCTKSTKLPQAA-VVAGVISLSVTLAAAVFLALIRYRRHKQKVSNTSDPSDGRLSTDQAK  356

Query  881   EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             +  R++ASPL++LEYSNGWDPLA  RNG  AFSQE L  + FN+++
Sbjct  357   DFYRKTASPLVSLEYSNGWDPLADGRNG-IAFSQEYLSKYWFNMED  401



>emb|CDY51809.1| BnaC04g53150D [Brassica napus]
Length=681

 Score =   334 bits (856),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 196/350 (56%), Positives = 247/350 (71%), Gaps = 18/350 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC+   +V NISLQG GL G IPP I  + +L+GLYLHFN L G +P++I+NL  L
Sbjct  60    FDGVACDGNRRVANISLQGMGLTGTIPPSIGLLTSLTGLYLHFNSLTGQIPKDISNLPFL  119

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP+I ++ +LQVLQLCYNKLSG+IP QLGSL  +TVLALQ N L+G
Sbjct  120   ADLYLNVNNLSGEIPPQIGDLDNLQVLQLCYNKLSGSIPTQLGSLNKITVLALQYNQLSG  179

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGD+  LTRLDLSFN LFG +P KLA A  LE+LDIRNN+ SG VP  LKRLN G
Sbjct  180   AIPASLGDIRTLTRLDLSFNDLFGPVPVKLAGAPLLEVLDIRNNSFSGFVPSGLKRLNNG  239

Query  542   FQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFGPGSNHLPTKDIPESANVQ-PHALNK  715
             F Y NN GLCG GF+ LK CT S   N ++P+P  P +        PESA++Q  +  NK
Sbjct  240   FHYANNHGLCGDGFTDLKPCTGSNEPNLNRPDPTNPNTFRTTNDVKPESADLQRSNCSNK  299

Query  716   ----PRKPQTAvvvvgvlglivAFFATGLF---TFSWYRRRKQKIGSTIDSSDSRLSTDQ  874
                   K   +  +  V+GLI +  A  +F    F+WYRRRKQ+IGS++D  DSR+ST+ 
Sbjct  300   NGGCSSKAAKSSSLGTVMGLIGSILAVAIFGGSMFTWYRRRKQRIGSSLDGMDSRVSTE-  358

Query  875   AKEVSRRSASPLINLEYSNGWDPLAKARNG--NAAFSQEVLESFMFNLDE  1018
                   +S+SPLI+LEYS GWDPL + +N   N+A SQEV +SFMFNL+E
Sbjct  359   ------KSSSPLISLEYSRGWDPLGRGQNSNNNSALSQEVFDSFMFNLEE  402



>ref|XP_006401961.1| hypothetical protein EUTSA_v10012874mg [Eutrema salsugineum]
 gb|ESQ43414.1| hypothetical protein EUTSA_v10012874mg [Eutrema salsugineum]
Length=676

 Score =   333 bits (855),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 188/343 (55%), Positives = 241/343 (70%), Gaps = 9/343 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ C+  GQV NISLQGKGL GKI P IA++K L+GL+LH+N L G +PREI NL+ L
Sbjct  59    FEGVGCDWKGQVSNISLQGKGLSGKISPAIAELKHLTGLFLHYNALVGDIPREIGNLSEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP  I  + SLQVLQLCYN L+G+IP +LGSLK L+VLALQSN LTG
Sbjct  119   TDLYLNVNNLSGEIPSHIGKMESLQVLQLCYNNLTGSIPGELGSLKKLSVLALQSNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  L RLDLS+NHLFGS+P KLA    L +LDIRNN+LSGNVP  LKRL+EG
Sbjct  179   AIPASLGDLNALERLDLSYNHLFGSVPGKLAGPPLLRVLDIRNNSLSGNVPPVLKRLSEG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----L  709
             F + NN GLCG  F+ LK C  +A  P +P+P+       P++DIPESAN++        
Sbjct  239   FSFENNLGLCGAEFTPLKSCNGTA--PEQPKPYSATVTGFPSRDIPESANLRSPCNGTDC  296

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
             N P       +++G++   +A  A  +  F+ YRRRKQK+ +  + S+  L+T       
Sbjct  297   NAPSNSHQGSILIGLVVSTIALSAISILLFTHYRRRKQKLSTAYEMSEPGLNTRGG--FR  354

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + S SPL +LEY+NGWDPL+  RN  + F+QEV++SF FNL+E
Sbjct  355   KNSGSPLASLEYTNGWDPLSDNRN-LSVFAQEVIQSFRFNLEE  396



>ref|XP_010482493.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1-like [Camelina sativa]
Length=682

 Score =   333 bits (855),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 242/343 (71%), Gaps = 7/343 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ C+  GQV NISLQGKGL GKI P IA++K L+GL+LH+N L G +PRE+ NL+ L
Sbjct  63    FEGVGCDWKGQVSNISLQGKGLSGKISPNIAKLKHLTGLFLHYNALVGDIPRELGNLSEL  122

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP    +  LQVLQLCYN L+G+IP +LGSL  L+VLALQSN LTG
Sbjct  123   TDLYLNVNNLSGEIPPNFGKMQGLQVLQLCYNNLTGSIPRELGSLSKLSVLALQSNKLTG  182

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL+ L RLDLS+NHLFGS+P KLAN   L +LDIRNN+L+GNVP  LKRLNEG
Sbjct  183   AIPASLGDLSALERLDLSYNHLFGSVPGKLANPPLLRVLDIRNNSLTGNVPPVLKRLNEG  242

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----L  709
             F + NN GLCG+ F SLK C  +A   +K  PFG     +P++DIP+SA ++        
Sbjct  243   FAFDNNLGLCGVEFPSLKSCNGTAHVGAK--PFGATVTDVPSRDIPQSATLRLPCNGTNC  300

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
             N P K     +++G++   +A  A  +  F+ YRRRKQK+ +  + SD+R +        
Sbjct  301   NAPPKSHQGAILIGLVVTTIALSAVSILLFTHYRRRKQKLSTAYEMSDTRPNNSVRGGFR  360

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + S SPL +LEY++GWDPL+  RN  + F+QEV++SF FNL+E
Sbjct  361   KNSGSPLASLEYTHGWDPLSDNRN-LSVFAQEVIQSFRFNLEE  402



>gb|KDO63769.1| hypothetical protein CISIN_1g005586mg [Citrus sinensis]
Length=689

 Score =   333 bits (853),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 197/349 (56%), Positives = 243/349 (70%), Gaps = 14/349 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNE  +V NISLQGKGL GK+ P ++ +K LSGLYLH+N L G +P+EI NLT L
Sbjct  59    FEGIACNEHRKVANISLQGKGLTGKLSPSLSGLKCLSGLYLHYNSLSGEIPKEIRNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VN+LSG+IPPEI ++ SLQVLQLC N+L+GNIP Q+GSLK+L+VL LQ N L G
Sbjct  119   TDLYLDVNNLSGNIPPEIGSMASLQVLQLCCNQLTGNIPAQIGSLKSLSVLTLQHNRLNG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG+L  L RLDLSFN LFG+IP  LAN  +L  LD++NNTLSG VP ALKRLN G
Sbjct  179   GIPDSLGNLGKLKRLDLSFNSLFGTIPESLANNAELLFLDVQNNTLSGIVPSALKRLNGG  238

Query  542   FQYTNNPGLCGIGFSSLKLCT---DSALNPSKPEPFGPGSNHLPTKDIPESANVQPH---  703
             FQ+ NNPGLCG G +SL+ CT   ++ +NP K  PFG  SN     DI E +  + H   
Sbjct  239   FQFQNNPGLCGDGIASLRACTVYDNTQINPVK--PFGSHSNDTTPIDISEPSGFKEHCNQ  296

Query  704   --ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD--  871
                 N  + PQ A V+  V  + V    TG+  F  YRR KQKIG+T +SSD +LSTD  
Sbjct  297   SQCSNSSKFPQIA-VLAAVTSVTVILAGTGILIFFRYRRHKQKIGNTSESSDWQLSTDLT  355

Query  872   QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              AK+ +R  ASPL++LEY +GWDPL    NG   FS+E L SF  NL+E
Sbjct  356   LAKDFNRNGASPLVSLEYCHGWDPLGDYLNG-TGFSREHLNSFRLNLEE  403



>ref|XP_004513505.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Cicer arietinum]
Length=664

 Score =   332 bits (851),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 188/341 (55%), Positives = 248/341 (73%), Gaps = 16/341 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGI CNE G V NISLQGKGLYGKIP  I  +K+L+ +YLHFN L+G +P+EIA+LT L
Sbjct  60    FEGIGCNEKGFVSNISLQGKGLYGKIPSVIGSLKSLTAVYLHFNALNGILPKEIASLTQL  119

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+ N+LSG+IP +I N+++LQVLQLCYN+L+G+IP++LG LK LT++ALQ+NHL+G
Sbjct  120   SDLYLSFNNLSGNIPHDIGNMSNLQVLQLCYNELNGSIPSELGRLKRLTIVALQNNHLSG  179

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L  L RLDLSFN LFG IP  LANA KL+ LDI NN+LSG+VP AL+RL  G
Sbjct  180   AIPASLGELETLERLDLSFNTLFGPIPVTLANAPKLQTLDITNNSLSGSVPTALQRLKGG  239

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKP  718
             F+Y NN GLCG GFS L  C   S  +P +PEP+ P  N++ ++D P  +      + K 
Sbjct  240   FKYINNHGLCGTGFSDLDSCRIVSNSDPVRPEPYEP-INNITSRDFPAESCGDADCI-KR  297

Query  719   RKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRS  898
              +  T  +   ++G++  F  TG+F F WY  +KQKIGST +SS      D+ K+V R++
Sbjct  298   SETSTIGLAFVMIGVVSVFSVTGVFLFLWYHHKKQKIGSTDESS------DKIKKVYRKN  351

Query  899   -ASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              ASPLI+LEYS+GWDPL+K  N      ++ L+SFMFNL+E
Sbjct  352   YASPLISLEYSSGWDPLSKGVN------EDFLQSFMFNLEE  386



>ref|XP_007039978.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY24479.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=683

 Score =   332 bits (852),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 191/345 (55%), Positives = 237/345 (69%), Gaps = 7/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ACNE  +V NISLQGKGL GK+ P +A +K LSGLYLH+N L G +P+E++NL  L
Sbjct  60    FVGVACNEHRKVANISLQGKGLSGKVSPAVAGLKCLSGLYLHYNSLSGEIPKELSNLREL  119

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSGSIPPEI N+  LQVLQLC N+L+GNIP ++GSLK L+VLALQ N L G
Sbjct  120   TDLYLNVNNLSGSIPPEIGNMADLQVLQLCCNQLTGNIPTEIGSLKKLSVLALQYNRLDG  179

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IPA++G+L +L RLDLS+N L G+IP  LA+  +LEIL+IRNNTL G+VP  LKRLN G
Sbjct  180   KIPASIGNLGMLRRLDLSYNRLSGAIPTTLADIPQLEILEIRNNTLYGSVPSGLKRLNGG  239

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----  706
             FQ  NNPGLCG GFS+L+ CT    LN ++ EPF    N   T    +++N+Q       
Sbjct  240   FQGENNPGLCGTGFSTLRDCTPFDGLNINQLEPFRSHLNGTATGVTSQTSNIQGDCNHTD  299

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              + P +     V+ G++ +   F   G   F  YRR+KQKIG+T D SD RLSTDQAKE 
Sbjct  300   CSNPSRFPKIPVIAGIITVSFVFVVGGFLAFVHYRRQKQKIGNTSDPSDGRLSTDQAKEF  359

Query  887   SRR-SASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              R  S SPL+ LEYS GWDPL     G   FS+E L  F FNL+E
Sbjct  360   HRNGSVSPLVTLEYSYGWDPLGDGWKG-IGFSEEHLNKFRFNLEE  403



>gb|AAM62629.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=680

 Score =   332 bits (851),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 244/343 (71%), Gaps = 8/343 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ C+  G+V NISLQGKGL GKI P I ++K L+GL+LH+N L G +PRE+ NL+ L
Sbjct  62    FEGVGCDWKGRVSNISLQGKGLSGKISPNIGKLKHLTGLFLHYNALVGDIPRELGNLSEL  121

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
               LYLNVN+LSG IP  I  +  LQVLQLCYN L+G+IP +L SL+ L+VLALQSN LTG
Sbjct  122   TGLYLNVNNLSGEIPSNIGKMQGLQVLQLCYNNLTGSIPRELSSLRKLSVLALQSNKLTG  181

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL+ L RLDLS+NHLFGS+P KLA+   L +LDIRNN+L+GNVP  LKRLNEG
Sbjct  182   AIPASLGDLSALERLDLSYNHLFGSVPGKLASPPLLRVLDIRNNSLTGNVPPVLKRLNEG  241

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----L  709
             F + NN GLCG  FS LK C  +A  P +P+P+G      P++DIPESAN++        
Sbjct  242   FSFENNLGLCGAEFSPLKSCNGTA--PEEPKPYGATVFGFPSRDIPESANLRSPCNGTNC  299

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
             N P K     +++G++   +A  A  +  F+ YRRRKQK+ +T + SD+RL+T       
Sbjct  300   NTPPKSHQGAILIGLVVSTIALSAISILLFTHYRRRKQKLSTTYEMSDNRLNT-VGGGFR  358

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + + SPL +LEY+NGWDPL+  RN  + F+QEV++SF FNL+E
Sbjct  359   KNNGSPLASLEYTNGWDPLSDNRN-LSVFAQEVIQSFRFNLEE  400



>ref|XP_010662200.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Vitis vinifera]
 emb|CBI22150.3| unnamed protein product [Vitis vinifera]
Length=680

 Score =   332 bits (850),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 250/347 (72%), Gaps = 11/347 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ CNE  +V NI+LQGKGL GK+PP +A +K LSGLYLH+N L G +PREI++LT L
Sbjct  62    FEGVHCNEHRKVANITLQGKGLSGKVPPAVAGLKCLSGLYLHYNSLSGEIPREISSLTEL  121

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+ N+LSG+IPPEI N+ SLQVLQLC N+L+G IP+++G LK L+V++LQ N+LTG
Sbjct  122   SDLYLDFNNLSGAIPPEIGNMASLQVLQLCSNQLTGAIPSEIGFLKKLSVVSLQKNNLTG  181

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG+L +L  L+LSFN L G+IPA LA A  LE LD+RNN+L G VP  LK+L EG
Sbjct  182   KIPPSLGNLGMLRMLNLSFNRLSGTIPANLAQAPALEFLDVRNNSLWGIVPSGLKKLKEG  241

Query  542   FQYTNN-PGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDI-PESANVQPHALN  712
             FQ+ NN  GLCG+GFSSL++C+    +N ++ E F P +N   T  I P S+N +PH  N
Sbjct  242   FQHANNSAGLCGVGFSSLRVCSYWDGMNINQSETF-PATNTDFTPTIYPVSSNFRPHC-N  299

Query  713   KPRKPQTAv-----vvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQA  877
             +   P  +      +V GV  + V   A GL TF  YRRRKQKIGS+ D+S+ +LSTD++
Sbjct  300   QTHCPNVSKFPRIVLVSGVTTVTVTLSAVGLLTFLCYRRRKQKIGSSFDTSECQLSTDRS  359

Query  878   KEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              +  R+ ASPL++LEYS GWDPLA  RNGN  FSQE  ++  FNLDE
Sbjct  360   IDCHRKIASPLVSLEYSTGWDPLADGRNGN-VFSQEFCQNPRFNLDE  405



>ref|XP_006477275.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Citrus sinensis]
Length=720

 Score =   332 bits (852),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 197/349 (56%), Positives = 243/349 (70%), Gaps = 14/349 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNE  +V NISLQGKGL GK+ P ++ +K LSGLYLH+N L G +P+EI NLT L
Sbjct  90    FEGIACNEHRKVANISLQGKGLTGKLSPALSGLKCLSGLYLHYNSLSGEIPKEIRNLTEL  149

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLY++VN+LSG+IPPEI ++ SLQVLQLC N+L+GNIP Q+GSLK+L VL LQ N L G
Sbjct  150   TDLYVDVNNLSGNIPPEIGSMASLQVLQLCCNQLTGNIPAQIGSLKSLNVLTLQHNRLNG  209

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIP +LG+L  L RLDLSFN LFG+IP  LAN  +L  LD++NNTLSG VP ALKRLN G
Sbjct  210   AIPDSLGNLGKLKRLDLSFNSLFGTIPESLANNAELLFLDVQNNTLSGIVPSALKRLNGG  269

Query  542   FQYTNNPGLCGIGFSSLKLCT---DSALNPSKPEPFGPGSNHLPTKDIPESANVQPH---  703
             FQ+ NNPGLCG G +SL+ CT   ++ +NP K  PFG  SN     DI E +  + H   
Sbjct  270   FQFQNNPGLCGDGIASLRACTVYDNTQINPVK--PFGSHSNDTTPIDISEPSGFKEHCNQ  327

Query  704   --ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD--  871
                 N  + PQ A V+  V  + V    TG+  F  YRR KQKIG+T +SSD +LSTD  
Sbjct  328   SQCSNSSKFPQIA-VLAAVTSVTVILAGTGILIFFRYRRHKQKIGNTSESSDWQLSTDLT  386

Query  872   QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              AK+ +R  ASPL++LEY +GWDPL    NG   FS+E L SF  NL+E
Sbjct  387   LAKDFNRNGASPLVSLEYCHGWDPLGDYLNG-TGFSREHLNSFRLNLEE  434



>gb|KDP25598.1| hypothetical protein JCGZ_20754 [Jatropha curcas]
Length=651

 Score =   330 bits (846),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 186/347 (54%), Positives = 244/347 (70%), Gaps = 10/347 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE  +V NISLQGKGL GKI P +A++K LSG+YLH+N L G +P+E++NLT L
Sbjct  28    FEGVACNEHRKVANISLQGKGLSGKISPAVAELKCLSGVYLHYNKLSGEIPKELSNLTEL  87

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSGSIP EI N+ SLQVL+LC N+L+G IP ++GSLK LTVLALQ N +T 
Sbjct  88    TDLYLNVNNLSGSIPAEIGNMASLQVLELCCNQLTGKIPTEMGSLKRLTVLALQYNRITD  147

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG+L +L RLDL FN LFG IP+ +  A +L++LD+RNN+LSG VP AL+RLNEG
Sbjct  148   QIPTSLGNLGMLRRLDLGFNSLFGPIPSSITKAPQLQVLDVRNNSLSGMVPSALQRLNEG  207

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGP------GSNHLPTKDIPESANVQP  700
             FQ+ NN GLCG+GF  L+ C+    +N ++ +P GP       S ++P   +  S   Q 
Sbjct  208   FQFKNNKGLCGVGFPQLRACSAFDKMNTNQIDPSGPIAGSSNTSKNIPISTVFHSPCNQT  267

Query  701   HALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
             +  +  + PQ  +V   +   I+   A  L  F +YRR+KQKIG+T + SD RLSTDQAK
Sbjct  268   NCSHSSKFPQILIVAGVITVTILLIGAGFLIIF-FYRRKKQKIGNTSEPSDGRLSTDQAK  326

Query  881   EVSRRSASPLINL-EYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             E+ R  ASPL++L EYSNGWDP  + RNG    S+  L +F FNL+E
Sbjct  327   ELPRGGASPLVSLVEYSNGWDPFGEGRNG-IRISEGCLNNFRFNLEE  372



>ref|XP_007140941.1| hypothetical protein PHAVU_008G154200g [Phaseolus vulgaris]
 gb|ESW12935.1| hypothetical protein PHAVU_008G154200g [Phaseolus vulgaris]
Length=661

 Score =   330 bits (847),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 233/343 (68%), Gaps = 18/343 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE G V NISLQGKGLYG +P  +A +K+L+GL+LHFN LHG +P++I  LT L
Sbjct  59    FEGVACNEQGLVTNISLQGKGLYGTVPHALAALKSLTGLFLHFNALHGILPKQITTLTDL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP EI N+++LQVLQLCYNK  GNIP++LG L+ L+V+ALQ N L  
Sbjct  119   TDLYLNVNNLSGDIPREIGNMSNLQVLQLCYNKFRGNIPSELGRLRKLSVVALQYNELNS  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG++  L RLDLSFN L G IP  LA+A KL+ L++RNN+LSG VP AL+RL  G
Sbjct  179   AIPASLGEVGTLARLDLSFNSLLGPIPVTLADAAKLQSLNVRNNSLSGRVPSALRRLKGG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKP  718
             F+Y NNPGLCG GF  L  C + S   P +PEP+ PG     TKD+P S   Q  +    
Sbjct  239   FEYMNNPGLCGTGFDDLDSCKEVSTSEPVRPEPYEPGDT--STKDLPASMEPQHESCGHC  296

Query  719   RKPQTAvvvvgvlglivAFFAT---GLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
             ++   +  +  V  +I   FA+   GL    W R + QKIGS         S +  K+V 
Sbjct  297   KRTSKSSKIGLVFTVIAVVFASTVAGLLLLFWRRSQNQKIGS---------SDNGPKQVC  347

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             ++SA PLI+LEYS+GWDPL K   G + +S EVLE FMFNL+E
Sbjct  348   QKSAFPLISLEYSDGWDPLEK---GGSGYSWEVLEGFMFNLEE  387



>ref|XP_006279482.1| hypothetical protein CARUB_v10026012mg [Capsella rubella]
 gb|EOA12380.1| hypothetical protein CARUB_v10026012mg [Capsella rubella]
Length=681

 Score =   329 bits (844),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 184/343 (54%), Positives = 241/343 (70%), Gaps = 8/343 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ C+  GQV NISLQGK L GKI P IA+++ L+GL+LH+N L G +PRE+ NL+ L
Sbjct  63    FEGVGCDWKGQVSNISLQGKALSGKISPNIAKLRHLTGLFLHYNALVGDIPRELGNLSEL  122

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP I  +  LQVLQLCYN L+G+IP +LGSL+ L+VLALQSN LTG
Sbjct  123   TDLYLNVNNLSGEIPPNIGKMQGLQVLQLCYNNLTGSIPRELGSLRKLSVLALQSNKLTG  182

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL+ L RLDLS+NHLFGS+P KLAN   L + DIRNN+L+GNVP  LKRLNEG
Sbjct  183   AIPASLGDLSALERLDLSYNHLFGSVPGKLANPPMLRVFDIRNNSLTGNVPPVLKRLNEG  242

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----L  709
             F + NN GLCG  FSSLK C  +A    +P+P+       P++DIPESAN++        
Sbjct  243   FAFDNNLGLCGAEFSSLKSCNGTA--HEEPKPYSATVTGFPSRDIPESANLRLPCNGTNC  300

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
             N P K     +++G++   +A  A  +  F+ YRRR+QK+ +  + SD+  S        
Sbjct  301   NAPPKSHQGAILIGLVVSTIALSAVSILLFTHYRRRRQKLSTAYEMSDTP-SNTLGGGFR  359

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + + SPL +LEY+NGWDPL+  RN  + F+QEV++SF FNL+E
Sbjct  360   KNNGSPLASLEYTNGWDPLSDNRN-LSVFAQEVIQSFRFNLEE  401



>ref|XP_002509606.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
 gb|EEF50993.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
Length=693

 Score =   330 bits (845),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 187/345 (54%), Positives = 241/345 (70%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE  +V NISLQG+GL G I P +A++K LSGLYLH+N L G +P+E+ANLT L
Sbjct  75    FEGVACNEHRKVANISLQGRGLSGSISPAVAKLKCLSGLYLHYNSLSGEIPKELANLTEL  134

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              D+YLNVN+LSGSIPPEI  + SLQVL+LC N+L+G+IP ++ SLK LTV+ALQ N LT 
Sbjct  135   SDVYLNVNNLSGSIPPEIGGMASLQVLELCCNQLTGSIPREMDSLKRLTVVALQYNRLTD  194

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IPA LG+L +L RLDL FN+L G IP  LANA +L++LD+RNN+LSG VP AL++LN G
Sbjct  195   QIPAGLGNLGMLRRLDLGFNNLSGPIPITLANAPQLQVLDVRNNSLSGMVPSALQKLNGG  254

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDIPESANVQP-----H  703
             FQ+ NN GLCG GF  L+ CT    +N ++ EP G  +N   +K+IP SA +Q       
Sbjct  255   FQFENNKGLCGAGFPELRACTAFDNMNINQVEPSGSITNTTTSKNIPVSAILQAPCDQTK  314

Query  704   ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
               N  + PQ A++       I+      L  F +YRR+KQKIG+  +SS+ RLSTD+AKE
Sbjct  315   CSNSSKFPQVAIISGVTTATIILIGVAFLIIF-FYRRQKQKIGNISESSEGRLSTDKAKE  373

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               R  ASPL++LEYSNGWDP    RNG    S+  L +F FNL+E
Sbjct  374   FHRAGASPLVSLEYSNGWDPFRGCRNG-VGISEPSLNNFRFNLEE  417



>ref|XP_010442662.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 isoform X1 [Camelina sativa]
 ref|XP_010442663.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 isoform X2 [Camelina sativa]
Length=682

 Score =   328 bits (841),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 241/343 (70%), Gaps = 7/343 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ C+  GQV NISLQGKGL GKI P IA++K L+GL+LH+N L G +PRE+ NL+ L
Sbjct  63    FEGVGCDWKGQVSNISLQGKGLSGKISPNIAKLKHLTGLFLHYNALVGDIPRELGNLSEL  122

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPP    +  LQVLQLCYN L+G+IP +LGSL  L+VLALQSN LTG
Sbjct  123   TDLYLNVNNLSGEIPPNFGKMQGLQVLQLCYNNLTGSIPRELGSLSKLSVLALQSNKLTG  182

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA++GDL+ L RLDLS+NHLFGS+P KLAN   L +LDIRNN+L+G+VP  LKRLNEG
Sbjct  183   AIPASIGDLSALERLDLSYNHLFGSVPGKLANPPLLRVLDIRNNSLTGSVPPVLKRLNEG  242

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----L  709
             F + NN GLCG  F SL  C  +A   +K  PFG     +P++DIP+SA ++        
Sbjct  243   FAFDNNLGLCGAEFPSLNSCNGTAHVGAK--PFGATVTDVPSRDIPQSATLRLPCNGTNC  300

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
             N P K     +++G++   +A  A  +  F+ YRRRKQK+ ++ + SD+R +        
Sbjct  301   NAPPKSHQGAILIGLVVSTIALSAVSILLFTHYRRRKQKLSTSYEMSDTRPNNSVRGGFR  360

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + S SPL +LEY++GWDPL+  RN  + F+QEV++SF FNL+E
Sbjct  361   KNSGSPLASLEYTHGWDPLSDNRN-LSVFAQEVIQSFRFNLEE  402



>emb|CDY00487.1| BnaA10g07860D [Brassica napus]
Length=677

 Score =   322 bits (825),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 185/345 (54%), Positives = 241/345 (70%), Gaps = 12/345 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ C+  GQV NISLQGKGL GK+ P IA++K L+GL+LH+N L G +PRE+ NL+ L
Sbjct  59    FEGVGCDWKGQVSNISLQGKGLSGKLSPAIAELKHLTGLFLHYNALVGDIPRELGNLSEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP  I  + SLQVLQLCYN L+G+IP ++GSLK L+VLALQSN L+G
Sbjct  119   TDLYLNVNNLSGEIPSHIGKMESLQVLQLCYNNLTGSIPREIGSLKKLSVLALQSNKLSG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  L RLDLS+NHLFGS+P KLA    L +LDIRNN+LSGNVP  LKRLNEG
Sbjct  179   AIPASLGDLNALERLDLSYNHLFGSVPGKLAVPPLLRVLDIRNNSLSGNVPPVLKRLNEG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQ-----PHA  706
             F + NN GLCG  FS LK C  +A  P +P+P+    N  P++ IPESA++Q        
Sbjct  239   FAFENNLGLCGAEFSPLKPCNGTA--PEEPKPYSATVNGFPSRAIPESADLQLPCNGTEC  296

Query  707   LNKPR-KPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
                P        +++G++   +A  A  +  F+ YRRRKQK+ +  + S++ L+   AK 
Sbjct  297   SGAPSPNSHQGSILIGLVVSTIALSAVSILLFTHYRRRKQKLSTAYEMSETGLN---AKG  353

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
                + +SPL +LEYS+GWDPL+  RN  + F QEV++SF FNL+E
Sbjct  354   RKNKGSSPLASLEYSSGWDPLSDNRN-LSIFDQEVIQSFRFNLEE  397



>ref|XP_009107333.1| PREDICTED: somatic embryogenesis receptor kinase 2 [Brassica 
rapa]
Length=677

 Score =   322 bits (824),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 185/345 (54%), Positives = 241/345 (70%), Gaps = 12/345 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ C+  GQV NISLQGKGL GK+ P IA++K L+GL+LH+N L G +PRE+ NL+ L
Sbjct  59    FEGVGCDWKGQVSNISLQGKGLSGKLSPAIAELKHLTGLFLHYNALVGDIPRELGNLSEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP  I  + SLQVLQLCYN L+G+IP ++GSLK L+VLALQSN L+G
Sbjct  119   TDLYLNVNNLSGEIPSHIGKMESLQVLQLCYNNLTGSIPREIGSLKKLSVLALQSNKLSG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  L RLDLS+NHLFGS+P KLA    L +LDIRNN+LSGNVP  LKRLNEG
Sbjct  179   AIPASLGDLNALERLDLSYNHLFGSVPGKLAVPPLLRVLDIRNNSLSGNVPPVLKRLNEG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQ-----PHA  706
             F + NN GLCG  FS LK C  +A  P +P+P+    N  P++ IPESA++Q        
Sbjct  239   FAFENNLGLCGAEFSPLKPCNGTA--PEEPKPYSATVNGFPSRAIPESADLQLPCNGTEC  296

Query  707   LNKPR-KPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
                P        +++G++   +A  A  +  F+ YRRRKQK+ +  + S++ L+   AK 
Sbjct  297   SGAPSPNSHQGSILIGLVVSTIALSAVSILLFTHYRRRKQKLSTAYEMSEAGLN---AKG  353

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
                + +SPL +LEYS+GWDPL+  RN  + F QEV++SF FNL+E
Sbjct  354   RKNKGSSPLASLEYSSGWDPLSDNRN-LSIFDQEVIQSFRFNLEE  397



>ref|XP_002522411.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
 gb|EEF39903.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
Length=648

 Score =   321 bits (822),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 196/343 (57%), Positives = 233/343 (68%), Gaps = 32/343 (9%)
 Frame = +2

Query  8     GIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLD  187
             G+ACN  G V NISLQGKGL G       QI   S     F+     +P+EIA LT L D
Sbjct  52    GVACNGQGNVANISLQGKGLSG-------QITGCSRWAQEFD----LIPKEIAQLTELSD  100

Query  188   LYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAI  367
             LY NVN+LS  IP +I N+++LQVLQLCYNKL+G+IP QLGSL+ L VLALQ N LT AI
Sbjct  101   LYPNVNNLSAEIPRQIGNMSNLQVLQLCYNKLTGSIPTQLGSLRKLNVLALQYNQLTSAI  160

Query  368   PAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQ  547
             PA+LGDL  LTRLDLSFN LFGS+P KLA A  L++LDIRNN+LSGN+P AL+RL+ GFQ
Sbjct  161   PASLGDLKFLTRLDLSFNGLFGSVPVKLATAPMLQVLDIRNNSLSGNLPAALRRLDNGFQ  220

Query  548   YTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANV-----QPHAL  709
             Y NNP +CGIGF +L+ CT S  LNP++PEPF P  N    +DIPESAN      Q H  
Sbjct  221   YDNNPDVCGIGFPNLETCTASGNLNPNRPEPFKP--NGTLQRDIPESANFTSNCGQTHCS  278

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
             N  + PQ  ++   +   IV      +FTF+WY R+KQKIGS  D+SD RLSTDQAK+  
Sbjct  279   NSSKNPQFGIIFGVIGVFIVLTIIV-IFTFTWYCRQKQKIGSAFDASDGRLSTDQAKK--  335

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
                      LEYSNGWDPLA  +N N   SQE LESFMFNL+E
Sbjct  336   ---------LEYSNGWDPLAIGQNKN-GLSQEFLESFMFNLEE  368



>ref|XP_009382007.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Musa acuminata subsp. malaccensis]
Length=689

 Score =   320 bits (821),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 186/345 (54%), Positives = 235/345 (68%), Gaps = 10/345 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+AC+E G+V NISLQG+GL G I P +A+++ L+GLYLHFN + G +PREI NL+ L
Sbjct  64    FEGVACDESGKVANISLQGRGLSGSIAPVVAELEGLTGLYLHFNKISGVIPREIGNLSRL  123

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSGSIP EI N+  LQVLQL  NKLSG++P +L  LKNL +LALQSNHL G
Sbjct  124   SDLYLNVNNLSGSIPEEIGNMGGLQVLQLSNNKLSGSVPPKLALLKNLNMLALQSNHLNG  183

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPATLGDLT LT LD+SFN LFGSIP KL+   +L +LD+++N LSGNVP  LK+L   
Sbjct  184   AIPATLGDLTELTWLDVSFNQLFGSIPVKLSQLPQLTVLDVQSNLLSGNVPSELKKLGGN  243

Query  542   FQYTNNPGLCGIGFSSLKLCTDSA-LNPSKPEPFGPGSNHLPTKDIPESANVQPHA----  706
             F+Y NN  LCG GF+ L+ CT +  LN S+PEPF  G   L  +DIP+S N+        
Sbjct  244   FKYGNNTDLCGTGFTDLRACTSADLLNASRPEPFSAG---LAPQDIPQSVNISADCSATH  300

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              +   K    V+VV    ++      GL  F W+R RKQKIG   + S+  LS D  K  
Sbjct  301   CSSSSKSTNVVIVVATTIVVFGVMVCGLMAFLWFRLRKQKIGGLFEVSNGLLSADPTK-F  359

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNA-AFSQEVLESFMFNLDE  1018
             S R+ASPLI+LEYS+ WDP+   R+G     SQEV + + FNL+E
Sbjct  360   SYRAASPLISLEYSSHWDPMTDERSGGINGLSQEVSQIYRFNLEE  404



>ref|XP_008448908.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Cucumis melo]
Length=681

 Score =   319 bits (817),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 180/350 (51%), Positives = 239/350 (68%), Gaps = 14/350 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ACNE  +V NISLQG+GL GK+ P +A++K LSGLYLH+N+L G +PREI++L  L
Sbjct  59    FVGVACNEHRKVANISLQGRGLSGKVSPAVAELKCLSGLYLHYNNLSGEIPREISSLNEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VN L+G IP EI N++SLQVLQ+C N+LSG IP Q+GSL+ LTVLALQ N L+G
Sbjct  119   ADLYLDVNSLTGDIPEEIGNMSSLQVLQICCNQLSGKIPTQIGSLRKLTVLALQHNRLSG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG L +L RL LSFN+  G IP  LA   +LE++D+RNN+  G+VP  L++LNEG
Sbjct  179   EIPTSLGSLEVLKRLYLSFNNFSGRIPFSLATIPQLEVVDVRNNSFFGHVPSGLRKLNEG  238

Query  542   FQYTNNPGLCGIGFSSLKLCT---DSALNPSKPEPFGPGSNHLPT--KDIPESANV----  694
             FQ  NNPGLCG+GF +++ CT   +  +     +PF    N+  T  K+IP+SA+     
Sbjct  239   FQGENNPGLCGVGFVTVRNCTVFDNENIKGEGFQPFLSEPNNTATTQKNIPQSADFYNAN  298

Query  695   --QPHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLST  868
               Q H     R P+ AVV   ++  ++   +  L  F WYRRRKQKIG++  S D RLST
Sbjct  299   CNQLHCSKSTRVPKIAVVSAVLIVSVILMVSMILTVF-WYRRRKQKIGNSSLSCDDRLST  357

Query  869   DQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             DQA+E+  +SASPL+ LEYS+GWD LA    G    SQ  L  F+FN++E
Sbjct  358   DQARELYSKSASPLVCLEYSHGWDSLADGIKG-LGLSQ-YLSKFIFNIEE  405



>emb|CDX99903.1| BnaC09g28020D [Brassica napus]
Length=676

 Score =   318 bits (816),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 184/345 (53%), Positives = 236/345 (68%), Gaps = 13/345 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ C+  GQV NISLQGKGL GK+ P IA++K L+GL+LH+N L G +PRE+ NL+ L
Sbjct  59    FEGVGCDWKGQVSNISLQGKGLSGKLSPAIAELKHLTGLFLHYNALVGDIPRELGNLSEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP  I  + SLQVLQLCYN L+G+IP ++GSLK L VLALQSN LTG
Sbjct  119   TDLYLNVNNLSGDIPSHIGKMESLQVLQLCYNNLTGSIPREIGSLKKLIVLALQSNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  L RLDLS+NHLFGS+P KLA    L +LDIRNN+LSGNVP  LKRLNEG
Sbjct  179   AIPASLGDLNALERLDLSYNHLFGSVPGKLAVPPLLRVLDIRNNSLSGNVPPVLKRLNEG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQ-----PHA  706
             F + NN GLCG  FS LK C  +A  P +P+P+       P++ IPESA++Q        
Sbjct  239   FAFENNLGLCGAEFSPLKPCNGTA--PEEPKPYSATVKGFPSRAIPESADLQLPCNGTEC  296

Query  707   LNKPR-KPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE  883
                P        +++G++   +A  A  +  F+ YRRRKQK+ +  + S++ L+    K 
Sbjct  297   SGAPSPNSHQGSILIGLVVSTIALSAVSILLFTHYRRRKQKLSTAYEMSETGLNAKGRKN  356

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
                 + SPL + EYSNGWDPL+  RN  + F QEV++SF FNL+E
Sbjct  357   ----NGSPLASFEYSNGWDPLSDNRN-LSIFDQEVIQSFRFNLEE  396



>gb|KHG14855.1| nsp-interacting kinase 2 -like protein [Gossypium arboreum]
Length=684

 Score =   318 bits (816),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 193/347 (56%), Positives = 233/347 (67%), Gaps = 9/347 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ACNE  +V NISLQGKGL GK+ P IA  K LSGLYLH+N L G +P+E++ L  L
Sbjct  59    FMGVACNEHRKVANISLQGKGLSGKLSPAIAGFKCLSGLYLHYNSLSGKIPQELSQLQEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSGSIPP+I N+  LQVLQLC N+L+GNIP Q+GSLK L V+ALQ N L G
Sbjct  119   TDLYLNVNNLSGSIPPQIGNMAGLQVLQLCCNQLTGNIPTQIGSLKQLNVVALQYNRLDG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG+L +L RLDLSFN LF +IP  LA+  +LEILD+RNNTLSG VP  LKRLNEG
Sbjct  179   KIPPSLGNLRMLKRLDLSFNSLFDAIPPTLADIPELEILDVRNNTLSGLVPSGLKRLNEG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDIPES--ANVQPHA--  706
             FQ  NNPGLCG GF  L+ C     +N ++ EPF P  N+   +    S  +NVQ H   
Sbjct  239   FQGDNNPGLCGAGFPLLRRCGPFDGVNINQVEPFRPHLNNTAPEPGVNSHPSNVQRHCNH  298

Query  707   --LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
                ++P +     V+ GV  ++  F   GLF    YRR+KQKIG+T  SSD   S DQ K
Sbjct  299   THCSRPSRFPEMPVISGVTTVVFIFTVAGLFAVIHYRRQKQKIGNTSGSSDESFSIDQKK  358

Query  881   EVSRR-SASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             E+ R  S SPLI LEYS GWDPL    +G   FSQE L  F FNL+E
Sbjct  359   EILRNGSVSPLITLEYSYGWDPLGDGWSG-IGFSQEHLNKFRFNLEE  404



>ref|XP_004147946.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Cucumis sativus]
 ref|XP_004159511.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Cucumis sativus]
 gb|KGN55915.1| Leucine rich repeat receptor kinase [Cucumis sativus]
Length=683

 Score =   318 bits (814),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 180/350 (51%), Positives = 239/350 (68%), Gaps = 14/350 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ACNE  +V NISLQG+GL GK+ P +A++K LSGLYLH+N+L G +PREI++L  L
Sbjct  61    FVGVACNEHRKVANISLQGRGLSGKVSPAVAELKCLSGLYLHYNNLSGEIPREISSLNEL  120

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VN L+G IP EI N++SLQVLQ+C N+LSG IP Q+GSL+ LTVLALQ N L+G
Sbjct  121   ADLYLDVNSLTGDIPEEIGNMSSLQVLQICCNQLSGKIPTQIGSLRKLTVLALQHNRLSG  180

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG L +L RL LSFN+  G IP  LA   +LE++D+RNN+  G+VP  L++LNEG
Sbjct  181   EIPTSLGSLEMLKRLYLSFNNFSGRIPFNLATIPQLEVVDVRNNSFFGHVPSGLRKLNEG  240

Query  542   FQYTNNPGLCGIGFSSLKLCT---DSALNPSKPEPFGPGSNHLPT--KDIPESANV----  694
             FQ  NNPGLCG+GF +++ CT   +  +     +PF    N+  T  K+IP+SA+     
Sbjct  241   FQGENNPGLCGVGFVTVRKCTVFDNENIKGDGFQPFLSEPNNTATTQKNIPQSADFYNAN  300

Query  695   --QPHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLST  868
               Q H     R P+ AVV   ++  ++   +  L  F WYRRRKQKIG++  S D RLST
Sbjct  301   CNQLHCSKSTRVPKIAVVSAVLIVSVILMVSMILTVF-WYRRRKQKIGNSSLSCDDRLST  359

Query  869   DQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             DQA+E+  +SASPL+ LEYS+GWD LA    G    SQ  L  F+FN++E
Sbjct  360   DQARELYSKSASPLVCLEYSHGWDSLADGIKG-LGLSQ-YLGKFIFNVEE  407



>ref|XP_009383987.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=675

 Score =   317 bits (813),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 184/344 (53%), Positives = 236/344 (69%), Gaps = 17/344 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+AC+E G+V NISLQGKGL G I P +A++K+L+GLY HFN++ G +PR IANLT L
Sbjct  65    FEGVACDEKGKVSNISLQGKGLSGCISPAVARLKSLTGLYFHFNNISGEIPRGIANLTEL  124

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              +LYLNVN+LSGSIP EI ++  LQVLQL  NKLSG+IP +LG LK L +L LQSNHL+G
Sbjct  125   SELYLNVNNLSGSIPEEIGDMDGLQVLQLSNNKLSGSIPPKLGLLKKLNMLDLQSNHLSG  184

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPATLGDL  LT LDLSFN LFGSIP KL+   +L +L ++NN+LSG++P  LKRL E 
Sbjct  185   AIPATLGDLIGLTWLDLSFNQLFGSIPVKLSQLPQLTVLYVQNNSLSGSIPPELKRLGEN  244

Query  542   FQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----  706
             F+Y +N  LCG GF+ L++CT +  LN S+PEPF  G   L  +DIP   N+  H     
Sbjct  245   FKYGSNTDLCGTGFTDLRICTSADLLNASRPEPFSAG---LTPQDIPHFVNISSHCNTTH  301

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              +   K     V + +  ++     +GL  F WYRRRKQK G         LSTD AK  
Sbjct  302   CSSSSKSANLAVFITITVVVFGIMISGLMAFVWYRRRKQKNG--------LLSTDLAKFS  353

Query  887   SRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              +RSASPLI+LEYSN WDP+    +G  + SQE+ +++ FNL+E
Sbjct  354   YQRSASPLISLEYSNRWDPMTDQSSG-ISLSQEISQNYKFNLEE  396



>ref|XP_011081121.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Sesamum indicum]
Length=685

 Score =   317 bits (813),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 186/346 (54%), Positives = 238/346 (69%), Gaps = 9/346 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE  +V NISLQGKGL GK+PP +A++K LSGLYLH+N L G +PREIANLT L
Sbjct  63    FEGVACNEHRKVANISLQGKGLTGKVPPAVAELKCLSGLYLHYNSLSGEIPREIANLTEL  122

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+L+G+IPPEI ++ SLQVLQLC N L+G+IP Q+G L+ L+VLAL+SN LTG
Sbjct  123   TDLYLNVNNLTGTIPPEIGSMASLQVLQLCCNHLTGSIPTQMGFLQRLSVLALESNGLTG  182

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IPA+LGDL +L RL LSFN L G IP +LAN   LE+LD++NNTLSG VP  L+RLNEG
Sbjct  183   QIPASLGDLGMLKRLYLSFNQLSGPIPVRLANNPSLEVLDVQNNTLSGVVPSGLRRLNEG  242

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDIPESA------NVQP  700
             F + NNPGLCG GFSSL+ CT    LN ++ +P  P +N     ++P+SA      N   
Sbjct  243   FHFDNNPGLCGTGFSSLRACTAWDNLNINQVDPSTPVANRTAPTNVPQSAAFPLPCNQSD  302

Query  701   HALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
              + +  R PQ  +V   +   +       +     YRRRKQK+G+  D+SD RLS DQ K
Sbjct  303   CSRSSSRLPQIGIVAGVITVTVGLTVVVFVCVVR-YRRRKQKVGNKSDTSDDRLSIDQVK  361

Query  881   EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             +V +RS SPL+ LEYSN W+P   A++ N       L+   FNL+E
Sbjct  362   DVYKRSPSPLVALEYSNSWNPTNAAQDCN-GLCHVFLQGSKFNLEE  406



>emb|CBI38873.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/236 (71%), Positives = 194/236 (82%), Gaps = 3/236 (1%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            FEG+ACNE G VVNISLQGKGL G+IP EIA++K+LSGL+LHFN L+G +P+EI+ L  L
Sbjct  28   FEGVACNEYGHVVNISLQGKGLMGQIPKEIAELKSLSGLFLHFNSLYGEIPKEISALAEL  87

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             DLYLNVN+LSG I P I N+++LQVLQLCYNKL+G IP QLGSLK L+VLALQSN LTG
Sbjct  88   SDLYLNVNNLSGVIHPGIGNMSNLQVLQLCYNKLTGGIPTQLGSLKKLSVLALQSNELTG  147

Query  362  AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
            AIPA+LGDL +LTRLDLSFN+LFG IP KLANA  LEILDIRNNTLSGNVP ALKRLN+G
Sbjct  148  AIPASLGDLEMLTRLDLSFNNLFGPIPVKLANAPMLEILDIRNNTLSGNVPQALKRLNDG  207

Query  542  FQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFGPGSNHLPTKDIPESANVQPHA  706
            FQY NNP LCG GF +L +C+ S  LNP++PEPFGP  N      +PESAN+QP  
Sbjct  208  FQYRNNPSLCGDGFLALDVCSASDQLNPNRPEPFGP--NGTDKNGLPESANLQPDC  261



>ref|XP_004973001.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Setaria italica]
Length=689

 Score =   314 bits (805),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 181/343 (53%), Positives = 232/343 (68%), Gaps = 5/343 (1%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ C+  G+V  ISLQGKGL G +PP +A +  L+GLYLH+N L GA+PRE+  L  L
Sbjct  68    FEGVTCDARGRVATISLQGKGLAGAVPPAVAMLPGLTGLYLHYNDLGGAIPRELGGLPDL  127

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              +LYL VN+LSG IP E+  + SLQVLQL YN+LSG+IP QLG LK LTVLALQSN LTG
Sbjct  128   AELYLGVNNLSGDIPAELGRLASLQVLQLGYNQLSGSIPTQLGQLKKLTVLALQSNQLTG  187

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  LTRLDLS N LFGSIP+KLA   +L  L++RNNTLSG+VP  LK+L+EG
Sbjct  188   AIPASLGDLPALTRLDLSSNQLFGSIPSKLAEIPQLSTLNLRNNTLSGSVPSGLKKLHEG  247

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHALN---  712
             F+Y NN  LCG  F SLK C D + N     P  P S  +  + I ++A++  +  N   
Sbjct  248   FRYENNSELCGAQFDSLKPCPDDS-NDDGKMPHKPESTSVKPQQIQKTADLNRNCDNGGC  306

Query  713   -KPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
              KP       V+ G + ++    A GL  FSW+RR+KQK+GS+++  + RLS DQ+KE  
Sbjct  307   SKPSTLSAGAVIAGTIIIVAGAAACGLSVFSWHRRQKQKVGSSVEHLEGRLSLDQSKETC  366

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             +RSAS LIN+EYS+GWD  ++     A  S E   S  FNL+E
Sbjct  367   QRSASSLINVEYSSGWDTSSEGSQHGARLSSEGSPSVRFNLEE  409



>ref|XP_010443441.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase IMK2 [Camelina sativa]
Length=682

 Score =   310 bits (795),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 179/343 (52%), Positives = 235/343 (69%), Gaps = 7/343 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ C+  GQV NISLQGKGL GKI P IA++K L+GL+LH+N L G +PRE+ NL+ L
Sbjct  63    FEGVGCDWKGQVSNISLQGKGLSGKISPNIAKLKHLTGLFLHYNALVGDIPRELGNLSEL  122

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP     +  LQVLQL YN L+G IP +LGSL NL+VL LQSN LTG
Sbjct  123   TDLYLNVNNLSGWIPSSFGKMQGLQVLQLGYNNLTGCIPRELGSLSNLSVLTLQSNKLTG  182

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL+ L RLDLS+N  FGS+P +LAN   L +LDIRNN+L+G+VP  LKRLNEG
Sbjct  183   AIPASLGDLSALERLDLSYNLFFGSVPERLANPPLLRVLDIRNNSLTGSVPPVLKRLNEG  242

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----L  709
             F + NN  LCG  F SLK C  SA   +K  PFG    ++P++DIP+S  ++        
Sbjct  243   FAFDNNSRLCGAEFPSLKPCNGSARLGAK--PFGATVTNVPSRDIPQSDILRLPCNGTNC  300

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
             N P K     +++G++   +A  A  +  F+ YRRRKQK+ +  + SD+RL+        
Sbjct  301   NAPPKSHQGAILIGLVVSTIALSAVSILLFTHYRRRKQKLSTAYEMSDTRLNNSVVGGFR  360

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + + SPL +LEY+NGWDPL+   N  + F+QEV++SF FNL+E
Sbjct  361   KNNGSPLASLEYTNGWDPLSDNMN-LSVFAQEVIQSFRFNLEE  402



>ref|XP_010024716.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Eucalyptus grandis]
 gb|KCW61180.1| hypothetical protein EUGRSUZ_H03944 [Eucalyptus grandis]
Length=669

 Score =   309 bits (792),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 181/326 (56%), Positives = 227/326 (70%), Gaps = 11/326 (3%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            F+G+ACNE  +V NISLQGKGL GK+PP +AQ+K LSGLYLH+N+L G +PREI+ LT L
Sbjct  59   FDGVACNEHQKVANISLQGKGLSGKVPPAMAQLKCLSGLYLHYNYLTGEIPREISRLTEL  118

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             DLYL+VN+L+GSIP EI ++ SLQVLQLCYN+L+G IP Q+GSLK L+VLALQ N L+G
Sbjct  119  TDLYLDVNNLTGSIPSEIGSMASLQVLQLCYNQLNGTIPPQIGSLKKLSVLALQHNKLSG  178

Query  362  AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             I   L +L  L RL L FN   G+ P ++A   +L+ LD++NN+LSG VP ALK+L E 
Sbjct  179  DIHG-LANLQTLKRLVLGFNGFNGTFPVEIAKIPELQTLDVQNNSLSGFVPAALKKL-ER  236

Query  542  FQYTNNPGLCGIGFSSLKLCT--DSALNPSKPEPFGPGSNHLP-TKDIPESANVQPHALN  712
            F Y NNPGLCG GF SL+ C   D  L+P+   P       +P T D+    N Q H  N
Sbjct  237  FNYQNNPGLCGSGFPSLRNCNNFDPNLHPNGVNPI----VLIPRTPDVKTHCN-QSHCSN  291

Query  713  KPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSR  892
              + PQ A +V G++ + V     GL TF  YRR KQKIGST D+SD RLSTDQ+K++  
Sbjct  292  PSKLPQAA-LVAGIVSVTVTLVGAGLLTFYRYRRGKQKIGSTADASDGRLSTDQSKDLYS  350

Query  893  RSASPLINLEYSNGWDPLAKARNGNA  970
            RSASPL+ LEYS+GWDPL   R GN 
Sbjct  351  RSASPLVCLEYSSGWDPLDDGRCGNG  376



>ref|XP_010676667.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=684

 Score =   310 bits (793),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 179/349 (51%), Positives = 239/349 (68%), Gaps = 11/349 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ACN+  +V NISLQG+GL GK+ P I  +K LSG+YLH+N + G +PRE+  LT L
Sbjct  58    FVGVACNDHRKVANISLQGRGLAGKLSPAIGDLKCLSGIYLHYNSISGEIPREVGKLTEL  117

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLN N+LSG +PPEI+++ SLQVL LC N L+GNIP QL SL  L  L LQ+N L G
Sbjct  118   TDLYLNYNNLSGIVPPEITHMISLQVLDLCCNHLTGNIPTQLSSLSKLGALYLQNNQLNG  177

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             +IP +LG L +L RLDLS+NHL G IP  LAN Q L+ILD+RNN+LSG +P +LKRL+ G
Sbjct  178   SIPPSLGSLDMLKRLDLSYNHLSGPIPVTLANIQPLKILDVRNNSLSGAIPTSLKRLDTG  237

Query  542   FQYTNNPGLCGIGFSSLKLCT--DSA-LNPSKPEPFGPGSNH--LPTKDIPESA-----N  691
             F Y NN  LCG  F  L+ CT  D+A ++ + P PFG   N+   P  + P++A     +
Sbjct  238   FLYQNNTKLCGPAFFKLRACTAFDNANVDVNTPRPFGLILNNHTTPKHEEPKNATDLQTD  297

Query  692   VQPHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD  871
               P   ++P K    V+V+GV+  +V   A G  T+  YRR+KQKIG+T+D+S+SR STD
Sbjct  298   CSPSTCSQPTKFPRIVIVIGVITGLVTLAAVGFLTYIRYRRQKQKIGTTVDASESRFSTD  357

Query  872   QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              A E+  ++ASPL++L YS GWDPLA   N +   SQE L++F +NL+E
Sbjct  358   HANELHSKNASPLVSLAYSTGWDPLADGLN-SGDLSQEALQNFRYNLEE  405



>ref|XP_009789637.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Nicotiana sylvestris]
Length=684

 Score =   309 bits (791),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 177/350 (51%), Positives = 234/350 (67%), Gaps = 16/350 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ CNE  ++ NISLQGKGL GK+ P +A++K LSGLYLH+N L G +P+E+ NLT L
Sbjct  61    FLGVFCNEHHKIANISLQGKGLTGKLSPAMAELKCLSGLYLHYNLLSGEIPKELGNLTEL  120

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLN N+LSG+IPPEI  + SLQ L L  N+L G+IP ++G LK L VLAL+ N LTG
Sbjct  121   TDLYLNDNNLSGTIPPEIGRMASLQALVLSCNQLKGSIPTEIGFLKKLIVLALEHNMLTG  180

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP+ LG   +L RL L FN L G IP+KLA A +LE+L+I+NNTL+G VP AL+RL+  
Sbjct  181   EIPSNLGIQGMLKRLYLGFNQLSGPIPSKLATAPQLEVLEIQNNTLTGVVPPALRRLSGK  240

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNH--LPTKDIPESANV------  694
             F Y +NPGLCG GF+SL++CT    +N ++ +P  P SN+  +P KD+PE+ANV      
Sbjct  241   FNYESNPGLCGTGFASLRVCTAWDNVNVNQVDPNEPNSNNNGVP-KDVPETANVSRLHCN  299

Query  695   QPHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRR--KQKIGSTIDSSDSRLST  868
             Q H     R PQ  +V   +   +    A     F  +RRR  KQ++G+T D+SD RLST
Sbjct  300   QTHCSRSSRFPQVIIVASVITVTVTLIVAV---VFGIFRRRRFKQRVGNTSDASDDRLST  356

Query  869   DQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             DQ KE+ +RS SPL+ +EYSN WDP+   + G  +   E L  F FNL+E
Sbjct  357   DQTKEIYKRSPSPLLTVEYSNHWDPMTPEK-GYGSMRYEFLHGFKFNLEE  405



>ref|XP_006573733.1| PREDICTED: somatic embryogenesis receptor kinase 2-like isoform 
X2 [Glycine max]
Length=655

 Score =   308 bits (789),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 183/348 (53%), Positives = 239/348 (69%), Gaps = 9/348 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE  +V NISLQGKGL G + P +A++K LSGLYLH+N+L G +P  I+NLT L
Sbjct  28    FEGVACNEHRKVANISLQGKGLSGWLSPALAELKCLSGLYLHYNNLSGEIPPRISNLTEL  87

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             +DLYL+VN LSG+IPPEISN+ SLQVLQL  N+L GNIP Q+GSLK+L+ LALQ N LTG
Sbjct  88    VDLYLDVNSLSGAIPPEISNMASLQVLQLGDNQLVGNIPTQMGSLKHLSTLALQYNKLTG  147

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG+L  L+RL+LSFN+  G++PA LA+ + LE+LDI+NN LSG VP ALKRL E 
Sbjct  148   QIPLSLGNLEKLSRLNLSFNNFSGTVPATLAHIEHLEVLDIQNNYLSGIVPSALKRLGER  207

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPG--SNHLPTKDIPESANVQPHA--  706
             FQ  NNPGLCG+GFS+L+ C  D  LN +  +        N   +K +PE A VQ H   
Sbjct  208   FQGANNPGLCGVGFSTLRACNKDQDLNVNHIDTSDGDQPENSDSSKALPEPAYVQSHCGQ  267

Query  707   --LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGST-IDSSDSRLSTDQA  877
                +K R+    V+  GV+ + +AF   G  TF  YRR+KQ+I +T   SS+ ++S DQ 
Sbjct  268   THCSKSRRFPHTVITAGVIIVALAFICAGFLTFFRYRRQKQRISNTSSSSSEGKVSPDQP  327

Query  878   KEVSRRSASPLINLEYSNGWDPLAKARNGNA-AFSQEVLESFMFNLDE  1018
             KE   +S S L+N+EY +GWDPL+  +N +      E L  F FN+DE
Sbjct  328   KEFYTKSPSALVNIEYYSGWDPLSNGQNADVGGLCNEYLNQFRFNVDE  375



>ref|XP_002443773.1| hypothetical protein SORBIDRAFT_07g001690 [Sorghum bicolor]
 gb|EES13268.1| hypothetical protein SORBIDRAFT_07g001690 [Sorghum bicolor]
Length=699

 Score =   308 bits (790),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 181/343 (53%), Positives = 223/343 (65%), Gaps = 5/343 (1%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ C+  G+V  ISLQGKGL G +PP +A +  L+GLYLH+N+L G +PRE+  L  L
Sbjct  65    FEGVTCDARGRVATISLQGKGLSGTVPPAVAMLPALTGLYLHYNNLGGEIPRELGGLPDL  124

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              +LYL VN+LSG+IP E+  + SLQVLQL YN+LSG+IP QLG L  LTVLALQSN LTG
Sbjct  125   AELYLGVNNLSGAIPVELGRLGSLQVLQLGYNQLSGSIPTQLGELNKLTVLALQSNQLTG  184

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  LTRLDLS N LFGSIPAKLA    L  LD+RNNTLSG+VP  LK+LNEG
Sbjct  185   AIPASLGDLPALTRLDLSSNQLFGSIPAKLAEIPHLATLDLRNNTLSGSVPSGLKKLNEG  244

Query  542   FQYTNNPGLCGIGFSSLKLC----TDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHAL  709
             F Y NN  LCG  F SLK C     D    P KPE        +  K I  + N      
Sbjct  245   FLYENNSELCGAQFGSLKACPNDGNDDGKMPRKPESTSVKPQQI-QKTIDLNRNCDNGVC  303

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
              KP    T  V+ G + ++    A GL  FSW+RR+KQK+GS+++  + R S DQ+KE  
Sbjct  304   TKPSSLSTGAVIAGTVIIVAGAAACGLSVFSWHRRQKQKVGSSVEHLEGRPSLDQSKETY  363

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             +RSAS LIN+EYS+GWD  ++        S E   S  FNL+E
Sbjct  364   QRSASSLINVEYSSGWDTSSEGSQHGVRLSSEGSPSVRFNLEE  406



>gb|KHN34965.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=689

 Score =   308 bits (789),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 184/359 (51%), Positives = 241/359 (67%), Gaps = 31/359 (9%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACN+  +V NISLQGKGL G + P +A++K LSGLYLH+N+L G +P  I+NLT L
Sbjct  62    FEGVACNDHRKVANISLQGKGLSGWLSPALAELKCLSGLYLHYNNLSGEIPPHISNLTEL  121

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             LDLYL+VN LSG+IPPEI+N+ SLQVLQL  N+L G IP Q+ SLK L+ LALQ N LTG
Sbjct  122   LDLYLDVNTLSGTIPPEIANMASLQVLQLGDNQLVGTIPTQMSSLKQLSTLALQYNKLTG  181

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG+L  L+RL+LSFN+  G++PA LA+ + LE+LDI+NN+LSG VP ALKRL EG
Sbjct  182   QIPLSLGNLEKLSRLNLSFNNFSGTVPATLAHIEHLEVLDIQNNSLSGIVPSALKRLGEG  241

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPGSNHLPTKD------------IPE  682
             FQ  NNPGLCG+GFS+L+ C  D  LN           NH+ T D            +PE
Sbjct  242   FQGANNPGLCGVGFSTLRACNKDQDLNV----------NHIDTSDGDQPKNSNSSKALPE  291

Query  683   SANVQPHA----LNKPRK-PQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTI-D  844
              A VQ H      +K R+ PQT  +  GV+ + + F   G  TF  YRR+KQ+I +T+  
Sbjct  292   PAYVQLHCGQTHCSKSRRFPQTV-ITAGVVIVTLTFICAGFLTFFRYRRQKQRISNTLSS  350

Query  845   SSDSRLSTDQAKEVSRRSASPLINLEYSNGWDPLAKARNGNA-AFSQEVLESFMFNLDE  1018
             SS+ ++S DQ KE   +S S L+N++Y +GWD L+  +N +A   S E L  F FN+DE
Sbjct  351   SSEGKVSLDQPKEFYTKSPSALVNIDYYSGWDQLSNGQNADAGGLSHEYLNQFRFNVDE  409



>ref|XP_007157320.1| hypothetical protein PHAVU_002G060200g [Phaseolus vulgaris]
 gb|ESW29314.1| hypothetical protein PHAVU_002G060200g [Phaseolus vulgaris]
Length=683

 Score =   308 bits (788),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 238/348 (68%), Gaps = 11/348 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+ACN+  +V NISLQGKGL G + P +A++K LSGLYLH+N+L G +P  I+NLT L
Sbjct  58    FQGVACNQNQKVANISLQGKGLSGWLSPALAELKCLSGLYLHYNNLSGEIPPHISNLTDL  117

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             +DLYL+VN LSG+IPPE+ N+ SLQVLQL  N+L GNIP Q+GSLK L+ LALQ N LTG
Sbjct  118   VDLYLDVNSLSGTIPPELGNMASLQVLQLGDNQLVGNIPTQMGSLKQLSTLALQYNKLTG  177

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG L  L RL+LSFN+  G++PA LA+ + LE+LD++NN+LSG VP ALKRL EG
Sbjct  178   QIPLSLGTLEKLRRLNLSFNNFNGTVPATLAHIEHLEVLDVQNNSLSGIVPSALKRLGEG  237

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFG---PGSNHLPTKDIPESANVQPHA-  706
             FQ  NNPGLCG+ FS+LK C  D  LN +  +      P S +  +K +PE ANVQ H  
Sbjct  238   FQGANNPGLCGVEFSTLKACNKDQNLNVNHIDTLDRDQPKSRN-SSKALPEPANVQLHCD  296

Query  707   ---LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQA  877
                 +K R PQ   +  GV+ + + F   G  TF  YRR+KQ+I +T  SS  +LS D+ 
Sbjct  297   HTHCSKSRFPQIV-ITAGVIAVSLTFICAGFLTFFRYRRQKQRISNTSSSSQGKLSPDKP  355

Query  878   KEVSRRSASPLINLEYSNGWDPLAKARNGNA-AFSQEVLESFMFNLDE  1018
             KE+  +S S L+N+EY +GWD L+  +N +A     + L  F FN+DE
Sbjct  356   KELYTKSPSALVNIEYYSGWDHLSNGQNADAGGLLNDYLSQFRFNVDE  403



>ref|XP_003517433.1| PREDICTED: somatic embryogenesis receptor kinase 2-like isoform 
X1 [Glycine max]
 gb|KHN42717.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=689

 Score =   308 bits (789),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 183/348 (53%), Positives = 239/348 (69%), Gaps = 9/348 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE  +V NISLQGKGL G + P +A++K LSGLYLH+N+L G +P  I+NLT L
Sbjct  62    FEGVACNEHRKVANISLQGKGLSGWLSPALAELKCLSGLYLHYNNLSGEIPPRISNLTEL  121

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             +DLYL+VN LSG+IPPEISN+ SLQVLQL  N+L GNIP Q+GSLK+L+ LALQ N LTG
Sbjct  122   VDLYLDVNSLSGAIPPEISNMASLQVLQLGDNQLVGNIPTQMGSLKHLSTLALQYNKLTG  181

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG+L  L+RL+LSFN+  G++PA LA+ + LE+LDI+NN LSG VP ALKRL E 
Sbjct  182   QIPLSLGNLEKLSRLNLSFNNFSGTVPATLAHIEHLEVLDIQNNYLSGIVPSALKRLGER  241

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPG--SNHLPTKDIPESANVQPHA--  706
             FQ  NNPGLCG+GFS+L+ C  D  LN +  +        N   +K +PE A VQ H   
Sbjct  242   FQGANNPGLCGVGFSTLRACNKDQDLNVNHIDTSDGDQPENSDSSKALPEPAYVQSHCGQ  301

Query  707   --LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGST-IDSSDSRLSTDQA  877
                +K R+    V+  GV+ + +AF   G  TF  YRR+KQ+I +T   SS+ ++S DQ 
Sbjct  302   THCSKSRRFPHTVITAGVIIVALAFICAGFLTFFRYRRQKQRISNTSSSSSEGKVSPDQP  361

Query  878   KEVSRRSASPLINLEYSNGWDPLAKARNGNA-AFSQEVLESFMFNLDE  1018
             KE   +S S L+N+EY +GWDPL+  +N +      E L  F FN+DE
Sbjct  362   KEFYTKSPSALVNIEYYSGWDPLSNGQNADVGGLCNEYLNQFRFNVDE  409



>ref|XP_003538634.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X1 [Glycine max]
Length=689

 Score =   308 bits (788),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 184/359 (51%), Positives = 241/359 (67%), Gaps = 31/359 (9%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACN+  +V NISLQGKGL G + P +A++K LSGLYLH+N+L G +P  I+NLT L
Sbjct  62    FEGVACNDHRKVANISLQGKGLSGWLSPALAELKCLSGLYLHYNNLSGEIPPHISNLTEL  121

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             LDLYL+VN LSG+IPPEI+N+ SLQVLQL  N+L G IP Q+ SLK L+ LALQ N LTG
Sbjct  122   LDLYLDVNTLSGTIPPEIANMASLQVLQLGDNQLVGTIPTQMSSLKQLSTLALQYNKLTG  181

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG+L  L+RL+LSFN+  G++PA LA+ + LE+LDI+NN+LSG VP ALKRL EG
Sbjct  182   QIPLSLGNLEKLSRLNLSFNNFSGTVPATLAHIEHLEVLDIQNNSLSGIVPSALKRLGEG  241

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPGSNHLPTKD------------IPE  682
             FQ  NNPGLCG+GFS+L+ C  D  LN           NH+ T D            +PE
Sbjct  242   FQGANNPGLCGVGFSTLRACNKDQDLNV----------NHIDTSDGDQPKNSNSSKALPE  291

Query  683   SANVQPHA----LNKPRK-PQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTI-D  844
              A VQ H      +K R+ PQT  +  GV+ + + F   G  TF  YRR+KQ+I +T+  
Sbjct  292   PAYVQLHCGQTHCSKSRRFPQTV-ITAGVVIVTLTFICAGFLTFFRYRRQKQRISNTLSS  350

Query  845   SSDSRLSTDQAKEVSRRSASPLINLEYSNGWDPLAKARNGNA-AFSQEVLESFMFNLDE  1018
             SS+ ++S DQ KE   +S S L+N++Y +GWD L+  +N +A   S E L  F FN+DE
Sbjct  351   SSEGKVSLDQPKEFYTKSPSALVNIDYYSGWDQLSNGQNADAGGLSNEYLNQFRFNVDE  409



>ref|XP_003573305.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Brachypodium distachyon]
Length=710

 Score =   306 bits (783),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 172/343 (50%), Positives = 231/343 (67%), Gaps = 4/343 (1%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+AC+  G+V  +SLQG+GL G +PP +A +  L+GLYLH+N L G++PRE+  L  L
Sbjct  76    FEGVACDARGRVSVVSLQGRGLAGTVPPAVAMLPGLTGLYLHYNRLGGSIPRELGELPDL  135

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              +LYL VN L+GS+P E+  +  LQVLQL YN+LSG+IP QLG LK LTVLALQSN LTG
Sbjct  136   AELYLGVNSLNGSVPVELGRLRCLQVLQLGYNQLSGSIPTQLGQLKKLTVLALQSNQLTG  195

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  +TRLDLS N LFGSIP+KLA+   L+ LD+RNNTLSG+VP  LK+L+ G
Sbjct  196   AIPASLGDLPEMTRLDLSSNRLFGSIPSKLADIPNLKTLDLRNNTLSGSVPSGLKKLHRG  255

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESA----NVQPHAL  709
             F++ NNP LCG  F SLK C +   +     P  P S  +  + I ++A    N    A 
Sbjct  256   FRFENNPELCGARFDSLKPCPNGDNSIDDQVPHKPESTSVKPQQIAQTADLSRNCDNGAC  315

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
             ++P    +  V+ G + ++    A GL  FSW+RR+KQK+GS++++S+ R S DQ KE  
Sbjct  316   SRPSNLSSGAVLAGTIIIVAGVAACGLSVFSWHRRQKQKVGSSVENSECRFSLDQPKEAY  375

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             ++SAS LIN+EYS+GWD  ++        S E   S  FNL+E
Sbjct  376   QKSASSLINVEYSSGWDTSSEGSQHGVRLSPEGSPSIRFNLEE  418



>ref|XP_003611243.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES94201.1| LRR receptor-like kinase [Medicago truncatula]
Length=683

 Score =   305 bits (780),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 182/349 (52%), Positives = 231/349 (66%), Gaps = 15/349 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNE  +V NISLQGKGL+G +   +A++K LSGLYLH+N+L G +P +I+NLT L
Sbjct  59    FEGIACNEHWKVANISLQGKGLFGSLSSSVAELKCLSGLYLHYNNLSGEIPSQISNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             +DLYL+VN LSG IPPEI N+ SLQVLQL  N+L GNIP Q+GSLK LT LALQ N LTG
Sbjct  119   VDLYLDVNSLSGRIPPEIGNMASLQVLQLGDNQLVGNIPTQMGSLKQLTTLALQYNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG+L  L+RL+LSFN+  G+IPA LAN   LE+LDI+NN+LSG VP  L+RL EG
Sbjct  179   QIPLSLGNLENLSRLNLSFNNFSGAIPATLANIAHLEVLDIQNNSLSGTVPSVLQRLGEG  238

Query  542   FQYTNNPGLCGIGFSSLKLCT-DSALNPSKPEPFGPGSNHL----PTKDIPESANVQPHA  706
             FQ  NN GLCG+G S+L+ C  +  LN S  +      +HL    P    PE AN Q H 
Sbjct  239   FQGANNQGLCGVGISTLRACNKEPDLNVSNIDT--SDQDHLKNSNPATPRPEPANFQMHC  296

Query  707   ----LNKPRK-PQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD  871
                  +K R  P + +    +  + +     GLFTF  YRRRKQKI S  +SS+ +LS  
Sbjct  297   NQKHCSKSRSVPTSVITASVIAIITLTIIGAGLFTFVKYRRRKQKISS--NSSEGKLSPQ  354

Query  872   QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             Q KE+ ++S S L+NL+Y NG  P+   +N     S E L  F FN+DE
Sbjct  355   QPKELYQKSPSTLVNLDYYNGCYPMPDDQNA-GGLSNEYLNQFRFNVDE  402



>ref|XP_010108139.1| LRR receptor-like serine/threonine-protein kinase GSO2 [Morus 
notabilis]
 gb|EXC17871.1| LRR receptor-like serine/threonine-protein kinase GSO2 [Morus 
notabilis]
Length=684

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 183/349 (52%), Positives = 231/349 (66%), Gaps = 13/349 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ACNE  +V NISLQGKGL GK+   +A+++ LSGLYLH+N+L G +PRE++NLT L
Sbjct  60    FEGVACNEHHKVANISLQGKGLSGKLSSAVAELRCLSGLYLHYNNLSGEIPRELSNLTEL  119

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP +I  + SLQVLQLC N+LSG IP ++G LK L+V+ALQ N LTG
Sbjct  120   TDLYLNVNNLSGDIPSQIGKMASLQVLQLCCNQLSGKIPTEMGLLKKLSVVALQYNKLTG  179

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG+L +L RLDLSFN L G IP  L   Q L++LD++NN+LSG VP  L+RLNEG
Sbjct  180   EIPPSLGNLGILKRLDLSFNTLSGKIPTTLGTIQSLQVLDLKNNSLSGFVPPGLRRLNEG  239

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGP-GSN----HLPTKDIPESANV----  694
             F   NNP LCG+GF+ L+ CT           FGP GSN      PT++ PESAN     
Sbjct  240   FHAENNPSLCGVGFAKLRACTSFDNYNMDVGVFGPSGSNGNATDGPTQN-PESANFHSTC  298

Query  695   -QPHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD  871
              + H     R    A VV  V+ + ++  A        YRR+KQKIG+  D SD RLS D
Sbjct  299   NRAHCARSTRF-SLAAVVAVVIAVTISMIAIVFLIIIRYRRQKQKIGNHCDPSDGRLSID  357

Query  872   QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             QAKE   +SASPL++LEY NGWDPL     G    SQE L +  FN+++
Sbjct  358   QAKEFRSKSASPLVSLEYCNGWDPLGDGLKG-IGLSQEYLNNKKFNMED  405



>ref|XP_010529507.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 [Tarenaya hassleriana]
Length=688

 Score =   301 bits (772),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 180/353 (51%), Positives = 233/353 (66%), Gaps = 18/353 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F GIACNE  +V N+SLQGKGL GK+ P +A++K LSGLYLH+N L G +P EI NLT L
Sbjct  59    FVGIACNEHRKVANVSLQGKGLTGKLSPAVAELKCLSGLYLHYNSLWGEIPEEITNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             LDLYLNVN+ SG IP +I  +TSLQV+ LC N+L+G IP Q+GSLK LTVL+LQ N+LTG
Sbjct  119   LDLYLNVNNFSGQIPAKIGAMTSLQVVDLCCNQLTGKIPEQMGSLKKLTVLSLQYNNLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP++LG+L +L+RLD+SFN L G IP  L++  +L+ LD+RNN+LSG VP  LK L+  
Sbjct  179   EIPSSLGNLDMLSRLDVSFNDLLGPIPKTLSDIPQLDTLDLRNNSLSGIVPPGLKELSGR  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNP------SKPEPFGPGSNHLPTKDIPESANVQPH  703
             FQ+ NNPGLCG GF SL+ C  SA +        +P P   GS+    +DIP++     H
Sbjct  239   FQFENNPGLCGTGFPSLRAC--SAFDNVNIEQLKQPSP-QIGSDKSSLQDIPKTVYFHGH  295

Query  704   A----LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD  871
                    K  K    V++  V+ + +    TG  TF  YRRRKQKI +T + S+ RLSTD
Sbjct  296   CNQTRCKKSSKLPQVVLISSVITVSITLIGTGFLTFLRYRRRKQKISNTTEVSEGRLSTD  355

Query  872   QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQE----VLESFMFNLDE  1018
               K++S   ASPL  L YS  WDPL  +RNG A FSQ+       SF F+L++
Sbjct  356   LQKDMSVNGASPLTGLGYSKEWDPLGDSRNG-AGFSQDHHFLANSSFRFSLED  407



>ref|XP_010055541.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Eucalyptus grandis]
 gb|KCW72023.1| hypothetical protein EUGRSUZ_E00473 [Eucalyptus grandis]
Length=660

 Score =   300 bits (769),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 173/327 (53%), Positives = 219/327 (67%), Gaps = 22/327 (7%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            F+G+ACNE  +V  ISLQGK L GK+PP +AQ+K LSGLYLH+N L G +PREI++LT L
Sbjct  59   FDGVACNEHQKVATISLQGKRLSGKVPPAVAQLKCLSGLYLHYNSLTGEIPREISSLTEL  118

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             DLYL+VN+L+GSIP EI ++ SL+VLQLC N+L+G IP Q+ SLK L+VLALQ N+ +G
Sbjct  119  TDLYLDVNNLTGSIPSEIGSMASLEVLQLCCNQLNGTIPLQIKSLKKLSVLALQHNNFSG  178

Query  362  AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             I   L DL  L  LDL+FN   G+ P ++A    L+ LDIRNN+LSG VP ALK L E 
Sbjct  179  DIIG-LADLQSLKSLDLAFNRFSGTFPVEIAKIPHLQTLDIRNNSLSGFVPPALKNLGER  237

Query  542  FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----L  709
            F Y NNPGLCG GF SL+ C                 N+     IP++A+V+ H      
Sbjct  238  FNYQNNPGLCGSGFHSLRNC-----------------NNFGQNLIPKTADVKKHCNQSHC  280

Query  710  NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
            ++P K   A +V G++ + V     GL TF  YRR KQKIGST D+SD RLSTDQ+K++ 
Sbjct  281  SEPSKLPQAALVAGIVSVTVTLVGAGLITFYRYRRGKQKIGSTADASDGRLSTDQSKDLY  340

Query  890  RRSASPLINLEYSNGWDPLAKARNGNA  970
             RSASPL+ LEYS+GWDPL   R GN 
Sbjct  341  SRSASPLVCLEYSSGWDPLDDGRCGNG  367



>emb|CDP09887.1| unnamed protein product [Coffea canephora]
Length=679

 Score =   301 bits (770),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 231/346 (67%), Gaps = 11/346 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ACNE  +V NISLQ KGL GK+PP +A+++ LSGLYLH+N L G +P+EIANL  L
Sbjct  59    FLGVACNEHRKVANISLQSKGLTGKVPPALARLECLSGLYLHYNSLTGQIPKEIANLNEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG+IPPE+ ++ SLQVLQL  N+L+GNIP ++G L+ L VLAL+ N LTG
Sbjct  119   NDLYLNVNNLSGTIPPELGSMASLQVLQLSGNQLTGNIPTEMGFLRKLNVLALEYNGLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             +IPA LG+L +L RL LSFN L GSIP  LA A  LE+LD++NNTLSG VP AL++LNEG
Sbjct  179   SIPANLGNLGMLRRLYLSFNQLSGSIPVALAGAPNLEVLDVQNNTLSGVVPPALQKLNEG  238

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKP  718
             F + NNP LCG+GF+SL+ CT    LN ++  P  P SN+     +P+ A V  H  N+ 
Sbjct  239   FHFENNPDLCGVGFTSLRNCTAWDNLNINQVAPLAPTSNN-NASPLPQFAYVHVHC-NQT  296

Query  719   RK------PQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
             R       P+ A+V            A  L  F  +RR+KQ+IG+T D SD R S  Q K
Sbjct  297   RCSSSSKLPRIAIVSGVTALTGSLMIAAFLSIFR-HRRQKQRIGNTSDISDDRCSIGQIK  355

Query  881   EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             E S RS SPL+ LEYS GWD +   +N +     E+ +   FNLDE
Sbjct  356   E-SCRSPSPLVCLEYSKGWDQMIAEQNCHGLCPTELPKGLKFNLDE  400



>emb|CDM83247.1| unnamed protein product [Triticum aestivum]
Length=693

 Score =   300 bits (769),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 225/346 (65%), Gaps = 14/346 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+ C+  G V N+SLQGKGL G + P +A ++ L+GLYLH+N L G VPRE+A LT L
Sbjct  63    FEGVVCDGSGAVANVSLQGKGLPGTLSPAVAGLRALTGLYLHYNALRGGVPRELARLTWL  122

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              D+YLNVN+ SG IP EI  + SLQVLQLCYN+L+G+IP QLG L  LTVLALQSNHL G
Sbjct  123   TDVYLNVNNFSGPIPAEIGAMASLQVLQLCYNQLTGSIPTQLGLLNRLTVLALQSNHLNG  182

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L  L RLDLSFNHLFGSIP +LA   ++  LD+RNN+L+G+VP  L +L  G
Sbjct  183   AIPASLGNLPELRRLDLSFNHLFGSIPVRLARLPQITALDVRNNSLTGSVPSELAKLEGG  242

Query  542   FQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDIPESANVQPHALNKP  718
             FQY NN  LCG G   L+ CT + L +P +P+PF  G     T D         H     
Sbjct  243   FQYGNNTDLCGTGLPDLRPCTPADLIDPDRPQPFSAGIAPQITPDGARGHCSGTHC----  298

Query  719   RKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGST---IDSSDSRLSTDQA--KE  883
               P +   +  V+ + V   A GL  FSW+R RKQ+  +    + +   R ST+    KE
Sbjct  299   --PPSTKALAAVVVVAVILLAAGLLVFSWHRWRKQRTAAGAPPMTTVGGRCSTEGEANKE  356

Query  884   VSRRSA-SPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               R+SA S L++LEYSNGWDPLA  R+G   FSQEV  S  FN++E
Sbjct  357   SFRKSASSTLVSLEYSNGWDPLADGRSG-VGFSQEVSPSLRFNMEE  401



>emb|CDX79173.1| BnaA01g12400D [Brassica napus]
Length=687

 Score =   299 bits (765),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 180/354 (51%), Positives = 236/354 (67%), Gaps = 21/354 (6%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACN+  +V NISLQGK L GK+ P +A++K LSGLYLH+N L G +P+EI NLT L
Sbjct  59    FEGIACNQHLKVANISLQGKRLTGKLSPAVAELKCLSGLYLHYNSLSGEIPQEITNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+ SG IP  I ++  LQV+ LC N L+G IP  +GSLK L+VL+LQ N LTG
Sbjct  119   SDLYLNVNNFSGEIPAGIGSMVGLQVMDLCCNSLAGKIPKSIGSLKKLSVLSLQHNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              +P +LG+L+ L+R+DLSFN L G+IP  LAN  +LE LD+RNNTLSG VP  L++LNE 
Sbjct  179   EVPWSLGNLSTLSRIDLSFNDLSGTIPKTLANIPQLETLDLRNNTLSGFVPPGLEKLNER  238

Query  542   FQYTNNPGLCGIGFSSLKLCT---DSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA--  706
             FQ+ NN GLCGI F SL+ C+   DS +   +P+     ++     +I +S  ++ H   
Sbjct  239   FQFENNAGLCGINFPSLRACSAFDDSTIEVKQPQG-EKDTDKSTLHNISDSVYLKSHCNQ  297

Query  707   --LNKP--RKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQ  874
                +KP  + PQ A ++  V+ + +  F  GL TF  YRRRKQKI +T + S+ RLSTDQ
Sbjct  298   THCHKPSSKLPQVA-LISSVITVTITLFGAGLLTFLRYRRRKQKISNTAEISEGRLSTDQ  356

Query  875   AKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQE------VLESFMFNLDE  1018
              K+     ASPL++L Y+  WDPL  +RNG A FSQE      V  SF FNL+E
Sbjct  357   QKDF---RASPLMSLAYTKEWDPLGDSRNG-AEFSQEPHHLFVVNSSFRFNLEE  406



>ref|XP_006363735.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Solanum tuberosum]
Length=685

 Score =   298 bits (763),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 172/347 (50%), Positives = 232/347 (67%), Gaps = 10/347 (3%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ CNE  +V NI+L  KGL GK+ P IA++K LSGLYLH+N L G +P+E+ NLT L
Sbjct  62    FLGVICNEHHKVTNITLTDKGLTGKLSPAIAELKCLSGLYLHYNSLTGEIPKELGNLTEL  121

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPE+ N+ SLQVL L  N+L+G+IP ++G LK L+VL LQ N LT 
Sbjct  122   NDLYLNVNNLSGIIPPELRNMASLQVLDLSCNQLTGSIPTEIGFLKKLSVLELQRNRLTD  181

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP  LG L  L +L L FN L G IP KLA A +LE+L+++NNTLSG +P AL+RLNE 
Sbjct  182   KIPENLGVLGTLKKLYLGFNQLSGPIPLKLAAAPQLEVLEVQNNTLSGVIPPALRRLNEK  241

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNH--LPTKDIPESANVQPHALN  712
             F Y +NPGLCG GF+SL++CT    +N ++     P SN+  +P  D+P +A++ P   N
Sbjct  242   FNYESNPGLCGTGFTSLRVCTAWDHVNVNQVGSDVPDSNNNGVPI-DVPGAAHISPLPCN  300

Query  713   KP---RKPQTAvvvvgvlglivAFFATGLFTFSWYRRR--KQKIGSTIDSSDSRLSTDQA  877
             +    R  +    ++    + V         F  +RRR  KQ++G+T D+SD RLSTDQA
Sbjct  301   QTHCSRSSKFPQAIIVASVITVTVTLVVAVVFGIFRRRRLKQRVGNTSDASDDRLSTDQA  360

Query  878   KEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             KE+ +RS SPL+ +EYSN WDP+   ++ N+ F+ E L  F FNL+E
Sbjct  361   KEIYKRSPSPLLTVEYSNRWDPMTPEKSCNSMFN-EFLSGFKFNLEE  406



>ref|XP_006413630.1| hypothetical protein EUTSA_v10024592mg [Eutrema salsugineum]
 gb|ESQ55083.1| hypothetical protein EUTSA_v10024592mg [Eutrema salsugineum]
Length=681

 Score =   298 bits (763),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 231/347 (67%), Gaps = 14/347 (4%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACN+  +V NISLQGK L GK+ P +A++K LSGLYLH+N L G +P+EI NLT L
Sbjct  59    FEGIACNQHLKVANISLQGKRLAGKLSPAVAELKCLSGLYLHYNSLSGEIPQEITNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+ SG IP EI ++  LQV+ LC N L+G IPN +GSLK L VL+LQ N LTG
Sbjct  119   SDLYLNVNNFSGEIPAEIGSMAGLQVMDLCCNSLTGKIPNNIGSLKKLNVLSLQHNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              +P++LG L+LL+RLDLSFN+L GSIP  L N  +L+ LD+RNNTLSG VP  LK+LNE 
Sbjct  179   EVPSSLGGLSLLSRLDLSFNNLLGSIPKTLDNIPELDTLDLRNNTLSGFVPPGLKKLNEK  238

Query  542   FQYTNNPGLCGIGFSSLKLCT---DSALNPSKPEPFGPGSNHLPTKDIPESANVQPHALN  712
             F++ NN GLCG+ F SL+ C+   D  +   K  P    +N     +I ES   Q    +
Sbjct  239   FKFENNIGLCGVDFPSLRACSAFDDETIQQLKQPPGELDTNKSTLHNISESVYHQKQK-S  297

Query  713   KPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSR  892
               + PQ A ++  V+ + +     GL TF  YRRRKQKI +T + S+ RLSTDQ K+   
Sbjct  298   SSKLPQVA-LISSVITVGITLIGAGLLTFFRYRRRKQKISNTGEISEGRLSTDQQKDF--  354

Query  893   RSASPLINLEYSNGWDPLAKARNGNAAFSQE-----VLESFMFNLDE  1018
               ASPL++L Y+  WDPL  +RNG A FSQE     V  SF FNL+E
Sbjct  355   -RASPLVSLAYTKEWDPLGDSRNG-AEFSQEPHLFVVNSSFRFNLEE  399



>gb|KFK28836.1| hypothetical protein AALP_AA7G055200 [Arabis alpina]
Length=688

 Score =   296 bits (759),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 234/353 (66%), Gaps = 19/353 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACN+  +V NISLQGK L GK+ P +A++K LSGLYLH+N L+G +P+EI NLT L
Sbjct  59    FEGIACNQHLKVANISLQGKRLTGKLSPAVAELKCLSGLYLHYNSLYGEIPQEITNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+ SG IP +I ++ SLQV+ LC N L+G IP  +GSLK L+VL+LQ N LTG
Sbjct  119   SDLYLNVNNFSGEIPVQIGSMASLQVMDLCCNSLTGKIPKNIGSLKKLSVLSLQHNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LGDL++L+RLD+S+N+L G IP  LAN  +L+ LD+RNNTLSG VP   K+LN  
Sbjct  179   EIPTSLGDLSMLSRLDMSYNNLLGLIPKTLANIPQLDTLDLRNNTLSGFVPPDFKKLNGK  238

Query  542   FQYTNNPGLCGIGFSSLKLCT--DSALNPSKPEPFGP-GSNHLPTKDIPESANVQPHA--  706
             FQ+ NN GLCG+ F  L+ CT  D+A      +P G   +N     +I ES  +Q H   
Sbjct  239   FQFENNTGLCGMDFPFLRACTAFDNANIEQLEQPSGEIDTNKSALHNISESVYLQRHCNQ  298

Query  707   ----LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQ  874
                  +  + PQ A ++  V+ + +     GL TF  YRRRKQKI +T++ S+ RLS DQ
Sbjct  299   THCKKSSSKLPQVA-LISSVITVTITLIGAGLLTFFRYRRRKQKISNTVEFSEGRLSIDQ  357

Query  875   AKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQE-----VLESFMFNLDE  1018
              K+     ASPL++L Y+  WDPL  +RNG A FSQE     V  SF FNL+E
Sbjct  358   QKDF---RASPLVSLAYTKEWDPLGDSRNG-AEFSQESHLFVVNSSFRFNLEE  406



>ref|NP_194004.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 emb|CAA16558.1| leucine rich repeat receptor kinase-like protein [Arabidopsis 
thaliana]
 emb|CAB79228.1| leucine rich repeat receptor kinase-like protein [Arabidopsis 
thaliana]
 gb|AAR23717.1| At4g22730 [Arabidopsis thaliana]
 dbj|BAD44629.1| leucine rich repeat receptor kinase-like protein [Arabidopsis 
thaliana]
 gb|ACN59346.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE84645.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=688

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 182/354 (51%), Positives = 234/354 (66%), Gaps = 20/354 (6%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACN+  +V NISLQGK L GK+ P +A++K LSGLYLH+N L G +P+EI NLT L
Sbjct  59    FEGIACNQHLKVANISLQGKRLVGKLSPAVAELKCLSGLYLHYNSLSGEIPQEITNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+ SG IP +I ++  LQV+ LC N L+G IP  +GSLK L VL+LQ N LTG
Sbjct  119   SDLYLNVNNFSGEIPADIGSMAGLQVMDLCCNSLTGKIPKNIGSLKKLNVLSLQHNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              +P TLG+L++L+RLDLSFN+L G IP  LAN  +L+ LD+RNNTLSG VP  LK+LN  
Sbjct  179   EVPWTLGNLSMLSRLDLSFNNLLGLIPKTLANIPQLDTLDLRNNTLSGFVPPGLKKLNGS  238

Query  542   FQYTNNPGLCGIGFSSLKLCT--DSALNPS--KPEPFGPGSNHLPTKDIPESANVQPHA-  706
             FQ+ NN GLCGI F SL+ C+  D+A N    K  P    ++     +IPES  +Q H  
Sbjct  239   FQFENNTGLCGIDFPSLRACSAFDNANNIEQFKQPPGEIDTDKSALHNIPESVYLQKHCN  298

Query  707   -----LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD  871
                   +  + PQ A ++  V+ + +     G+ TF  YRRRKQKI +T + S+ RLSTD
Sbjct  299   QTHCKKSSSKLPQVA-LISSVITVTITLIGAGILTFFRYRRRKQKISNTPEFSEGRLSTD  357

Query  872   QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQE-----VLESFMFNLDE  1018
             Q KE     ASPL++L Y+  WDPL  +RNG A FSQE     V  SF FNL++
Sbjct  358   QQKEF---RASPLVSLAYTKEWDPLGDSRNG-AEFSQEPHLFVVNSSFRFNLED  407



>ref|XP_003569250.1| PREDICTED: LOW QUALITY PROTEIN: somatic embryogenesis receptor 
kinase 2 [Brachypodium distachyon]
Length=711

 Score =   296 bits (758),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 183/359 (51%), Positives = 233/359 (65%), Gaps = 21/359 (6%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+AC+  G V N+SLQGKGL G + P +A ++ L+GLYLH+N L GAVPRE+  L+ L
Sbjct  66    FEGVACDARGGVANLSLQGKGLSGTLSPAVAGLRALTGLYLHYNALRGAVPRELTGLSQL  125

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VN+ SG+IPPEI  + SLQVLQLCYN+L+G+IP QLG L  LTVLALQSNHL G
Sbjct  126   TDLYLDVNNFSGAIPPEIGTMASLQVLQLCYNQLTGSIPTQLGLLNKLTVLALQSNHLNG  185

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALK-----  526
             AIPA+LGDL  L RLDLSFNHLFGSIP +LA    L   D+RNN+L+G+VP  L      
Sbjct  186   AIPASLGDLPELMRLDLSFNHLFGSIPVRLAKLPLLAAFDVRNNSLTGSVPAELNVXFCL  245

Query  527   --RLNE---GFQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPG-SNHLPTKDIPES  685
               R+ E   GFQY NN  LCG G   L+ CT + L +P +P+PF  G +  +      ++
Sbjct  246   VPRIGELEGGFQYGNNTDLCGTGLPDLRPCTPADLIDPDRPQPFSAGIAPDITPGSSSDA  305

Query  686   ANVQPHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKI-----GSTIDSS  850
                     + P   +     V V  +I+A  A GLF FSWYR RKQ+      G+    +
Sbjct  306   GRGHCSGTHCPPSTKALAAAVVVAVVILAATAAGLFAFSWYRWRKQRTAGAAAGAPPAPA  365

Query  851   DSRLSTDQAKEVS--RRSA-SPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               R ST+  KE S  R+SA S L++LEYSNGWDPL+  R+G A FS+EV  S  FN++E
Sbjct  366   GGRCSTEATKEPSSFRKSASSTLVSLEYSNGWDPLSDGRSG-AGFSKEVSPSLRFNMEE  423



>ref|XP_004245714.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Solanum lycopersicum]
Length=683

 Score =   294 bits (753),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 230/345 (67%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ CNE  +V NI+L  KGL GK+ P IA++K LSGL+LH+N L G +P+E+ NLT L
Sbjct  62    FLGVICNEHHKVTNITLTDKGLTGKLSPAIAELKCLSGLFLHYNSLTGEIPKELGNLTEL  121

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IPPE+ N+ SLQVL L  N+L+G+IP ++G L+ L+VL LQ N LTG
Sbjct  122   NDLYLNVNNLSGIIPPELGNMESLQVLDLSCNQLTGSIPTEIGFLRKLSVLELQHNRLTG  181

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP  LG    L +L L FN L G IP+KLA A +LE+L+++NNTLSG VP AL+RLNE 
Sbjct  182   EIPVKLGIPGTLKKLYLGFNQLSGPIPSKLAAAPQLEVLEVQNNTLSGVVPPALRRLNEK  241

Query  542   FQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNK-  715
             F   +NPGLCG GF+SL++CT    +N ++     P +N  P  D+P +A++ P   N+ 
Sbjct  242   FNCESNPGLCGTGFTSLRVCTAWDHVNVNQVGSDVPNNNGDPI-DVPGAAHISPLPCNQI  300

Query  716   --PRKPQTAvvvvgvlglivAFFATGLFTFSWYRRR--KQKIGSTIDSSDSRLSTDQAKE  883
                R  +    ++    + V         F  +RRR  KQ++G+T D+SD RLSTDQAKE
Sbjct  301   HCSRSSKFPQAIIVASVITVTLTLVVAVVFGIFRRRRLKQRVGNTSDASDDRLSTDQAKE  360

Query  884   VSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + +RS SPL+ +EYSN WDP+   ++ N+ F+ + L  F FNL+E
Sbjct  361   MYKRSPSPLLTVEYSNRWDPMTPEKSCNSMFN-DFLNGFKFNLEE  404



>ref|NP_001043393.1| Os01g0577600 [Oryza sativa Japonica Group]
 dbj|BAB32930.1| extra sporogenous cells-like [Oryza sativa Japonica Group]
 dbj|BAB91809.1| extra sporogenous cells-like [Oryza sativa Japonica Group]
 dbj|BAF05307.1| Os01g0577600 [Oryza sativa Japonica Group]
 gb|EAY74647.1| hypothetical protein OsI_02539 [Oryza sativa Indica Group]
 gb|EAZ12433.1| hypothetical protein OsJ_02327 [Oryza sativa Japonica Group]
Length=689

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 179/343 (52%), Positives = 231/343 (67%), Gaps = 10/343 (3%)
 Frame = +2

Query  11    IACN-ELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLD  187
             +AC+   G V N+SLQGKGL G +PP +A +  L+GLYLH+N L GA+PRE+A L+ L D
Sbjct  71    VACDGATGAVANVSLQGKGLAGTLPPAVAGLTALTGLYLHYNRLTGALPRELAALSRLTD  130

Query  188   LYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAI  367
             LYLNVN+ SG IPPEI+ + SLQV+QLCYN+L+G +P QLG LK LTVL LQSNHL+GAI
Sbjct  131   LYLNVNNFSGPIPPEIAAMPSLQVVQLCYNQLTGGVPTQLGLLKRLTVLELQSNHLSGAI  190

Query  368   PAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQ  547
             PA+LGDL  L RLDLSFN+LFGSIP +LA   +L  LD+RNNTL+G+VP  L +L  GFQ
Sbjct  191   PASLGDLPQLVRLDLSFNNLFGSIPVRLALLPRLLALDVRNNTLTGSVPSELAKLQGGFQ  250

Query  548   YTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDIPESANVQPHALNKPRK  724
             Y NN  LCG G  +L+ CT + L +P  P+PF  G +  P      S++   H       
Sbjct  251   YANNTDLCGTGLPALRPCTPADLISPDMPQPFSAGIS--PQITPGSSSDGHGHCTGTHCP  308

Query  725   PQTAvvvvgvlglivAFFAT--GLFTFSWYRRRKQK-IGSTIDSSDSRLSTDQA-KEVSR  892
             P T  +   V+  ++    T  G+F  SWYR RKQ+ +  +  +   R STD A K+  R
Sbjct  309   PSTKALAAVVVVAVILLAVTGAGMFALSWYRWRKQRVVAGSPAAVGGRCSTDAAGKDSFR  368

Query  893   RSA-SPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             +SA S L++LEYSNGWDPLA  R G   FSQEV +SF FN+++
Sbjct  369   KSASSTLVSLEYSNGWDPLADGR-GGIGFSQEVAQSFRFNMED  410



>emb|CDX82961.1| BnaC01g14110D [Brassica napus]
Length=687

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 178/354 (50%), Positives = 235/354 (66%), Gaps = 21/354 (6%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACN+  +V NISLQGK L GK+ P +A++K LSGLYLH+N L G +P+EI NLT L
Sbjct  59    FEGIACNQHLKVANISLQGKRLTGKLSPAVAELKCLSGLYLHYNSLFGEIPQEITNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+ SG IP  I ++  LQV+ LC N L+G IP  +GSLK L+VL+LQ N LTG
Sbjct  119   SDLYLNVNNFSGEIPAGIGSMAGLQVMDLCCNSLTGKIPKSIGSLKKLSVLSLQHNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              +P +LG+L++L+R+DLSFN L G+IP  LAN  +LE LD+RNNTLSG VP  LK+LNE 
Sbjct  179   EVPWSLGNLSMLSRIDLSFNDLSGTIPKTLANIPQLETLDLRNNTLSGFVPPGLKKLNER  238

Query  542   FQYTNNPGLCGIGFSSLKLCT---DSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA--  706
             FQ+ NN GLCGI   SL+ C+   DS +   +P+     ++     +I +S  ++ H   
Sbjct  239   FQFENNTGLCGIDIPSLRACSAFDDSTIEVKQPQG-EKDTDKSTLHNISDSVYLKIHCNQ  297

Query  707   --LNKP--RKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQ  874
                +KP  + PQ A ++  V+ + +  F  GL TF  YRRRKQKI +T + S+ RLSTDQ
Sbjct  298   THCHKPSSKLPQVA-LISSVITVTITLFGAGLLTFLRYRRRKQKISNTAELSEGRLSTDQ  356

Query  875   AKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQE------VLESFMFNLDE  1018
              K+     +SPL++L Y+  WDPL  +RNG A F QE      V  SF FNL+E
Sbjct  357   QKDF---RSSPLVSLAYTKEWDPLGDSRNG-AEFLQEPHHLFVVNSSFRFNLEE  406



>ref|XP_010448856.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Camelina sativa]
Length=687

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 179/352 (51%), Positives = 229/352 (65%), Gaps = 17/352 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACN+  +V NISLQGK L GK+ P +A++K LSGLYLH+N L G +P+EI NLT L
Sbjct  59    FEGIACNQHLKVANISLQGKRLTGKLSPAVAELKCLSGLYLHYNSLSGEIPQEITNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+LSG IP EI ++  LQV+ LC N L+GNIPN +GSLK L VL+LQ N LTG
Sbjct  119   SDLYLNVNNLSGEIPAEIGSMAGLQVMDLCCNSLTGNIPNNIGSLKKLNVLSLQHNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              +P +LG+L++L RLDLSFN L G IP  LAN  +L+ LD+RNNTLSG VP  LK+LN  
Sbjct  179   EVPWSLGNLSMLCRLDLSFNSLLGLIPKTLANIAQLDTLDLRNNTLSGFVPPGLKKLNGR  238

Query  542   FQYTNNPGLCGIGFSSLKLCT--DSALNPSKPEPFGPGSNHLPTKDIPESANVQP-----  700
             FQ+ NN GLCGI F SL+ C+  + A    K  P    ++     +I ES  +Q      
Sbjct  239   FQFENNTGLCGIDFPSLRACSAFEEANIEFKQPPGEIDTDKSTLHNISESVYLQKHCNQT  298

Query  701   HALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
             H      K     V+  V+ + +     G+ TF  YRRRKQKI +T + S+ RLSTDQ K
Sbjct  299   HCHKSSSKLTQVAVISSVITVAITLIGAGILTFFRYRRRKQKISNTPEFSEGRLSTDQQK  358

Query  881   EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQE------VLESFMFNLDE  1018
             ++    ASPL++L Y+  WDPL  +RNG A FSQ+      V  SF FNL++
Sbjct  359   DL---RASPLVSLAYTKEWDPLGDSRNG-AEFSQQEPHLFVVNSSFRFNLED  406



>ref|XP_004511651.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Cicer arietinum]
Length=682

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 183/351 (52%), Positives = 234/351 (67%), Gaps = 19/351 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNE  +V NISLQGKGL G I P ++++K LSGLYLH+N+L G +P +I+NLT L
Sbjct  59    FEGIACNEHWKVANISLQGKGLSGWISPAVSELKCLSGLYLHYNNLSGEIPSQISNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             +DLYL+VN LSG+IP E+ N+ SLQVLQL  N+L GNIP Q+GSLK LT LALQ N LTG
Sbjct  119   VDLYLDVNSLSGTIPHEVGNMASLQVLQLGDNQLVGNIPTQMGSLKQLTTLALQYNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG+L  L+RL+LSFN+  GSIPA LA    LE+LDI+NN+LSG VP ALKRL EG
Sbjct  179   QIPLSLGNLENLSRLNLSFNNFTGSIPATLATIAHLEVLDIQNNSLSGIVPSALKRLGEG  238

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPGSNHLPTKDI-------PESANVQ  697
             FQ  NNPGLCG+G S+ + C  D  LN S  +      +HL  K+I       PE AN+Q
Sbjct  239   FQGRNNPGLCGVGLSNSRACENDPDLNAS--DVGTTDQDHL--KNINNTATPRPEPANIQ  294

Query  698   PHA----LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLS  865
              H      +K R    +V+ V V+ + ++    GLF    YRRRKQ+I S  +SS+ + S
Sbjct  295   VHCNQTHCSKSRSFPLSVITVSVVAITLSIIGFGLFKLVRYRRRKQRITS--NSSEGKFS  352

Query  866   TDQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               Q KE+ R+S S  +NL+Y NG  PL   +N +   + E L  F FN+DE
Sbjct  353   PQQPKELYRKSPSTFVNLDYYNGCYPLPNDQNAD-GLANEYLNQFRFNVDE  402



>ref|XP_006646028.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like, partial [Oryza brachyantha]
Length=592

 Score =   290 bits (742),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 219/316 (69%), Gaps = 5/316 (2%)
 Frame = +2

Query  80    PPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNITSLQV  259
             PP +A ++ L+GLYLH+N L GA+PRE+A LT L DLYLNVN+ SG+IPPEI  + SLQV
Sbjct  1     PPAVAGLRGLTGLYLHYNRLTGALPRELAGLTRLTDLYLNVNNFSGAIPPEIGAMASLQV  60

Query  260   LQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNHLFGSI  439
             +QLCYN+L+G +P QLG LK L+VLALQSNHL GAIPA+LGDL  L RLDLSFN+LFGSI
Sbjct  61    VQLCYNQLTGGVPTQLGLLKRLSVLALQSNHLNGAIPASLGDLPQLVRLDLSFNNLFGSI  120

Query  440   PAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFSSLKLCTDSAL-  616
             P +LA   +L  LD+RNNTL+G+VP  L +L  GFQY NN  LCG G  +L+ CT + L 
Sbjct  121   PVRLAQLPRLAALDVRNNTLTGSVPSELAKLQGGFQYANNTDLCGTGLPALRPCTPADLI  180

Query  617   NPSKPEPFGPGSNHLPTKDIPESANVQPHALNKPRKPQTAvvvvgvlglivAFFATGLFT  796
             +P +P+PF  G +   T   P+  + +      P   +    VV +  +++A  A GLF 
Sbjct  181   SPDRPQPFSAGISPQITPGSPD-GHGRCSGARCPPSTKALAAVVVIAVILLAVTAAGLFA  239

Query  797   FSWYRRRKQKIGSTIDSSDSRLSTDQA-KEVSRRS-ASPLINLEYSNGWDPLAKARNGNA  970
             FSWYR RKQ++  +      R ST+ A KE  R+S +S L++LEYSNGWDPLA  R G A
Sbjct  240   FSWYRWRKQRVAGSPVVVGGRCSTEAAVKESFRKSVSSTLVSLEYSNGWDPLADGR-GGA  298

Query  971   AFSQEVLESFMFNLDE  1018
              FSQEV ++F FN+++
Sbjct  299   GFSQEVAQNFRFNMED  314


 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 62/109 (57%), Gaps = 3/109 (3%)
 Frame = +2

Query  2    FEGIACNELGQVVN---ISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANL  172
            F G    E+G + +   + L    L G +P ++  +K LS L L  NHL+GA+P  + +L
Sbjct  44   FSGAIPPEIGAMASLQVVQLCYNQLTGGVPTQLGLLKRLSVLALQSNHLNGAIPASLGDL  103

Query  173  THLLDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLK  319
              L+ L L+ N+L GSIP  ++ +  L  L +  N L+G++P++L  L+
Sbjct  104  PQLVRLDLSFNNLFGSIPVRLAQLPRLAALDVRNNTLTGSVPSELAKLQ  152



>ref|XP_006285866.1| hypothetical protein CARUB_v10007360mg [Capsella rubella]
 gb|EOA18764.1| hypothetical protein CARUB_v10007360mg [Capsella rubella]
Length=686

 Score =   292 bits (748),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 227/351 (65%), Gaps = 16/351 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACN+  +V NISLQGK L GK+ P +A++K LSGLYLH+N L G +P+EI NLT L
Sbjct  59    FEGIACNQHLKVANISLQGKRLTGKLSPAVAELKCLSGLYLHYNSLSGEIPQEITNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+ SG IP EI ++  LQV+ LC N L+G +PN +G+LK L VL+LQ N LTG
Sbjct  119   SDLYLNVNNFSGEIPAEIGSMAGLQVMDLCCNSLTGKLPNGIGTLKKLNVLSLQHNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              +P +LG+L++L RLDLSFN+L G IP  LAN  +L+ LD+RNNTLSG VP  LK+LN  
Sbjct  179   EVPWSLGNLSMLNRLDLSFNYLLGLIPKTLANIPQLDTLDLRNNTLSGFVPTGLKKLNGR  238

Query  542   FQYTNNPGLCGIGFSSLKLCT--DSALNPSKPEPFGPGSNHLPTKDIPESANVQP-----  700
             FQ+ NN GLCGI F SL+ C+  D A    K  P    ++     +I ES  +Q      
Sbjct  239   FQFENNTGLCGIDFPSLRACSAFDQANIEFKQPPGEIDTDKSSLHNISESVYLQKHCNQT  298

Query  701   HALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAK  880
             H      K     ++  V+ + +     G+ TF  YRRRKQKI +T + S+ RLSTDQ K
Sbjct  299   HCHKSSSKLAQVALISSVITVTITLIGAGILTFFRYRRRKQKISNTPEFSEGRLSTDQQK  358

Query  881   EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQE-----VLESFMFNLDE  1018
             +     ASPL++L Y+  WDPL  +RNG A FSQE     V  SF FNL++
Sbjct  359   DF---RASPLVSLAYTKEWDPLGDSRNG-AEFSQEPHLFVVNSSFRFNLED  405



>ref|XP_010434007.1| PREDICTED: somatic embryogenesis receptor kinase 4-like [Camelina 
sativa]
Length=687

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 230/353 (65%), Gaps = 19/353 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACN+  +V NISLQGK L GK+ P +A++K LSGLYLH+N L G +P+EI NLT L
Sbjct  59    FEGIACNQHLKVANISLQGKRLTGKLSPAVAELKCLSGLYLHYNSLSGEIPQEITNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+ SG IP EI ++  LQV+ LC N L+G IPN +GSLK L VL+LQ N LTG
Sbjct  119   SDLYLNVNNFSGEIPAEIGSMAGLQVMDLCCNSLTGKIPNNIGSLKKLNVLSLQHNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              +P ++G+L++L+RLDLSFN L G IP  LAN  +L+ LD+RNNTLSG VP  LK+LN  
Sbjct  179   EVPWSVGNLSMLSRLDLSFNSLLGLIPKTLANIPQLDTLDLRNNTLSGFVPPGLKKLNGR  238

Query  542   FQYTNNPGLCGIGFSSLKLCT--DSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA---  706
             FQ+ NN GLCGI F SL+ C+  D A    K  P    ++     +I ES  +Q H    
Sbjct  239   FQFENNTGLCGIDFPSLRDCSAFDEANIEFKQPPGETDTDKSSLHNISESVYIQKHCNQT  298

Query  707   ---LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQA  877
                 +  + PQ A ++  V+ + +      + TF  YRRRKQKI +T + S  RLSTDQ 
Sbjct  299   HCHKSSSKLPQVA-LISSVITVSITLIGAAILTFFRYRRRKQKISNTPEFSKGRLSTDQQ  357

Query  878   KEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQE------VLESFMFNLDE  1018
             K++    ASPL++L Y+  WDPL  +RNG A FSQ+      V  SF FNL++
Sbjct  358   KDL---RASPLVSLAYTKEWDPLGDSRNG-AEFSQQEPHLFVVNSSFRFNLED  406



>ref|XP_009593141.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 [Nicotiana tomentosiformis]
Length=681

 Score =   290 bits (742),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 169/350 (48%), Positives = 229/350 (65%), Gaps = 19/350 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ CNE  +V NISL+ KGL GK+ P +A++K LSGLYLH+N L G +P+E+ NLT L
Sbjct  61    FLGVVCNEHHKVANISLESKGLTGKLSPAMAELKCLSGLYLHYNLLSGEIPKELGNLTEL  120

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLN N+LSG+IPPEI ++ SLQ L L  N+L+G+IP ++G LK L++LAL+ N LTG
Sbjct  121   TDLYLNANNLSGTIPPEIGSMASLQALDLSCNQLTGSIPTEIGFLKKLSILALEHNMLTG  180

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP+ LG   +L RL L FN L G IP KLA A +LE+L+++NNTLSG VP AL+RL+  
Sbjct  181   EIPSNLGIQGMLKRLYLGFNQLSGPIPLKLATAPQLEVLEVQNNTLSGIVPPALRRLSGK  240

Query  542   FQYTNNPGLCGIGFSSLKLCT---DSALNPSKPEPFGPGSNHLPTKDIPESANV------  694
             F Y +NPGLCG GF+SL++CT   +  +N   P      +N +P +D+PE+ANV      
Sbjct  241   FNYESNPGLCGTGFTSLRVCTAWDNVNVNQVDPNGPNTNNNGVP-RDVPETANVSRLHCN  299

Query  695   QPHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRR--KQKIGSTIDSSDSRLST  868
             Q H     R PQ  +V   +   +    A     F  +RRR  KQ++G+T   SD RLST
Sbjct  300   QTHCSRSSRFPQAIIVASVITVTVTLIVAV---VFGIFRRRRFKQRVGNT---SDDRLST  353

Query  869   DQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             DQ KE+ +RS SPL+ +EYSN WDP+   ++   +   + L  F FNL+E
Sbjct  354   DQTKEIYKRSPSPLLTVEYSNHWDPMTPEKSC-GSMRYDFLHGFKFNLEE  402



>ref|XP_002869809.1| hypothetical protein ARALYDRAFT_492596 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46068.1| hypothetical protein ARALYDRAFT_492596 [Arabidopsis lyrata subsp. 
lyrata]
Length=687

 Score =   290 bits (742),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 179/356 (50%), Positives = 234/356 (66%), Gaps = 25/356 (7%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACN+  +V NISLQGK L GK+ P +A++K LSGLYLH+N L G +P+EI NLT L
Sbjct  59    FEGIACNQHLKVANISLQGKRLAGKLSPAVAELKCLSGLYLHYNSLSGEIPQEITNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+ SG IP +I ++  LQV+ LC N L+G IP  +G+LK L VL+LQ N LTG
Sbjct  119   SDLYLNVNNFSGEIPADIGSMDGLQVMDLCCNSLTGKIPKNIGTLKKLNVLSLQHNQLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              +P +LG+L++L+R+DLSFN+L G IP  LAN  +LE LD+RNNTLSG VP  LK+LN  
Sbjct  179   EVPWSLGNLSMLSRIDLSFNNLLGLIPKTLANIPQLETLDLRNNTLSGFVPSGLKKLNGS  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFG--PG---SNHLPTKDIPESANVQPHA  706
             FQ+ NN GLCG+ F SL+ C  SA + +  E F   PG   ++     +I ES  +Q H 
Sbjct  239   FQFENNTGLCGMDFPSLRAC--SAFDNANIEQFKQPPGEIDTDKSALHNISESVYLQKHC  296

Query  707   LNKP-------RKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLS  865
              NK        + PQ A ++  V+ + +     G+ TF  YRRRKQKI +T + S+ RLS
Sbjct  297   -NKTQCKKSSSKLPQVA-LISSVITVTITLLGAGILTFFRYRRRKQKISNTPEFSEGRLS  354

Query  866   TDQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQE-----VLESFMFNLDE  1018
             TD  K+     ASPL++L Y+  WDPL  +RNG A FSQE     V  SF FNL++
Sbjct  355   TDLQKDF---RASPLVSLAYTKEWDPLGDSRNG-AEFSQEPHLFVVNSSFRFNLED  406



>ref|XP_002458036.1| hypothetical protein SORBIDRAFT_03g025880 [Sorghum bicolor]
 gb|EES03156.1| hypothetical protein SORBIDRAFT_03g025880 [Sorghum bicolor]
Length=693

 Score =   290 bits (742),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 226/353 (64%), Gaps = 24/353 (7%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+AC+  G V N+SLQGKGL G + P +A +++L+GLYLH+N L G +PRE+A L  L
Sbjct  71    FEGVACDARGAVANVSLQGKGLAGTLTPAVAGLRSLTGLYLHYNALRGGIPRELAALDAL  130

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VN+ SG IPPEI  + SLQV+QLCYN+L+G+IP QLG+L  LTVLALQSN L G
Sbjct  131   TDLYLDVNNFSGPIPPEIGAMASLQVVQLCYNQLTGSIPTQLGNLTRLTVLALQSNQLNG  190

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLAL-KRLNE  538
             AIPA+LG L LL RLDLSFN LFGSIP +LA    L  LD+RNN+L+G+VP  L  +L  
Sbjct  191   AIPASLGGLPLLARLDLSFNRLFGSIPVRLAQLPSLAALDVRNNSLTGSVPAELAAKLQA  250

Query  539   GFQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDIPESANVQPHALNK  715
             GFQY NN  LCG G  +L+ CT + L +P +P+PF  G           ++ V P     
Sbjct  251   GFQYGNNSDLCGAGLPALRPCTPADLIDPDRPQPFSAGI----------ASQVTPSGGGN  300

Query  716   PRKPQTAvvvvgvlglivAFFAT--GLFTFSWYRRRKQKI--GSTIDSSDSRLSTD----  871
              R P T  +   V+  +    AT  GLF  SW R R+Q++  GS    S  R ST+    
Sbjct  301   GRAPSTRALAAVVVAAVALLAATGVGLFALSWRRWRRQRVAGGSPSTISGGRCSTENAPS  360

Query  872   --QAKEVSRRSA-SPLINLEYSNGWDPLAKARNGNAAFSQEVL-ESFMFNLDE  1018
               +A   +R+SA S L +LEYSN WDPLA AR G    SQ+VL +S   + +E
Sbjct  361   AAKASPSARKSASSALASLEYSNAWDPLADARGGLGFLSQDVLAQSLRISTEE  413



>gb|EMT04404.1| Leucine-rich repeat receptor protein kinase EXS [Aegilops tauschii]
Length=699

 Score =   288 bits (736),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 173/340 (51%), Positives = 220/340 (65%), Gaps = 17/340 (5%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+AC+  G V N+SLQGKGL G + P +A ++ L+GLYLH+N L G VPRE+A LT L
Sbjct  63    FEGVACDGSGAVANVSLQGKGLAGTLSPAVAGLRALTGLYLHYNALRGGVPRELARLTRL  122

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              D+YLNVN+LSG IP EI  + SLQVLQLCYN+L+G+IP QLG    LTVLALQSNHL G
Sbjct  123   TDVYLNVNNLSGPIPAEIGAMASLQVLQLCYNQLTGSIPTQLGLPNRLTVLALQSNHLNG  182

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  L RLDLSFNHLFGSIP +LA   +L  LD+RNN+L+G+VP  L +L  G
Sbjct  183   AIPASLGDLPELRRLDLSFNHLFGSIPVRLARLPQLAALDVRNNSLTGSVPSELAKLEGG  242

Query  542   FQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDIPESANVQPHALNKP  718
             FQY NN  LCG G   L+ CT + L +P +P+P   G   +  +  P+ A       + P
Sbjct  243   FQYGNNSDLCGTGLPDLRPCTPADLIDPDRPQPLSAG---IAPQITPDGARGHCSGTHCP  299

Query  719   RKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRS  898
                +    VV V  +++A  A GL  FSW+R RKQ+  +             A  ++   
Sbjct  300   PSTKALAAVVVVAVILLAATAAGLLAFSWHRWRKQRTAA------------GAPPMTTSR  347

Query  899   ASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             A  L++LEYSNGWDPLA  R+G   FS EV  S  FN++E
Sbjct  348   APTLVSLEYSNGWDPLADGRSG-VGFSHEVSPSLRFNMEE  386



>ref|XP_008660396.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Zea 
mays]
 gb|AFW89180.1| putative leucine-rich repeat protein kinase family protein [Zea 
mays]
Length=693

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 217/324 (67%), Gaps = 16/324 (5%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            FEG+AC+  G+V  ISLQGKGL G +PP +A +  L+GLYLH+N L G +PRE+  L  L
Sbjct  62   FEGVACDARGRVATISLQGKGLAGAVPPALAMLPALTGLYLHYNALRGEIPRELGALPGL  121

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             +LYL VN+LSG IP E+  + SLQVLQL YN+L+G+IP QLG L  LTVLALQSN L+G
Sbjct  122  AELYLGVNNLSGPIPVELGRLGSLQVLQLGYNQLTGSIPTQLGHLNKLTVLALQSNQLSG  181

Query  362  AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
            AIPA+LGDL  L RLDLS N LFGSIP+KLA   +L  LD+RNNTLSG+VP  LK+LNEG
Sbjct  182  AIPASLGDLPALARLDLSSNQLFGSIPSKLAEIPRLATLDLRNNTLSGSVPSGLKKLNEG  241

Query  542  FQYTNNPGLCGIGFSSLKLC----TDSALNPSKPEPFGPGSNHLPTKDIPESA----NVQ  697
            F Y NNP LCG  F SLK C     D    P KPE     S  +  + I ++A    N  
Sbjct  242  FLYENNPELCGAQFDSLKACPNDGNDDGRTPRKPE-----STSVKPQQIQKTADLNRNCG  296

Query  698  PHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIG-STIDSSDSRLSTDQ  874
                +KP    T  VV G + ++    A GL  FSW+RR+KQK+G S+++  + R S D+
Sbjct  297  DGGCSKPSTLSTGAVVAGTVVIVAGAAACGLSAFSWHRRQKQKVGSSSVEHLEGRPSLDR  356

Query  875  AKEVSRRSA-SPLINLEYSN-GWD  940
            +KE  +RSA S L+N+EYS+ GWD
Sbjct  357  SKEAYQRSAVSSLMNVEYSSGGWD  380



>ref|XP_008647994.1| PREDICTED: uncharacterized protein LOC100304214 isoform X1 [Zea 
mays]
 gb|AFW74369.1| putative leucine-rich repeat protein kinase family protein [Zea 
mays]
Length=691

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 180/357 (50%), Positives = 233/357 (65%), Gaps = 22/357 (6%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG+AC+  G+V  ISLQGKGL G +PP +A +  L+GLYLH+N L G +PRE+A L  L
Sbjct  62    FEGVACDARGRVATISLQGKGLAGAVPPAVAMLPALTGLYLHYNALRGEIPRELAALPGL  121

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              +LYL VN+LSG +P E+  + SLQVLQL YN+L+G+IP QLG L  LTVLALQSN L+G
Sbjct  122   AELYLGVNNLSGPVPAELGRLGSLQVLQLGYNQLTGSIPTQLGQLNKLTVLALQSNQLSG  181

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  L RLDLS N LFGSIP+KLA   +L  LD+RNNTLSG+VP  LK+LNEG
Sbjct  182   AIPASLGDLPALARLDLSSNQLFGSIPSKLAEIPRLATLDLRNNTLSGSVPSGLKKLNEG  241

Query  542   FQYTNNPGLCGIGFSSLKLC----TDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHAL  709
             F Y NNP LCG  F SLK C     D    P KPE     ++ +  + I ++A++  +  
Sbjct  242   FLYENNPELCGAQFDSLKACPNDGNDDGRTPRKPES----TSVIKPQQIQKAADLNRNCG  297

Query  710   N-----KPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIG-STIDSSDSRLSTD  871
             +     KP    T  VV G   ++    A GL  FSW+RR+KQKIG S+++  + R S D
Sbjct  298   DDGGCLKPSTLPTGAVVAGTFVIVAGAAACGLSAFSWHRRQKQKIGSSSVEHLEGRPSLD  357

Query  872   QAKEVSRRSA-SPLINLEYSN-GWDPL---AKARNGNAAFSQEV---LESFMFNLDE  1018
             ++KE   RSA S LIN+EYS+ GWD     +++++G A  S        S  FNL+E
Sbjct  358   RSKEAYERSAVSSLINVEYSSGGWDTSSEGSQSQHGVARLSSAAECGSPSVRFNLEE  414



>ref|XP_010439303.1| PREDICTED: somatic embryogenesis receptor kinase 4 [Camelina 
sativa]
Length=688

 Score =   285 bits (730),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 231/355 (65%), Gaps = 23/355 (6%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACN+  +V NISLQGK L GK+ P +A++K LSGLYLH+N L G +P+EI NLT L
Sbjct  59    FEGIACNQHLKVANISLQGKRLTGKLSPAVAELKCLSGLYLHYNSLSGEIPQEITNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+ SG IP  I ++T LQV+ LC N L+G IPN +GSLK L VL+LQ N LTG
Sbjct  119   SDLYLNVNNFSGEIPAAIGSMTGLQVMDLCCNSLTGKIPNNIGSLKKLNVLSLQHNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              +P +LG+L++L+RLDLSFN L G IP  LAN  +L+ LD+RNNTLSG VP  LK+L+  
Sbjct  179   EVPWSLGNLSMLSRLDLSFNSLLGLIPKTLANIPQLDTLDLRNNTLSGFVPPGLKKLSGR  238

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPE----PFGPGSNHLPTKDIPESANVQPHA-  706
             FQ+ NN GL GI F SL+ C  SA N +  E    P    ++     +I ES  +Q H  
Sbjct  239   FQFENNTGLYGIDFPSLRAC--SAFNEANIEFKQPPGETDTDKTSLHNISESVYLQKHCN  296

Query  707   -----LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD  871
                   +  + PQ A ++  V+ + +      + TF  YRRRKQKI +T + S+ RLSTD
Sbjct  297   QTHCHKSSSKLPQVA-LISSVITVSITLIGAAILTFFRYRRRKQKISNTPEFSEGRLSTD  355

Query  872   QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQE------VLESFMFNLDE  1018
             Q K++    ASPL++L Y+  WDPL  +RNG A FSQ+      V  SF FNL++
Sbjct  356   QQKDL---RASPLVSLAYTKEWDPLGDSRNG-AEFSQQEPHLFVVNSSFRFNLED  406



>gb|EYU30450.1| hypothetical protein MIMGU_mgv1a026158mg, partial [Erythranthe 
guttata]
Length=442

 Score =   277 bits (709),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 215/325 (66%), Gaps = 11/325 (3%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            FEG+ACNE  +V NISLQGKGL GK+P  +A++K LSGLYLH+N L G +P+EIANLT L
Sbjct  28   FEGVACNEHRKVANISLQGKGLAGKVPAAVAELKCLSGLYLHYNSLSGGIPKEIANLTEL  87

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             DLYLNVN+LSG IP +I ++ SLQVLQLC N L+G IP ++G LK L+VLAL+SN LTG
Sbjct  88   TDLYLNVNNLSGIIPSQIGSMASLQVLQLCCNHLTGTIPTEMGFLKKLSVLALESNKLTG  147

Query  362  AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             IP+ LGDL LL RL LSFN+L G IP  LAN   L++LD++NN+LSG VP  L++++EG
Sbjct  148  QIPSNLGDLLLLKRLYLSFNYLSGPIPLTLANLPSLQVLDLQNNSLSGVVPSGLRKMSEG  207

Query  542  FQYTNNPGLCGIGFSSLKLCT--DSALNP-SKPEPFGPGSNHLPTKDIPESANV-----Q  697
            F + NNPGLCG GFSSL+ CT  D+  N  ++       +N     +IP+SA       Q
Sbjct  208  FNFGNNPGLCGNGFSSLRNCTPWDNLNNDITRNNSSVIITNKTSPANIPQSAAFPLPCNQ  267

Query  698  PHAL--NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD  871
             H    +  + PQ  +V            A         RRRKQKI +  DS D  LS D
Sbjct  268  SHCAKSSSSKLPQIGIVAGAAALAATIITAFVFVAIFRRRRRKQKISNKSDSCDEILSVD  327

Query  872  Q-AKEVSRRSASPLINLEYSNGWDP  943
            + AK+  +RS SPL++LEYS GWDP
Sbjct  328  RGAKDFYKRSPSPLVSLEYSKGWDP  352



>gb|EMT10973.1| Leucine-rich repeat receptor protein kinase EXS [Aegilops tauschii]
Length=766

 Score =   285 bits (730),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 171/343 (50%), Positives = 227/343 (66%), Gaps = 5/343 (1%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG++C+  G+V  +SLQG+ L G + P  A +  L+GLYLH+N L GA+PRE+ +L  L
Sbjct  65    FEGVSCDASGRVSVVSLQGRRLSGSVSPAGAMLPGLTGLYLHYNDLGGAIPRELGDLPDL  124

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              +LYL VN+LSG IP E+  +  LQVLQL YN+LSG+IP QLG LK LTVLA+QSN LTG
Sbjct  125   AELYLGVNNLSGGIPVELGRLHRLQVLQLGYNQLSGSIPTQLGELKKLTVLAVQSNQLTG  184

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  LTRLDLS NHLFGSIP+KLA   +L  LD+RNNTLSG+VP  LK+L  G
Sbjct  185   AIPASLGDLPELTRLDLSSNHLFGSIPSKLAGIPQLATLDLRNNTLSGSVPSGLKKLGHG  244

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALN---PSKPEPFGPGSNHLPTKDIPESANVQPHAL  709
             F++ NN  LCG  F SLK C  D  ++   P KPE         P ++I ++ N    A 
Sbjct  245   FKFDNNLELCGSHFGSLKACPNDDNVDEQMPHKPESTSIKPQQTP-QNISQNTNCDIGAC  303

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
             ++     +  V+ G + +I    A GL  FSW+RR+KQK+G +++S + R S +Q+KE  
Sbjct  304   SRSSTLSSGAVLAGTIIIIAGVAACGLSVFSWHRRQKQKVGCSVESLEGRPSLEQSKETY  363

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             ++SAS LIN+EYS+GWD  ++        S E   S  FNL+E
Sbjct  364   QKSASSLINVEYSSGWDTSSEGSQHGVRLSPEGSPSVRFNLEE  406



>ref|XP_002436427.1| hypothetical protein SORBIDRAFT_10g002300 [Sorghum bicolor]
 gb|EER87794.1| hypothetical protein SORBIDRAFT_10g002300 [Sorghum bicolor]
Length=561

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 165/286 (58%), Positives = 207/286 (72%), Gaps = 10/286 (3%)
 Frame = +2

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             +DLYL+VNHL+G +P EI+ I +LQVLQL YN+L+G+IP QLG++  LTVLA+QSN L G
Sbjct  1     MDLYLDVNHLTGPVPVEIAAIVNLQVLQLGYNQLTGSIPPQLGNMNKLTVLAMQSNQLAG  60

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPATLG+LT L RLDLSFN LFGSIP+K+A    LE+ D+RNNTLSG+VP+ L+RLN G
Sbjct  61    AIPATLGELTQLRRLDLSFNSLFGSIPSKIAEVPLLEVFDVRNNTLSGSVPVGLRRLNGG  120

Query  542   FQYTNNPGLCGIGFSSLKLCTDS--ALNPSKPEPFGPGSNHLPTKDIPESA---NVQPHA  706
             FQY NN GLCG  FS L+LC+ S   L PSKPEPFGP    + T+ +P+SA   N     
Sbjct  121   FQYMNNKGLCGADFSLLELCSSSEDGLKPSKPEPFGPDGT-VKTRQVPQSANPDNCSGSG  179

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD--QAK  880
              +K       V++V V+ +++     GLF FSWYRR+KQKIGS+++ SDSRLSTD  Q K
Sbjct  180   CSKSANASEGVLIVAVVAVVIGAAFCGLFAFSWYRRQKQKIGSSLEVSDSRLSTDHFQQK  239

Query  881   EVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             E  RRSASPLI++EYSN WDPL+         S EV +SF FNL+E
Sbjct  240   EACRRSASPLISVEYSNSWDPLSGGA--GVGSSGEVGDSFRFNLEE  283



>ref|XP_010100886.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB85810.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=614

 Score =   280 bits (716),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 166/266 (62%), Positives = 199/266 (75%), Gaps = 18/266 (7%)
 Frame = +2

Query  266   LCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNHLFGSIPA  445
             LCYN L+G+ P QL +LK L+VLALQ N LTGAIPA+LG+L  LTRLDLSFN LFGS+PA
Sbjct  45    LCYNTLTGSTPLQLRNLKRLSVLALQYNQLTGAIPASLGELKALTRLDLSFNSLFGSVPA  104

Query  446   KLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFSSLKLCTDS-ALNP  622
             KLA+A  L++LDIRNN+LSG VP ALKRLN GFQ  NNP LCG+GF  L +C+ S    P
Sbjct  105   KLADAPMLQVLDIRNNSLSGTVPQALKRLNGGFQCENNPHLCGVGFPDLHVCSASDGWEP  164

Query  623   SKPEPFGP----------GSNHLPTKDIPESANVQPH----ALNKPRKPQTAvvvvgvlg  760
             ++PEP+ P           + +L  +D+PESAN+ P     + +K  K     V +GV+G
Sbjct  165   NRPEPYQPSNLSANGFPHSAQNLTAEDLPESANLNPDCSRTSCSKTSKSPQVGVALGVIG  224

Query  761   livAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRSASPLINLEYSNGWD  940
             L VAF  +GLFTFSWYRRRKQKIGS  +SSDSRLSTDQAKEV R+SASPLI+LEYSNGWD
Sbjct  225   LFVAFTVSGLFTFSWYRRRKQKIGSAFNSSDSRLSTDQAKEVYRKSASPLISLEYSNGWD  284

Query  941   PLAKARNGNAAFSQEVLESFMFNLDE  1018
             P+AK   G + FSQEVLESFMFNL+E
Sbjct  285   PVAK---GCSGFSQEVLESFMFNLEE  307


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   LYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNI  244
            L G  P ++  +K LS L L +N L GA+P  +  L  L  L L+ N L GS+P ++++ 
Sbjct  50   LTGSTPLQLRNLKRLSVLALQYNQLTGAIPASLGELKALTRLDLSFNSLFGSVPAKLADA  109

Query  245  TSLQVLQLCYNKLSGNIPNQLGSL  316
              LQVL +  N LSG +P  L  L
Sbjct  110  PMLQVLDIRNNSLSGTVPQALKRL  133



>gb|KCW82134.1| hypothetical protein EUGRSUZ_C035232, partial [Eucalyptus grandis]
Length=381

 Score =   273 bits (698),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 165/306 (54%), Positives = 208/306 (68%), Gaps = 11/306 (4%)
 Frame = +2

Query  62   GLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISN  241
            GL GK+PP +AQ+K LSGLYLH+    G +PREI++LT L DLYL+VN+L+GSIP EI +
Sbjct  62   GLSGKVPPAVAQLKCLSGLYLHYITWTGEIPREISSLTELTDLYLDVNNLTGSIPSEIGS  121

Query  242  ITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFN  421
            + SLQVLQLCYN+L+G IP Q+GSLK L+VLALQ N L+G I   L +L  L RL L FN
Sbjct  122  MASLQVLQLCYNQLNGTIPPQIGSLKKLSVLALQHNKLSGDIHG-LANLQTLKRLVLGFN  180

Query  422  HLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFSSLKLC  601
               G+ P ++A   +L+ LD++NN+LSG VP ALK+L E F Y NNPGLCG GF SL+ C
Sbjct  181  GFNGTFPVEIAKIPELQTLDVQNNSLSGFVPAALKKL-ERFNYQNNPGLCGSGFPSLRNC  239

Query  602  T--DSALNPSKPEPFGPGSNHLP-TKDIPESANVQPHALNKPRKPQTAvvvvgvlglivA  772
               D  L+P+   P       +P T D+    N Q H  N  + PQ A +V G++ + V 
Sbjct  240  NNFDPNLHPNGVNPI----VLIPRTPDVKTHCN-QSHCSNPSKLPQAA-LVAGIVSVTVT  293

Query  773  FFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRSASPLINLEYSNGWDPLAK  952
                GL TF  YRR KQKIGST D+SD RLSTDQ+K++  RSASPL+ LEYS+GWDPL  
Sbjct  294  LVGAGLLTFYRYRRGKQKIGSTADASDGRLSTDQSKDLYSRSASPLVCLEYSSGWDPLDD  353

Query  953  ARNGNA  970
             R GN 
Sbjct  354  GRCGNG  359



>ref|XP_006659770.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At1g53420-like, partial [Oryza 
brachyantha]
Length=693

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 177/365 (48%), Positives = 228/365 (62%), Gaps = 31/365 (8%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG++C+  G+V  +SLQGKGL G I P +A +  L+GLYLH+N L GA+PR++ +L  L
Sbjct  51    FEGVSCDARGRVATVSLQGKGLAGAISPAVAMLPGLTGLYLHYNALSGAIPRQLGDLPLL  110

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              +LYL VN+LSG+IP E+  ++SLQVLQL YN+LSG+IP QLG LK LTVLALQSN L G
Sbjct  111   AELYLGVNNLSGAIPVELGRLSSLQVLQLGYNQLSGSIPTQLGQLKKLTVLALQSNQLAG  170

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  L RLDLS NHLFGSIP+KLA   KL  LD+RNNTLSG+VP  LK+LNEG
Sbjct  171   AIPASLGDLPELARLDLSSNHLFGSIPSKLAAIPKLVALDLRNNTLSGSVPSGLKKLNEG  230

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALN--------PSKPEPFGPGSNHLPTKDI--PESAN  691
             F Y NN  LCG  F SLK C +   +        P KPE     S  +  K +  P++ N
Sbjct  231   FHYDNNSELCGARFDSLKPCANGDGDDNEDGGKMPRKPE-----STSVNVKPLQPPQTMN  285

Query  692   VQPHALN------------KPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGS  835
             V     N                  +  ++ G + ++    A GL  FSW RR+KQK+GS
Sbjct  286   VNRDCDNGGCSTSSSSSSSTATTLSSGAILAGTIVIVGGVAACGLSVFSWRRRQKQKVGS  345

Query  836   TIDSSDSRLSTDQAKEVSRRS--ASPLIN--LEYSNGWDPLAKARNGNAAFSQEVLESFM  1003
             T++S + R S D+ KE  +RS  +S LIN  +E S+GWD  ++        S E   S  
Sbjct  346   TVESLEGRGSMDKQKEACQRSNASSSLINWSVESSSGWDTSSEGSQQGVRLSPEWSPSVR  405

Query  1004  FNLDE  1018
             FNL+E
Sbjct  406   FNLEE  410



>ref|XP_003550887.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930-like [Glycine max]
 gb|KHN09757.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=685

 Score =   280 bits (715),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 174/345 (50%), Positives = 225/345 (65%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ CNE  +V NISL G+GL G + P +A++K LSGLYLH+N+L G +PREI NL  L
Sbjct  59    FLGVVCNEHNKVANISLPGRGLSGVVSPAVAELKCLSGLYLHYNYLSGDIPREIVNLKEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             LDLYLN N+LSG+IPP+I+N+TSLQVLQL YN+L GNIP +LGSLK L  ++LQ N L G
Sbjct  119   LDLYLNFNNLSGTIPPDIANMTSLQVLQLGYNQLEGNIPEELGSLKQLNDISLQHNKLAG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG L  L RL LS+N+  G+IPA LA+   LEILDI+NN+LSG VP AL+RL EG
Sbjct  179   QIPQSLGSLEKLRRLYLSYNNFNGTIPAALADIANLEILDIQNNSLSGTVPSALQRLREG  238

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----  706
             FQ  NN GLCG GFS+LK C  D+    S+        N +P    P+  N   H     
Sbjct  239   FQGANNQGLCGDGFSTLKACNKDTIFGVSQISAPNISINRIPPITFPKPVNTHLHCNQTP  298

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              +K R     V+   V   ++   ++GLF F  YRR++Q++ +T D S+ + S  Q KE 
Sbjct  299   CSKSRSFLHLVIAASVTTTVITLISSGLFIFVRYRRQRQRVRNTSDYSEGQRSPYQPKEF  358

Query  887   SRRSASPLINLE-YSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               RS+SPL+NLE Y +GWD LA  +N  +  S E L  F FN+DE
Sbjct  359   -YRSSSPLVNLEYYYDGWDSLADGQN-ESGLSLEYLNRFRFNIDE  401



>ref|XP_009136073.1| PREDICTED: somatic embryogenesis receptor kinase 4 [Brassica 
rapa]
Length=687

 Score =   280 bits (715),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 179/354 (51%), Positives = 235/354 (66%), Gaps = 21/354 (6%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACN+  +V NISLQGK L GK+ P +A++K LSGLYLH+N L G +P+EI NLT L
Sbjct  59    FEGIACNQHLKVANISLQGKRLTGKLSPAVAELKCLSGLYLHYNSLSGEIPQEITNLTEL  118

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYLNVN+ SG IP  I ++  LQV+ LC N L+G IP  +GSLK L+VL+LQ N LTG
Sbjct  119   SDLYLNVNNFSGEIPAGIGSMVGLQVMDLCCNSLAGKIPKSIGSLKKLSVLSLQHNKLTG  178

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              +P +LG+L+ L+R+DLSFN L G+IP  LAN  +LE LD+RNNTLSG VP  L++LNE 
Sbjct  179   EVPWSLGNLSTLSRIDLSFNDLSGTIPKTLANIPQLETLDLRNNTLSGFVPPGLEKLNER  238

Query  542   FQYTNNPGLCGIGFSSLKLCT---DSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA--  706
             FQ+ NN GLCGI F SL+ C+   DS +   +P+     ++     +I +S  ++ H   
Sbjct  239   FQFENNAGLCGIDFPSLRACSAFDDSTIEVKQPQG-EKDTDKSTLHNISDSVYLKSHCNQ  297

Query  707   --LNKP--RKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQ  874
                +KP  + PQ A ++  V+ + +  F  GL T   YRRRKQKI +T + S+ RLSTDQ
Sbjct  298   THCHKPSSKLPQVA-LISSVITVTITLFGAGLLTLLRYRRRKQKISNTAEISEGRLSTDQ  356

Query  875   AKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQE------VLESFMFNLDE  1018
              K+     ASPL++L Y+  WDPL  +RNG A FSQE      V  SF FNL+E
Sbjct  357   QKDF---RASPLMSLAYTKEWDPLGDSRNG-AEFSQEPHHLFVVNSSFRFNLEE  406



>ref|XP_003525760.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170-like [Glycine max]
 gb|KHN04759.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=683

 Score =   276 bits (706),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 169/352 (48%), Positives = 217/352 (62%), Gaps = 22/352 (6%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ CNE  +V NISL G+GL G++ P +A++K LSGLYLH+N L G +P EIANL  L
Sbjct  58    FLGVVCNEHNKVANISLPGRGLSGRVSPAVAELKCLSGLYLHYNLLSGDIPGEIANLKEL  117

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             LDLYLN N+LSG+IP +I N+TSLQVLQL YN+L G IP +LGSLK L V++LQ N LTG
Sbjct  118   LDLYLNFNNLSGTIPSDIGNMTSLQVLQLGYNQLEGTIPEELGSLKQLNVISLQHNKLTG  177

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG L  L +L LS+N+  G+IP KLA+   LE+LDI+NN LSG +P AL+RL EG
Sbjct  178   EIPQSLGHLEKLRKLYLSYNNFSGTIPVKLADVANLEVLDIQNNHLSGTIPSALQRLREG  237

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDI--------PESANVQ  697
             FQ  NN  LCG  FS+LK C       +K   FG      P   I        P+  N  
Sbjct  238   FQGANNRDLCGDDFSALKTC-------NKDRIFGVSQISAPNISIYRNPPITFPKPVNAH  290

Query  698   PHA----LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLS  865
              H      +K R     V+   V   ++   ++G+F F  YRR++QK+ +  D S+ + S
Sbjct  291   LHCNQTHCSKSRSFLLLVIAASVTTTVITLISSGIFIFVRYRRQRQKVRNPSDYSEGQHS  350

Query  866   TDQAKEVSRRSASPLINLE-YSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               Q KE   RS+SPL+NLE Y  GWD LA   N  +  S E L  F FN+DE
Sbjct  351   PYQPKEF-YRSSSPLVNLEHYYTGWDSLADGHN-ESGLSLEYLNRFRFNIDE  400



>ref|XP_007155588.1| hypothetical protein PHAVU_003G214800g [Phaseolus vulgaris]
 gb|ESW27582.1| hypothetical protein PHAVU_003G214800g [Phaseolus vulgaris]
Length=681

 Score =   271 bits (692),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 172/345 (50%), Positives = 224/345 (65%), Gaps = 8/345 (2%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F G+ACN+  +V NISL G+GL G++ P +A+++ LSGLYL FN L G +PREIANL  L
Sbjct  58    FLGVACNQHNKVANISLPGRGLSGRVSPAVAELRCLSGLYLQFNRLSGDIPREIANLKEL  117

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             LDLYLNVN+LSG+IPP+I N+TSLQVLQL YN+L G IP +LGSLK L  ++LQ N LTG
Sbjct  118   LDLYLNVNYLSGTIPPDIGNMTSLQVLQLGYNQLEGKIPKELGSLKQLNAMSLQHNKLTG  177

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP TLG L  L  L LS N+  G IPA LA+   LE+LDI+NN+LSG VP ALKRL EG
Sbjct  178   QIPLTLGSLEKLKMLYLSSNNFNGIIPATLADIANLEVLDIQNNSLSGTVPSALKRLGEG  237

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHA----  706
             F+  NNP LC +GFS+LK C +D  L   +        N+ P+  +   AN    +    
Sbjct  238   FKGENNPDLCAVGFSTLKACNSDKILGIGQISSPNISLNNNPSVTLTNPANTHSQSNQIH  297

Query  707   LNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEV  886
              +K R     V+   V   I+ F ++G+F F  YRR+++++ +T D S+S+LS    K+ 
Sbjct  298   CSKSRGFLHLVIAASVTTTIITFLSSGIFIFVRYRRQRERVRNTSDCSESQLSPYLPKDF  357

Query  887   SRRSASPLINLE-YSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
               RS+SPL+NLE Y NG D  A  +N N   S E L  F FN+DE
Sbjct  358   -YRSSSPLVNLENYYNGMDSPADGQNAN-GLSLEYLHRFRFNIDE  400



>gb|AFW83078.1| putative leucine-rich repeat protein kinase family protein [Zea 
mays]
Length=692

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 172/353 (49%), Positives = 226/353 (64%), Gaps = 28/353 (8%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC++ G V N+SLQGKGL G +PP +A +++L+GLYLH+N L G +PRE+A L  L
Sbjct  68    FDGVACDDSGAVANVSLQGKGLAGTLPPAVAGLRSLTGLYLHYNALRGGIPRELAALAAL  127

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VN+ SG +PPEI  + SLQV+QLCYN+L+G+IP QLG+L  LTVLALQSN L G
Sbjct  128   TDLYLDVNNFSGPVPPEIGAMASLQVVQLCYNQLTGSIPTQLGNLSRLTVLALQSNRLNG  187

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLAL-KRLNE  538
             AIPA+LGDL LL RLDLSFN LFGSIP +LA    L  LD+RNN+L+G+VP  L  +L  
Sbjct  188   AIPASLGDLPLLARLDLSFNRLFGSIPVRLAQLPSLVALDVRNNSLTGSVPAELAAKLQA  247

Query  539   GFQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDIPESANVQPHAL-N  712
             GFQY NN  LCG G  +L+ CT + L +P +P+PF              SA + P    +
Sbjct  248   GFQYGNNSDLCGAGLPALRPCTPADLIDPDRPQPF--------------SAGIAPQVRPS  293

Query  713   KPRKPQTAvvvvgvlglivAFFAT--GLFTFSWYRRRKQKI--GSTIDSSDSRLSTD---  871
               R P T  +   V+  +    AT  GL   SW R R+Q++  GS    S  R ST+   
Sbjct  294   DGRAPSTRALAAVVVVAVALLAATGVGLLALSWRRWRRQRVAGGSPSTVSGGRCSTEAAP  353

Query  872   ---QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVL-ESFMFNLDE  1018
                +A    + ++S L +LEYSN WDPLA AR G   FSQ+ L +S   + +E
Sbjct  354   SAAKASSARKSASSALASLEYSNAWDPLADARGGLGLFSQDALAQSLRISTEE  406



>ref|XP_008656611.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Zea mays]
Length=786

 Score =   268 bits (685),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 172/353 (49%), Positives = 226/353 (64%), Gaps = 28/353 (8%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+AC++ G V N+SLQGKGL G +PP +A +++L+GLYLH+N L G +PRE+A L  L
Sbjct  162   FDGVACDDSGAVANVSLQGKGLAGTLPPAVAGLRSLTGLYLHYNALRGGIPRELAALAAL  221

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              DLYL+VN+ SG +PPEI  + SLQV+QLCYN+L+G+IP QLG+L  LTVLALQSN L G
Sbjct  222   TDLYLDVNNFSGPVPPEIGAMASLQVVQLCYNQLTGSIPTQLGNLSRLTVLALQSNRLNG  281

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLAL-KRLNE  538
             AIPA+LGDL LL RLDLSFN LFGSIP +LA    L  LD+RNN+L+G+VP  L  +L  
Sbjct  282   AIPASLGDLPLLARLDLSFNRLFGSIPVRLAQLPSLVALDVRNNSLTGSVPAELAAKLQA  341

Query  539   GFQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDIPESANVQPHAL-N  712
             GFQY NN  LCG G  +L+ CT + L +P +P+PF              SA + P    +
Sbjct  342   GFQYGNNSDLCGAGLPALRPCTPADLIDPDRPQPF--------------SAGIAPQVRPS  387

Query  713   KPRKPQTAvvvvgvlglivAFFAT--GLFTFSWYRRRKQKI--GSTIDSSDSRLSTD---  871
               R P T  +   V+  +    AT  GL   SW R R+Q++  GS    S  R ST+   
Sbjct  388   DGRAPSTRALAAVVVVAVALLAATGVGLLALSWRRWRRQRVAGGSPSTVSGGRCSTEAAP  447

Query  872   ---QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVL-ESFMFNLDE  1018
                +A    + ++S L +LEYSN WDPLA AR G   FSQ+ L +S   + +E
Sbjct  448   SAAKASSARKSASSALASLEYSNAWDPLADARGGLGLFSQDALAQSLRISTEE  500



>gb|EMT21475.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=531

 Score =   254 bits (650),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 154/263 (59%), Positives = 189/263 (72%), Gaps = 11/263 (4%)
 Frame = +2

Query  242   ITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFN  421
             + +LQVLQL YN+L+G+IP QLG+L  L VLALQSN LTGAIPATLGDLT LTR+DLSFN
Sbjct  1     MANLQVLQLGYNQLTGSIPPQLGNLNKLAVLALQSNQLTGAIPATLGDLTQLTRVDLSFN  60

Query  422   HLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFSSLKLC  601
             +LFGSIP+K+A+   LE+ D+RNNTLSG+VP  LKRLN GFQY NN GLCG  F SL LC
Sbjct  61    NLFGSIPSKIADVPSLEVFDVRNNTLSGSVPAGLKRLNGGFQYVNNKGLCGAEFISLDLC  120

Query  602   --TDSALNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKPRKPQTAvvvvgvlglivAF  775
               T+  L PSKPEPFGP    + T  +P+S  V PH     +     ++V  +  +I A 
Sbjct  121   TSTEDGLRPSKPEPFGP-DGTVKTGQVPQS--VDPHTTKSAKASAGVLIVGVLAVVIGAA  177

Query  776   FATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD--QAKEVSRRSASPLINLEYSNGWDPLA  949
             F  G+F FS+YRR+KQKIGS+++ SDSRLSTD  Q KE  RRSASPLI++EYSNGWD ++
Sbjct  178   FC-GIFAFSYYRRQKQKIGSSLEVSDSRLSTDHFQQKEACRRSASPLISVEYSNGWDTMS  236

Query  950   KARNGNAAFSQEVLESFMFNLDE  1018
                      S EV +SF FNL+E
Sbjct  237   GG---GCGSSGEVGDSFRFNLEE  256


 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   LYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNI  244
            L G IPP++  +  L+ L L  N L GA+P  + +LT L  + L+ N+L GSIP +I+++
Sbjct  14   LTGSIPPQLGNLNKLAVLALQSNQLTGAIPATLGDLTQLTRVDLSFNNLFGSIPSKIADV  73

Query  245  TSLQVLQLCYNKLSGNIPNQLGSL  316
             SL+V  +  N LSG++P  L  L
Sbjct  74   PSLEVFDVRNNTLSGSVPAGLKRL  97



>gb|KEH22284.1| LRR receptor-like kinase [Medicago truncatula]
Length=614

 Score =   257 bits (656),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 167/343 (49%), Positives = 204/343 (59%), Gaps = 62/343 (18%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             F+G+ACNE G V NISLQGKGL                                      
Sbjct  53    FDGVACNEQGLVTNISLQGKGL--------------------------------------  74

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
                       SG IP       S+ VLQLC+N+L+G+IP +LG LK L+VLALQ NHL+G
Sbjct  75    ----------SGEIP-------SVIVLQLCHNELNGSIPTELGKLKRLSVLALQYNHLSG  117

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LG+L  L RLDLSFN L G IP  LANA KLE LDIRNN+LSG+VP  LKRL EG
Sbjct  118   AIPASLGELETLERLDLSFNTLLGPIPVTLANAPKLETLDIRNNSLSGSVPTDLKRLKEG  177

Query  542   FQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGP---GSNHLPTKDIPESANVQPHAL  709
             FQY NN GLCG GF+ L  C   S  +P +PEP+ P    +   PT   P S N      
Sbjct  178   FQYFNNHGLCGTGFAHLDSCQIVSNSDPVRPEPYDPSNISTIEFPTTPEPTSKNCGNSGC  237

Query  710   NKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVS  889
              +     T  +V  V+G++     TGLF    +RR KQKIG+T++ SD+RLSTD+ KEV 
Sbjct  238   RRRSDSSTIGLVFAVIGVVSVSALTGLFLILRHRRLKQKIGNTVEISDNRLSTDKIKEVY  297

Query  890   RRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             R+ ASPLINLEYS+GWDPL+K      ++SQE L+SFMFNL+E
Sbjct  298   RKKASPLINLEYSSGWDPLSKDL---GSYSQEFLQSFMFNLEE  337



>ref|NP_001060863.1| Os08g0117700 [Oryza sativa Japonica Group]
 dbj|BAD33103.1| putative SERK1 protein [Oryza sativa Japonica Group]
 dbj|BAF22777.1| Os08g0117700 [Oryza sativa Japonica Group]
 gb|EAZ05404.1| hypothetical protein OsI_27613 [Oryza sativa Indica Group]
Length=702

 Score =   258 bits (660),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 166/360 (46%), Positives = 222/360 (62%), Gaps = 36/360 (10%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEG++C+  G+V  +SLQGKGL G I P +A +  L+GLYLH+N L GA+PR++ +L  L
Sbjct  76    FEGVSCDARGRVAAVSLQGKGLAGAISPAVAMLPGLTGLYLHYNELAGAIPRQLGDLPML  135

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
              +LYL VN+LSG+IP E+  + +LQVLQL YN+LSG+IP QLG LK LTVLALQSN LTG
Sbjct  136   AELYLGVNNLSGTIPVELGRLPALQVLQLGYNQLSGSIPTQLGQLKKLTVLALQSNQLTG  195

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             AIPA+LGDL  L RLDLS N LFGSIP+KLA   KL  LD+RNNTLSG+VP  LK+LNEG
Sbjct  196   AIPASLGDLPELARLDLSSNRLFGSIPSKLAAIPKLATLDLRNNTLSGSVPSGLKKLNEG  255

Query  542   FQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQ----PHAL  709
             F + NN  LCG  F SLK C +   + ++        + +  K  PES NV+    P  +
Sbjct  256   FHFDNNSELCGAHFDSLKPCANGDEDDNEE------GSKMARK--PESTNVKPLQAPQTM  307

Query  710   NKPRKPQ---------------TAvvvvgvlglivAFFATGLFTFSWYRRRKQKI--GST  838
             N  R                  +  ++ G + +I    A G+   SW RR+KQK+  G T
Sbjct  308   NVNRDCDNGGCSRSSSSSTTLSSGAILAGTIIIIGGAAACGISVISWRRRQKQKVGGGGT  367

Query  839   IDSSDSRLSTDQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             ++S + R S+         ++S LIN+EYS+GWD  ++        S E   S  +N++E
Sbjct  368   VESLEGRASSSN-------ASSSLINVEYSSGWDTSSEGSQQGLRLSPEWSPSVRYNMEE  420



>ref|NP_001146186.1| uncharacterized LOC100279756 precursor [Zea mays]
 gb|ACL53424.1| unknown [Zea mays]
 tpg|DAA58650.1| TPA: putative leucine-rich repeat protein kinase family protein 
[Zea mays]
Length=696

 Score =   256 bits (654),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 168/347 (48%), Positives = 215/347 (62%), Gaps = 32/347 (9%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            FEG+AC+  G V N+SLQGKGL G +PP +A +++L+GLYLH+N L G +PRE+A L  L
Sbjct  68   FEGVACDARGAVANVSLQGKGLAGTLPPAVAGLRSLTGLYLHYNALRGGIPRELAALAAL  127

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             DLYL+VN+ SG IP EI  + SLQV+QLCYN+L+G+IP QLG+L  LTVLALQSN   G
Sbjct  128  TDLYLDVNNFSGPIPSEIGAMASLQVVQLCYNQLTGSIPTQLGNLTRLTVLALQSNRFNG  187

Query  362  AIPAtlgdltlltrldlSFNHLFGSIPAKLAN-AQKLEILDIRNNTLSGNVPLAL-KRLN  535
            AIPA+LGDL LL RLDLSFN LFGSIP +LA     L +LD+RNN+L+G+VP  L  +L 
Sbjct  188  AIPASLGDLPLLARLDLSFNRLFGSIPVRLAQLPCSLVVLDVRNNSLTGSVPAELAAKLQ  247

Query  536  EGFQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDIPESANVQPHAL-  709
             GFQY NN  LCG G  +L+ CT + L +P +P+PF              SA + P    
Sbjct  248  AGFQYGNNSDLCGAGLPALRPCTPADLIDPDRPQPF--------------SAGIAPQVTP  293

Query  710  ----NKPRKPQTAvvvvgvlglivAFFAT--GLFTFSWYRRRKQKIGSTIDS--SDSRLS  865
                   R P T  +   V+  +     T  GLF  SW R  +QK+     S  S  R S
Sbjct  294  SDGRGNGRVPSTRALAAVVVVAVALLLTTGVGLFALSWRRWHRQKVAGASPSTISGGRCS  353

Query  866  TD------QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEV  988
            T+      +A    + ++S L +LEYSN WDPLA AR G    SQ+V
Sbjct  354  TEVVPSAAKASSARKSASSALASLEYSNAWDPLADARGGLGFVSQDV  400



>ref|XP_004969430.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Setaria italica]
Length=696

 Score =   256 bits (653),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 162/321 (50%), Positives = 209/321 (65%), Gaps = 16/321 (5%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            FEG+AC+  G V N+SLQGKGL G +PP +A ++ L+GLYLH+N L G +PRE+A L  L
Sbjct  68   FEGVACDARGAVANVSLQGKGLAGTLPPAVAGLRALTGLYLHYNALRGGIPRELAALGAL  127

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             DLYL+VN+LSG IPPEI  + SLQV+QLCYN+L+G+IP QLG+L  LTVLALQSN L G
Sbjct  128  TDLYLDVNNLSGPIPPEIGAMASLQVVQLCYNQLTGSIPTQLGNLTRLTVLALQSNRLNG  187

Query  362  AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLAL-KRLNE  538
            AIPA+LGDL LL+RLDL FN+LFGSIP +LA   +L  LD+RNN+L+G+VP  L   L  
Sbjct  188  AIPASLGDLPLLSRLDLGFNNLFGSIPVRLARLPRLVALDVRNNSLTGSVPAELAANLQA  247

Query  539  GFQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFGPGSNHLPTKDIPESANVQPHALNK  715
            GFQY NN  LCG G  +L+ CT + L +P +P+PF  G +   T          P    +
Sbjct  248  GFQYGNNTDLCGAGLPALRPCTPADLIDPDRPQPFSAGISPQVTS---------PDGGGR  298

Query  716  PRKPQT--AvvvvgvlglivAFFATGLFTFSWYRRRKQKI---GSTIDSSDSRLSTDQAK  880
             R P T     VV V   ++A  A GLF  SW R R Q++   GS   +     +  +A 
Sbjct  299  GRAPSTKALAAVVVVAVALLAATAVGLFALSWRRWRGQRVVSGGSPPTACGVTEAAAKAS  358

Query  881  EVSRRSASPLINLEYSNGWDP  943
               + ++S L +LEYSN WDP
Sbjct  359  SARKSASSALASLEYSNAWDP  379



>gb|EMS50357.1| Leucine-rich repeat receptor protein kinase EXS [Triticum urartu]
Length=643

 Score =   252 bits (643),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 153/308 (50%), Positives = 202/308 (66%), Gaps = 5/308 (2%)
 Frame = +2

Query  107   LSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLS  286
             L+GLYLH+N L GA+PRE+ +L  L +LYL VN+LSG IP E+  +  LQVLQL YN+LS
Sbjct  5     LTGLYLHYNELGGAIPRELGDLPDLAELYLGVNNLSGGIPIELGRLHRLQVLQLGYNQLS  64

Query  287   GNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNHLFGSIPAKLANAQK  466
             G+IP QLG LK LTVLA+QSN LTGAIPA+LGDL  LTRLDLS NHLFGSIP+KLA   +
Sbjct  65    GSIPTQLGELKKLTVLAVQSNQLTGAIPASLGDLPELTRLDLSSNHLFGSIPSKLAGIPQ  124

Query  467   LEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFSSLKLCTDSALNPSKPEPFGP  646
             +  LD+RNNTLSG+VP  LK+L  GF++ NN  LCG  F +LK C +   N     P  P
Sbjct  125   IATLDLRNNTLSGSVPSGLKKLGHGFKFDNNLELCGSHFDTLKACPNDE-NVDDQMPHKP  183

Query  647   GSNHLPTKDIPESA----NVQPHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRR  814
              S  +  +  P++     N    A ++     +  V+ G + +I    A GL  FSW+RR
Sbjct  184   ESTSIKPQQTPQNTSQNRNCDNGACSRSSTLSSGAVLAGTIIIIAGVAACGLSVFSWHRR  243

Query  815   RKQKIGSTIDSSDSRLSTDQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLE  994
             +KQK+G +++S + R S +Q+KE  ++SAS LIN+EYS+GWD  ++        S E   
Sbjct  244   QKQKVGCSVESLEGRPSLEQSKETYQKSASSLINVEYSSGWDTSSEGSQHGVRLSPEGSP  303

Query  995   SFMFNLDE  1018
             S  FNL+E
Sbjct  304   SVRFNLEE  311


 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 58/101 (57%), Gaps = 3/101 (3%)
 Frame = +2

Query  23   ELGQVVNISLQGKG---LYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLY  193
            ELG++  + +   G   L G IP ++ ++K L+ L +  N L GA+P  + +L  L  L 
Sbjct  46   ELGRLHRLQVLQLGYNQLSGSIPTQLGELKKLTVLAVQSNQLTGAIPASLGDLPELTRLD  105

Query  194  LNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSL  316
            L+ NHL GSIP +++ I  +  L L  N LSG++P+ L  L
Sbjct  106  LSSNHLFGSIPSKLAGIPQIATLDLRNNTLSGSVPSGLKKL  146



>ref|XP_008377897.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180, partial [Malus domestica]
Length=500

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 141/273 (52%), Positives = 175/273 (64%), Gaps = 39/273 (14%)
 Frame = +2

Query  227   PEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrl  406
             P +  +    VLQLCYN+L+G+IP QLGSLKNL+VLALQSNHLTGAIPA           
Sbjct  23    PHLGFVFCFSVLQLCYNQLTGSIPTQLGSLKNLSVLALQSNHLTGAIPA-----------  71

Query  407   dlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFS  586
                             +A  LE+LD+RNNTLSGNVPLALKRLNEGF Y NN GLCG GF 
Sbjct  72    ---------------TDAPVLEVLDVRNNTLSGNVPLALKRLNEGFSYENNLGLCGAGFM  116

Query  587   SLKLCTDSAL-NPSKPEPFGPGSNHLPTKDIPESANV-----QPHALNKPRKPQTAvvvv  748
             SL  CT S   N S+PEPFG G   +PT+D PE+ANV     Q    N  +  Q +V VV
Sbjct  117   SLTACTTSGHPNASRPEPFGAG---VPTRDFPETANVPLPCNQTRCSNLSKSHQASVAVV  173

Query  749   gvlgliv-AFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKE--VSRRSASPLINL  919
               + ++  A    G   F+ +RRRKQK+G++ D+++ R STD+AK   V R++ SPLI+L
Sbjct  174   VGVIVVTIALSGVGFVFFTQHRRRKQKLGNSFDTAEGRFSTDEAKANGVYRKNGSPLISL  233

Query  920   EYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             EY+NGWDPLA  RN  + F+QEV  SF FNL+E
Sbjct  234   EYANGWDPLANGRN-LSVFAQEVFGSFRFNLEE  265



>gb|EAZ41323.1| hypothetical protein OsJ_25834 [Oryza sativa Japonica Group]
Length=678

 Score =   236 bits (601),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 157/342 (46%), Positives = 208/342 (61%), Gaps = 36/342 (11%)
 Frame = +2

Query  56    GKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEI  235
             GKGL G I P +A +  L+GLYLH+N L GA+PR++ +L  L +LYL VN+LSG+IP E+
Sbjct  70    GKGLAGAISPAVAMLPGLTGLYLHYNELAGAIPRQLGDLPMLAELYLGVNNLSGTIPVEL  129

Query  236   SNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlS  415
               + +LQVLQL YN+LSG+IP QLG LK LTVLALQSN LTGAIPA+LGDL  L RLDLS
Sbjct  130   GRLPALQVLQLGYNQLSGSIPTQLGQLKKLTVLALQSNQLTGAIPASLGDLPELARLDLS  189

Query  416   FNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFSSLK  595
              N LFGSIP+KLA   KL  LD+RNNTLSG+VP  LK+LNEGF + NN  LCG  F SLK
Sbjct  190   SNRLFGSIPSKLAAIPKLATLDLRNNTLSGSVPSGLKKLNEGFHFDNNSELCGAHFDSLK  249

Query  596   LCTDSALNPSKPEPFGPGSNHLPTKDIPESANVQ----PHALNKPRKPQ-----------  730
              C +   + ++        + +  K  PES NV+    P  +N  R              
Sbjct  250   PCANGDEDDNEE------GSKMARK--PESTNVKPLQAPQTMNVNRDCDNGGCSRSSSSS  301

Query  731   ----TAvvvvgvlglivAFFATGLFTFSWYRRRKQKI--GSTIDSSDSRLSTDQAKEVSR  892
                 +  ++ G + +I    A G+   SW RR+KQK+  G T++S + R S+        
Sbjct  302   TTLSSGAILAGTIIIIGGAAACGISVISWRRRQKQKVGGGGTVESLEGRASSSN------  355

Query  893   RSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              ++S LIN+EYS+GWD  ++        S E   S  +N++E
Sbjct  356   -ASSSLINVEYSSGWDTSSEGSQQGLRLSPEWSPSVRYNMEE  396



>gb|KEH27456.1| LRR receptor-like kinase [Medicago truncatula]
Length=645

 Score =   234 bits (597),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 157/349 (45%), Positives = 200/349 (57%), Gaps = 53/349 (15%)
 Frame = +2

Query  2     FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
             FEGIACNE  +V NISLQGKGL+G +   +A++K LSGLYLH+N+               
Sbjct  59    FEGIACNEHWKVANISLQGKGLFGSLSSSVAELKCLSGLYLHYNN---------------  103

Query  182   LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
                                    L VLQL  N+L GNIP Q+GSLK LT LALQ N LTG
Sbjct  104   -----------------------LSVLQLGDNQLVGNIPTQMGSLKQLTTLALQYNKLTG  140

Query  362   AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              IP +LG+L  L+RL+LSFN+  G+IPA LAN   LE+LDI+NN+LSG VP  L+RL EG
Sbjct  141   QIPLSLGNLENLSRLNLSFNNFSGAIPATLANIAHLEVLDIQNNSLSGTVPSVLQRLGEG  200

Query  542   FQYTNNPGLCGIGFSSLKLCT-DSALNPSKPEPFGPGSNHL----PTKDIPESANVQPHA  706
             FQ  NN GLCG+G S+L+ C  +  LN S  +      +HL    P    PE AN Q H 
Sbjct  201   FQGANNQGLCGVGISTLRACNKEPDLNVSNIDT--SDQDHLKNSNPATPRPEPANFQMHC  258

Query  707   ----LNKPRK-PQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD  871
                  +K R  P + +    +  + +     GLFTF  YRRRKQKI S  +SS+ +LS  
Sbjct  259   NQKHCSKSRSVPTSVITASVIAIITLTIIGAGLFTFVKYRRRKQKISS--NSSEGKLSPQ  316

Query  872   QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             Q KE+ ++S S L+NL+Y NG  P+   +N     S E L  F FN+DE
Sbjct  317   QPKELYQKSPSTLVNLDYYNGCYPMPDDQNA-GGLSNEYLNQFRFNVDE  364



>ref|XP_008791357.1| PREDICTED: somatic embryogenesis receptor kinase 1-like, partial 
[Phoenix dactylifera]
Length=513

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 132/260 (51%), Positives = 161/260 (62%), Gaps = 40/260 (15%)
 Frame = +2

Query  257   VLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNHLFGS  436
             VLQL YN+L+G IP  LG L  LT L L                        SFNHLFGS
Sbjct  11    VLQLGYNQLTGAIPATLGDLTQLTRLYL------------------------SFNHLFGS  46

Query  437   IPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFSSLKLC-TDSA  613
             IP KLA   +L + D++NN+LSG+VP  LKRLNEGFQY NN GLCG+GF+SLK C +D  
Sbjct  47    IPVKLAQVPQLVVFDVQNNSLSGSVPSDLKRLNEGFQYGNNTGLCGVGFTSLKGCPSDDP  106

Query  614   LNPSKPEPFGPGSNHLPTKDIPESANVQPHALNKPRKPQTAvvvvgvlglivAFFATG--  787
             L PSKPEPFG        ++IP+SANV  H  N    P+++      + + +   A G  
Sbjct  107   LKPSKPEPFG--------QEIPQSANVTTHC-NHSHCPKSSKSSAVKVVIGIVAMAVGGL  157

Query  788   ---LFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRSASPLINLEYSNGWDPLAKAR  958
                L  F+ YRRRKQKIGS ++ SDSRLSTDQ K+  R+SASPLI+LEYS+GWD L   R
Sbjct  158   VISLLAFALYRRRKQKIGSALEVSDSRLSTDQPKDFYRKSASPLISLEYSSGWDSLVDGR  217

Query  959   NGNAAFSQEVLESFMFNLDE  1018
              G A  SQEV +SF FNL+E
Sbjct  218   -GGAGISQEVSQSFRFNLEE  236


 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +2

Query  116  LYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNI  295
            L L +N L GA+P  + +LT L  LYL+ NHL GSIP +++ +  L V  +  N LSG++
Sbjct  12   LQLGYNQLTGAIPATLGDLTQLTRLYLSFNHLFGSIPVKLAQVPQLVVFDVQNNSLSGSV  71

Query  296  PNQLGSL  316
            P+ L  L
Sbjct  72   PSDLKRL  78



>ref|XP_008232646.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X2 [Prunus mume]
Length=473

 Score =   226 bits (576),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 153/196 (78%), Gaps = 15/196 (8%)
 Frame = +2

Query  467   LEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFSSLKLCTDSAL-NPSKPEPFG  643
             L++LD+R+N+LSGN+P  LKRLN GFQY NNP LCG+GFS LK+CT +   NP+KP+PF 
Sbjct  2     LQVLDVRSNSLSGNIPPDLKRLNGGFQYENNPSLCGVGFSGLKVCTATTTRNPNKPQPFE  61

Query  644   PG---SNHLP----TKDIPESANVQPHA----LNKPRKPQTAvvvvgvlglivAFFATGL  790
             PG   + +LP     ++IPESAN++ +      ++  K Q   +V GV+G+I A   +GL
Sbjct  62    PGNFTAKNLPDSPTAREIPESANLESNCSQTHCSRASKSQQIGIVFGVIGVIAALAVSGL  121

Query  791   FTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRSASPLINLEYSNGWDPLAKARNGNA  970
             FTFSWYRRRKQKIGST+D+SDSRLSTDQAKEV +++ASPLINLEYSNGWDPLAK   G+A
Sbjct  122   FTFSWYRRRKQKIGSTLDTSDSRLSTDQAKEVYKKNASPLINLEYSNGWDPLAK---GSA  178

Query  971   AFSQEVLESFMFNLDE  1018
              +SQEVLESFMFNL+E
Sbjct  179   GYSQEVLESFMFNLEE  194



>ref|NP_001140286.1| uncharacterized protein LOC100272330 [Zea mays]
 gb|ACN32044.1| unknown [Zea mays]
Length=513

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 165/234 (71%), Gaps = 8/234 (3%)
 Frame = +2

Query  338   LQSNHLTGAIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPL  517
             +QSN L GAIPATLG+LT L RLDLSFN LFGSIP+K+A    LE+ D+RNNTLSG+VP+
Sbjct  1     MQSNQLDGAIPATLGELTQLRRLDLSFNSLFGSIPSKIAEVPLLEVFDVRNNTLSGSVPV  60

Query  518   ALKRLNEGFQYTNNPGLCGIGFSSLKLC--TDSALNPSKPEPFGPGSNHLPTKDIPESAN  691
              L+RLN GFQY NN GLCG GFS L+LC  ++  L PSKPEPFGP    + T+ +P+SAN
Sbjct  61    GLRRLNGGFQYMNNKGLCGAGFSLLELCLSSEDGLKPSKPEPFGP-DGTVKTRQVPQSAN  119

Query  692   ---VQPHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRL  862
                    + +K       V++V V+  ++     GLF FSWYRR+KQKIGS+++ SDSRL
Sbjct  120   PDGCSGASCSKSANASQGVLIVAVVAAVIGAAFCGLFAFSWYRRQKQKIGSSLEVSDSRL  179

Query  863   STD--QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             STD  Q KE  RRSASPLI++EYSN WDPL+    G  +  Q V +SF FNL+E
Sbjct  180   STDHFQQKEACRRSASPLISVEYSNSWDPLSAGGAGVGSPGQVVGDSFRFNLEE  233



>gb|EPS72502.1| hypothetical protein M569_02256, partial [Genlisea aurea]
Length=226

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            FEG+ACNE G+VVNISLQGKGL GK+ P + ++  L+GLYLH+N L+G +PREI NL  L
Sbjct  56   FEGVACNENGRVVNISLQGKGLAGKLSPAVGRLVHLTGLYLHYNSLYGEIPREIGNLVLL  115

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             DLYLN+N+LSG IP  +  + +LQVLQLCYN L+G+IP QLGSLK L V+ALQ N LTG
Sbjct  116  SDLYLNLNNLSGQIPSVLGRMQNLQVLQLCYNHLTGSIPTQLGSLKRLNVVALQHNLLTG  175

Query  362  AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVP  514
            AIPA+LGD   LTRLDLSFN LFGSIP KLA+A+ L ILD+RNN+LSGNVP
Sbjct  176  AIPASLGDSKTLTRLDLSFNRLFGSIPTKLADAKMLGILDVRNNSLSGNVP  226



>gb|KDO63770.1| hypothetical protein CISIN_1g005586mg [Citrus sinensis]
Length=589

 Score =   219 bits (558),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 141/264 (53%), Positives = 174/264 (66%), Gaps = 14/264 (5%)
 Frame = +2

Query  257   VLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNHLFGS  436
             VLQLC N+L+GNIP Q+GSLK+L+VL LQ N L G IP +LG+L  L RLDLSFN LFG+
Sbjct  44    VLQLCCNQLTGNIPAQIGSLKSLSVLTLQHNRLNGGIPDSLGNLGKLKRLDLSFNSLFGT  103

Query  437   IPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFSSLKLCT---D  607
             IP  LAN  +L  LD++NNTLSG VP ALKRLN GFQ+ NNPGLCG G +SL+ CT   +
Sbjct  104   IPESLANNAELLFLDVQNNTLSGIVPSALKRLNGGFQFQNNPGLCGDGIASLRACTVYDN  163

Query  608   SALNPSKPEPFGPGSNHLPTKDIPESANVQPH-----ALNKPRKPQTAvvvvgvlglivA  772
             + +NP K  PFG  SN     DI E +  + H       N  + PQ A V+  V  + V 
Sbjct  164   TQINPVK--PFGSHSNDTTPIDISEPSGFKEHCNQSQCSNSSKFPQIA-VLAAVTSVTVI  220

Query  773   FFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD--QAKEVSRRSASPLINLEYSNGWDPL  946
                TG+  F  YRR KQKIG+T +SSD +LSTD   AK+ +R  ASPL++LEY +GWDPL
Sbjct  221   LAGTGILIFFRYRRHKQKIGNTSESSDWQLSTDLTLAKDFNRNGASPLVSLEYCHGWDPL  280

Query  947   AKARNGNAAFSQEVLESFMFNLDE  1018
                 NG   FS+E L SF  NL+E
Sbjct  281   GDYLNG-TGFSREHLNSFRLNLEE  303


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = +2

Query  38   VNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSG  217
            V + L    L G IP +I  +K+LS L L  N L+G +P  + NL  L  L L+ N L G
Sbjct  43   VVLQLCCNQLTGNIPAQIGSLKSLSVLTLQHNRLNGGIPDSLGNLGKLKRLDLSFNSLFG  102

Query  218  SIPPEISNITSLQVLQLCYNKLSGNIPNQLGSL  316
            +IP  ++N   L  L +  N LSG +P+ L  L
Sbjct  103  TIPESLANNAELLFLDVQNNTLSGIVPSALKRL  135



>ref|XP_002985490.1| hypothetical protein SELMODRAFT_122408 [Selaginella moellendorffii]
 gb|EFJ13364.1| hypothetical protein SELMODRAFT_122408 [Selaginella moellendorffii]
Length=724

 Score =   218 bits (555),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 138/293 (47%), Positives = 188/293 (64%), Gaps = 13/293 (4%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            F G+AC+  G+V N+SLQG+GL G IP  I ++ +L+ LYLH+N L G++P  +A+LT L
Sbjct  63   FVGVACDSRGRVTNVSLQGRGLEGSIPAAIGELSSLTALYLHYNSLSGSIPSSLASLTGL  122

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             D+YLNVN LSG+IP +++++ +LQ LQLC N LSG IP+ LG L  L +LALQ NHL G
Sbjct  123  TDVYLNVNKLSGAIPSQLTSLRNLQALQLCCNDLSGPIPDALGHLGLLNLLALQHNHLDG  182

Query  362  AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKR----  529
             IPA+LG L+ L  LDLSFN L G IPA L N  ++ +LD+R+N LSG VP   ++    
Sbjct  183  RIPASLGQLSSLKHLDLSFNSLSGPIPAALNNLAQITVLDVRSNKLSGYVPAGKRKLLIA  242

Query  530  ----LNEGFQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFG-PGSNHLPTKDIPESAN  691
                L  GF Y+NN GLCG+GF SL  C+ S A +  +P+PFG PG+     + + + A 
Sbjct  243  SNSNLETGFAYSNNTGLCGVGFPSLPYCSGSGASSLQRPQPFGAPGNAATVAQTVAKRAP  302

Query  692  VQPHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSS  850
            +  +  +  R PQ AV+   V        A  L +F W+RR KQ+I ST DSS
Sbjct  303  LSTN--SSSRIPQMAVIGGVVAVTGGVLLAM-LMSFVWFRRHKQRISSTHDSS  352



>gb|EPS61496.1| hypothetical protein M569_13300 [Genlisea aurea]
Length=650

 Score =   217 bits (552),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 153/201 (76%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            F+G+ACN   +V N+SLQGKGL GK+PP +A++K+L+GLYLH+N+L G VP+EIA+LT L
Sbjct  56   FDGVACNSDRRVENVSLQGKGLTGKLPPAVARLKSLTGLYLHYNYLSGEVPKEIADLTLL  115

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             DLYL+VN+LSG+IPPEI  + SLQVLQLC N+L+G IP  LG L  LTV+AL+ N L G
Sbjct  116  TDLYLDVNNLSGTIPPEIGTMPSLQVLQLCCNRLTGEIPASLGQLGKLTVMALERNQLAG  175

Query  362  AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             IP +L  +  L RL LSFN L GSIPA +A+  +LE+LD++ N LSG +P  L RL +G
Sbjct  176  GIPESLSAVASLNRLYLSFNRLSGSIPAGVADMPRLEVLDVQFNNLSGVIPSGLSRLKDG  235

Query  542  FQYTNNPGLCGIGFSSLKLCT  604
            F+Y NN GLCG GF S++ CT
Sbjct  236  FRYGNNSGLCGSGFPSVRGCT  256



>ref|XP_002987081.1| hypothetical protein SELMODRAFT_125338 [Selaginella moellendorffii]
 gb|EFJ11924.1| hypothetical protein SELMODRAFT_125338 [Selaginella moellendorffii]
Length=738

 Score =   218 bits (554),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 138/293 (47%), Positives = 188/293 (64%), Gaps = 13/293 (4%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            F G+AC+  G+V N+SLQG+GL G IP  I ++ +L+ LYLH+N L G++P  +A+LT L
Sbjct  63   FVGVACDSRGRVTNVSLQGRGLEGSIPGAIGELSSLTALYLHYNSLSGSIPSSLASLTGL  122

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             D+YLNVN LSG+IP +++++ +LQ LQLC N LSG IP+ LG L  L +LALQ NHL G
Sbjct  123  TDVYLNVNKLSGAIPSQLTSLRNLQALQLCCNDLSGPIPDALGHLGLLNLLALQHNHLDG  182

Query  362  AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKR----  529
             IPA+LG L+ L  LDLSFN L G IPA L N  ++ +LD+R+N LSG VP   ++    
Sbjct  183  RIPASLGQLSSLKHLDLSFNSLSGPIPAALNNLAQITVLDVRSNKLSGYVPAGKRKLLIA  242

Query  530  ----LNEGFQYTNNPGLCGIGFSSLKLCTDS-ALNPSKPEPFG-PGSNHLPTKDIPESAN  691
                L  GF Y+NN GLCG+GF SL  C+ S A +  +P+PFG PG+     + + + A 
Sbjct  243  SNSNLETGFAYSNNTGLCGVGFPSLPYCSGSGASSLQRPQPFGAPGNAATVAQTVAKRAP  302

Query  692  VQPHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSS  850
            +  +  +  R PQ AV+   V        A  L +F W+RR KQ+I ST DSS
Sbjct  303  LSTN--SSSRIPQMAVIGGVVAVTGGVLLAM-LMSFVWFRRHKQRISSTHDSS  352



>gb|ACN31808.1| unknown [Zea mays]
Length=397

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 165/264 (63%), Gaps = 38/264 (14%)
 Frame = +2

Query  338   LQSNHLTGAIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVP-  514
             +QSN L GAIPATLG+LT L RLDLSFN LFGSIP+K+A    LE+ D+RNNTLSG+VP 
Sbjct  1     MQSNQLDGAIPATLGELTQLRRLDLSFNSLFGSIPSKIAEVPLLEVFDVRNNTLSGSVPV  60

Query  515   -----------------------------LALKRLNEGFQYTNNPGLCGIGFSSLKLC--  601
                                          L L+RLN GFQY NN GLCG GFS L+LC  
Sbjct  61    GNNLIAFLKLVLFFVSLHGILTTTILCWMLGLRRLNGGFQYMNNKGLCGAGFSLLELCLS  120

Query  602   TDSALNPSKPEPFGPGSNHLPTKDIPESAN---VQPHALNKPRKPQTAvvvvgvlglivA  772
             ++  L PSKPEPFGP    + T+ +P+SAN       + +K       V++V V+  ++ 
Sbjct  121   SEDGLKPSKPEPFGP-DGTVKTRQVPQSANPDGCSGASCSKSANASQGVLIVAVVAAVIG  179

Query  773   FFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTD--QAKEVSRRSASPLINLEYSNGWDPL  946
                 GLF FSWYRR+KQKIGS+++ SDSRLSTD  Q KE  RRSASPLI++EYSN WDPL
Sbjct  180   AAFCGLFAFSWYRRQKQKIGSSLEVSDSRLSTDHFQQKEACRRSASPLISVEYSNSWDPL  239

Query  947   AKARNGNAAFSQEVLESFMFNLDE  1018
             +    G  +  Q V +SF FNL+E
Sbjct  240   SAGGAGVGSPGQVVGDSFRFNLEE  263



>gb|AFW74368.1| putative leucine-rich repeat protein kinase family protein [Zea 
mays]
Length=236

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            FEG+AC+  G+V  ISLQGKGL G +PP +A +  L+GLYLH+N L G +PRE+A L  L
Sbjct  62   FEGVACDARGRVATISLQGKGLAGAVPPAVAMLPALTGLYLHYNALRGEIPRELAALPGL  121

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             +LYL VN+LSG +P E+  + SLQVLQL YN+L+G+IP QLG L  LTVLALQSN L+G
Sbjct  122  AELYLGVNNLSGPVPAELGRLGSLQVLQLGYNQLTGSIPTQLGQLNKLTVLALQSNQLSG  181

Query  362  AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVP  514
            AIPA+LGDL  L RLDLS N LFGSIP+KLA   +L  LD+RNNTLSG+VP
Sbjct  182  AIPASLGDLPALARLDLSSNQLFGSIPSKLAEIPRLATLDLRNNTLSGSVP  232


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   NELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLN  199
              LG +  + L    L G IP ++ Q+  L+ L L  N L GA+P  + +L  L  L L+
Sbjct  140  GRLGSLQVLQLGYNQLTGSIPTQLGQLNKLTVLALQSNQLSGAIPASLGDLPALARLDLS  199

Query  200  VNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPN  301
             N L GSIP +++ I  L  L L  N LSG++P+
Sbjct  200  SNQLFGSIPSKLAEIPRLATLDLRNNTLSGSVPS  233



>ref|XP_010676668.1| PREDICTED: protein NSP-INTERACTING KINASE 2 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=575

 Score =   205 bits (522),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 130/266 (49%), Positives = 175/266 (66%), Gaps = 11/266 (4%)
 Frame = +2

Query  251   LQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNHLF  430
             + VL LC N L+GNIP QL SL  L  L LQ+N L G+IP +LG L +L RLDLS+NHL 
Sbjct  32    IDVLDLCCNHLTGNIPTQLSSLSKLGALYLQNNQLNGSIPPSLGSLDMLKRLDLSYNHLS  91

Query  431   GSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFSSLKLCT--  604
             G IP  LAN Q L+ILD+RNN+LSG +P +LKRL+ GF Y NN  LCG  F  L+ CT  
Sbjct  92    GPIPVTLANIQPLKILDVRNNSLSGAIPTSLKRLDTGFLYQNNTKLCGPAFFKLRACTAF  151

Query  605   DSA-LNPSKPEPFGPGSNH--LPTKDIPESA-----NVQPHALNKPRKPQTAvvvvgvlg  760
             D+A ++ + P PFG   N+   P  + P++A     +  P   ++P K    V+V+GV+ 
Sbjct  152   DNANVDVNTPRPFGLILNNHTTPKHEEPKNATDLQTDCSPSTCSQPTKFPRIVIVIGVIT  211

Query  761   livAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRSASPLINLEYSNGWD  940
              +V   A G  T+  YRR+KQKIG+T+D+S+SR STD A E+  ++ASPL++L YS GWD
Sbjct  212   GLVTLAAVGFLTYIRYRRQKQKIGTTVDASESRFSTDHANELHSKNASPLVSLAYSTGWD  271

Query  941   PLAKARNGNAAFSQEVLESFMFNLDE  1018
             PLA   N +   SQE L++F +NL+E
Sbjct  272   PLADGLN-SGDLSQEALQNFRYNLEE  296


 Score = 63.5 bits (153),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   LYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNI  244
            L G IP +++ +  L  LYL  N L+G++P  + +L  L  L L+ NHLSG IP  ++NI
Sbjct  42   LTGNIPTQLSSLSKLGALYLQNNQLNGSIPPSLGSLDMLKRLDLSYNHLSGPIPVTLANI  101

Query  245  TSLQVLQLCYNKLSGNIPNQLGSL  316
              L++L +  N LSG IP  L  L
Sbjct  102  QPLKILDVRNNSLSGAIPTSLKRL  125



>ref|XP_006590549.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X2 [Glycine max]
Length=633

 Score =   191 bits (484),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 170/264 (64%), Gaps = 11/264 (4%)
 Frame = +2

Query  257   VLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNHLFGS  436
             V +L  N+L G IP Q+ SLK L+ LALQ N LTG IP +LG+L  L+RL+LSFN+  G+
Sbjct  91    VSKLGDNQLVGTIPTQMSSLKQLSTLALQYNKLTGQIPLSLGNLEKLSRLNLSFNNFSGT  150

Query  437   IPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFSSLKLC-TDSA  613
             +PA LA+ + LE+LDI+NN+LSG VP ALKRL EGFQ  NNPGLCG+GFS+L+ C  D  
Sbjct  151   VPATLAHIEHLEVLDIQNNSLSGIVPSALKRLGEGFQGANNPGLCGVGFSTLRACNKDQD  210

Query  614   LNPSKPEPFGPG--SNHLPTKDIPESANVQPHA----LNKPRK-PQTAvvvvgvlglivA  772
             LN +  +        N   +K +PE A VQ H      +K R+ PQT  +  GV+ + + 
Sbjct  211   LNVNHIDTSDGDQPKNSNSSKALPEPAYVQLHCGQTHCSKSRRFPQTV-ITAGVVIVTLT  269

Query  773   FFATGLFTFSWYRRRKQKIGSTI-DSSDSRLSTDQAKEVSRRSASPLINLEYSNGWDPLA  949
             F   G  TF  YRR+KQ+I +T+  SS+ ++S DQ KE   +S S L+N++Y +GWD L+
Sbjct  270   FICAGFLTFFRYRRQKQRISNTLSSSSEGKVSLDQPKEFYTKSPSALVNIDYYSGWDQLS  329

Query  950   KARNGNA-AFSQEVLESFMFNLDE  1018
               +N +A   S E L  F FN+DE
Sbjct  330   NGQNADAGGLSNEYLNQFRFNVDE  353



>ref|XP_001772778.1| predicted protein [Physcomitrella patens]
 gb|EDQ62345.1| predicted protein [Physcomitrella patens]
Length=713

 Score =   182 bits (461),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 127/191 (66%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            FEGI CN +G+V NISLQG+ L G IP E++++  LSGL+LHFN L G +P  +  L  L
Sbjct  56   FEGIFCNSVGRVTNISLQGRSLTGYIPHEVSELLYLSGLFLHFNELQGGIPGSLFTLESL  115

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             DLYLN N L+G IPP+I  +T LQ L+LC NKL G IP ++ +L NL  LA+ +N L G
Sbjct  116  TDLYLNWNQLTGPIPPQIGQLTRLQALELCCNKLEGEIPVEITTLSNLKTLAINANSLYG  175

Query  362  AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
              P T+GDLT+L R DLS N L G IP  +AN   L  LD+ NN LSG VP  L  L+ G
Sbjct  176  TTPTTVGDLTMLQRFDLSNNTLIGRIPDSIANLTNLVFLDVSNNFLSGPVPTGLFSLSHG  235

Query  542  FQYTNNPGLCG  574
            F Y NN GLCG
Sbjct  236  FNYINNSGLCG  246



>ref|XP_002880175.1| hypothetical protein ARALYDRAFT_346342 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56434.1| hypothetical protein ARALYDRAFT_346342 [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 144/216 (67%), Gaps = 19/216 (9%)
 Frame = +2

Query  413   SFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFSSL  592
             SFN+LFG +P KLA A  LE+LDIRNN L  + PL   RLN GFQY+NN GLCG GF+ L
Sbjct  11    SFNNLFGPVPVKLAGAPLLEVLDIRNNPLPASFPL---RLNNGFQYSNNHGLCGDGFTDL  67

Query  593   KLCTD-SALNPSKPEPFGPGSNHLPTKDI-PESANVQPHALNK-----PRKPQTAvvvvg  751
               CT  +  N ++P+P  P   +  T D+ PESA++Q    +        K   +  +  
Sbjct  68    NACTGLNGPNLNRPDPTNP--TNFTTVDVKPESADLQRSNCSNNNGVCSSKTSKSSPLGI  125

Query  752   vlglivAFFATGLF---TFSWYRRRKQKIGSTIDSSDSRLSTD-QAKEVSRR-SASPLIN  916
             V+GL+ +  A  +F   TF+WYRRRKQKIGS++D+ D R+ST+   KEVSRR S+SPLI+
Sbjct  126   VMGLMGSILAVAIFGGSTFTWYRRRKQKIGSSLDAMDGRISTEYNFKEVSRRKSSSPLIS  185

Query  917   LEYSNGWDPLAKAR--NGNAAFSQEVLESFMFNLDE  1018
             LEY++GWDPL + +  N N+A SQEV ESFMFNL+E
Sbjct  186   LEYASGWDPLGRGQSSNNNSALSQEVFESFMFNLEE  221



>ref|XP_002880174.1| hypothetical protein ARALYDRAFT_346340 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56433.1| hypothetical protein ARALYDRAFT_346340 [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 144/216 (67%), Gaps = 19/216 (9%)
 Frame = +2

Query  413   SFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFSSL  592
             SFN+LFG +P KLA A  LE+LDIRNN L  + PL   RLN GFQY+NN GLCG GF+ L
Sbjct  11    SFNNLFGPVPVKLAGAPLLEVLDIRNNPLPASFPL---RLNNGFQYSNNHGLCGDGFTDL  67

Query  593   KLCTD-SALNPSKPEPFGPGSNHLPTKDI-PESANVQPHALNK-----PRKPQTAvvvvg  751
               CT  +  N ++P+P  P   +  T D+ PESA++Q    +        K   +  +  
Sbjct  68    NACTGLNGPNLNRPDPTNP--TNFTTVDVKPESADLQRSNCSNNNGVCSSKTSKSSPLGI  125

Query  752   vlglivAFFATGLF---TFSWYRRRKQKIGSTIDSSDSRLSTD-QAKEVSRR-SASPLIN  916
             V+GL+ +  A  +F   TF+WYRRRKQKIGS++D+ D R+ST+   KEVSRR S+SPLI+
Sbjct  126   VMGLMGSILAVAIFGGSTFTWYRRRKQKIGSSLDAMDGRISTEYNFKEVSRRKSSSPLIS  185

Query  917   LEYSNGWDPLAKAR--NGNAAFSQEVLESFMFNLDE  1018
             LEY++GWDPL + +  N N+A SQEV ESFMFNL+E
Sbjct  186   LEYASGWDPLGRGQSSNNNSALSQEVFESFMFNLEE  221



>ref|XP_001785536.1| predicted protein [Physcomitrella patens]
 gb|EDQ49646.1| predicted protein [Physcomitrella patens]
Length=694

 Score =   176 bits (445),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 132/194 (68%), Gaps = 0/194 (0%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            F+G+ C+  G+V NISLQG+ L G IP  ++++  L+ L+LHFN L G +P  ++ L  L
Sbjct  53   FDGVLCDSAGRVTNISLQGRSLTGFIPDAVSELPELTALFLHFNELRGGIPASLSYLEGL  112

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             D+YLN N LSG+IPP++  + SLQVL+L  N L G IP +L SL NL  LA+ +N+L G
Sbjct  113  TDMYLNWNQLSGAIPPQLGQLASLQVLELSCNNLEGEIPVELASLSNLETLAVNANNLNG  172

Query  362  AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEG  541
             IP+T+G++T+L RLD+S N L G IPA + N  KL  LD+ +N LSG VP  L  L  G
Sbjct  173  TIPSTIGNMTMLQRLDVSNNTLTGKIPASVENLTKLIYLDVSHNLLSGPVPTGLFDLRHG  232

Query  542  FQYTNNPGLCGIGF  583
            F+Y+NN GLCG G 
Sbjct  233  FKYSNNSGLCGTGL  246



>gb|KEH27457.1| LRR receptor-like kinase [Medicago truncatula]
Length=524

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 116/248 (47%), Positives = 150/248 (60%), Gaps = 15/248 (6%)
 Frame = +2

Query  305   LGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDI  484
             +GSLK LT LALQ N LTG IP +LG+L  L+RL+LSFN+  G+IPA LAN   LE+LDI
Sbjct  1     MGSLKQLTTLALQYNKLTGQIPLSLGNLENLSRLNLSFNNFSGAIPATLANIAHLEVLDI  60

Query  485   RNNTLSGNVPLALKRLNEGFQYTNNPGLCGIGFSSLKLC-TDSALNPSKPEPFGPGSNHL  661
             +NN+LSG VP  L+RL EGFQ  NN GLCG+G S+L+ C  +  LN S  +      +HL
Sbjct  61    QNNSLSGTVPSVLQRLGEGFQGANNQGLCGVGISTLRACNKEPDLNVSNIDT--SDQDHL  118

Query  662   ----PTKDIPESANVQPHA----LNKPRK-PQTAvvvvgvlglivAFFATGLFTFSWYRR  814
                 P    PE AN Q H      +K R  P + +    +  + +     GLFTF  YRR
Sbjct  119   KNSNPATPRPEPANFQMHCNQKHCSKSRSVPTSVITASVIAIITLTIIGAGLFTFVKYRR  178

Query  815   RKQKIGSTIDSSDSRLSTDQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLE  994
             RKQKI S  +SS+ +LS  Q KE+ ++S S L+NL+Y NG  P+   +N     S E L 
Sbjct  179   RKQKISS--NSSEGKLSPQQPKELYQKSPSTLVNLDYYNGCYPMPDDQNA-GGLSNEYLN  235

Query  995   SFMFNLDE  1018
              F FN+DE
Sbjct  236   QFRFNVDE  243


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +2

Query  89   IAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNITSLQVLQL  268
            +  +K L+ L L +N L G +P  + NL +L  L L+ N+ SG+IP  ++NI  L+VL +
Sbjct  1    MGSLKQLTTLALQYNKLTGQIPLSLGNLENLSRLNLSFNNFSGAIPATLANIAHLEVLDI  60

Query  269  CYNKLSGNIPNQLGSL  316
              N LSG +P+ L  L
Sbjct  61   QNNSLSGTVPSVLQRL  76


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +2

Query  26   LGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVN  205
            L Q+  ++LQ   L G+IP  +  ++ LS L L FN+  GA+P  +AN+ HL  L +  N
Sbjct  4    LKQLTTLALQYNKLTGQIPLSLGNLENLSRLNLSFNNFSGAIPATLANIAHLEVLDIQNN  63

Query  206  HLSGSIP  226
             LSG++P
Sbjct  64   SLSGTVP  70



>dbj|BAJ93229.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=298

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 110/172 (64%), Gaps = 11/172 (6%)
 Frame = +2

Query  515   LALKRLNEGFQYTNNPGLCGIGFSSLKLC--TDSALNPSKPEPFGPGSNHLPTKDIPESA  688
             L LKRLN GFQY NN GLCG  FS L LC  T+  L PSKPEPFGP    + T  +P+S 
Sbjct  4     LGLKRLNGGFQYVNNKGLCGSEFSLLDLCTSTEDGLRPSKPEPFGP-DGTVKTGQVPQS-  61

Query  689   NVQPHALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSDSRLST  868
              V PH     +     ++V  V  +I A F  G+F FS+YRR+KQKI S+++ SDSRLST
Sbjct  62    -VDPHTTKSAKASAGVLIVGIVAVVIGAAFC-GIFAFSYYRRQKQKISSSLEVSDSRLST  119

Query  869   D--QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             D  Q KE  RRSASPLI++EYSNGWD ++         S EV +SF FNL+E
Sbjct  120   DHFQQKEACRRSASPLISVEYSNGWDTMSGG---GCGSSGEVGDSFRFNLEE  168



>ref|XP_009334232.1| PREDICTED: somatic embryogenesis receptor kinase 4-like [Pyrus 
x bretschneideri]
Length=168

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            FEG+ACNE  +V N+SL GKGL G++ P +A++K LSGLYLH+N L G +P+EI+ LT L
Sbjct  59   FEGVACNEHRKVANVSLVGKGLSGRVSPAVAELKCLSGLYLHYNSLSGEIPKEISYLTEL  118

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGS  313
             DLYLNVN+L+G IP EI N+TSLQVLQLC N+L+GNIP Q+ S
Sbjct  119  TDLYLNVNNLTGGIPSEIGNMTSLQVLQLCCNQLTGNIPTQMRS  162



>ref|XP_009342747.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 [Pyrus x bretschneideri]
Length=238

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            FEG+ACNE  +V N+SL GKGL G++ P +A++K LSGLYLH+N L G +P+EI+ LT L
Sbjct  59   FEGVACNEHRKVANVSLVGKGLSGRVSPAVAELKCLSGLYLHYNSLSGEIPKEISYLTEL  118

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGS  313
             DLYLNVN+L+G IP EI N+TSLQVLQLC N+L+GNIP Q+ S
Sbjct  119  TDLYLNVNNLTGGIPSEIGNMTSLQVLQLCCNQLTGNIPTQMRS  162



>ref|XP_002509720.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
 gb|EEF51107.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
Length=451

 Score =   137 bits (345),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 107/176 (61%), Gaps = 8/176 (5%)
 Frame = +2

Query  509   VPLALKRLNEGFQYTNNPGLCGIGFSSLKLCTD-SALNPSKPEPFGPGSNHLPTKDIPES  685
             VP AL++LN GFQ+ NN GLCG GF  L+ CT  + +N ++ EP GP +N   +K+IP S
Sbjct  2     VPSALQKLNGGFQFENNKGLCGAGFPELRACTAFNNMNINQVEPSGPITNTTTSKNIPVS  61

Query  686   ANVQP-----HALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSS  850
             A +Q         N  + PQ A++       I+      L  F +YRR+KQKIG+  +SS
Sbjct  62    AILQAPCDQTKCSNSSKFPQVAIISGVTTATIILIGVAFLIIF-FYRRQKQKIGNISESS  120

Query  851   DSRLSTDQAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
             + RLSTDQAKE     ASPL++LEYSNGWDP    RNG    S+  L +F FNL+E
Sbjct  121   EGRLSTDQAKEFHGAGASPLVSLEYSNGWDPFRGCRNG-VGISEPSLNNFRFNLEE  175



>gb|AGO88092.1| hypothetical protein [uncultured bacterium 405006-B04]
Length=265

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 117/177 (66%), Gaps = 3/177 (2%)
 Frame = +2

Query  23   ELGQVVNISLQGKG---LYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLY  193
            E+G ++N+ +   G   L G IPPEI  +  L+ L+L+ N L G +P EI NLT+L  L+
Sbjct  55   EIGDLINLEILRLGRNELTGSIPPEIGNLTNLTQLFLNSNQLRGTIPPEIWNLTNLTHLW  114

Query  194  LNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPA  373
            L+ N L+G+IPPEI N+T+L +L L  N+L+G+IP ++G+L NLT L L  N LTG+IP+
Sbjct  115  LDWNQLTGTIPPEIWNLTNLNILWLHRNQLTGSIPPEIGNLTNLTHLYLGWNDLTGSIPS  174

Query  374  tlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGF  544
             + DLT L  LDLS N L GSIP+++ N   L  L + NN L+G VP ++  LN  F
Sbjct  175  EIWDLTNLVELDLSGNDLTGSIPSEIGNLTNLYYLWLTNNQLTGEVPESICDLNVDF  231


 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 108/166 (65%), Gaps = 0/166 (0%)
 Frame = +2

Query  35   VVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLS  214
              N++LQ  GL G+IPPEI  +  L  L L  N L G++P EI NLT+L  L+LN N L 
Sbjct  38   TTNLNLQSHGLTGEIPPEIGDLINLEILRLGRNELTGSIPPEIGNLTNLTQLFLNSNQLR  97

Query  215  GSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltl  394
            G+IPPEI N+T+L  L L +N+L+G IP ++ +L NL +L L  N LTG+IP  +G+LT 
Sbjct  98   GTIPPEIWNLTNLTHLWLDWNQLTGTIPPEIWNLTNLNILWLHRNQLTGSIPPEIGNLTN  157

Query  395  ltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRL  532
            LT L L +N L GSIP+++ +   L  LD+  N L+G++P  +  L
Sbjct  158  LTHLYLGWNDLTGSIPSEIWDLTNLVELDLSGNDLTGSIPSEIGNL  203


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 85/148 (57%), Gaps = 0/148 (0%)
 Frame = +2

Query  89   IAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNITSLQVLQL  268
            +  ++  + L L  + L G +P EI +L +L  L L  N L+GSIPPEI N+T+L  L L
Sbjct  32   VYSVENTTNLNLQSHGLTGEIPPEIGDLINLEILRLGRNELTGSIPPEIGNLTNLTQLFL  91

Query  269  CYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNHLFGSIPAK  448
              N+L G IP ++ +L NLT L L  N LTG IP  + +LT L  L L  N L GSIP +
Sbjct  92   NSNQLRGTIPPEIWNLTNLTHLWLDWNQLTGTIPPEIWNLTNLNILWLHRNQLTGSIPPE  151

Query  449  LANAQKLEILDIRNNTLSGNVPLALKRL  532
            + N   L  L +  N L+G++P  +  L
Sbjct  152  IGNLTNLTHLYLGWNDLTGSIPSEIWDL  179



>gb|AFK46209.1| unknown [Lotus japonicus]
Length=155

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            FEG+ACNE GQV NISLQGKGL GK+ P IA++K L+GLYLH+N L+G +PRE+ANLT L
Sbjct  59   FEGVACNEKGQVANISLQGKGLPGKLSPAIAELKHLTGLYLHYNSLNGEIPREVANLTKL  118

Query  182  LDLYLNVNHLSGSIPPEISNITSLQ  256
             DLYLNVNHLSG IPPEI  + SLQ
Sbjct  119  SDLYLNVNHLSGEIPPEIGRMESLQ  143



>gb|KDO63771.1| hypothetical protein CISIN_1g005586mg [Citrus sinensis]
Length=464

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 106/177 (60%), Gaps = 14/177 (8%)
 Frame = +2

Query  518   ALKRLNEGFQYTNNPGLCGIGFSSLKLCT---DSALNPSKPEPFGPGSNHLPTKDIPESA  688
             ALKRLN GFQ+ NNPGLCG G +SL+ CT   ++ +NP K  PFG  SN     DI E +
Sbjct  6     ALKRLNGGFQFQNNPGLCGDGIASLRACTVYDNTQINPVK--PFGSHSNDTTPIDISEPS  63

Query  689   NVQPH-----ALNKPRKPQTAvvvvgvlglivAFFATGLFTFSWYRRRKQKIGSTIDSSD  853
               + H       N  + PQ AV+       ++    TG+  F  YRR KQKIG+T +SSD
Sbjct  64    GFKEHCNQSQCSNSSKFPQIAVLAAVTSVTVI-LAGTGILIFFRYRRHKQKIGNTSESSD  122

Query  854   SRLSTD--QAKEVSRRSASPLINLEYSNGWDPLAKARNGNAAFSQEVLESFMFNLDE  1018
              +LSTD   AK+ +R  ASPL++LEY +GWDPL    NG   FS+E L SF  NL+E
Sbjct  123   WQLSTDLTLAKDFNRNGASPLVSLEYCHGWDPLGDYLNG-TGFSREHLNSFRLNLEE  178



>dbj|BAP57509.1| hypothetical protein THII_3212 [Thioploca ingrica]
Length=494

 Score =   132 bits (332),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 121/197 (61%), Gaps = 9/197 (5%)
 Frame = +2

Query  26   LGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVN  205
            L ++ ++ L G  L G IPPE+  +  L GL+L  N L G +P E+ NL++L  L+L+ N
Sbjct  146  LSKLEDLCLNGNQLSGPIPPELGNLSNLQGLWLDDNQLSGPIPPELGNLSNLQGLWLDDN  205

Query  206  HLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgd  385
             LSGSIPPE+ N+++L++L+L  N+LSG+IP +LG+L NL +L L SN L+G IP  LG+
Sbjct  206  QLSGSIPPELGNLSNLELLRLDSNQLSGSIPPELGNLSNLQLLWLVSNQLSGPIPPDLGN  265

Query  386  ltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQYTNNPG  565
            L+ L  L LS+N L G IP +L N   L+ L +  N LSG +P  L  LN          
Sbjct  266  LSNLQTLLLSYNQLSGPIPTELGNLSNLQELGLSWNQLSGPIPPELGNLNN---------  316

Query  566  LCGIGFSSLKLCTDSAL  616
            L  +G S  +LC D  L
Sbjct  317  LQDLGLSDNQLCGDIPL  333


 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 111/177 (63%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            + GI+C+  G VV+I L    L G IPPE++ +  L  L L +N L G +P E+ NL+ L
Sbjct  67   WHGISCDN-GYVVSIDLYNNHLSGLIPPELSNLDNLQYLELSYNQLSGPIPPELGNLSKL  125

Query  182  LDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
             DL+L  N LSGSIPPE+ N++ L+ L L  N+LSG IP +LG+L NL  L L  N L+G
Sbjct  126  EDLWLYGNQLSGSIPPELGNLSKLEDLCLNGNQLSGPIPPELGNLSNLQGLWLDDNQLSG  185

Query  362  AIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRL  532
             IP  LG+L+ L  L L  N L GSIP +L N   LE+L + +N LSG++P  L  L
Sbjct  186  PIPPELGNLSNLQGLWLDDNQLSGSIPPELGNLSNLELLRLDSNQLSGSIPPELGNL  242


 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 109/173 (63%), Gaps = 3/173 (2%)
 Frame = +2

Query  23   ELGQVVNIS---LQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLY  193
            ELG + N+    L    L G IPPE+  +  L GL+L  N L G++P E+ NL++L  L 
Sbjct  166  ELGNLSNLQGLWLDDNQLSGPIPPELGNLSNLQGLWLDDNQLSGSIPPELGNLSNLELLR  225

Query  194  LNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPA  373
            L+ N LSGSIPPE+ N+++LQ+L L  N+LSG IP  LG+L NL  L L  N L+G IP 
Sbjct  226  LDSNQLSGSIPPELGNLSNLQLLWLVSNQLSGPIPPDLGNLSNLQTLLLSYNQLSGPIPT  285

Query  374  tlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRL  532
             LG+L+ L  L LS+N L G IP +L N   L+ L + +N L G++PL+L  L
Sbjct  286  ELGNLSNLQELGLSWNQLSGPIPPELGNLNNLQDLGLSDNQLCGDIPLSLMNL  338


 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 97/163 (60%), Gaps = 3/163 (2%)
 Frame = +2

Query  23   ELGQVVNIS---LQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLY  193
            ELG + N+    L    L G IPPE+  +  L  L L  N L G++P E+ NL++L  L+
Sbjct  190  ELGNLSNLQGLWLDDNQLSGSIPPELGNLSNLELLRLDSNQLSGSIPPELGNLSNLQLLW  249

Query  194  LNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPA  373
            L  N LSG IPP++ N+++LQ L L YN+LSG IP +LG+L NL  L L  N L+G IP 
Sbjct  250  LVSNQLSGPIPPDLGNLSNLQTLLLSYNQLSGPIPTELGNLSNLQELGLSWNQLSGPIPP  309

Query  374  tlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLS  502
             LG+L  L  L LS N L G IP  L N  +L    ++NN L+
Sbjct  310  ELGNLNNLQDLGLSDNQLCGDIPLSLMNLSRLNNTQLQNNALN  352



>ref|XP_002511696.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
 gb|EEF50365.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
Length=382

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = +2

Query  788   LFTFSWYRRRKQKIGSTIDSSDSRLSTDQAKEVSRRSASPLINLEYSNGWDPLAKARNGN  967
             LFTF+WYRR+KQKIGS  D+SD RLSTDQAKEV R+SASPLI+LEYSNGWDPLA  +N N
Sbjct  27    LFTFTWYRRQKQKIGSAFDASDGRLSTDQAKEVYRKSASPLISLEYSNGWDPLAIGQNKN  86

Query  968   AAFSQEVLESFMFNLDE  1018
                SQE LESFMFNL+E
Sbjct  87    -GLSQEFLESFMFNLEE  102



>emb|CBJ27111.1| Hypothetical leucine rich repeat protein [Ectocarpus siliculosus]
Length=367

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 110/176 (63%), Gaps = 0/176 (0%)
 Frame = +2

Query  11   IACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDL  190
            +  N  G+VV +SL    L G IP E+ ++  L  L L  N L GA+P E+  LT L  L
Sbjct  163  VEVNSQGRVVKLSLWNNNLQGPIPVEVGRLAVLEYLDLRANELTGAIPPEVGKLTALRWL  222

Query  191  YLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIP  370
             L  N LSG IPP++ ++++L++L L +NKL GNIP +LG L+ L +L L  NHLTGAIP
Sbjct  223  NLRSNQLSGPIPPQLGDLSTLEILDLSWNKLDGNIPTELGDLRQLQLLLLNENHLTGAIP  282

Query  371  AtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNE  538
            A LG L  LTRLDLS N L G IP +L   + L+ L + NN L+GN+P  L  L +
Sbjct  283  AQLGALNKLTRLDLSINQLSGPIPPELGELEALKSLYLSNNQLAGNIPPELGDLRQ  338


 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 0/106 (0%)
 Frame = +2

Query  44   ISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSI  223
            + L    L G IP E+  ++ L  L L+ NHL GA+P ++  L  L  L L++N LSG I
Sbjct  246  LDLSWNKLDGNIPTELGDLRQLQLLLLNENHLTGAIPAQLGALNKLTRLDLSINQLSGPI  305

Query  224  PPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTG  361
            PPE+  + +L+ L L  N+L+GNIP +LG L+ L  L L  NHLTG
Sbjct  306  PPELGELEALKSLYLSNNQLAGNIPPELGDLRQLQWLRLSENHLTG  351


 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 78/131 (60%), Gaps = 0/131 (0%)
 Frame = +2

Query  44   ISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSI  223
            ++L+   L G IPP++  + TL  L L +N L G +P E+ +L  L  L LN NHL+G+I
Sbjct  222  LNLRSNQLSGPIPPQLGDLSTLEILDLSWNKLDGNIPTELGDLRQLQLLLLNENHLTGAI  281

Query  224  PPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltr  403
            P ++  +  L  L L  N+LSG IP +LG L+ L  L L +N L G IP  LGDL  L  
Sbjct  282  PAQLGALNKLTRLDLSINQLSGPIPPELGELEALKSLYLSNNQLAGNIPPELGDLRQLQW  341

Query  404  ldlSFNHLFGS  436
            L LS NHL G+
Sbjct  342  LRLSENHLTGT  352



>gb|KCW62655.1| hypothetical protein EUGRSUZ_G00190 [Eucalyptus grandis]
Length=858

 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 111/167 (66%), Gaps = 3/167 (2%)
 Frame = +2

Query  23   ELGQVVNIS---LQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLY  193
            E+G + N++   L+G  L G IPPEI  +++L+ L+L  N L G++P+EI NLT L++LY
Sbjct  230  EIGNLRNLTCLYLRGNQLGGSIPPEIGNLRSLTILHLEENQLGGSIPQEIGNLTSLINLY  289

Query  194  LNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPA  373
            L  N L GSIPPEI N+TSL  L L  NKLSG+IP ++G+L +L  L LQ N L G+IP+
Sbjct  290  LQENQLGGSIPPEIGNLTSLIHLYLQENKLSGSIPPEIGNLTSLIQLYLQENKLNGSIPS  349

Query  374  tlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVP  514
             + +LT L  L L  N L GSIP ++ N   L  L ++ N LSG++P
Sbjct  350  EIENLTSLIHLYLQENKLVGSIPLEIGNLTSLTYLILQGNQLSGSIP  396


 Score =   116 bits (291),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 104/169 (62%), Gaps = 0/169 (0%)
 Frame = +2

Query  26   LGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVN  205
            L  ++++ LQ   L G IPPEI  + +L  LYL  N L+G++P EI NLT L+ LYL  N
Sbjct  306  LTSLIHLYLQENKLSGSIPPEIGNLTSLIQLYLQENKLNGSIPSEIENLTSLIHLYLQEN  365

Query  206  HLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgd  385
             L GSIP EI N+TSL  L L  N+LSG+IP  +G+LK+LT L +Q N + G+I   +G+
Sbjct  366  KLVGSIPLEIGNLTSLTYLILQGNQLSGSIPPGIGNLKSLTYLDMQGNQVGGSISPEIGN  425

Query  386  ltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRL  532
            L  L    L  N L GSIP ++ N   L  L  + N LSG++PL +  L
Sbjct  426  LRNLNYFHLQGNRLDGSIPPEIGNLMSLTYLYSQGNKLSGSIPLEIGNL  474


 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 100/156 (64%), Gaps = 0/156 (0%)
 Frame = +2

Query  65   LYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNI  244
            L G IPPEI  +++L+ LYL  N L G++P EI NL +L  LYL  N L GSIPPEI N+
Sbjct  199  LDGSIPPEIGNLRSLTYLYLGGNQLGGSIPPEIGNLRNLTCLYLRGNQLGGSIPPEIGNL  258

Query  245  TSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNH  424
             SL +L L  N+L G+IP ++G+L +L  L LQ N L G+IP  +G+LT L  L L  N 
Sbjct  259  RSLTILHLEENQLGGSIPQEIGNLTSLINLYLQENQLGGSIPPEIGNLTSLIHLYLQENK  318

Query  425  LFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRL  532
            L GSIP ++ N   L  L ++ N L+G++P  ++ L
Sbjct  319  LSGSIPPEIGNLTSLIQLYLQENKLNGSIPSEIENL  354


 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 106/167 (63%), Gaps = 3/167 (2%)
 Frame = +2

Query  23   ELGQVVNIS---LQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLY  193
            E+G + +++   LQG  L G IPP I  +K+L+ L +  N + G++  EI NL +L   +
Sbjct  374  EIGNLTSLTYLILQGNQLSGSIPPGIGNLKSLTYLDMQGNQVGGSISPEIGNLRNLNYFH  433

Query  194  LNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPA  373
            L  N L GSIPPEI N+ SL  L    NKLSG+IP ++G+L+ LT+L LQ N L G+IP 
Sbjct  434  LQGNRLDGSIPPEIGNLMSLTYLYSQGNKLSGSIPLEIGNLRGLTLLYLQGNQLGGSIPL  493

Query  374  tlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVP  514
             + +L  LT LDL  N L GSIP+++ N + L  L+++ N L G++P
Sbjct  494  EIWNLMSLTYLDLQGNKLGGSIPSEIGNLRSLTYLNLQGNQLGGSIP  540


 Score =   108 bits (271),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 102/163 (63%), Gaps = 0/163 (0%)
 Frame = +2

Query  44   ISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSI  223
            + L G  L G IPPEI  ++ L+ LYL  N L G++P EI NL  L  L+L  N L GSI
Sbjct  216  LYLGGNQLGGSIPPEIGNLRNLTCLYLRGNQLGGSIPPEIGNLRSLTILHLEENQLGGSI  275

Query  224  PPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltr  403
            P EI N+TSL  L L  N+L G+IP ++G+L +L  L LQ N L+G+IP  +G+LT L +
Sbjct  276  PQEIGNLTSLINLYLQENQLGGSIPPEIGNLTSLIHLYLQENKLSGSIPPEIGNLTSLIQ  335

Query  404  ldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRL  532
            L L  N L GSIP+++ N   L  L ++ N L G++PL +  L
Sbjct  336  LYLQENKLNGSIPSEIENLTSLIHLYLQENKLVGSIPLEIGNL  378


 Score =   108 bits (270),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 104/167 (62%), Gaps = 4/167 (2%)
 Frame = +2

Query  26   LGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLH----GAVPREIANLTHLLDLY  193
            L  ++++ L G  L G IP EI  +++L+ L+L  N L     G++P EI NL  L  LY
Sbjct  158  LRSLIDLYLGGNQLGGSIPLEIGNLRSLTDLFLEGNQLENQLDGSIPPEIGNLRSLTYLY  217

Query  194  LNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPA  373
            L  N L GSIPPEI N+ +L  L L  N+L G+IP ++G+L++LT+L L+ N L G+IP 
Sbjct  218  LGGNQLGGSIPPEIGNLRNLTCLYLRGNQLGGSIPPEIGNLRSLTILHLEENQLGGSIPQ  277

Query  374  tlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVP  514
             +G+LT L  L L  N L GSIP ++ N   L  L ++ N LSG++P
Sbjct  278  EIGNLTSLINLYLQENQLGGSIPPEIGNLTSLIHLYLQENKLSGSIP  324


 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 99/167 (59%), Gaps = 4/167 (2%)
 Frame = +2

Query  26   LGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVN  205
            L  + N+ L+G  L G IP EI  + +L  L L  N L G++P EI NL  L  LY   N
Sbjct  86   LMNLTNLDLRGNQLCGSIPLEIGNLMSLIHLNLGRNQLSGSIPPEIGNLRSLSYLYFGGN  145

Query  206  HLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQ----SNHLTGAIPA  373
             L GSIPPEI N+ SL  L L  N+L G+IP ++G+L++LT L L+     N L G+IP 
Sbjct  146  QLGGSIPPEIGNLRSLIDLYLGGNQLGGSIPLEIGNLRSLTDLFLEGNQLENQLDGSIPP  205

Query  374  tlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVP  514
             +G+L  LT L L  N L GSIP ++ N + L  L +R N L G++P
Sbjct  206  EIGNLRSLTYLYLGGNQLGGSIPPEIGNLRNLTCLYLRGNQLGGSIP  252


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 78/120 (65%), Gaps = 3/120 (3%)
 Frame = +2

Query  23   ELGQVVNIS---LQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLY  193
            E+G + N++   LQG  L G IPPEI  + +L+ LY   N L G++P EI NL  L  LY
Sbjct  422  EIGNLRNLNYFHLQGNRLDGSIPPEIGNLMSLTYLYSQGNKLSGSIPLEIGNLRGLTLLY  481

Query  194  LNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPA  373
            L  N L GSIP EI N+ SL  L L  NKL G+IP+++G+L++LT L LQ N L G+IP+
Sbjct  482  LQGNQLGGSIPLEIWNLMSLTYLDLQGNKLGGSIPSEIGNLRSLTYLNLQGNQLGGSIPS  541


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 71/121 (59%), Gaps = 4/121 (3%)
 Frame = +2

Query  164  ANLTHLLDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQ  343
             NL +L +L L  N L GSIP EI N+ SL  L L  N+LSG+IP ++G+L++L+ L   
Sbjct  84   GNLMNLTNLDLRGNQLCGSIPLEIGNLMSLIHLNLGRNQLSGSIPPEIGNLRSLSYLYFG  143

Query  344  SNHLTGAIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIR----NNTLSGNV  511
             N L G+IP  +G+L  L  L L  N L GSIP ++ N + L  L +      N L G++
Sbjct  144  GNQLGGSIPPEIGNLRSLIDLYLGGNQLGGSIPLEIGNLRSLTDLFLEGNQLENQLDGSI  203

Query  512  P  514
            P
Sbjct  204  P  204


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 52/120 (43%), Gaps = 32/120 (27%)
 Frame = +2

Query  44   ISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSI  223
            + LQG  L G IP EI  + +L+ L L  N L G++P EI NL  L  L L  N L GSI
Sbjct  480  LYLQGNQLGGSIPLEIWNLMSLTYLDLQGNKLGGSIPSEIGNLRSLTYLNLQGNQLGGSI  539

Query  224  PPEISNITSLQVLQL--------------------------------CYNKLSGNIPNQL  307
            P EI N+ SL  L L                                 YN+L G IPN L
Sbjct  540  PSEIGNLRSLTYLNLQENQLDLDLHNNSLFGSIFIFTIFSYLNHLNLSYNRLKGPIPNNL  599



>ref|XP_010061931.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1-like isoform X2 [Eucalyptus grandis]
Length=314

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            F+G+ CNE  +V NISLQGKGL GK+PP +AQ+K LSGLYLH+N+L G +PREI++LT L
Sbjct  59   FDGVVCNEHQKVANISLQGKGLSGKVPPAVAQLKCLSGLYLHYNYLTGEIPREISSLTEL  118

Query  182  LDLYLNVNHLSGSIPPEISNITSLQ  256
             DLYL+VN+L+GSIP EI ++ SLQ
Sbjct  119  TDLYLDVNNLTGSIPSEIGSMASLQ  143



>ref|XP_010061930.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Eucalyptus grandis]
Length=315

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FEGIACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHL  181
            F+G+ CNE  +V NISLQGKGL GK+PP +AQ+K LSGLYLH+N+L G +PREI++LT L
Sbjct  59   FDGVVCNEHQKVANISLQGKGLSGKVPPAVAQLKCLSGLYLHYNYLTGEIPREISSLTEL  118

Query  182  LDLYLNVNHLSGSIPPEISNITSLQ  256
             DLYL+VN+L+GSIP EI ++ SLQ
Sbjct  119  TDLYLDVNNLTGSIPSEIGSMASLQ  143



>ref|WP_039116704.1| hypothetical protein, partial [Flavobacterium sp. KMS]
Length=300

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 105/167 (63%), Gaps = 0/167 (0%)
 Frame = +2

Query  14   ACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLY  193
            +  EL +++N+ LQ   L G IP EI+Q+  L  L L  N L G +PR+I+NLT+L++L+
Sbjct  46   SIGELTELLNLGLQNNKLTGFIPEEISQLTKLRNLILTRNTLAGTIPRDISNLTNLINLW  105

Query  194  LNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPA  373
            LN N L+G +P +I N++SLQ L L YNKL+G IP    +L  L    +++N L+G + +
Sbjct  106  LNYNQLTGPLPLQIGNLSSLQFLDLGYNKLNGTIPPSFYNLTRLITFYIENNSLSGLLSS  165

Query  374  tlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVP  514
             +  L  L  L +S N L G IPA++    +L  LD+R N L+G++P
Sbjct  166  EISKLVSLRDLRISSNQLSGEIPAEMGQLSRLSTLDLRANKLTGSIP  212


 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 91/158 (58%), Gaps = 0/158 (0%)
 Frame = +2

Query  32   QVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHL  211
            Q+  ++L    L G IP EI  +K L+ LYL  N L G +P  I  LT LL+L L  N L
Sbjct  4    QIQYLNLYSNNLKGYIPEEIGMLKYLTSLYLQNNSLGGIIPSSIGELTELLNLGLQNNKL  63

Query  212  SGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdlt  391
            +G IP EIS +T L+ L L  N L+G IP  + +L NL  L L  N LTG +P  +G+L+
Sbjct  64   TGFIPEEISQLTKLRNLILTRNTLAGTIPRDISNLTNLINLWLNYNQLTGPLPLQIGNLS  123

Query  392  lltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSG  505
             L  LDL +N L G+IP    N  +L    I NN+LSG
Sbjct  124  SLQFLDLGYNKLNGTIPPSFYNLTRLITFYIENNSLSG  161


 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 81/150 (54%), Gaps = 0/150 (0%)
 Frame = +2

Query  65   LYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNI  244
            L G IPP    +  L   Y+  N L G +  EI+ L  L DL ++ N LSG IP E+  +
Sbjct  135  LNGTIPPSFYNLTRLITFYIENNSLSGLLSSEISKLVSLRDLRISSNQLSGEIPAEMGQL  194

Query  245  TSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNH  424
            + L  L L  NKL+G+IP ++G L+ L  L L  N L+G IP  +  L  L  L L  N 
Sbjct  195  SRLSTLDLRANKLTGSIPPEIGQLRLLVSLILYGNMLSGEIPTEIKQLGNLDVLWLHNNR  254

Query  425  LFGSIPAKLANAQKLEILDIRNNTLSGNVP  514
              G+IP+++    KL  L +  N LSG++P
Sbjct  255  FTGNIPSEIKGLVKLRYLYLYGNQLSGSIP  284


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 83/160 (52%), Gaps = 1/160 (1%)
 Frame = +2

Query  101  KTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNITSLQVLQLCYNK  280
            K +  L L+ N+L G +P EI  L +L  LYL  N L G IP  I  +T L  L L  NK
Sbjct  3    KQIQYLNLYSNNLKGYIPEEIGMLKYLTSLYLQNNSLGGIIPSSIGELTELLNLGLQNNK  62

Query  281  LSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNHLFGSIPAKLANA  460
            L+G IP ++  L  L  L L  N L G IP  + +LT L  L L++N L G +P ++ N 
Sbjct  63   LTGFIPEEISQLTKLRNLILTRNTLAGTIPRDISNLTNLINLWLNYNQLTGPLPLQIGNL  122

Query  461  QKLEILDIRNNTLSGNVPLALKRLNEGFQ-YTNNPGLCGI  577
              L+ LD+  N L+G +P +   L      Y  N  L G+
Sbjct  123  SSLQFLDLGYNKLNGTIPPSFYNLTRLITFYIENNSLSGL  162


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 72/126 (57%), Gaps = 3/126 (2%)
 Frame = +2

Query  2    FEGIACNELGQVV---NISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANL  172
              G+  +E+ ++V   ++ +    L G+IP E+ Q+  LS L L  N L G++P EI  L
Sbjct  159  LSGLLSSEISKLVSLRDLRISSNQLSGEIPAEMGQLSRLSTLDLRANKLTGSIPPEIGQL  218

Query  173  THLLDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNH  352
              L+ L L  N LSG IP EI  + +L VL L  N+ +GNIP+++  L  L  L L  N 
Sbjct  219  RLLVSLILYGNMLSGEIPTEIKQLGNLDVLWLHNNRFTGNIPSEIKGLVKLRYLYLYGNQ  278

Query  353  LTGAIP  370
            L+G+IP
Sbjct  279  LSGSIP  284


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 68/112 (61%), Gaps = 4/112 (4%)
 Frame = +2

Query  23   ELGQVVNIS---LQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLY  193
            E+GQ+  +S   L+   L G IPPEI Q++ L  L L+ N L G +P EI  L +L  L+
Sbjct  190  EMGQLSRLSTLDLRANKLTGSIPPEIGQLRLLVSLILYGNMLSGEIPTEIKQLGNLDVLW  249

Query  194  LNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSN  349
            L+ N  +G+IP EI  +  L+ L L  N+LSG+IP+ L SL  L  L ++SN
Sbjct  250  LHNNRFTGNIPSEIKGLVKLRYLYLYGNQLSGSIPD-LSSLTLLKRLKIESN  300



>ref|WP_011429901.1| hypothetical protein [Synechococcus sp. JA-3-3Ab]
 ref|YP_474481.1| hypothetical protein CYA_1022 [Synechococcus sp. JA-3-3Ab]
 gb|ABC99218.1| leucine rich repeat protein [Synechococcus sp. JA-3-3Ab]
Length=296

 Score =   120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 101/168 (60%), Gaps = 0/168 (0%)
 Frame = +2

Query  35   VVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLS  214
            +V + L  +GL G +PPEI Q + L  L L +N L G +P E+  L  L  L+L+ N  S
Sbjct  68   LVQLVLDRRGLRGSLPPEIGQFRRLRALSLSYNQLSGPIPAELGQLRELEQLFLDYNQFS  127

Query  215  GSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltl  394
            G IPPE+  + +L+ L L +N+LSG IP +LG L  L  L+LQ+N L+GAIPA LG +  
Sbjct  128  GPIPPELGQLGNLRGLFLDHNQLSGPIPPELGRLSRLENLSLQNNQLSGAIPAQLGQMRS  187

Query  395  ltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNE  538
            L  L L  N L G IP +L     LE L + +N LSG++P  L +L +
Sbjct  188  LKGLFLDRNQLSGPIPPQLGQLHNLENLYLSDNRLSGSLPPELAQLKQ  235


 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 107/188 (57%), Gaps = 5/188 (3%)
 Frame = +2

Query  23   ELGQ---VVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLY  193
            E+GQ   +  +SL    L G IP E+ Q++ L  L+L +N   G +P E+  L +L  L+
Sbjct  85   EIGQFRRLRALSLSYNQLSGPIPAELGQLRELEQLFLDYNQFSGPIPPELGQLGNLRGLF  144

Query  194  LNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPA  373
            L+ N LSG IPPE+  ++ L+ L L  N+LSG IP QLG +++L  L L  N L+G IP 
Sbjct  145  LDHNQLSGPIPPELGRLSRLENLSLQNNQLSGAIPAQLGQMRSLKGLFLDRNQLSGPIPP  204

Query  374  tlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLN--EGFQ  547
             LG L  L  L LS N L GS+P +LA  ++L  L +  N L+G +P  L  L   E   
Sbjct  205  QLGQLHNLENLYLSDNRLSGSLPPELAQLKQLRDLRLARNRLTGELPGFLAELPRLERLH  264

Query  548  YTNNPGLC  571
               NPGLC
Sbjct  265  IEGNPGLC  272



>ref|XP_006493670.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Citrus sinensis]
Length=1002

 Score =   125 bits (314),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 113/205 (55%), Gaps = 25/205 (12%)
 Frame = +2

Query  8    GIACNELGQVVNISLQGKGL-------------------------YGKIPPEIAQIKTLS  112
            GI CN +G+V++ISL   GL                         YG IPP+I+ +  L 
Sbjct  69   GIFCNLVGRVISISLSSLGLNGTFQDFSFSSFPHLMYLNLSCNVLYGNIPPQISNLSKLR  128

Query  113  GLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGN  292
             L L  N L G +P+EI +LT L  LY +VNHL GSIP EI  ++ + VL LC+N  SG 
Sbjct  129  ALDLGNNQLSGVIPQEIGHLTCLRMLYFDVNHLHGSIPLEIGKLSLINVLTLCHNNFSGR  188

Query  293  IPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLE  472
            IP  LG+L NL  L L +N L G+IP  +G+L  L+ LDLS N L GSIP  LAN   L 
Sbjct  189  IPPSLGNLSNLAYLYLNNNSLFGSIPNVMGNLNSLSILDLSQNQLRGSIPFSLANLSNLG  248

Query  473  ILDIRNNTLSGNVPLALKRLNEGFQ  547
            IL +  N+L G +P  +  L   F+
Sbjct  249  ILYLYKNSLFGFIPSVIGNLKSLFE  273


 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 91/162 (56%), Gaps = 0/162 (0%)
 Frame = +2

Query  26   LGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVN  205
            L  +  + L    L+G IP   + + +L+ + L  N L G++P    NL  L +L L +N
Sbjct  268  LKSLFELDLSENQLFGSIPLSFSNLSSLTLMSLFNNSLSGSIPPTQGNLEALSELGLYIN  327

Query  206  HLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgd  385
             L G IPP I N++SL+ L L  N   G +PN++G LK+L+ L L  NHL+G IP ++G+
Sbjct  328  QLDGVIPPSIGNLSSLRTLYLYDNGFYGLVPNEIGYLKSLSKLELCRNHLSGVIPHSIGN  387

Query  386  ltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNV  511
            LT L  +++  NHLFG IP    N   LE L    N L G V
Sbjct  388  LTKLVLVNMCENHLFGLIPKSFRNLTSLERLRFNQNNLFGKV  429


 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 90/167 (54%), Gaps = 0/167 (0%)
 Frame = +2

Query  11   IACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDL  190
            ++ + L  +  +SL    L G IPP    ++ LS L L+ N L G +P  I NL+ L  L
Sbjct  287  LSFSNLSSLTLMSLFNNSLSGSIPPTQGNLEALSELGLYINQLDGVIPPSIGNLSSLRTL  346

Query  191  YLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIP  370
            YL  N   G +P EI  + SL  L+LC N LSG IP+ +G+L  L ++ +  NHL G IP
Sbjct  347  YLYDNGFYGLVPNEIGYLKSLSKLELCRNHLSGVIPHSIGNLTKLVLVNMCENHLFGLIP  406

Query  371  AtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNV  511
             +  +LT L RL  + N+LFG +     +   L  LD+  N L G +
Sbjct  407  KSFRNLTSLERLRFNQNNLFGKVYEAFGDHPNLTFLDLSQNNLYGEI  453


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 93/165 (56%), Gaps = 0/165 (0%)
 Frame = +2

Query  44   ISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSI  223
            + L    L G IP  +A +  L  LYL+ N L G +P  I NL  L +L L+ N L GSI
Sbjct  226  LDLSQNQLRGSIPFSLANLSNLGILYLYKNSLFGFIPSVIGNLKSLFELDLSENQLFGSI  285

Query  224  PPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltr  403
            P   SN++SL ++ L  N LSG+IP   G+L+ L+ L L  N L G IP ++G+L+ L  
Sbjct  286  PLSFSNLSSLTLMSLFNNSLSGSIPPTQGNLEALSELGLYINQLDGVIPPSIGNLSSLRT  345

Query  404  ldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNE  538
            L L  N  +G +P ++   + L  L++  N LSG +P ++  L +
Sbjct  346  LYLYDNGFYGLVPNEIGYLKSLSKLELCRNHLSGVIPHSIGNLTK  390


 Score = 85.5 bits (210),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 96/174 (55%), Gaps = 3/174 (2%)
 Frame = +2

Query  2    FEGIACNELGQVVNIS---LQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANL  172
            F G     LG + N++   L    L+G IP  +  + +LS L L  N L G++P  +ANL
Sbjct  185  FSGRIPPSLGNLSNLAYLYLNNNSLFGSIPNVMGNLNSLSILDLSQNQLRGSIPFSLANL  244

Query  173  THLLDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNH  352
            ++L  LYL  N L G IP  I N+ SL  L L  N+L G+IP    +L +LT+++L +N 
Sbjct  245  SNLGILYLYKNSLFGFIPSVIGNLKSLFELDLSENQLFGSIPLSFSNLSSLTLMSLFNNS  304

Query  353  LTGAIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVP  514
            L+G+IP T G+L  L+ L L  N L G IP  + N   L  L + +N   G VP
Sbjct  305  LSGSIPPTQGNLEALSELGLYINQLDGVIPPSIGNLSSLRTLYLYDNGFYGLVP  358


 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 67/217 (31%), Positives = 91/217 (42%), Gaps = 53/217 (24%)
 Frame = +2

Query  26   LGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVN  205
            L  +  + L   G YG +P EI  +K+LS L L  NHL G +P  I NLT L+ + +  N
Sbjct  340  LSSLRTLYLYDNGFYGLVPNEIGYLKSLSKLELCRNHLSGVIPHSIGNLTKLVLVNMCEN  399

Query  206  HLSGSIPPEISNITSLQVLQL---------------------------------------  268
            HL G IP    N+TSL+ L+                                        
Sbjct  400  HLFGLIPKSFRNLTSLERLRFNQNNLFGKVYEAFGDHPNLTFLDLSQNNLYGEISFNWRN  459

Query  269  ---------CYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFN  421
                       N + G+IP ++G    L VL L SNH+        G LT L  LDLS N
Sbjct  460  FPKLGTFNASMNNIYGSIPPEIGDSSKLQVLDLSSNHI-----VEFGSLTELQYLDLSAN  514

Query  422  HLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRL  532
             L  SIP  + N  KL  L++ NN  +  +P   ++L
Sbjct  515  KLSSSIPKSMGNLSKLHYLNLSNNQFNHKIPTEFEKL  551


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 81/163 (50%), Gaps = 5/163 (3%)
 Frame = +2

Query  44   ISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSI  223
            + L    LYG+I         L       N+++G++P EI + + L  L L+ NH+    
Sbjct  442  LDLSQNNLYGEISFNWRNFPKLGTFNASMNNIYGSIPPEIGDSSKLQVLDLSSNHIV---  498

Query  224  PPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltr  403
              E  ++T LQ L L  NKLS +IP  +G+L  L  L L +N     IP     L  L+ 
Sbjct  499  --EFGSLTELQYLDLSANKLSSSIPKSMGNLSKLHYLNLSNNQFNHKIPTEFEKLIHLSE  556

Query  404  ldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRL  532
            LDLS N L G IP ++ N + LE L++ +N L   +P   + +
Sbjct  557  LDLSHNFLQGEIPPQICNMESLEELNLSHNNLFDLIPGCFEEM  599



>gb|KDO64898.1| hypothetical protein CISIN_1g043316mg [Citrus sinensis]
Length=1031

 Score =   125 bits (314),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 113/205 (55%), Gaps = 25/205 (12%)
 Frame = +2

Query  8    GIACNELGQVVNISLQGKGL-------------------------YGKIPPEIAQIKTLS  112
            GI CN +G+V++ISL   GL                         YG IPP+I+ +  L 
Sbjct  69   GIFCNLVGRVISISLSSLGLNGTFQDFSFSSFPHLMYLNLSCNVLYGNIPPQISNLSKLR  128

Query  113  GLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGN  292
             L L  N L G +P+EI +LT L  LY +VNHL GSIP EI  ++ + VL LC+N  SG 
Sbjct  129  ALDLGNNQLSGVIPQEIGHLTCLRMLYFDVNHLHGSIPLEIGKLSLINVLTLCHNNFSGR  188

Query  293  IPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLE  472
            IP  LG+L NL  L L +N L G+IP  +G+L  L+ LDLS N L GSIP  LAN   L 
Sbjct  189  IPPSLGNLSNLAYLYLNNNSLFGSIPNVMGNLNSLSILDLSQNQLRGSIPFSLANLSNLG  248

Query  473  ILDIRNNTLSGNVPLALKRLNEGFQ  547
            IL +  N+L G +P  +  L   F+
Sbjct  249  ILYLYKNSLFGFIPSVIGNLKSLFE  273


 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 91/162 (56%), Gaps = 0/162 (0%)
 Frame = +2

Query  26   LGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVN  205
            L  +  + L    L+G IP   + + +L+ + L  N L G++P    NL  L +L L +N
Sbjct  268  LKSLFELDLSENQLFGSIPLSFSNLSSLTLMSLFNNSLSGSIPPTQGNLEALSELGLYIN  327

Query  206  HLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgd  385
             L G IPP I N++SL+ L L  N   G +PN++G LK+L+ L L  NHL+G IP ++G+
Sbjct  328  QLDGVIPPSIGNLSSLRTLYLYDNGFYGLVPNEIGYLKSLSKLELCRNHLSGVIPHSIGN  387

Query  386  ltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNV  511
            LT L  +++  NHLFG IP    N   LE L    N L G V
Sbjct  388  LTKLVLVNMCENHLFGLIPKSFRNLTSLERLRFNQNNLFGKV  429


 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 90/167 (54%), Gaps = 0/167 (0%)
 Frame = +2

Query  11   IACNELGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDL  190
            ++ + L  +  +SL    L G IPP    ++ LS L L+ N L G +P  I NL+ L  L
Sbjct  287  LSFSNLSSLTLMSLFNNSLSGSIPPTQGNLEALSELGLYINQLDGVIPPSIGNLSSLRTL  346

Query  191  YLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIP  370
            YL  N   G +P EI  + SL  L+LC N LSG IP+ +G+L  L ++ +  NHL G IP
Sbjct  347  YLYDNGFYGLVPNEIGYLKSLSKLELCRNHLSGVIPHSIGNLTKLVLVNMCENHLFGLIP  406

Query  371  AtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNV  511
             +  +LT L RL  + N+LFG +     +   L  LD+  N L G +
Sbjct  407  KSFRNLTSLERLRFNQNNLFGKVYEAFGDHPNLTFLDLSQNNLYGEI  453


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 84/156 (54%), Gaps = 0/156 (0%)
 Frame = +2

Query  65   LYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNI  244
            +YG IPPEI     L  L L  NH+ G +P +   L  L  L LN+N LSG +P E  ++
Sbjct  473  IYGSIPPEIGDSSKLQVLDLSSNHIVGKIPVQFEKLFSLNKLILNLNQLSGGVPLEFGSL  532

Query  245  TSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNH  424
            T LQ L L  NKLS +IP  +G+L  L  L L +N     IP     L  L+ LDLS N 
Sbjct  533  TELQYLDLSANKLSSSIPKSMGNLSKLHYLNLSNNQFNHKIPTEFEKLIHLSELDLSHNF  592

Query  425  LFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRL  532
            L G IP ++ N + LE L++ +N L   +P   + +
Sbjct  593  LQGEIPPQICNMESLEELNLSHNNLFDLIPGCFEEM  628


 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 93/165 (56%), Gaps = 0/165 (0%)
 Frame = +2

Query  44   ISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSI  223
            + L    L G IP  +A +  L  LYL+ N L G +P  I NL  L +L L+ N L GSI
Sbjct  226  LDLSQNQLRGSIPFSLANLSNLGILYLYKNSLFGFIPSVIGNLKSLFELDLSENQLFGSI  285

Query  224  PPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltr  403
            P   SN++SL ++ L  N LSG+IP   G+L+ L+ L L  N L G IP ++G+L+ L  
Sbjct  286  PLSFSNLSSLTLMSLFNNSLSGSIPPTQGNLEALSELGLYINQLDGVIPPSIGNLSSLRT  345

Query  404  ldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNE  538
            L L  N  +G +P ++   + L  L++  N LSG +P ++  L +
Sbjct  346  LYLYDNGFYGLVPNEIGYLKSLSKLELCRNHLSGVIPHSIGNLTK  390


 Score = 85.1 bits (209),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 96/174 (55%), Gaps = 3/174 (2%)
 Frame = +2

Query  2    FEGIACNELGQVVNIS---LQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANL  172
            F G     LG + N++   L    L+G IP  +  + +LS L L  N L G++P  +ANL
Sbjct  185  FSGRIPPSLGNLSNLAYLYLNNNSLFGSIPNVMGNLNSLSILDLSQNQLRGSIPFSLANL  244

Query  173  THLLDLYLNVNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNH  352
            ++L  LYL  N L G IP  I N+ SL  L L  N+L G+IP    +L +LT+++L +N 
Sbjct  245  SNLGILYLYKNSLFGFIPSVIGNLKSLFELDLSENQLFGSIPLSFSNLSSLTLMSLFNNS  304

Query  353  LTGAIPAtlgdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVP  514
            L+G+IP T G+L  L+ L L  N L G IP  + N   L  L + +N   G VP
Sbjct  305  LSGSIPPTQGNLEALSELGLYINQLDGVIPPSIGNLSSLRTLYLYDNGFYGLVP  358


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/219 (30%), Positives = 96/219 (44%), Gaps = 48/219 (22%)
 Frame = +2

Query  26   LGQVVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVN  205
            L  +  + L   G YG +P EI  +K+LS L L  NHL G +P  I NLT L+ + +  N
Sbjct  340  LSSLRTLYLYDNGFYGLVPNEIGYLKSLSKLELCRNHLSGVIPHSIGNLTKLVLVNMCEN  399

Query  206  HLSGSIPPEISNITSLQVLQL---------------------------------------  268
            HL G IP    N+TSL+ L+                                        
Sbjct  400  HLFGLIPKSFRNLTSLERLRFNQNNLFGKVYEAFGDHPNLTFLDLSQNNLYGEISFNWRN  459

Query  269  ---------CYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFN  421
                       N + G+IP ++G    L VL L SNH+ G IP     L  L +L L+ N
Sbjct  460  FPKLGTFNASMNNIYGSIPPEIGDSSKLQVLDLSSNHIVGKIPVQFEKLFSLNKLILNLN  519

Query  422  HLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNE  538
             L G +P +  +  +L+ LD+  N LS ++P ++  L++
Sbjct  520  QLSGGVPLEFGSLTELQYLDLSANKLSSSIPKSMGNLSK  558


 Score = 76.6 bits (187),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 81/156 (52%), Gaps = 0/156 (0%)
 Frame = +2

Query  65   LYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLSGSIPPEISNI  244
            L+GK+         L+ L L  N+L+G +     N   L     ++N++ GSIPPEI + 
Sbjct  425  LFGKVYEAFGDHPNLTFLDLSQNNLYGEISFNWRNFPKLGTFNASMNNIYGSIPPEIGDS  484

Query  245  TSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltlltrldlSFNH  424
            + LQVL L  N + G IP Q   L +L  L L  N L+G +P   G LT L  LDLS N 
Sbjct  485  SKLQVLDLSSNHIVGKIPVQFEKLFSLNKLILNLNQLSGGVPLEFGSLTELQYLDLSANK  544

Query  425  LFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRL  532
            L  SIP  + N  KL  L++ NN  +  +P   ++L
Sbjct  545  LSSSIPKSMGNLSKLHYLNLSNNQFNHKIPTEFEKL  580



>gb|EAZ17906.1| hypothetical protein OsJ_33453 [Oryza sativa Japonica Group]
Length=631

 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 107/189 (57%), Gaps = 1/189 (1%)
 Frame = +2

Query  35   VVNISLQGKGLYGKIPPEIAQIKTLSGLYLHFNHLHGAVPREIANLTHLLDLYLNVNHLS  214
            V  I +   G  G I P I   ++L+ L+L  NHL G +P EI  L  L  LYL+ N  S
Sbjct  42   VTIIDVSDNGFTGSISPAIGDAQSLNQLWLQNNHLDGEIPPEIGRLGQLQKLYLSNNSFS  101

Query  215  GSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtlgdltl  394
            G IPPEI +++ L  L L  N L+G +P ++G    L  + +  N LTG IPATL  L+ 
Sbjct  102  GEIPPEIGSLSQLTALHLEENALTGRLPGEIGGCARLVEIDVSRNALTGPIPATLSALSS  161

Query  395  ltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVPLALKRLNEGFQYTNNPGLCG  574
            L  L+LS N + G+IPA+L    KL  +D  +N L+GNVP AL  ++    +  NPGLC 
Sbjct  162  LNSLNLSHNAITGAIPAQLV-VLKLSSVDFSSNRLTGNVPPALLVIDGDVAFAGNPGLCV  220

Query  575  IGFSSLKLC  601
             G S L +C
Sbjct  221  GGRSELGVC  229


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 61/105 (58%), Gaps = 0/105 (0%)
 Frame = +2

Query  200  VNHLSGSIPPEISNITSLQVLQLCYNKLSGNIPNQLGSLKNLTVLALQSNHLTGAIPAtl  379
            +N  SG +P E S+  SLQ  ++  NKL+G++P  L  L  +T++ +  N  TG+I   +
Sbjct  1    MNGFSGELPDEYSSCDSLQRFRINKNKLTGSLPAGLWGLPAVTIIDVSDNGFTGSISPAI  60

Query  380  gdltlltrldlSFNHLFGSIPAKLANAQKLEILDIRNNTLSGNVP  514
            GD   L +L L  NHL G IP ++    +L+ L + NN+ SG +P
Sbjct  61   GDAQSLNQLWLQNNHLDGEIPPEIGRLGQLQKLYLSNNSFSGEIP  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2302838196460