BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14616_g1_i2 len=1192 path=[3473:0-61 599:62-1191]

Length=1192
                                                                      Score     E

ref|XP_009600257.1|  PREDICTED: uncharacterized protein LOC104095...    498   3e-171   
ref|XP_009794489.1|  PREDICTED: uncharacterized protein LOC104241...    493   1e-169   
ref|XP_009622278.1|  PREDICTED: uncharacterized protein LOC104113...    486   1e-166   
ref|XP_009600258.1|  PREDICTED: uncharacterized protein LOC104095...    485   2e-166   
ref|XP_009794490.1|  PREDICTED: uncharacterized protein LOC104241...    480   2e-164   
emb|CDP09019.1|  unnamed protein product                                479   8e-164   
ref|XP_011000281.1|  PREDICTED: uncharacterized protein LOC105107896    478   1e-163   
ref|XP_010092779.1|  hypothetical protein L484_001846                   478   1e-163   
ref|XP_002298369.1|  ACT domain-containing family protein               478   2e-163   Populus trichocarpa [western balsam poplar]
ref|XP_002284171.1|  PREDICTED: uncharacterized protein LOC100262...    475   2e-162   Vitis vinifera
ref|XP_007205255.1|  hypothetical protein PRUPE_ppa006272mg             473   9e-162   
ref|XP_009353711.1|  PREDICTED: uncharacterized protein LOC103944...    474   1e-161   
ref|XP_009622281.1|  PREDICTED: uncharacterized protein LOC104113...    473   1e-161   
gb|KHG17010.1|  [Protein-PII] uridylyltransferase                       471   7e-161   
ref|XP_008366334.1|  PREDICTED: uncharacterized protein LOC103429...    470   2e-160   
ref|XP_009353712.1|  PREDICTED: uncharacterized protein LOC103944...    469   4e-160   
ref|XP_008223202.1|  PREDICTED: uncharacterized protein LOC103323019    468   1e-159   
gb|KDO72917.1|  hypothetical protein CISIN_1g014754mg                   468   2e-159   
ref|XP_006424782.1|  hypothetical protein CICLE_v10028516mg             467   2e-159   
ref|XP_011089801.1|  PREDICTED: uncharacterized protein LOC105170...    467   3e-159   
gb|KHG30678.1|  [Protein-PII] uridylyltransferase                       467   4e-159   
ref|XP_006488284.1|  PREDICTED: uncharacterized protein LOC102630286    466   5e-159   
ref|XP_010259962.1|  PREDICTED: uncharacterized protein LOC104599...    464   3e-158   
ref|XP_007016485.1|  ACT domain-containing protein isoform 2            463   1e-157   
ref|XP_010259960.1|  PREDICTED: uncharacterized protein LOC104599...    464   1e-157   
ref|XP_003597349.1|  hypothetical protein MTR_2g096640                  462   1e-157   
ref|XP_009612955.1|  PREDICTED: uncharacterized protein LOC104106...    462   1e-157   
gb|KDP44210.1|  hypothetical protein JCGZ_05677                         462   2e-157   
gb|AES67600.2|  four ACT domain ACT domain protein which protein        462   2e-157   
ref|XP_007016484.1|  ACT domain-containing protein isoform 1            462   3e-157   
ref|XP_010685812.1|  PREDICTED: uncharacterized protein LOC104900152    461   4e-157   
ref|XP_010043578.1|  PREDICTED: uncharacterized protein LOC104432753    461   6e-157   
ref|XP_010253239.1|  PREDICTED: uncharacterized protein LOC104594...    461   7e-157   
ref|XP_009769845.1|  PREDICTED: uncharacterized protein LOC104220644    459   6e-156   
gb|KCW85596.1|  hypothetical protein EUGRSUZ_B02387                     462   5e-155   
gb|KCW85594.1|  hypothetical protein EUGRSUZ_B02387                     462   8e-155   
ref|XP_010535546.1|  PREDICTED: uncharacterized protein LOC104810818    453   9e-154   
gb|KHN33401.1|  [Protein-PII] uridylyltransferase                       451   4e-153   
ref|XP_003547397.2|  PREDICTED: uncharacterized protein LOC100793459    451   4e-153   
ref|XP_004294579.1|  PREDICTED: uncharacterized protein LOC101295495    449   3e-152   
ref|XP_007150307.1|  hypothetical protein PHAVU_005G142400g             447   3e-151   
ref|XP_004487024.1|  PREDICTED: uncharacterized protein LOC101513...    440   1e-148   
gb|EYU36259.1|  hypothetical protein MIMGU_mgv1a007078mg                437   1e-147   
gb|EPS73518.1|  hypothetical protein M569_01237                         435   1e-146   
ref|XP_006418981.1|  hypothetical protein EUTSA_v10002542mg             434   2e-146   
ref|XP_010259961.1|  PREDICTED: uncharacterized protein LOC104599...    433   8e-146   
ref|XP_010920651.1|  PREDICTED: uncharacterized protein LOC105044447    424   2e-142   
ref|XP_011089802.1|  PREDICTED: uncharacterized protein LOC105170...    422   3e-142   
ref|XP_009794329.1|  PREDICTED: uncharacterized protein LOC104241112    421   2e-141   
ref|XP_009421343.1|  PREDICTED: uncharacterized protein LOC104000914    421   4e-141   
ref|XP_009599789.1|  PREDICTED: uncharacterized protein LOC104095372    420   5e-141   
gb|KCW85595.1|  hypothetical protein EUGRSUZ_B02387                     426   5e-141   
ref|XP_006436032.1|  hypothetical protein CICLE_v10031651mg             416   4e-139   
ref|XP_006436031.1|  hypothetical protein CICLE_v10031651mg             414   7e-139   
ref|XP_009404607.1|  PREDICTED: uncharacterized protein LOC103987882    413   3e-138   
emb|CDX68360.1|  BnaC01g24380D                                          413   4e-138   
ref|XP_009337600.1|  PREDICTED: uncharacterized protein LOC103930...    409   6e-137   
ref|XP_009337599.1|  PREDICTED: uncharacterized protein LOC103930...    410   6e-137   
ref|XP_009357700.1|  PREDICTED: uncharacterized protein LOC103948398    410   7e-137   
ref|XP_008371493.1|  PREDICTED: uncharacterized protein LOC103434895    410   7e-137   
ref|XP_010503205.1|  PREDICTED: uncharacterized protein LOC104780408    409   1e-136   
ref|XP_009337598.1|  PREDICTED: uncharacterized protein LOC103930...    410   1e-136   
ref|XP_008366335.1|  PREDICTED: uncharacterized protein LOC103429...    408   2e-136   
ref|XP_010514916.1|  PREDICTED: uncharacterized protein LOC104790830    408   3e-136   
ref|XP_006291198.1|  hypothetical protein CARUB_v10017326mg             408   5e-136   
ref|XP_008233594.1|  PREDICTED: uncharacterized protein LOC103332625    407   1e-135   
ref|XP_010466563.1|  PREDICTED: uncharacterized protein LOC104746737    405   4e-135   
emb|CDP00065.1|  unnamed protein product                                405   7e-135   
ref|XP_002283917.1|  PREDICTED: uncharacterized protein LOC100256399    404   1e-134   Vitis vinifera
ref|XP_007218067.1|  hypothetical protein PRUPE_ppa006240mg             404   1e-134   
ref|XP_009414313.1|  PREDICTED: uncharacterized protein LOC103995444    404   2e-134   
ref|XP_010095038.1|  hypothetical protein L484_026344                   403   3e-134   
ref|XP_004239778.1|  PREDICTED: uncharacterized protein LOC101260344    403   3e-134   
ref|XP_010534491.1|  PREDICTED: uncharacterized protein LOC104810...    402   5e-134   
ref|XP_004487025.1|  PREDICTED: uncharacterized protein LOC101513...    399   8e-133   
ref|XP_006345943.1|  PREDICTED: uncharacterized protein LOC102604712    399   2e-132   
gb|EPS62989.1|  hypothetical protein M569_11799                         397   2e-132   
ref|XP_007009386.1|  ACT domain-containing protein                      400   4e-132   
ref|XP_004307534.1|  PREDICTED: uncharacterized protein LOC101293138    397   5e-132   
ref|XP_008343544.1|  PREDICTED: uncharacterized protein LOC103406326    395   3e-131   
gb|EEC78396.1|  hypothetical protein OsI_18182                          396   5e-131   Oryza sativa Indica Group [Indian rice]
gb|EEE62089.1|  hypothetical protein OsJ_16873                          395   5e-131   Oryza sativa Japonica Group [Japonica rice]
gb|KHN13889.1|  hypothetical protein glysoja_016173                     395   6e-131   
ref|NP_001054453.1|  Os05g0113000                                       395   1e-130   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002528441.1|  amino acid binding protein, putative               394   2e-130   Ricinus communis
ref|NP_001242111.1|  uncharacterized protein LOC100787003               390   3e-129   
ref|XP_004492116.1|  PREDICTED: uncharacterized protein LOC101495407    389   8e-129   
ref|XP_003569001.1|  PREDICTED: uncharacterized protein LOC100846...    390   9e-129   
ref|XP_002312081.1|  ACT domain-containing family protein               388   2e-128   Populus trichocarpa [western balsam poplar]
ref|XP_007139241.1|  hypothetical protein PHAVU_008G013100g             388   2e-128   
ref|XP_002315234.2|  ACT domain-containing family protein               388   3e-128   Populus trichocarpa [western balsam poplar]
ref|XP_011026220.1|  PREDICTED: uncharacterized protein LOC105126867    388   3e-128   
ref|XP_002875758.1|  hypothetical protein ARALYDRAFT_323253             386   4e-128   
ref|XP_003621862.1|  hypothetical protein MTR_7g024320                  385   3e-127   
gb|KFK36847.1|  hypothetical protein AALP_AA4G179500                    385   3e-127   
ref|XP_010231766.1|  PREDICTED: uncharacterized protein LOC100846...    385   6e-127   
ref|XP_006411185.1|  hypothetical protein EUTSA_v10016727mg             384   6e-127   
ref|XP_002879806.1|  ACT domain-containing protein                      384   7e-127   
ref|XP_010253240.1|  PREDICTED: uncharacterized protein LOC104594...    383   7e-127   
ref|XP_006294312.1|  hypothetical protein CARUB_v10023319mg             384   1e-126   
gb|AFK39044.1|  unknown                                                 384   1e-126   
dbj|BAJ97213.1|  predicted protein                                      385   1e-126   
ref|NP_565908.1|  ACT domain-containing protein                         383   2e-126   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ88654.1|  predicted protein                                      384   3e-126   
gb|ACJ84336.1|  unknown                                                 382   4e-126   Medicago truncatula
ref|XP_010508999.1|  PREDICTED: uncharacterized protein LOC104785475    382   4e-126   
gb|AAK74028.1|  At2g39570/F12L6.23                                      380   3e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141822.1|  PREDICTED: uncharacterized protein LOC103865730    380   3e-125   
gb|AGV54627.1|  hypothetical protein                                    380   4e-125   
ref|XP_011027156.1|  PREDICTED: uncharacterized protein LOC105127517    380   5e-125   
emb|CDY07020.1|  BnaA04g22950D                                          379   5e-125   
ref|XP_004960506.1|  PREDICTED: uncharacterized protein LOC101766737    380   8e-125   
ref|XP_002439153.1|  hypothetical protein SORBIDRAFT_09g001450          379   2e-124   Sorghum bicolor [broomcorn]
ref|XP_010517312.1|  PREDICTED: uncharacterized protein LOC104792784    376   7e-124   
gb|KHG23446.1|  [Protein-PII] uridylyltransferase                       375   3e-123   
ref|XP_003621863.1|  hypothetical protein MTR_7g024320                  375   5e-123   
gb|KDP44992.1|  hypothetical protein JCGZ_01492                         374   6e-123   
ref|XP_008647291.1|  PREDICTED: uncharacterized protein LOC100191...    367   8e-120   
gb|KHN30188.1|  hypothetical protein glysoja_010566                     362   7e-119   
ref|XP_008654649.1|  PREDICTED: uncharacterized protein LOC100274...    367   2e-118   
gb|ACG35222.1|  amino acid binding protein                              362   8e-118   Zea mays [maize]
ref|XP_008654652.1|  PREDICTED: uncharacterized protein LOC100274...    363   4e-117   
gb|KDO67682.1|  hypothetical protein CISIN_1g0447301mg                  357   5e-117   
ref|XP_010243241.1|  PREDICTED: uncharacterized protein LOC104587361    358   9e-117   
ref|XP_008654648.1|  PREDICTED: uncharacterized protein LOC100274...    362   2e-116   
ref|XP_006851299.1|  hypothetical protein AMTR_s00050p00129660          357   2e-116   
ref|XP_008654650.1|  PREDICTED: uncharacterized protein LOC100274...    358   2e-115   
ref|XP_006654914.1|  PREDICTED: uncharacterized protein LOC102712815    350   3e-114   
ref|XP_009400424.1|  PREDICTED: uncharacterized protein LOC103984616    349   4e-113   
ref|XP_008779018.1|  PREDICTED: uncharacterized protein LOC103698...    348   9e-113   
ref|XP_010267219.1|  PREDICTED: uncharacterized protein LOC104604537    348   1e-112   
ref|XP_010918604.1|  PREDICTED: uncharacterized protein LOC105042...    348   1e-112   
ref|XP_008787465.1|  PREDICTED: uncharacterized protein LOC103705509    346   2e-111   
ref|XP_009377043.1|  PREDICTED: uncharacterized protein LOC103965693    344   2e-111   
ref|XP_010940513.1|  PREDICTED: uncharacterized protein LOC105059061    345   2e-111   
ref|XP_010534493.1|  PREDICTED: uncharacterized protein LOC104810...    343   2e-111   
ref|XP_006436512.1|  hypothetical protein CICLE_v10031674mg             343   4e-111   
emb|CDX93251.1|  BnaC04g46450D                                          342   5e-111   
ref|XP_010935832.1|  PREDICTED: uncharacterized protein LOC105055633    343   7e-111   
ref|XP_007144373.1|  hypothetical protein PHAVU_007G150800g             342   2e-110   
ref|XP_003542564.1|  PREDICTED: uncharacterized protein LOC100816138    342   2e-110   
ref|XP_008650906.1|  PREDICTED: hypothetical protein isoform X2         340   2e-110   
ref|XP_008345381.1|  PREDICTED: uncharacterized protein LOC103408303    342   2e-110   
gb|EMT05218.1|  hypothetical protein F775_20811                         342   3e-110   
ref|XP_003535183.1|  PREDICTED: uncharacterized protein LOC100789...    341   3e-110   
ref|XP_008650905.1|  PREDICTED: hypothetical protein isoform X1         340   8e-110   
ref|XP_006428457.1|  hypothetical protein CICLE_v10011863mg             340   8e-110   
ref|XP_002266940.1|  PREDICTED: uncharacterized protein LOC100266711    340   1e-109   Vitis vinifera
gb|KHN18678.1|  hypothetical protein glysoja_021429                     340   1e-109   
ref|XP_008241389.1|  PREDICTED: uncharacterized protein LOC103339815    340   2e-109   
ref|XP_002311991.1|  hypothetical protein POPTR_0008s03320g             339   2e-109   Populus trichocarpa [western balsam poplar]
ref|XP_011031650.1|  PREDICTED: uncharacterized protein LOC105130709    339   2e-109   
ref|XP_008387533.1|  PREDICTED: uncharacterized protein LOC103449993    339   2e-109   
ref|XP_009385681.1|  PREDICTED: uncharacterized protein LOC103972...    338   6e-109   
ref|XP_002533376.1|  amino acid binding protein, putative               338   6e-109   Ricinus communis
ref|XP_008442722.1|  PREDICTED: uncharacterized protein LOC103486...    335   2e-108   
ref|XP_011094592.1|  PREDICTED: uncharacterized protein LOC105174256    336   3e-108   
ref|XP_008809905.1|  PREDICTED: uncharacterized protein LOC103721458    337   3e-108   
emb|CAN63142.1|  hypothetical protein VITISV_034576                     339   3e-108   Vitis vinifera
gb|KDP30487.1|  hypothetical protein JCGZ_16166                         336   3e-108   
ref|XP_004137843.1|  PREDICTED: uncharacterized protein LOC101221909    336   4e-108   
emb|CAN64495.1|  hypothetical protein VITISV_004035                     338   5e-108   Vitis vinifera
ref|XP_011040578.1|  PREDICTED: uncharacterized protein LOC105136...    335   5e-108   
ref|NP_001063990.1|  Os09g0570900                                       336   6e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007218084.1|  hypothetical protein PRUPE_ppa006415mg             335   6e-108   
ref|XP_002268949.1|  PREDICTED: uncharacterized protein LOC100265834    335   7e-108   Vitis vinifera
ref|XP_008442721.1|  PREDICTED: uncharacterized protein LOC103486...    335   7e-108   
ref|XP_011084278.1|  PREDICTED: uncharacterized protein LOC105166577    335   7e-108   
ref|XP_009762913.1|  PREDICTED: uncharacterized protein LOC104214888    335   8e-108   
ref|XP_003554396.1|  PREDICTED: uncharacterized protein LOC100818216    335   1e-107   
ref|XP_004956244.1|  PREDICTED: uncharacterized protein LOC101773426    335   1e-107   
ref|XP_002315327.1|  hypothetical protein POPTR_0010s23520g             334   2e-107   Populus trichocarpa [western balsam poplar]
gb|KDP29171.1|  hypothetical protein JCGZ_16560                         333   3e-107   
ref|XP_008446832.1|  PREDICTED: uncharacterized protein LOC103489...    333   5e-107   
gb|EYU38569.1|  hypothetical protein MIMGU_mgv1a007289mg                333   5e-107   
ref|XP_002298947.1|  hypothetical protein POPTR_0001s43320g             333   5e-107   Populus trichocarpa [western balsam poplar]
ref|XP_007162783.1|  hypothetical protein PHAVU_001G180200g             333   6e-107   
ref|XP_011024365.1|  PREDICTED: uncharacterized protein LOC105125549    333   7e-107   
ref|XP_008233260.1|  PREDICTED: uncharacterized protein LOC103332312    333   8e-107   
ref|XP_010050712.1|  PREDICTED: uncharacterized protein LOC104439...    331   3e-106   
ref|XP_011040576.1|  PREDICTED: uncharacterized protein LOC105136...    331   3e-106   
ref|XP_002519483.1|  amino acid binding protein, putative               331   3e-106   Ricinus communis
ref|XP_004142413.1|  PREDICTED: uncharacterized protein LOC101203151    331   4e-106   
ref|XP_011011060.1|  PREDICTED: uncharacterized protein LOC105115755    330   8e-106   
ref|XP_007027446.1|  ACT-like superfamily protein isoform 1             330   1e-105   
ref|XP_008343479.1|  PREDICTED: uncharacterized protein LOC103406256    330   1e-105   
ref|XP_004494076.1|  PREDICTED: uncharacterized protein LOC101505514    329   1e-105   
dbj|BAK02727.1|  predicted protein                                      330   1e-105   
ref|XP_003578696.1|  PREDICTED: uncharacterized protein LOC100833127    329   2e-105   
ref|XP_009368933.1|  PREDICTED: uncharacterized protein LOC103958404    328   3e-105   
ref|XP_004304473.1|  PREDICTED: uncharacterized protein LOC101301029    328   4e-105   
gb|KFK36561.1|  hypothetical protein AALP_AA4G139300                    328   4e-105   
ref|XP_006588800.1|  PREDICTED: uncharacterized protein LOC100789...    328   7e-105   
ref|NP_001150201.1|  LOC100283831                                       328   8e-105   Zea mays [maize]
ref|XP_004307345.1|  PREDICTED: uncharacterized protein LOC101307536    327   9e-105   
gb|EYU29887.1|  hypothetical protein MIMGU_mgv1a007224mg                327   9e-105   
ref|XP_008803450.1|  PREDICTED: uncharacterized protein LOC103717002    327   1e-104   
ref|XP_006661009.1|  PREDICTED: uncharacterized protein LOC102710812    327   2e-104   
ref|XP_009141611.1|  PREDICTED: uncharacterized protein LOC103865562    326   3e-104   
gb|KEH42165.1|  four ACT domain ACT domain protein which protein        326   3e-104   
emb|CDY66646.1|  BnaAnng22650D                                          326   3e-104   
gb|EMS64248.1|  hypothetical protein TRIUR3_00431                       326   7e-104   
ref|XP_009605627.1|  PREDICTED: uncharacterized protein LOC104100160    324   2e-103   
ref|XP_004515911.1|  PREDICTED: uncharacterized protein LOC101492421    323   4e-103   
ref|XP_009612956.1|  PREDICTED: uncharacterized protein LOC104106...    321   5e-103   
ref|XP_002881473.1|  hypothetical protein ARALYDRAFT_482665             323   6e-103   
emb|CDO99796.1|  unnamed protein product                                322   7e-103   
ref|XP_004246614.1|  PREDICTED: uncharacterized protein LOC101258588    322   7e-103   
ref|XP_002271915.1|  PREDICTED: uncharacterized protein LOC100259822    323   7e-103   Vitis vinifera
gb|AFW74931.1|  hypothetical protein ZEAMMB73_542989                    322   8e-103   
emb|CDY67381.1|  BnaAnng24140D                                          321   2e-102   
ref|XP_010908509.1|  PREDICTED: uncharacterized protein LOC105034890    322   2e-102   
ref|XP_006294313.1|  hypothetical protein CARUB_v10023321mg             321   2e-102   
ref|XP_010050706.1|  PREDICTED: uncharacterized protein LOC104439...    321   3e-102   
emb|CDP15279.1|  unnamed protein product                                320   4e-102   
ref|XP_010509430.1|  PREDICTED: uncharacterized protein LOC104785...    319   5e-102   
ref|XP_010067351.1|  PREDICTED: uncharacterized protein LOC104454251    320   6e-102   
ref|XP_006354381.1|  PREDICTED: uncharacterized protein LOC102581...    320   6e-102   
gb|AAM61017.1|  unknown                                                 320   9e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530480.1|  PREDICTED: uncharacterized protein LOC104807...    320   1e-101   
gb|KEH24036.1|  four ACT domain ACT domain protein which protein        317   2e-101   
ref|XP_010032142.1|  PREDICTED: uncharacterized protein LOC104421765    318   3e-101   
ref|NP_030235.1|  ACT domain-containing protein                         318   4e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505230.1|  PREDICTED: uncharacterized protein LOC104782...    318   5e-101   
ref|XP_010509428.1|  PREDICTED: uncharacterized protein LOC104785...    317   7e-101   
ref|XP_006377899.1|  ACT domain-containing family protein               316   2e-100   
ref|XP_006410856.1|  hypothetical protein EUTSA_v10016601mg             318   2e-100   
ref|XP_004487026.1|  PREDICTED: uncharacterized protein LOC101513...    314   3e-100   
ref|XP_010696293.1|  PREDICTED: uncharacterized protein LOC104908830    316   3e-100   
ref|XP_003625701.1|  hypothetical protein MTR_7g102330                  315   4e-100   
ref|XP_006846099.1|  hypothetical protein AMTR_s00012p00123010          313   8e-100   
ref|XP_010516911.1|  PREDICTED: uncharacterized protein LOC104792465    313   5e-99    
ref|XP_011077308.1|  PREDICTED: uncharacterized protein LOC105161352    310   6e-98    
gb|KHG23990.1|  [Protein-PII] uridylyltransferase                       309   1e-97    
ref|XP_007010015.1|  ACT-like superfamily protein isoform 1             308   2e-97    
gb|EYU32419.1|  hypothetical protein MIMGU_mgv1a007371mg                306   1e-96    
gb|ACR34913.1|  unknown                                                 303   4e-95    Zea mays [maize]
ref|XP_001756159.1|  predicted protein                                  302   7e-95    
ref|XP_010098797.1|  hypothetical protein L484_022562                   299   8e-94    
ref|XP_002968862.1|  hypothetical protein SELMODRAFT_270752             297   3e-93    
ref|XP_002974109.1|  hypothetical protein SELMODRAFT_173843             297   4e-93    
ref|XP_001780363.1|  predicted protein                                  296   2e-92    
ref|XP_007010016.1|  ACT-like superfamily protein isoform 2             296   3e-92    
gb|AFW74932.1|  hypothetical protein ZEAMMB73_542989                    304   2e-91    
gb|EMS57585.1|  hypothetical protein TRIUR3_30023                       291   3e-91    
ref|XP_008779027.1|  PREDICTED: uncharacterized protein LOC103698...    290   7e-91    
gb|AFW74933.1|  hypothetical protein ZEAMMB73_542989                    304   2e-90    
ref|XP_001780567.1|  predicted protein                                  291   2e-90    
emb|CAN66473.1|  hypothetical protein VITISV_029959                     291   3e-90    Vitis vinifera
gb|AFK39862.1|  unknown                                                 287   4e-90    
gb|KHG18482.1|  [Protein-PII] uridylyltransferase                       288   1e-89    
gb|EMT25780.1|  hypothetical protein F775_28922                         290   1e-89    
ref|XP_010918605.1|  PREDICTED: uncharacterized protein LOC105042...    286   2e-89    
ref|XP_006491661.1|  PREDICTED: uncharacterized protein LOC102628...    284   2e-88    
ref|XP_009385682.1|  PREDICTED: uncharacterized protein LOC103972...    279   2e-86    
gb|KCW89361.1|  hypothetical protein EUGRSUZ_A01656                     272   6e-84    
ref|XP_008784502.1|  PREDICTED: uncharacterized protein LOC103703438    268   7e-84    
ref|XP_006595016.1|  PREDICTED: uncharacterized protein LOC100785121    268   1e-83    
ref|XP_006354382.1|  PREDICTED: uncharacterized protein LOC102581...    271   2e-83    
gb|EEE70275.1|  hypothetical protein OsJ_30424                          271   3e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007202236.1|  hypothetical protein PRUPE_ppa008697mg             263   8e-81    
ref|XP_010505231.1|  PREDICTED: uncharacterized protein LOC104782...    261   2e-79    
ref|XP_010509429.1|  PREDICTED: uncharacterized protein LOC104785...    261   2e-79    
ref|XP_008654653.1|  PREDICTED: uncharacterized protein LOC100274...    257   7e-77    
ref|XP_008654654.1|  PREDICTED: uncharacterized protein LOC100274...    253   8e-76    
ref|XP_008343585.1|  PREDICTED: uncharacterized protein LOC103406373    244   4e-74    
gb|KDO44435.1|  hypothetical protein CISIN_1g015208mg                   246   5e-74    
ref|XP_001779702.1|  predicted protein                                  236   7e-70    
ref|XP_008650134.1|  PREDICTED: uncharacterized protein LOC103630869    231   5e-69    
tpg|DAA39590.1|  TPA: hypothetical protein ZEAMMB73_464424              224   2e-66    
ref|XP_007027447.1|  ACT-like superfamily protein isoform 2             224   7e-66    
ref|XP_008446833.1|  PREDICTED: uncharacterized protein LOC103489...    224   7e-66    
ref|XP_001754537.1|  predicted protein                                  226   9e-66    
ref|XP_010507633.1|  PREDICTED: uncharacterized protein LOC104784283    219   1e-64    
gb|KEH42164.1|  four ACT domain ACT domain protein which protein        219   2e-64    
emb|CAN66925.1|  hypothetical protein VITISV_011829                     220   4e-64    Vitis vinifera
ref|XP_010050718.1|  PREDICTED: uncharacterized protein LOC104439...    214   7e-62    
gb|EYU32420.1|  hypothetical protein MIMGU_mgv1a007371mg                204   1e-58    
gb|KDO44436.1|  hypothetical protein CISIN_1g015208mg                   196   6e-56    
ref|XP_010103523.1|  hypothetical protein L484_017031                   190   2e-53    
dbj|BAG90893.1|  unnamed protein product                                186   6e-52    
ref|NP_001130535.1|  uncharacterized protein LOC100191634               177   2e-49    
ref|XP_003063311.1|  predicted protein                                  177   9e-48    
ref|NP_001132108.1|  hypothetical protein                               172   2e-47    
gb|EPS69784.1|  hypothetical protein M569_04982                         173   4e-47    
ref|XP_010431025.1|  PREDICTED: uncharacterized protein LOC104715305    172   2e-46    
ref|XP_002506325.1|  predicted protein                                  174   2e-46    
ref|XP_006358412.1|  PREDICTED: uncharacterized protein LOC102595693    180   5e-46    
gb|KHG08517.1|  [Protein-PII] uridylyltransferase                       171   1e-45    
ref|XP_008649078.1|  PREDICTED: uncharacterized protein LOC103629...    166   1e-45    
ref|XP_008649077.1|  PREDICTED: uncharacterized protein LOC103629...    166   3e-45    
ref|XP_005846292.1|  hypothetical protein CHLNCDRAFT_135650             172   8e-45    
gb|ACF80808.1|  unknown                                                 162   4e-44    
ref|XP_010505641.1|  PREDICTED: uncharacterized protein LOC104782414    160   1e-43    
ref|XP_008653667.1|  PREDICTED: uncharacterized protein LOC103633753    159   7e-42    
ref|XP_010103524.1|  hypothetical protein L484_017032                   159   7e-42    
tpg|DAA59934.1|  TPA: hypothetical protein ZEAMMB73_352928              162   8e-42    
gb|AFW82845.1|  hypothetical protein ZEAMMB73_547714                    151   3e-39    
ref|XP_005646198.1|  hypothetical protein COCSUDRAFT_48206              154   4e-38    
ref|XP_001421782.1|  predicted protein                                  151   2e-37    
gb|ACR38328.1|  unknown                                                 137   1e-34    
gb|EEC85098.1|  hypothetical protein OsI_32471                          137   1e-32    
ref|XP_003083699.1|  ACT domain-containing protein (ISS)                132   1e-30    
ref|XP_010431024.1|  PREDICTED: uncharacterized protein LOC104715304    114   5e-27    
ref|NP_001142350.1|  uncharacterized protein LOC100274521               114   4e-26    
gb|KGN43143.1|  hypothetical protein Csa_7G000010                       110   1e-25    
emb|CEG00436.1|  unnamed product                                        108   3e-22    
ref|XP_007508673.1|  predicted protein                                  108   5e-22    
gb|KDD75230.1|  hypothetical protein H632_c796p2                      85.5    3e-16    
ref|XP_002875569.1|  hypothetical protein ARALYDRAFT_905350           83.2    5e-16    
gb|KDD71966.1|  hypothetical protein H632_c4084p0                     84.0    9e-15    
ref|WP_022733608.1|  PII uridylyl-transferase                         73.6    1e-10    
gb|EEC78399.1|  hypothetical protein OsI_18187                        69.3    1e-10    
ref|WP_033070336.1|  protein-PII uridylyltransferase                  73.2    1e-10    
ref|WP_037988980.1|  protein-PII uridylyltransferase                  65.5    4e-08    
ref|WP_007088540.1|  PII uridylyl-transferase                         65.5    5e-08    
ref|WP_008888732.1|  PII uridylyl-transferase                         65.1    6e-08    
ref|XP_007158417.1|  hypothetical protein PHAVU_002G151300g           63.9    9e-08    
gb|KDO67681.1|  hypothetical protein CISIN_1g0447302mg                58.9    1e-07    
ref|XP_006307537.1|  hypothetical protein CARUB_v10009162mg           60.8    9e-07    
ref|XP_002870757.1|  hypothetical protein ARALYDRAFT_916315           57.4    1e-06    
gb|KHN34976.1|  [Protein-PII] uridylyltransferase                     59.3    2e-06    
ref|XP_003538563.1|  PREDICTED: uncharacterized protein LOC100806283  59.3    3e-06    
ref|XP_009416935.1|  PREDICTED: uncharacterized protein LOC103997445  59.3    3e-06    
ref|WP_012332055.1|  PII uridylyl-transferase                         59.3    4e-06    
ref|XP_003608787.1|  hypothetical protein MTR_4g101950                57.8    7e-06    
ref|WP_013513604.1|  protein-P-II uridylyltransferase                 57.4    2e-05    
emb|CDY30079.1|  BnaC05g09410D                                        56.6    2e-05    
ref|WP_019403846.1|  hypothetical protein                             57.0    2e-05    
gb|KFK43503.1|  hypothetical protein AALP_AA1G133800                  56.2    2e-05    
ref|WP_015927851.1|  PII uridylyl-transferase                         57.0    2e-05    
ref|XP_003549893.2|  PREDICTED: uncharacterized protein LOC100794729  56.2    3e-05    
gb|KHN09770.1|  [Protein-PII] uridylyltransferase                     55.8    3e-05    
ref|WP_034416448.1|  hypothetical protein                             55.1    4e-05    
ref|XP_003611221.1|  hypothetical protein MTR_5g011580                55.8    4e-05    
ref|XP_008437163.1|  PREDICTED: uncharacterized protein LOC103482670  54.7    8e-05    
ref|XP_004147566.1|  PREDICTED: uncharacterized protein LOC101209959  54.7    8e-05    
ref|XP_006363718.1|  PREDICTED: uncharacterized protein LOC102603691  54.3    1e-04    
ref|WP_012320481.1|  PII uridylyl-transferase                         54.7    1e-04    
ref|WP_020092537.1|  PII uridylyl-transferase                         54.7    1e-04    
gb|AIQ91819.1|  protein-P-II uridylyltransferase                      54.7    1e-04    
ref|WP_037021242.1|  protein-PII uridylyltransferase                  54.3    1e-04    
ref|XP_010511930.1|  PREDICTED: uncharacterized protein LOC104787960  53.9    1e-04    
ref|WP_024829253.1|  protein-PII uridylyltransferase                  54.3    1e-04    
ref|WP_029360502.1|  protein-PII uridylyltransferase                  54.3    1e-04    
ref|WP_036289290.1|  protein-PII uridylyltransferase                  54.3    1e-04    
ref|WP_010684634.1|  PII uridylyl-transferase                         54.3    2e-04    
ref|XP_004245697.1|  PREDICTED: uncharacterized protein LOC101260460  53.5    2e-04    
ref|XP_010470880.1|  PREDICTED: uncharacterized protein LOC104750738  53.5    2e-04    
ref|XP_009767148.1|  PREDICTED: uncharacterized protein LOC104218369  53.5    2e-04    
ref|XP_009588356.1|  PREDICTED: uncharacterized protein LOC104085940  53.5    2e-04    
ref|XP_003525780.1|  PREDICTED: uncharacterized protein LOC100802262  53.1    2e-04    
ref|WP_034991991.1|  protein-PII uridylyltransferase                  53.5    3e-04    
ref|XP_010415531.1|  PREDICTED: uncharacterized protein LOC104701533  52.8    3e-04    
emb|CDX88335.1|  BnaC06g37790D                                        52.8    3e-04    
gb|AFW82843.1|  hypothetical protein ZEAMMB73_547714                  51.6    3e-04    
ref|WP_018045805.1|  PII uridylyl-transferase                         53.1    4e-04    
ref|WP_016917888.1|  PII uridylyl-transferase                         52.8    4e-04    
ref|XP_002304443.1|  ACT domain-containing family protein             52.4    4e-04    
ref|XP_011033868.1|  PREDICTED: uncharacterized protein LOC105132218  52.4    4e-04    
ref|XP_009106363.1|  PREDICTED: uncharacterized protein LOC103832156  52.4    4e-04    
ref|XP_009106365.1|  PREDICTED: uncharacterized protein LOC103832...  52.0    5e-04    
ref|WP_027171505.1|  protein-PII uridylyltransferase                  52.4    5e-04    
ref|WP_019906390.1|  PII uridylyl-transferase                         52.4    6e-04    
ref|XP_010648677.1|  PREDICTED: uncharacterized protein LOC100852...  52.0    6e-04    
ref|XP_010676642.1|  PREDICTED: uncharacterized protein LOC104892413  52.0    6e-04    
ref|WP_029029740.1|  protein-PII uridylyltransferase                  52.4    6e-04    
emb|CBI21063.3|  unnamed protein product                              52.0    7e-04    
emb|CDX87550.1|  BnaA07g33230D                                        51.6    7e-04    
gb|AAF27052.1|AC008262_1  F4N2.2                                      51.6    7e-04    
ref|XP_003631797.2|  PREDICTED: uncharacterized protein LOC100852...  51.6    8e-04    
ref|WP_007558686.1|  PII uridylyl-transferase                         52.0    8e-04    
ref|NP_974107.1|  ACT domain-containing protein                       51.6    8e-04    
ref|WP_017482748.1|  PII uridylyl-transferase                         52.0    8e-04    
ref|WP_012452351.1|  PII uridylyl-transferase                         52.0    8e-04    
ref|NP_177067.1|  ACT domain-containing protein                       51.2    0.001    



>ref|XP_009600257.1| PREDICTED: uncharacterized protein LOC104095767 isoform X1 [Nicotiana 
tomentosiformis]
Length=419

 Score =   498 bits (1281),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 247/370 (67%), Positives = 290/370 (78%), Gaps = 5/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+VVIQ G K G+PY+ITVNC DK GLGC+IC  ILDFGL I KGDVSTDG WCYV++W
Sbjct  6     DDAVVIQKGKKAGEPYVITVNCPDKTGLGCDICYTILDFGLYIIKGDVSTDGIWCYVILW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             V P +S+P+V WA LK+RL SVCP  S   YL  P  PA SS  YL+T     R GLLHD
Sbjct  66    VVPHASSPMVRWANLKERLLSVCPSCSVSFYLTQPSPPAASSPVYLLTFCSHDRRGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VTQ LCE EL I+RVKV TTPD RVLD+F I D+LELL+ KE+Q+E  +QL AVLG+S  
Sbjct  126   VTQVLCELELTIQRVKVTTTPDGRVLDLFFITDNLELLHTKERQDETYKQLHAVLGQS-F  184

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   G  ++NL C S+LSPSV  ELFRCELS+NE   Q LSPD+M LK+  VTID
Sbjct  185   SCELQLA--GSQFDNLQCVSSLSPSVAEELFRCELSDNEFRTQALSPDMMNLKRGSVTID  242

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N++S AHTL+QI CVD+K FLYDI R LK CN+QI Y RFSA NKGQRELD+F++ K+G+
Sbjct  243   NSMSPAHTLLQIDCVDHKGFLYDIMRTLKDCNIQIAYGRFSAVNKGQRELDLFIRQKDGK  302

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+DP+KQ  LC  LK E+LHPLRV+I+NRGPDTELLVANP+ELSG GRPRVFYDVT A+
Sbjct  303   KIVDPDKQDVLCSRLKAEMLHPLRVIITNRGPDTELLVANPVELSGKGRPRVFYDVTLAM  362

Query  90    KTLGICIFSV  61
             KTLGICIFS 
Sbjct  363   KTLGICIFSA  372



>ref|XP_009794489.1| PREDICTED: uncharacterized protein LOC104241258 isoform X1 [Nicotiana 
sylvestris]
Length=420

 Score =   493 bits (1269),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 246/371 (66%), Positives = 293/371 (79%), Gaps = 6/371 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDP-YMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVM  988
             DD+VVIQ G KPG+P Y+ITVNC DK GLGC+IC  ILDFGL I KGDVSTDG WCYV++
Sbjct  6     DDAVVIQKGKKPGEPEYVITVNCPDKTGLGCDICNTILDFGLYIIKGDVSTDGIWCYVIL  65

Query  987   WVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLH  814
             WV P +S+P+V WA LK+RL SVCP  S   YL     PATSS  YL+T     R GLLH
Sbjct  66    WVVPHASSPMVRWANLKERLLSVCPSCSVSFYLNQTSPPATSSPAYLLTFCSRDRRGLLH  125

Query  813   DVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESC  634
             DVTQ LCE EL I+RVKV TTPD RVLD+F I D+LELL+ KE+Q+E+ +QL AVLG+S 
Sbjct  126   DVTQVLCELELTIQRVKVTTTPDGRVLDLFFITDNLELLHTKERQDEMYKQLHAVLGQS-  184

Query  633   ISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTI  454
              SCEL+L   GP Y+N+ C S+LSPSV  ELFRCELS+NE H Q LSPD++ LK++ VTI
Sbjct  185   FSCELQLA--GPQYDNVQCVSSLSPSVAEELFRCELSDNEFHTQALSPDMINLKRASVTI  242

Query  453   DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNG  274
             DN++S AHTL+QI CVD+K FLYDI R LK CN+ I Y RFS  NKGQRELD+F++ K+G
Sbjct  243   DNSMSPAHTLLQIGCVDHKGFLYDIMRTLKDCNILIAYGRFSPVNKGQRELDLFIRQKDG  302

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
             +KI+DP+KQ  LC  LK+E+LHPLRV+I+NRGPDTELLVANP+ELSG GRP VFYDVT A
Sbjct  303   KKIVDPDKQDVLCSRLKLEMLHPLRVIITNRGPDTELLVANPVELSGKGRPSVFYDVTLA  362

Query  93    LKTLGICIFSV  61
             +KTLGICIFS 
Sbjct  363   MKTLGICIFSA  373



>ref|XP_009622278.1| PREDICTED: uncharacterized protein LOC104113722 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009622279.1| PREDICTED: uncharacterized protein LOC104113722 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009622280.1| PREDICTED: uncharacterized protein LOC104113722 isoform X1 [Nicotiana 
tomentosiformis]
Length=416

 Score =   486 bits (1250),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 243/370 (66%), Positives = 288/370 (78%), Gaps = 5/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+VVIQ G KPG+PY+ITVNC DK G GC+I   ILDFGL I KGDVSTDG WCYV++W
Sbjct  6     DDAVVIQKGKKPGEPYVITVNCPDKTGRGCDISYTILDFGLYIIKGDVSTDGIWCYVILW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             V   +S+P+V WA LK+RL SVCP  S   YL  P  PA SS  YL+T   + R GLLHD
Sbjct  66    VVLHASSPMVRWANLKERLLSVCPSCSVSFYLNQPSPPAASSPVYLLTFCSLDRRGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VTQ LCE EL I+RVKV TTPD RVLD+F I D+LELL+ KE+Q+E  +QL AVLG+S  
Sbjct  126   VTQVLCELELTIQRVKVTTTPDGRVLDLFFITDNLELLHTKERQDETYKQLHAVLGQS-F  184

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   GP Y+NL C S+LSPSV  ELFRCELS+NE   Q LSP +M LK++ VTID
Sbjct  185   SCELQLA--GPQYDNLQCVSSLSPSVAEELFRCELSDNEFCTQALSPVMMNLKRASVTID  242

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N++S AHTL+QI CVD+K FLYDI R LK CN+QI Y RF   NKGQ+ELD+F++ K+G+
Sbjct  243   NSMSPAHTLLQIGCVDHKGFLYDIMRTLKDCNIQIAYGRFPPVNKGQKELDLFIRQKDGK  302

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+DP+KQ   C  LKVE+LHPLRV+I+NRGPDTELLVANP+ELSG GRPRVFYDVT A+
Sbjct  303   KIVDPDKQDVFCSRLKVEMLHPLRVIITNRGPDTELLVANPVELSGKGRPRVFYDVTLAM  362

Query  90    KTLGICIFSV  61
             KTLGICIFS 
Sbjct  363   KTLGICIFSA  372



>ref|XP_009600258.1| PREDICTED: uncharacterized protein LOC104095767 isoform X2 [Nicotiana 
tomentosiformis]
Length=415

 Score =   485 bits (1249),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 243/370 (66%), Positives = 286/370 (77%), Gaps = 9/370 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+VVIQ G K G+PY+ITVNC DK GLGC+IC  ILDFGL I KGD    G WCYV++W
Sbjct  6     DDAVVIQKGKKAGEPYVITVNCPDKTGLGCDICYTILDFGLYIIKGD----GIWCYVILW  61

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             V P +S+P+V WA LK+RL SVCP  S   YL  P  PA SS  YL+T     R GLLHD
Sbjct  62    VVPHASSPMVRWANLKERLLSVCPSCSVSFYLTQPSPPAASSPVYLLTFCSHDRRGLLHD  121

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VTQ LCE EL I+RVKV TTPD RVLD+F I D+LELL+ KE+Q+E  +QL AVLG+S  
Sbjct  122   VTQVLCELELTIQRVKVTTTPDGRVLDLFFITDNLELLHTKERQDETYKQLHAVLGQS-F  180

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   G  ++NL C S+LSPSV  ELFRCELS+NE   Q LSPD+M LK+  VTID
Sbjct  181   SCELQLA--GSQFDNLQCVSSLSPSVAEELFRCELSDNEFRTQALSPDMMNLKRGSVTID  238

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N++S AHTL+QI CVD+K FLYDI R LK CN+QI Y RFSA NKGQRELD+F++ K+G+
Sbjct  239   NSMSPAHTLLQIDCVDHKGFLYDIMRTLKDCNIQIAYGRFSAVNKGQRELDLFIRQKDGK  298

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+DP+KQ  LC  LK E+LHPLRV+I+NRGPDTELLVANP+ELSG GRPRVFYDVT A+
Sbjct  299   KIVDPDKQDVLCSRLKAEMLHPLRVIITNRGPDTELLVANPVELSGKGRPRVFYDVTLAM  358

Query  90    KTLGICIFSV  61
             KTLGICIFS 
Sbjct  359   KTLGICIFSA  368



>ref|XP_009794490.1| PREDICTED: uncharacterized protein LOC104241258 isoform X2 [Nicotiana 
sylvestris]
Length=416

 Score =   480 bits (1235),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 242/371 (65%), Positives = 289/371 (78%), Gaps = 10/371 (3%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDP-YMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVM  988
             DD+VVIQ G KPG+P Y+ITVNC DK GLGC+IC  ILDFGL I KGD    G WCYV++
Sbjct  6     DDAVVIQKGKKPGEPEYVITVNCPDKTGLGCDICNTILDFGLYIIKGD----GIWCYVIL  61

Query  987   WVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLH  814
             WV P +S+P+V WA LK+RL SVCP  S   YL     PATSS  YL+T     R GLLH
Sbjct  62    WVVPHASSPMVRWANLKERLLSVCPSCSVSFYLNQTSPPATSSPAYLLTFCSRDRRGLLH  121

Query  813   DVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESC  634
             DVTQ LCE EL I+RVKV TTPD RVLD+F I D+LELL+ KE+Q+E+ +QL AVLG+S 
Sbjct  122   DVTQVLCELELTIQRVKVTTTPDGRVLDLFFITDNLELLHTKERQDEMYKQLHAVLGQS-  180

Query  633   ISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTI  454
              SCEL+L   GP Y+N+ C S+LSPSV  ELFRCELS+NE H Q LSPD++ LK++ VTI
Sbjct  181   FSCELQLA--GPQYDNVQCVSSLSPSVAEELFRCELSDNEFHTQALSPDMINLKRASVTI  238

Query  453   DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNG  274
             DN++S AHTL+QI CVD+K FLYDI R LK CN+ I Y RFS  NKGQRELD+F++ K+G
Sbjct  239   DNSMSPAHTLLQIGCVDHKGFLYDIMRTLKDCNILIAYGRFSPVNKGQRELDLFIRQKDG  298

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
             +KI+DP+KQ  LC  LK+E+LHPLRV+I+NRGPDTELLVANP+ELSG GRP VFYDVT A
Sbjct  299   KKIVDPDKQDVLCSRLKLEMLHPLRVIITNRGPDTELLVANPVELSGKGRPSVFYDVTLA  358

Query  93    LKTLGICIFSV  61
             +KTLGICIFS 
Sbjct  359   MKTLGICIFSA  369



>emb|CDP09019.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   479 bits (1232),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 238/368 (65%), Positives = 281/368 (76%), Gaps = 4/368 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+VVI  G  PGDPY+ITVNC DK GLGC+ICR ILDFGL I KGD++TDGRWCY+V+W
Sbjct  6     DDAVVIHKGKVPGDPYVITVNCPDKTGLGCDICRTILDFGLCICKGDITTDGRWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             V P + +P V W  LK+RL SVCP  S   YL  P +  T S  YL+    + R GLLHD
Sbjct  66    VIPHARSPAVRWPNLKERLLSVCPSCSVSFYLNQPSSIGTPSPVYLLKYCGLDRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VTQ LC  EL I+RVKV TTPD R+LD+F I D+LELL+ KE+Q+E C QL+AVLGESC 
Sbjct  126   VTQVLCYLELTIQRVKVTTTPDGRILDLFFITDNLELLHKKERQDETCAQLQAVLGESCF  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   G  Y+NL   S+LSP+V  ELFR  LS+ E   Q LS DV KLKKS V +D
Sbjct  186   SCELQLAGSG--YDNLQSMSSLSPAVAEELFRYVLSDKEIRAQALSSDVTKLKKSSVIVD  243

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS AHTL+QI+CVD+K FLYDI R LK   +QI++ RFS  N G RELD+F++ K+G+
Sbjct  244   NSLSPAHTLLQINCVDHKGFLYDILRTLKDYGIQISFGRFSLVNNGHRELDLFIRQKDGK  303

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KILDPEKQ SLC  LKVE+LHPLRV+I+NRGPDTELLVANP+ELSG GRPRVFYDVT AL
Sbjct  304   KILDPEKQESLCSRLKVEMLHPLRVIITNRGPDTELLVANPVELSGKGRPRVFYDVTHAL  363

Query  90    KTLGICIF  67
             KTLGICIF
Sbjct  364   KTLGICIF  371



>ref|XP_011000281.1| PREDICTED: uncharacterized protein LOC105107896 [Populus euphratica]
Length=417

 Score =   478 bits (1230),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 229/370 (62%), Positives = 283/370 (76%), Gaps = 3/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+I+ G K GDP++ITVNC DK GL C+I  +ILD+GL I KGDVSTDGRWCY+V W
Sbjct  6     DDTVLIEKGKKAGDPHVITVNCPDKTGLACDIFHVILDYGLYITKGDVSTDGRWCYMVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHDVT  805
             V P S + I+ W  LK+RL SVCPP S        ++ +   YL+  + + R GLLHDVT
Sbjct  66    VVPHSRS-IIRWTHLKNRLLSVCPPCSVSFDWNQQQSKSCPVYLLKFFSLDRKGLLHDVT  124

Query  804   QFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCISC  625
             Q LCE EL I+RVKV TTPD RVLD+F + D LELL+ K++Q+E CEQL AVLGESCISC
Sbjct  125   QVLCELELTIQRVKVTTTPDGRVLDLFFVTDKLELLHTKQRQDETCEQLHAVLGESCISC  184

Query  624   ELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDNA  445
             EL+L   GP YE L   S+LSP + +ELF CE+S+ E H Q LS D+MKLK++ V IDN+
Sbjct  185   ELRLA--GPEYECLQGMSSLSPVIADELFHCEISDKEIHSQALSLDMMKLKRTDVVIDNS  242

Query  444   LSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEKI  265
             LS AHTL+Q+ CVD+K  LYD+ R LK CN+QI Y RFS    G R+LD+F+Q K+G+KI
Sbjct  243   LSPAHTLLQVRCVDHKGLLYDVMRTLKDCNIQIAYGRFSLVTNGHRDLDLFIQQKDGKKI  302

Query  264   LDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALKT  85
             +DPEKQ++LC+ LKVE+LHPLRV+I+NRGPDTELLVANP+ELSG GRPRVFYD+T ALK 
Sbjct  303   VDPEKQSALCFRLKVEMLHPLRVIIANRGPDTELLVANPVELSGKGRPRVFYDITLALKA  362

Query  84    LGICIFSVRK  55
             LGICIFS  K
Sbjct  363   LGICIFSAEK  372



>ref|XP_010092779.1| hypothetical protein L484_001846 [Morus notabilis]
 gb|EXB52244.1| hypothetical protein L484_001846 [Morus notabilis]
Length=420

 Score =   478 bits (1230),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 231/370 (62%), Positives = 286/370 (77%), Gaps = 4/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ G  PG+P ++TVNC DK GLGC+ICRIILDF + I KGD+STDG WCY+V+W
Sbjct  6     DDVVLIQKGKAPGEPSVVTVNCPDKTGLGCDICRIILDFEIYITKGDISTDGIWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             V P SS+ IV W+ LK+RL SVCP  S    L    T ++SS  YL+  + + R GLLHD
Sbjct  66    VVPHSSSVIVKWSSLKNRLLSVCPSCSTCFLLYEQSTISSSSPVYLLKFFSLDRRGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VTQ LCE EL I+RVKV TTPD RVLD+F I D+ ELL+ +E+Q E  EQL  VLG+SCI
Sbjct  126   VTQVLCELELTIQRVKVTTTPDGRVLDLFFITDNRELLHTEERQNETLEQLHTVLGDSCI  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             +CELKL   GP YE+    ++LSP+V  ELFRCELS+ E H Q LSPD+ KLKK+ VT+D
Sbjct  186   TCELKLA--GPEYEHHQGINSLSPAVAEELFRCELSDKEIHSQALSPDMTKLKKANVTVD  243

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS AHTL+Q+ C D+K  LYD+ R LK CN+QI+Y RFS ++KG R+LD+F+Q K+G+
Sbjct  244   NSLSPAHTLLQVHCADHKGLLYDVMRTLKDCNIQISYGRFSLSSKGFRDLDLFIQQKDGK  303

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+D EKQ++LC  LKVE+LHPLRV+I+NRGPD ELLVANP+ELSG GRPRVFYDVT AL
Sbjct  304   KIVDLEKQSALCSHLKVEMLHPLRVIIANRGPDAELLVANPVELSGKGRPRVFYDVTLAL  363

Query  90    KTLGICIFSV  61
             KTLGIC+FS 
Sbjct  364   KTLGICVFSA  373



>ref|XP_002298369.1| ACT domain-containing family protein [Populus trichocarpa]
 gb|EEE83174.1| ACT domain-containing family protein [Populus trichocarpa]
Length=417

 Score =   478 bits (1229),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 227/368 (62%), Positives = 283/368 (77%), Gaps = 3/368 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+I+ G K GDP++ITVNC DK GL C+I  +ILD+GL I KGDVSTDG+WCY+V+W
Sbjct  6     DDAVLIEKGKKAGDPHVITVNCPDKTGLACDIFHVILDYGLYITKGDVSTDGKWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHDVT  805
             V P S + I+ W  LK+RL SVCP  S   Y    ++ +   YL+  + + R GLLHDV 
Sbjct  66    VVPHSRS-IIRWTHLKNRLLSVCPSCSVSFYWNQQQSKSCPVYLLKFFSLDRKGLLHDVN  124

Query  804   QFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCISC  625
             Q LCE EL I+RVKV TTPD RVLD+F + D LELL+ K++Q+E CEQL AVLGESCISC
Sbjct  125   QVLCELELTIQRVKVTTTPDGRVLDLFFVTDKLELLHTKQRQDETCEQLHAVLGESCISC  184

Query  624   ELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDNA  445
             EL+L   GP YE L   S+LSP + +ELF CE+S+ E H + LSPD+MKLK++ V IDN+
Sbjct  185   ELRLA--GPEYECLQGMSSLSPVIADELFHCEISDKEIHSRALSPDMMKLKRTDVMIDNS  242

Query  444   LSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEKI  265
             LS AHTL+Q+ CVD+K  LYD+ R LK CN+QI Y RFS    G R+LD+F+Q K+G+KI
Sbjct  243   LSPAHTLLQVHCVDHKGLLYDVMRTLKDCNIQIAYGRFSLVTNGHRDLDLFIQQKDGKKI  302

Query  264   LDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALKT  85
             +DPEKQ++LC+ LKVE+LHPLRVVI+NRGPDTELLVANP+ELSG GRPRVFYD+T ALK 
Sbjct  303   VDPEKQSALCFRLKVEMLHPLRVVIANRGPDTELLVANPVELSGKGRPRVFYDITHALKA  362

Query  84    LGICIFSV  61
             LGICIFS 
Sbjct  363   LGICIFSA  370



>ref|XP_002284171.1| PREDICTED: uncharacterized protein LOC100262189 isoform X2 [Vitis 
vinifera]
 ref|XP_010651049.1| PREDICTED: uncharacterized protein LOC100262189 isoform X1 [Vitis 
vinifera]
 emb|CBI16169.3| unnamed protein product [Vitis vinifera]
Length=420

 Score =   475 bits (1222),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 233/372 (63%), Positives = 285/372 (77%), Gaps = 4/372 (1%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+IQ G K G+P +ITVNC DK GLGC+ICR IL+FGL I KGD+STDG WCY+V
Sbjct  4     LNDDVVLIQKGTKLGEPCVITVNCPDKTGLGCDICRTILNFGLYITKGDISTDGIWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPP--YSNLIYLPSPKTPATSSYLMTLYCIGRTGLL  817
             +WV P SS+ I+ W+ LKDRL S+CPP   S      S  T  +  YL+  +C+ R GLL
Sbjct  64    LWVIPHSSSHIIRWSNLKDRLISICPPCSVSYCFNQQSDCTAPSPVYLLKFFCLDRKGLL  123

Query  816   HDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGES  637
             HDVTQ L E EL I+RVKV TTPD RVLD+F I D++ELL+ K++Q++  EQL AVLGES
Sbjct  124   HDVTQVLSELELTIQRVKVTTTPDGRVLDLFFITDNMELLHTKKRQDDTLEQLYAVLGES  183

Query  636   CISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVT  457
             CISCEL+L   GP YEN  C S+LSP +  ELFRCELS+ E+H Q LSPD+  LKK+ V 
Sbjct  184   CISCELQLA--GPEYENHQCVSSLSPGIAEELFRCELSDKESHSQALSPDMTILKKASVI  241

Query  456   IDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKN  277
             +DN+LS AHTL+QI CVD+K  +YDI R LK CN++I+Y R S   KG R+LD+F+Q K+
Sbjct  242   VDNSLSPAHTLLQIYCVDHKGLVYDILRTLKDCNIKISYGRLSQNTKGYRDLDLFIQQKD  301

Query  276   GEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTF  97
             G+KI+DPEKQ++LC  LKVE+LHPLRVVISNRGPDTELLVANP+ELSG GRPRVF+D T 
Sbjct  302   GKKIVDPEKQSALCSRLKVEMLHPLRVVISNRGPDTELLVANPVELSGKGRPRVFFDATL  361

Query  96    ALKTLGICIFSV  61
             ALK LGICIFS 
Sbjct  362   ALKMLGICIFSA  373



>ref|XP_007205255.1| hypothetical protein PRUPE_ppa006272mg [Prunus persica]
 gb|EMJ06454.1| hypothetical protein PRUPE_ppa006272mg [Prunus persica]
Length=420

 Score =   473 bits (1218),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 234/372 (63%), Positives = 287/372 (77%), Gaps = 4/372 (1%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD VVIQ GN+PG+P +ITVNC DK GLGC+ICRIILDFGL I+K D STDG WCY+V
Sbjct  4     LSDDVVVIQKGNRPGEPCVITVNCPDKTGLGCDICRIILDFGLYIEKADFSTDGIWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLL  817
             +WVFP SS+PIV  + LK++L SVCP  +   Y     T  +SS  YL+T  C+ R GLL
Sbjct  64    LWVFPHSSSPIVRLSNLKNQLQSVCPSCTMSYYFFQQTTRPSSSAVYLLTFVCLDRKGLL  123

Query  816   HDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGES  637
             HDVTQ L E EL I+ VKV TTPDDRVLD+F I D+++LL+ KE+Q+E  +QL  VLGES
Sbjct  124   HDVTQILSELELSIQSVKVTTTPDDRVLDLFFITDNMDLLHTKERQDETLKQLHDVLGES  183

Query  636   CISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVT  457
             CISCEL+L    P+YE+     +LSP V  ELF CEL + ET  Q LSPD+ KLK+S VT
Sbjct  184   CISCELQLA--DPVYESHRGIPSLSPVVAEELFTCELLDKETLSQALSPDMTKLKESNVT  241

Query  456   IDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKN  277
             +DN+LS AHTL+QI C D+K  LYDI R LK CN++I+Y RFS   KG R+LD+F+Q K+
Sbjct  242   MDNSLSPAHTLLQIHCADHKGLLYDIMRTLKDCNIKISYGRFSPNVKGYRDLDLFIQQKD  301

Query  276   GEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTF  97
             G+K +DP+KQ++LC CLKVE+LHPLRV+I++RGPDTELLVANP+ELSG GRPRVFYDVT 
Sbjct  302   GKKFVDPDKQSALCLCLKVEMLHPLRVIIADRGPDTELLVANPVELSGKGRPRVFYDVTL  361

Query  96    ALKTLGICIFSV  61
             ALKTLGICIFS 
Sbjct  362   ALKTLGICIFSA  373



>ref|XP_009353711.1| PREDICTED: uncharacterized protein LOC103944951 isoform X1 [Pyrus 
x bretschneideri]
Length=443

 Score =   474 bits (1219),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 237/374 (63%), Positives = 290/374 (78%), Gaps = 4/374 (1%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD VVIQ G +PG+P +ITVNC DK GLGC+ICRIILDFGL I+K D STDG WCYVV
Sbjct  4     LSDDVVVIQKGKRPGEPCIITVNCPDKTGLGCDICRIILDFGLLIEKADFSTDGIWCYVV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLL  817
             +WVFP SS+P V  + LK++L SVCP  S   YL    T ++SS  YL+T  C+ R GLL
Sbjct  64    LWVFPDSSSPAVKLSNLKNQLQSVCPSCSVPFYLYQQPTRSSSSPVYLLTFLCLDRKGLL  123

Query  816   HDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGES  637
             HDVT+ L E EL I+RVKV TTPDDRVLD+F I D+++LL+ KE+Q+E  +QLR VLGES
Sbjct  124   HDVTKTLSELELSIQRVKVTTTPDDRVLDLFFITDNMDLLHTKERQDETIKQLRDVLGES  183

Query  636   CISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVT  457
             CISCEL+LV  GP YE+     +LSP+V  ELFRCEL + ET  Q LSPD+ KLKK+ VT
Sbjct  184   CISCELQLV--GPEYESHHGIPSLSPAVAEELFRCELLDKETRSQALSPDMTKLKKTNVT  241

Query  456   IDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKN  277
             +DN+LS AHTL+QI C D+K  LYDI R LK  N++I Y R S   KG R+LD+F+Q  +
Sbjct  242   MDNSLSPAHTLLQIHCADHKGLLYDILRTLKDSNIKIAYGRISPNIKGYRDLDLFIQQND  301

Query  276   GEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTF  97
             G+K++DP+KQ++L   LKVE+LHPLRV+I+NRGPDTELLVANP+ELSG GRPRVFYDVT 
Sbjct  302   GKKLVDPDKQSALYLRLKVEMLHPLRVIIANRGPDTELLVANPVELSGKGRPRVFYDVTI  361

Query  96    ALKTLGICIFSVRK  55
             ALKTLGICIFSVR+
Sbjct  362   ALKTLGICIFSVRR  375



>ref|XP_009622281.1| PREDICTED: uncharacterized protein LOC104113722 isoform X2 [Nicotiana 
tomentosiformis]
Length=412

 Score =   473 bits (1216),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 239/370 (65%), Positives = 284/370 (77%), Gaps = 9/370 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+VVIQ G KPG+PY+ITVNC DK G GC+I   ILDFGL I KGD    G WCYV++W
Sbjct  6     DDAVVIQKGKKPGEPYVITVNCPDKTGRGCDISYTILDFGLYIIKGD----GIWCYVILW  61

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             V   +S+P+V WA LK+RL SVCP  S   YL  P  PA SS  YL+T   + R GLLHD
Sbjct  62    VVLHASSPMVRWANLKERLLSVCPSCSVSFYLNQPSPPAASSPVYLLTFCSLDRRGLLHD  121

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VTQ LCE EL I+RVKV TTPD RVLD+F I D+LELL+ KE+Q+E  +QL AVLG+S  
Sbjct  122   VTQVLCELELTIQRVKVTTTPDGRVLDLFFITDNLELLHTKERQDETYKQLHAVLGQS-F  180

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   GP Y+NL C S+LSPSV  ELFRCELS+NE   Q LSP +M LK++ VTID
Sbjct  181   SCELQLA--GPQYDNLQCVSSLSPSVAEELFRCELSDNEFCTQALSPVMMNLKRASVTID  238

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N++S AHTL+QI CVD+K FLYDI R LK CN+QI Y RF   NKGQ+ELD+F++ K+G+
Sbjct  239   NSMSPAHTLLQIGCVDHKGFLYDIMRTLKDCNIQIAYGRFPPVNKGQKELDLFIRQKDGK  298

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+DP+KQ   C  LKVE+LHPLRV+I+NRGPDTELLVANP+ELSG GRPRVFYDVT A+
Sbjct  299   KIVDPDKQDVFCSRLKVEMLHPLRVIITNRGPDTELLVANPVELSGKGRPRVFYDVTLAM  358

Query  90    KTLGICIFSV  61
             KTLGICIFS 
Sbjct  359   KTLGICIFSA  368



>gb|KHG17010.1| [Protein-PII] uridylyltransferase [Gossypium arboreum]
Length=420

 Score =   471 bits (1212),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 234/371 (63%), Positives = 286/371 (77%), Gaps = 6/371 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+IQ GNK G+P++ITVNC DK GLGC+IC IILDFGL I KGDVSTDG WCY+V W
Sbjct  6     DDAVLIQKGNKQGEPHVITVNCPDKHGLGCDICHIILDFGLYITKGDVSTDGIWCYMVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL---PSPKTPATSSYLMTLYCIGRTGLLH  814
             V P SS+P+V W  LK+RL S+CP  S   YL   PS  +PA+  YL+  +C+ R GLLH
Sbjct  66    VVPHSSSPVVRWPSLKNRLQSLCPSCSVTFYLNDQPS-NSPASPVYLLKFFCLDRKGLLH  124

Query  813   DVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESC  634
             DVTQ LCE EL I++VKV TTPD RVLD+F I D++ELL+ +E+Q  LC+QL AVLG+SC
Sbjct  125   DVTQVLCELELTIQKVKVTTTPDGRVLDLFFITDNMELLHTEERQHHLCKQLDAVLGDSC  184

Query  633   ISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTI  454
             ISC+L+L   GP Y+     S+LSP+V  ELF   LS+ ET LQ LS D+ KLKK+ V +
Sbjct  185   ISCKLRLA--GPEYDCHHGISSLSPAVAEELFCFVLSDKETRLQALSSDMTKLKKANVVV  242

Query  453   DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNG  274
             DN+LS AHTL+QI CVD+KS  YDI R LK CN++I + RFS  +KG R+LD+F+Q K+G
Sbjct  243   DNSLSPAHTLLQIHCVDHKSLFYDILRTLKDCNIKIAFGRFSPNSKGCRDLDLFIQQKDG  302

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
             +K +DPEKQ  LC  LKVE+LHPLRV+I+NRGPDTELLVANP+ELSG GRPRVFYDVT A
Sbjct  303   KKFVDPEKQNGLCSRLKVEMLHPLRVIIANRGPDTELLVANPVELSGKGRPRVFYDVTLA  362

Query  93    LKTLGICIFSV  61
             LK LGICIFS 
Sbjct  363   LKALGICIFSA  373



>ref|XP_008366334.1| PREDICTED: uncharacterized protein LOC103429983 isoform X1 [Malus 
domestica]
Length=420

 Score =   470 bits (1209),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 236/370 (64%), Positives = 285/370 (77%), Gaps = 4/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVIQ G +PG+P +ITVNC DK GLGC+ICRIILDFGL I+K D STDG WCY V+W
Sbjct  6     DDVVVIQKGRRPGEPCIITVNCPDKTGLGCDICRIILDFGLLIEKADFSTDGIWCYXVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             VFP SS+P+V  + LK++L SVCP  S   YL    T ++SS  YL+T  C+ R GLLHD
Sbjct  66    VFPDSSSPVVKLSNLKNQLQSVCPSCSVPFYLYQQATRSSSSPVYLLTFLCLDRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ L E EL I+RVKV TTPDDRVLD+F I D+ +LL+ KE+Q+E  +QLR VLGESCI
Sbjct  126   VTKTLSELELSIQRVKVTTTPDDRVLDLFFITDNTDLLHTKERQDETIKQLRDVLGESCI  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+LV  GP YE+L    +LSP V  ELFRCEL + ET  Q LSPD+ KLKK+ VT+D
Sbjct  186   SCELQLV--GPEYESLHGIPSLSPVVAEELFRCELLDKETRSQALSPDMTKLKKTNVTMD  243

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS AHTL+QI C D+K  LYDI R LK CN++I Y R S   KG R+LD+F+Q  +G+
Sbjct  244   NSLSPAHTLLQIHCADHKGLLYDILRTLKDCNIKIAYGRISPNIKGYRDLDLFIQQNDGK  303

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             K +DP+KQ++L   LKVE+LHPLRV+I+NRGPDTELLVANP+ELSG GRPRVFYDVT AL
Sbjct  304   KFVDPDKQSALYLRLKVEMLHPLRVIIANRGPDTELLVANPVELSGKGRPRVFYDVTTAL  363

Query  90    KTLGICIFSV  61
             KTLGICIFS 
Sbjct  364   KTLGICIFSA  373



>ref|XP_009353712.1| PREDICTED: uncharacterized protein LOC103944951 isoform X2 [Pyrus 
x bretschneideri]
Length=420

 Score =   469 bits (1207),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 235/372 (63%), Positives = 287/372 (77%), Gaps = 4/372 (1%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD VVIQ G +PG+P +ITVNC DK GLGC+ICRIILDFGL I+K D STDG WCYVV
Sbjct  4     LSDDVVVIQKGKRPGEPCIITVNCPDKTGLGCDICRIILDFGLLIEKADFSTDGIWCYVV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLL  817
             +WVFP SS+P V  + LK++L SVCP  S   YL    T ++SS  YL+T  C+ R GLL
Sbjct  64    LWVFPDSSSPAVKLSNLKNQLQSVCPSCSVPFYLYQQPTRSSSSPVYLLTFLCLDRKGLL  123

Query  816   HDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGES  637
             HDVT+ L E EL I+RVKV TTPDDRVLD+F I D+++LL+ KE+Q+E  +QLR VLGES
Sbjct  124   HDVTKTLSELELSIQRVKVTTTPDDRVLDLFFITDNMDLLHTKERQDETIKQLRDVLGES  183

Query  636   CISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVT  457
             CISCEL+LV  GP YE+     +LSP+V  ELFRCEL + ET  Q LSPD+ KLKK+ VT
Sbjct  184   CISCELQLV--GPEYESHHGIPSLSPAVAEELFRCELLDKETRSQALSPDMTKLKKTNVT  241

Query  456   IDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKN  277
             +DN+LS AHTL+QI C D+K  LYDI R LK  N++I Y R S   KG R+LD+F+Q  +
Sbjct  242   MDNSLSPAHTLLQIHCADHKGLLYDILRTLKDSNIKIAYGRISPNIKGYRDLDLFIQQND  301

Query  276   GEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTF  97
             G+K++DP+KQ++L   LKVE+LHPLRV+I+NRGPDTELLVANP+ELSG GRPRVFYDVT 
Sbjct  302   GKKLVDPDKQSALYLRLKVEMLHPLRVIIANRGPDTELLVANPVELSGKGRPRVFYDVTI  361

Query  96    ALKTLGICIFSV  61
             ALKTLGICIFS 
Sbjct  362   ALKTLGICIFSA  373



>ref|XP_008223202.1| PREDICTED: uncharacterized protein LOC103323019 [Prunus mume]
Length=420

 Score =   468 bits (1204),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 231/370 (62%), Positives = 284/370 (77%), Gaps = 4/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVIQ GN+PG+P +ITVNC DK GLGC+ICRIILDFGL I+K D STDG WCY+V+W
Sbjct  6     DDVVVIQKGNRPGEPCVITVNCPDKTGLGCDICRIILDFGLYIEKADFSTDGIWCYLVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             VFP SS+P+V  + LK++L SVCP  +   Y     T  +SS  YL+T  C+ R GLLHD
Sbjct  66    VFPHSSSPVVRLSNLKNQLQSVCPSCTVSYYFFQQTTRPSSSAVYLLTFVCLDRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ L E EL I+ VKV TTPDDRVLD+F I D+++LL+ KE+Q+E  +QL  VLGESCI
Sbjct  126   VTKILSELELSIQSVKVTTTPDDRVLDLFFITDNMDLLHTKERQDETLKQLHDVLGESCI  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L    P+YE+     +LSP V  ELF C L + ET  Q LSPD+ KLK+S VT+D
Sbjct  186   SCELQLA--DPVYESHRGIPSLSPVVAEELFTCALLDKETLSQALSPDMTKLKESNVTMD  243

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS AHTL+QI C D+K  LYDI R LK CN++I+Y RFS   KG R+LD+F+Q K+G+
Sbjct  244   NSLSPAHTLLQIHCADHKGLLYDIMRTLKDCNIKISYGRFSPKVKGYRDLDLFIQQKDGK  303

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             K +DP+KQ++LC CLKVE+LHPLRV+I+NRGPD ELLVANP+ELSG GRPRVFYDVT AL
Sbjct  304   KFVDPDKQSALCLCLKVEMLHPLRVIIANRGPDNELLVANPVELSGKGRPRVFYDVTLAL  363

Query  90    KTLGICIFSV  61
             KTLGICIFS 
Sbjct  364   KTLGICIFSA  373



>gb|KDO72917.1| hypothetical protein CISIN_1g014754mg [Citrus sinensis]
Length=419

 Score =   468 bits (1203),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 232/370 (63%), Positives = 285/370 (77%), Gaps = 5/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ G +PG+P++ITVNC DK GLGC+ICRIILDFGL I KGD+STDG WCY+V+W
Sbjct  6     DDVVLIQKGKRPGEPHVITVNCPDKTGLGCDICRIILDFGLYITKGDISTDGIWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             V P SS+ I+ W  LK+RL   CP  S   Y     T  T S  YL+ L+C+ R GLLHD
Sbjct  66    VVPHSSS-IIRWTNLKNRLMLECPSCSVSFYFNQLSTRPTCSPVYLLKLFCLDRKGLLHD  124

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VTQ LCE EL I+RVKV TTPD RVLD+F I D+ ELL+ K++Q+E CEQL AVLGESCI
Sbjct  125   VTQVLCELELSIQRVKVTTTPDGRVLDLFFITDNRELLHTKKRQDETCEQLHAVLGESCI  184

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   GP  +     ++LSP V  ELFR ELS+ ET LQ LSPD+ KLKK+ V +D
Sbjct  185   SCELQLA--GPECDCHQGVTSLSPVVAEELFRFELSDKETRLQALSPDMTKLKKANVVVD  242

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS AHTL+QI CVD+K  LYDI R LK CN++I+Y RFS  ++G R+LD+F+Q K+G+
Sbjct  243   NSLSPAHTLLQIHCVDHKGLLYDIMRTLKDCNMKISYGRFSPNSQGYRDLDLFIQQKDGK  302

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+DPEKQ+++C  LK+E+LHPLRV+I+NRGPDTELLVANP+EL G GRPRVFYDVT AL
Sbjct  303   KIVDPEKQSAICSRLKMEMLHPLRVIIANRGPDTELLVANPVELCGKGRPRVFYDVTLAL  362

Query  90    KTLGICIFSV  61
             K LGIC+FS 
Sbjct  363   KVLGICVFSA  372



>ref|XP_006424782.1| hypothetical protein CICLE_v10028516mg [Citrus clementina]
 gb|ESR38022.1| hypothetical protein CICLE_v10028516mg [Citrus clementina]
Length=419

 Score =   467 bits (1202),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 232/370 (63%), Positives = 285/370 (77%), Gaps = 5/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ G +PG+P++ITVNC DK GLGC+ICRIILDFGL I KGD+STDG WCY+V+W
Sbjct  6     DDVVLIQKGKRPGEPHVITVNCPDKTGLGCDICRIILDFGLYITKGDISTDGIWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             V P SS+ I+ W  LK+RL   CP  S   Y     T  T S  YL+ L+C+ R GLLHD
Sbjct  66    VVPHSSS-IIRWTNLKNRLMLECPSCSVSFYFNQLSTRPTCSPVYLLKLFCLDRKGLLHD  124

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VTQ LCE EL I+RVKV TTPD RVLD+F I D+ ELL+ K++Q+E CEQL AVLGESCI
Sbjct  125   VTQVLCELELSIQRVKVTTTPDGRVLDLFFITDNRELLHTKKRQDETCEQLHAVLGESCI  184

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             +CEL+L   GP  +     S+LSP V  ELFR ELS+ ET LQ LSPD+ KLKK+ V +D
Sbjct  185   NCELQLA--GPECDCHQGVSSLSPVVAEELFRFELSDKETRLQALSPDMTKLKKANVVVD  242

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS AHTL+QI CVD+K  LYDI R LK CN++I+Y RFS  ++G R+LD+F+Q K+G+
Sbjct  243   NSLSPAHTLLQIHCVDHKGLLYDIMRTLKDCNMKISYGRFSPNSQGYRDLDLFIQQKDGK  302

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+DPEKQ+++C  LK+E+LHPLRV+I+NRGPDTELLVANP+EL G GRPRVFYDVT AL
Sbjct  303   KIVDPEKQSAICSRLKMEMLHPLRVIIANRGPDTELLVANPVELCGKGRPRVFYDVTLAL  362

Query  90    KTLGICIFSV  61
             K LGIC+FS 
Sbjct  363   KVLGICVFSA  372



>ref|XP_011089801.1| PREDICTED: uncharacterized protein LOC105170647 isoform X1 [Sesamum 
indicum]
Length=420

 Score =   467 bits (1201),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 233/368 (63%), Positives = 280/368 (76%), Gaps = 4/368 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+I+ G K G+PY+ITVNC DK GLGC+IC  IL+FGL I +GDVSTDG WCYVV+W
Sbjct  6     DDAVLIEKGKKAGEPYVITVNCPDKTGLGCDICHTILEFGLYITRGDVSTDGIWCYVVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             V P SS+ +V W  LK+RL S+CPP     YL  P   A+SS  YL+    + R GLLHD
Sbjct  66    VIPHSSSHVVRWMNLKERLQSICPPSIPSFYLNQPSQRASSSPVYLLKFCSLDRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ L E EL I+RVKV TTPD  VLD+F IKD+LELL+ K +Q+E CE+L  VLGESCI
Sbjct  126   VTEVLDELELTIQRVKVTTTPDGYVLDLFFIKDNLELLHTKARQDETCERLYTVLGESCI  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   GP  ENL   S+LS     ELFR  LSE E   Q LS D+ +LK++ V  D
Sbjct  186   SCELQLA--GPHCENLQGTSSLSSVAAEELFRFTLSEKEPRSQALSQDITELKRASVKTD  243

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS AHTL+QI+CVD+K FLYDI R LK  N++I Y RFS  NKG+RELD+F+QHK GE
Sbjct  244   NSLSPAHTLLQINCVDHKGFLYDIMRTLKDWNIKIAYGRFSPVNKGRRELDLFIQHKGGE  303

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+DPEKQ +LC  LK+ELLHPLRV+I+NRGPDTELLVANP+E+SG GRPRVFYDVTFAL
Sbjct  304   KIVDPEKQDALCSRLKLELLHPLRVLITNRGPDTELLVANPVEVSGRGRPRVFYDVTFAL  363

Query  90    KTLGICIF  67
             K+LGICIF
Sbjct  364   KSLGICIF  371



>gb|KHG30678.1| [Protein-PII] uridylyltransferase [Gossypium arboreum]
Length=429

 Score =   467 bits (1201),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 230/373 (62%), Positives = 284/373 (76%), Gaps = 7/373 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+VVIQ G K GDP++ITVNC DK GLGC+ICRIILDFGL I KGDVSTDG WCY+V W
Sbjct  6     DDAVVIQKGKKNGDPHVITVNCPDKHGLGCDICRIILDFGLYITKGDVSTDGIWCYMVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-----YLMTLYCIGRTGL  820
             V P SS+P V W  LK+RL S+CP  S   +     + ++++     YL+  +C+ R GL
Sbjct  66    VVPHSSSPFVRWPSLKNRLQSLCPSCSVTFHFEGQASNSSAAAASPVYLLKFFCLDRKGL  125

Query  819   LHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGE  640
             LHDVTQ L E EL I++VKV TTPD RVLD+F I D++ELL+ KE+Q++  +QL AVLGE
Sbjct  126   LHDVTQVLSELELTIQKVKVTTTPDGRVLDLFFITDNMELLHTKERQDDTYKQLNAVLGE  185

Query  639   SCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIV  460
             SCISCELKLV  GP YE     S+LSP++  ELFR ELS+ ET  Q LSPD+ KLKK+ V
Sbjct  186   SCISCELKLV--GPEYERHHGISSLSPAIAEELFRFELSDKETRSQALSPDMAKLKKATV  243

Query  459   TIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHK  280
              +DN+LS  HTL+QI CVD+K   YD+ R LK CN++I Y RFS  +KG R+LD+F+Q  
Sbjct  244   VVDNSLSPVHTLLQIVCVDHKGLFYDVLRTLKDCNIKIAYGRFSLNSKGYRDLDLFIQQN  303

Query  279   NGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVT  100
             +G+KI+DP+KQ  LC  L++E+LHPLRV+ISNRGPDTELLVANP+ELSG GRPRVFYDVT
Sbjct  304   DGKKIVDPDKQDGLCSRLRMEMLHPLRVIISNRGPDTELLVANPVELSGKGRPRVFYDVT  363

Query  99    FALKTLGICIFSV  61
              ALK+LGICIFS 
Sbjct  364   QALKSLGICIFSA  376



>ref|XP_006488284.1| PREDICTED: uncharacterized protein LOC102630286 [Citrus sinensis]
Length=419

 Score =   466 bits (1200),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 231/370 (62%), Positives = 285/370 (77%), Gaps = 5/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ G +PG+P++ITVNC DK GLGC+ICRIILDFGL I KGD+STDG WCY+V+W
Sbjct  6     DDVVLIQKGKRPGEPHVITVNCPDKTGLGCDICRIILDFGLYITKGDISTDGIWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             V P SS+ I+ W  LK+RL   CP  S   Y     T  T S  YL+ L+C+ R GLLHD
Sbjct  66    VVPHSSS-IIRWTNLKNRLMLECPSCSVSFYFNQLSTRPTCSPVYLLKLFCLDRKGLLHD  124

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VTQ LCE EL I+RVKV TTPD RVLD+F I D+ ELL+ K++Q+E CEQL AVLGESCI
Sbjct  125   VTQVLCELELSIQRVKVTTTPDGRVLDLFFITDNRELLHTKKRQDETCEQLHAVLGESCI  184

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             +CEL+L   GP  +     ++LSP V  ELFR ELS+ ET LQ LSPD+ KLKK+ V +D
Sbjct  185   NCELQLA--GPECDCHQGVTSLSPVVAEELFRFELSDKETRLQALSPDMTKLKKANVVVD  242

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS AHTL+QI CVD+K  LYDI R LK CN++I+Y RFS  ++G R+LD+F+Q K+G+
Sbjct  243   NSLSPAHTLLQIHCVDHKGLLYDIMRTLKDCNMKISYGRFSPNSQGYRDLDLFIQQKDGK  302

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+DPEKQ+++C  LK+E+LHPLRV+I+NRGPDTELLVANP+EL G GRPRVFYDVT AL
Sbjct  303   KIVDPEKQSAICSRLKMEMLHPLRVIIANRGPDTELLVANPVELCGKGRPRVFYDVTLAL  362

Query  90    KTLGICIFSV  61
             K LGIC+FS 
Sbjct  363   KVLGICVFSA  372



>ref|XP_010259962.1| PREDICTED: uncharacterized protein LOC104599213 isoform X3 [Nelumbo 
nucifera]
Length=420

 Score =   464 bits (1195),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 227/370 (61%), Positives = 280/370 (76%), Gaps = 4/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ G +PG+P +ITVNC DK GLGC++CRIIL+FGL I +GDVSTDGRWCYVV+W
Sbjct  6     DDVVLIQKGKQPGEPCVITVNCPDKTGLGCDLCRIILEFGLCITRGDVSTDGRWCYVVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             V P   +  ++W  LK+RL SVCP  S   Y     + +T S  YL+ L+C+ R GLLHD
Sbjct  66    VVPHPVSLTISWGNLKNRLLSVCPSCSVSFYFNQHSSRSTPSPVYLLKLFCLNRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VTQ LCE EL I+RVKV+TTPD RV+D+F I D +ELL+ K++Q+E CEQL +VLGESC+
Sbjct  126   VTQVLCELELTIQRVKVMTTPDGRVMDLFFITDGMELLHTKKRQDETCEQLNSVLGESCV  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   GP YE    FS++ P    ELF CEL + ET  Q LS D+ KLKK+ VTID
Sbjct  186   SCELQLA--GPEYEIQQEFSSILPVAAEELFGCELLDKETRTQALSADLTKLKKASVTID  243

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS AHTL Q+ CVD K  LYDI R LK CN+QI Y R+S++    R++D+F+Q  +G+
Sbjct  244   NSLSPAHTLFQMHCVDQKCLLYDIMRTLKDCNIQIAYGRYSSSMNDYRDVDLFLQQTDGK  303

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+DPEKQ++LC  LKVE+LHPLRV I+NRGPDTELLVANP+ELSG GRPRVFYDVT AL
Sbjct  304   KIVDPEKQSTLCSRLKVEMLHPLRVTIANRGPDTELLVANPVELSGKGRPRVFYDVTLAL  363

Query  90    KTLGICIFSV  61
             K LGICIFS 
Sbjct  364   KMLGICIFSA  373



>ref|XP_007016485.1| ACT domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY34104.1| ACT domain-containing protein isoform 2 [Theobroma cacao]
Length=420

 Score =   463 bits (1191),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 230/370 (62%), Positives = 278/370 (75%), Gaps = 4/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ G KPG+P++ITVNC DK GLGC+ICRIILDFGL I KGDVSTDG WCY+V W
Sbjct  6     DDVVLIQKGKKPGEPHVITVNCPDKHGLGCDICRIILDFGLYITKGDVSTDGIWCYMVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL--PSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P SS+  V W  LK+RL S+CP  S   YL   +  + A+  YL+  +C+ R  LLHD
Sbjct  66    VVPHSSSIFVRWPSLKNRLQSICPSCSVTFYLNDQTSHSAASPVYLLKFFCLDRKELLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VTQ LCE EL I++VKV TTPD RVLD+F I D++ELL+ KE+Q++  +QL AVLGESCI
Sbjct  126   VTQVLCELELTIQKVKVTTTPDGRVLDLFFITDNMELLHTKERQDDTYKQLNAVLGESCI  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCELKL   GP YE      +LSP+V  ELFR ELS+ ET  Q LSPD+ KLKK+ V +D
Sbjct  186   SCELKLA--GPEYECHHGILSLSPAVVEELFRSELSDKETRSQALSPDMTKLKKANVVVD  243

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS AHTL+Q+ CVD+K   YD+ R LK CN++I Y RFS    G R++DVF+  K+G+
Sbjct  244   NSLSPAHTLLQLHCVDHKGLFYDVLRTLKDCNIKIAYGRFSPTFNGYRDIDVFILQKDGK  303

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+ P+KQ  LC  LKVE+LHPLRV+ISNRGPDTELLVANP+ELSG GRPRVFYDVT AL
Sbjct  304   KIVGPDKQNGLCSRLKVEMLHPLRVIISNRGPDTELLVANPVELSGKGRPRVFYDVTLAL  363

Query  90    KTLGICIFSV  61
             K LGICIFS 
Sbjct  364   KGLGICIFSA  373



>ref|XP_010259960.1| PREDICTED: uncharacterized protein LOC104599213 isoform X1 [Nelumbo 
nucifera]
Length=449

 Score =   464 bits (1193),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 227/370 (61%), Positives = 280/370 (76%), Gaps = 4/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ G +PG+P +ITVNC DK GLGC++CRIIL+FGL I +GDVSTDGRWCYVV+W
Sbjct  6     DDVVLIQKGKQPGEPCVITVNCPDKTGLGCDLCRIILEFGLCITRGDVSTDGRWCYVVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             V P   +  ++W  LK+RL SVCP  S   Y     + +T S  YL+ L+C+ R GLLHD
Sbjct  66    VVPHPVSLTISWGNLKNRLLSVCPSCSVSFYFNQHSSRSTPSPVYLLKLFCLNRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VTQ LCE EL I+RVKV+TTPD RV+D+F I D +ELL+ K++Q+E CEQL +VLGESC+
Sbjct  126   VTQVLCELELTIQRVKVMTTPDGRVMDLFFITDGMELLHTKKRQDETCEQLNSVLGESCV  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   GP YE    FS++ P    ELF CEL + ET  Q LS D+ KLKK+ VTID
Sbjct  186   SCELQLA--GPEYEIQQEFSSILPVAAEELFGCELLDKETRTQALSADLTKLKKASVTID  243

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS AHTL Q+ CVD K  LYDI R LK CN+QI Y R+S++    R++D+F+Q  +G+
Sbjct  244   NSLSPAHTLFQMHCVDQKCLLYDIMRTLKDCNIQIAYGRYSSSMNDYRDVDLFLQQTDGK  303

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+DPEKQ++LC  LKVE+LHPLRV I+NRGPDTELLVANP+ELSG GRPRVFYDVT AL
Sbjct  304   KIVDPEKQSTLCSRLKVEMLHPLRVTIANRGPDTELLVANPVELSGKGRPRVFYDVTLAL  363

Query  90    KTLGICIFSV  61
             K LGICIFS 
Sbjct  364   KMLGICIFSA  373



>ref|XP_003597349.1| hypothetical protein MTR_2g096640 [Medicago truncatula]
Length=421

 Score =   462 bits (1190),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 227/369 (62%), Positives = 281/369 (76%), Gaps = 3/369 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DDSV IQ GNKPGDP++ITVNC DK GL C+ICR IL FGL I KGDVSTDG WCY+V+W
Sbjct  8     DDSVQIQLGNKPGDPFIITVNCPDKTGLACDICRFILHFGLCILKGDVSTDGVWCYIVLW  67

Query  984   VFPQSST-PIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHDV  808
             V PQS   P ++++ LKDRL ++CPP     YL    T ++  YL+   C+ R GLLHDV
Sbjct  68    VIPQSILLPRMSYSYLKDRLQAICPPCVASFYLVQKPTTSSPVYLLKFCCLDRKGLLHDV  127

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T+ LCE EL I+RVKV TTPD +VLD+F + D++ELL+ +++Q E CE+L AVLG+SCI 
Sbjct  128   TKVLCELELTIQRVKVTTTPDGKVLDLFFVTDNMELLHTRKRQNETCERLNAVLGDSCIK  187

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CEL+L   GP YE+    S+LSP + NELF+CELS+N+   Q LSPD+ KLKK+   +DN
Sbjct  188   CELQLA--GPEYEHNQGISSLSPVLANELFQCELSDNDVRSQALSPDMKKLKKANAALDN  245

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
             +LS AHTL+QI C D+K  LYDI R LK  N +I+Y RF     G R+LD+F+Q K+G+K
Sbjct  246   SLSQAHTLLQIQCADHKGLLYDIMRTLKDMNFKISYGRFLPNVMGYRDLDIFIQQKDGKK  305

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             ILDPEKQ +LC  LK+E+LHPLRV I++RGPDTELLVANP+ELSG GRPRVFYDVTFALK
Sbjct  306   ILDPEKQNALCSRLKLEMLHPLRVTIADRGPDTELLVANPVELSGNGRPRVFYDVTFALK  365

Query  87    TLGICIFSV  61
             TLGICIFS 
Sbjct  366   TLGICIFSA  374



>ref|XP_009612955.1| PREDICTED: uncharacterized protein LOC104106170 isoform X1 [Nicotiana 
tomentosiformis]
Length=422

 Score =   462 bits (1190),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 231/369 (63%), Positives = 280/369 (76%), Gaps = 5/369 (1%)
 Frame = -2

Query  1161  DSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMWV  982
             D+V+IQ G +  +P +ITVNC DK GLGC+ICR ILDFGL+I KGDVSTDG WCYVV+WV
Sbjct  10    DTVIIQKGKRGEEPNVITVNCPDKTGLGCDICRTILDFGLHIIKGDVSTDGLWCYVVLWV  69

Query  981   FPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL--PSPKTPATSSYLMTLYCIGRTGLLHDV  808
              PQSS+  V W  LK+RL SVCP YS   YL  PSP   ++S YL+T     R GLLHDV
Sbjct  70    VPQSSSSKVRWKNLKERLVSVCPSYSVSFYLNQPSPHAISSSVYLLTFCSSDRRGLLHDV  129

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
              + L E EL I+RVKV  TPD   +D+F I D+LELL+ K +Q+E  EQLRAVLGESC  
Sbjct  130   NEVLSELELTIQRVKVTRTPDGHAVDLFFITDNLELLHTKARQDETYEQLRAVLGESC-G  188

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
              EL+L   GP Y+NL   S+L PSV  ELFRC++ +NE H Q LS ++ KLKK+ VTIDN
Sbjct  189   FELQLA--GPKYDNLQYISSLPPSVAEELFRCKIEDNEFHAQALSSEMTKLKKASVTIDN  246

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
             +LS  HTL+QISC+D+K FLYDI R LK  ++QI++ RFS  NKGQRELD+F++ K+G K
Sbjct  247   SLSPGHTLLQISCIDHKGFLYDIMRTLKDFSIQISFGRFSPVNKGQRELDLFIRQKDGRK  306

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             I+DPEKQ ++C  LKVE+LHPLRV+I+NRGPDTELLVANP+ELSG GRPRV YDVT ALK
Sbjct  307   IVDPEKQDAICSRLKVEMLHPLRVIITNRGPDTELLVANPIELSGNGRPRVSYDVTLALK  366

Query  87    TLGICIFSV  61
              LGICIFS 
Sbjct  367   NLGICIFSA  375



>gb|KDP44210.1| hypothetical protein JCGZ_05677 [Jatropha curcas]
Length=420

 Score =   462 bits (1190),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 221/371 (60%), Positives = 285/371 (77%), Gaps = 6/371 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+VVIQ GNKP +P+++ VNC D+ GL C+ICR IL+FGL I KGDVSTDG+WCY+V+W
Sbjct  6     DDAVVIQKGNKPEEPHVVAVNCPDRTGLACDICRTILEFGLYITKGDVSTDGKWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNL-IYLPSPKTPATSS--YLMTLYCIGRTGLLH  814
             V P S + ++ W+ LK+RL S+CP   ++  YL    +P  +S  YL+  +C+ R GLLH
Sbjct  66    VVPHSHS-LLRWSNLKNRLVSICPSSCSVSFYLNQQSSPLEASPVYLLKFFCLDRKGLLH  124

Query  813   DVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESC  634
             DVT+ L E EL I+RVKV TTPD RVLD+F I D++ELL+ K++Q+E CEQL AVLG+SC
Sbjct  125   DVTRVLTELELTIQRVKVTTTPDGRVLDLFFITDNMELLHTKKRQDETCEQLHAVLGKSC  184

Query  633   ISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTI  454
             ISCEL+L   G  YE     S+LSP +  ELF CE+S+ E+H Q LSPD+ KLKK+ V I
Sbjct  185   ISCELQLT--GAEYECHQGMSSLSPVIAEELFHCEISDKESHFQALSPDMTKLKKTNVII  242

Query  453   DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNG  274
             DN+LS AHTL+Q+ C+D+K  LYD  R LK CN+QI Y RFS  N G R+LD+F+Q K+G
Sbjct  243   DNSLSPAHTLLQVHCIDHKGLLYDALRTLKDCNIQIAYGRFSPNNSGYRDLDLFIQQKDG  302

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
             +KI+D +KQ+ LC  L++E+LHPLRV+++NRGPDTELLVANP+ELSG GRPRVFYDVT A
Sbjct  303   KKIVDSDKQSELCSRLRLEMLHPLRVIVANRGPDTELLVANPVELSGKGRPRVFYDVTLA  362

Query  93    LKTLGICIFSV  61
             LK+LGICIFS 
Sbjct  363   LKSLGICIFSA  373



>gb|AES67600.2| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=422

 Score =   462 bits (1190),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 227/369 (62%), Positives = 281/369 (76%), Gaps = 3/369 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DDSV IQ GNKPGDP++ITVNC DK GL C+ICR IL FGL I KGDVSTDG WCY+V+W
Sbjct  9     DDSVQIQLGNKPGDPFIITVNCPDKTGLACDICRFILHFGLCILKGDVSTDGVWCYIVLW  68

Query  984   VFPQSST-PIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHDV  808
             V PQS   P ++++ LKDRL ++CPP     YL    T ++  YL+   C+ R GLLHDV
Sbjct  69    VIPQSILLPRMSYSYLKDRLQAICPPCVASFYLVQKPTTSSPVYLLKFCCLDRKGLLHDV  128

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T+ LCE EL I+RVKV TTPD +VLD+F + D++ELL+ +++Q E CE+L AVLG+SCI 
Sbjct  129   TKVLCELELTIQRVKVTTTPDGKVLDLFFVTDNMELLHTRKRQNETCERLNAVLGDSCIK  188

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CEL+L   GP YE+    S+LSP + NELF+CELS+N+   Q LSPD+ KLKK+   +DN
Sbjct  189   CELQLA--GPEYEHNQGISSLSPVLANELFQCELSDNDVRSQALSPDMKKLKKANAALDN  246

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
             +LS AHTL+QI C D+K  LYDI R LK  N +I+Y RF     G R+LD+F+Q K+G+K
Sbjct  247   SLSQAHTLLQIQCADHKGLLYDIMRTLKDMNFKISYGRFLPNVMGYRDLDIFIQQKDGKK  306

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             ILDPEKQ +LC  LK+E+LHPLRV I++RGPDTELLVANP+ELSG GRPRVFYDVTFALK
Sbjct  307   ILDPEKQNALCSRLKLEMLHPLRVTIADRGPDTELLVANPVELSGNGRPRVFYDVTFALK  366

Query  87    TLGICIFSV  61
             TLGICIFS 
Sbjct  367   TLGICIFSA  375



>ref|XP_007016484.1| ACT domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY34103.1| ACT domain-containing protein isoform 1 [Theobroma cacao]
Length=444

 Score =   462 bits (1190),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 230/370 (62%), Positives = 278/370 (75%), Gaps = 4/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ G KPG+P++ITVNC DK GLGC+ICRIILDFGL I KGDVSTDG WCY+V W
Sbjct  6     DDVVLIQKGKKPGEPHVITVNCPDKHGLGCDICRIILDFGLYITKGDVSTDGIWCYMVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL--PSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P SS+  V W  LK+RL S+CP  S   YL   +  + A+  YL+  +C+ R  LLHD
Sbjct  66    VVPHSSSIFVRWPSLKNRLQSICPSCSVTFYLNDQTSHSAASPVYLLKFFCLDRKELLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VTQ LCE EL I++VKV TTPD RVLD+F I D++ELL+ KE+Q++  +QL AVLGESCI
Sbjct  126   VTQVLCELELTIQKVKVTTTPDGRVLDLFFITDNMELLHTKERQDDTYKQLNAVLGESCI  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCELKL   GP YE      +LSP+V  ELFR ELS+ ET  Q LSPD+ KLKK+ V +D
Sbjct  186   SCELKLA--GPEYECHHGILSLSPAVVEELFRSELSDKETRSQALSPDMTKLKKANVVVD  243

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS AHTL+Q+ CVD+K   YD+ R LK CN++I Y RFS    G R++DVF+  K+G+
Sbjct  244   NSLSPAHTLLQLHCVDHKGLFYDVLRTLKDCNIKIAYGRFSPTFNGYRDIDVFILQKDGK  303

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+ P+KQ  LC  LKVE+LHPLRV+ISNRGPDTELLVANP+ELSG GRPRVFYDVT AL
Sbjct  304   KIVGPDKQNGLCSRLKVEMLHPLRVIISNRGPDTELLVANPVELSGKGRPRVFYDVTLAL  363

Query  90    KTLGICIFSV  61
             K LGICIFS 
Sbjct  364   KGLGICIFSA  373



>ref|XP_010685812.1| PREDICTED: uncharacterized protein LOC104900152 [Beta vulgaris 
subsp. vulgaris]
Length=419

 Score =   461 bits (1187),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 227/369 (62%), Positives = 280/369 (76%), Gaps = 3/369 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I+ G KPGDP++ITVNC DK GLG +ICR ILDFGL I KGDVSTDG+WCY+V+W
Sbjct  6     DDIVLIEKGKKPGDPWVITVNCPDKTGLGLDICRTILDFGLYISKGDVSTDGKWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYS-NLIYLPSPKTPATSSYLMTLYCIGRTGLLHDV  808
             V P SST  V W  LK+RL SVCP  S +  Y P P   ++  YL+   C+ R GLL+DV
Sbjct  66    VVPHSSTRAVRWENLKERLVSVCPSCSLSYYYAPPPPCKSSPIYLLKFCCLDRRGLLYDV  125

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T  LCE EL IERVKV TTPD RVLD+F I D+L+LL+ KE+QEE  EQLR VLG+SCIS
Sbjct  126   THILCELELSIERVKVTTTPDGRVLDLFFITDNLKLLHTKERQEETYEQLRRVLGDSCIS  185

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CEL+L      +E     S++SP+V  ELF  E S+ E H+Q LS D+ +LKK++V +DN
Sbjct  186   CELQLADKH--HEARQGTSSISPAVAEELFASEYSKKECHMQALSADLTQLKKAVVNVDN  243

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
             +LS +HTL+QI CVD+K  LYDI R LK  +V+I+Y R SA  KG R++D+FVQHK+G+K
Sbjct  244   SLSPSHTLLQIHCVDHKGLLYDIVRTLKDHDVKISYGRISAVTKGHRDMDLFVQHKDGKK  303

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             I+D E++  LC CLK+E+LHPLRV+I+NRGPDTELLVANP+ELSG GRPRVFYDVT ALK
Sbjct  304   IVDSEREYLLCSCLKIEMLHPLRVLIANRGPDTELLVANPVELSGRGRPRVFYDVTLALK  363

Query  87    TLGICIFSV  61
              LGICIFS 
Sbjct  364   KLGICIFSA  372



>ref|XP_010043578.1| PREDICTED: uncharacterized protein LOC104432753 [Eucalyptus grandis]
Length=420

 Score =   461 bits (1186),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 225/369 (61%), Positives = 279/369 (76%), Gaps = 4/369 (1%)
 Frame = -2

Query  1161  DSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMWV  982
             D+V+IQ   KPG+P++ITVNC DK GLGC+ICR ILDFGL I KGD+STDG WCY+V+WV
Sbjct  7     DAVLIQKPKKPGEPHVITVNCPDKTGLGCDICRTILDFGLCITKGDISTDGIWCYIVLWV  66

Query  981   FPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHDV  808
              P +ST IV W+ LKDRL S CP  S   YL      +TSS  YL+    + R GLLHDV
Sbjct  67    LPHTSTLIVKWSNLKDRLMSACPSSSVQFYLDHQPAHSTSSPVYLLKFLSLDRKGLLHDV  126

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T+ LCE EL I+RVKV+TTPD+RVLD+F I D+++LL+ K++Q++ CEQL AVLGESCIS
Sbjct  127   TRVLCELELTIQRVKVMTTPDERVLDLFFITDNMDLLHTKKRQDQTCEQLYAVLGESCIS  186

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CEL+L   GP Y        LSP+V  ELFRCE  ++ET+ + L+PD+ KLKK+ ++ DN
Sbjct  187   CELQLA--GPEYGGHQAILTLSPAVAEELFRCEPLKDETYSRALTPDLTKLKKTTISADN  244

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
              LS AHTL+QI  VD+K  LYDI R LK C++QI Y RFS    G R+LD+F+Q   G+K
Sbjct  245   TLSPAHTLLQIHSVDHKGLLYDIMRTLKDCSIQIAYGRFSPNVNGHRDLDLFIQQTGGKK  304

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             I+DPEKQ++L   LK+E+LHPLRV+IS+RGPDTELLVANP+ELSG GRPRVFYDVT ALK
Sbjct  305   IVDPEKQSALISRLKLEMLHPLRVIISSRGPDTELLVANPVELSGKGRPRVFYDVTLALK  364

Query  87    TLGICIFSV  61
              LGICIFS 
Sbjct  365   MLGICIFSA  373



>ref|XP_010253239.1| PREDICTED: uncharacterized protein LOC104594585 isoform X1 [Nelumbo 
nucifera]
Length=419

 Score =   461 bits (1186),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 224/369 (61%), Positives = 278/369 (75%), Gaps = 3/369 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ G KPG+P +ITVNC DK GLGC++CRIIL+FGL I +GDVSTDG+WCY+++W
Sbjct  6     DDVVLIQKGKKPGEPCVITVNCPDKAGLGCDLCRIILEFGLCITRGDVSTDGKWCYILLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHDV  808
             V P   +  V WA LK+RL SVCP  S   Y   P   + S  YL+   C+ R GLLHDV
Sbjct  66    VEPHPVSLTVRWASLKNRLLSVCPSCSVSFYFNQPSCSSPSPVYLLKFCCLDRKGLLHDV  125

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             TQ LCE EL I+RVKV+TTPD RV+D+F I D +ELL+ K +Q++ CE+L A+LGESC+S
Sbjct  126   TQVLCELELTIQRVKVMTTPDGRVMDLFFITDGMELLHTKRRQDDTCERLNAILGESCVS  185

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CEL+L   GP YE     S++S     ELF CE S+ ET  Q LS D+ KLKK+ VTIDN
Sbjct  186   CELQLA--GPEYEMQQGVSSISSEAAEELFNCEFSDKETRSQALSADLTKLKKACVTIDN  243

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
             +LS AHTLIQ+ CVD K  LYDI R +K CN+QI Y R++++ KG R++D+FVQ  +G+K
Sbjct  244   SLSPAHTLIQMHCVDQKGLLYDIMRTMKDCNIQIAYGRYTSSTKGYRDVDLFVQQMDGKK  303

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             ++DPEKQ++LC  LKVE+LHPLRV I+NRGPDTELLVANP+ELSG GRPRVFYDVT ALK
Sbjct  304   MVDPEKQSALCSRLKVEMLHPLRVSIANRGPDTELLVANPVELSGKGRPRVFYDVTLALK  363

Query  87    TLGICIFSV  61
              LGICIFS 
Sbjct  364   MLGICIFSA  372



>ref|XP_009769845.1| PREDICTED: uncharacterized protein LOC104220644 [Nicotiana sylvestris]
Length=422

 Score =   459 bits (1180),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 231/369 (63%), Positives = 275/369 (75%), Gaps = 5/369 (1%)
 Frame = -2

Query  1161  DSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMWV  982
             D+V+IQ G    +P +ITVNC DK GLGC+I R ILDFGL+I KGDVSTDG WCYVV+WV
Sbjct  10    DTVIIQKGKGGEEPNVITVNCPDKTGLGCDISRTILDFGLHIIKGDVSTDGIWCYVVLWV  69

Query  981   FPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHDV  808
              PQSS+  V W  LK RL SVCP  S  IYL  P  PA SS  YL+T     R GLLHDV
Sbjct  70    VPQSSSSKVRWKNLKVRLVSVCPSCSVSIYLNQPSPPAISSPVYLLTFCSSDRRGLLHDV  129

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
              Q L E EL I+RVKV  TPD   +D+F I D+LELL+ K +Q+E  EQLRAVLGESC  
Sbjct  130   NQVLSELELTIQRVKVTKTPDGHAVDLFFITDNLELLHTKARQDETYEQLRAVLGESC--  187

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
              + +L   G  Y+NL   S+L PSV  ELFRC++ +NE H Q LS D+ KLKK+ VTIDN
Sbjct  188   -DFELQLAGSKYDNLQYISSLPPSVAEELFRCKIGDNEFHAQALSSDMTKLKKASVTIDN  246

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
             +LS  HTL+QISC+D+K FLYDI R LK  ++QI++ RFS  NKGQRELD+F++ K+G K
Sbjct  247   SLSPGHTLLQISCIDHKGFLYDIMRTLKDFSIQISFGRFSPVNKGQRELDLFIRQKDGRK  306

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             I+DPEKQ ++C  LKVE+LHPLRV+I+NRGPDTELLVANP+ELSG GRPRVFYDVT ALK
Sbjct  307   IVDPEKQDAICSRLKVEMLHPLRVIIANRGPDTELLVANPIELSGNGRPRVFYDVTLALK  366

Query  87    TLGICIFSV  61
              LGICIFS 
Sbjct  367   NLGICIFSA  375



>gb|KCW85596.1| hypothetical protein EUGRSUZ_B02387 [Eucalyptus grandis]
Length=583

 Score =   462 bits (1189),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 225/369 (61%), Positives = 280/369 (76%), Gaps = 4/369 (1%)
 Frame = -2

Query  1161  DSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMWV  982
             D+V+IQ   KPG+P++ITVNC DK GLGC+ICR ILDFGL I KGD+STDG WCY+V+WV
Sbjct  183   DAVLIQKPKKPGEPHVITVNCPDKTGLGCDICRTILDFGLCITKGDISTDGIWCYIVLWV  242

Query  981   FPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHDV  808
              P +ST IV W+ LKDRL S CP  S   YL      +TSS  YL+    + R GLLHDV
Sbjct  243   LPHTSTLIVKWSNLKDRLMSACPSSSVQFYLDHQPAHSTSSPVYLLKFLSLDRKGLLHDV  302

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T+ LCE EL I+RVKV+TTPD+RVLD+F I D+++LL+ K++Q++ CEQL AVLGESCIS
Sbjct  303   TRVLCELELTIQRVKVMTTPDERVLDLFFITDNMDLLHTKKRQDQTCEQLYAVLGESCIS  362

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CEL+L   GP Y        LSP+V  ELFRCE  ++ET+ + L+PD+ KLKK+ ++ DN
Sbjct  363   CELQLA--GPEYGGHQAILTLSPAVAEELFRCEPLKDETYSRALTPDLTKLKKTTISADN  420

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
              LS AHTL+QI  VD+K  LYDI R LK C++QI Y RFS    G R+LD+F+Q   G+K
Sbjct  421   TLSPAHTLLQIHSVDHKGLLYDIMRTLKDCSIQIAYGRFSPNVNGHRDLDLFIQQTGGKK  480

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             I+DPEKQ++L   LK+E+LHPLRV+IS+RGPDTELLVANP+ELSG GRPRVFYDVT ALK
Sbjct  481   IVDPEKQSALISRLKLEMLHPLRVIISSRGPDTELLVANPVELSGKGRPRVFYDVTLALK  540

Query  87    TLGICIFSV  61
              LGICIFS+
Sbjct  541   MLGICIFSI  549



>gb|KCW85594.1| hypothetical protein EUGRSUZ_B02387 [Eucalyptus grandis]
Length=596

 Score =   462 bits (1189),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 225/369 (61%), Positives = 279/369 (76%), Gaps = 4/369 (1%)
 Frame = -2

Query  1161  DSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMWV  982
             D+V+IQ   KPG+P++ITVNC DK GLGC+ICR ILDFGL I KGD+STDG WCY+V+WV
Sbjct  183   DAVLIQKPKKPGEPHVITVNCPDKTGLGCDICRTILDFGLCITKGDISTDGIWCYIVLWV  242

Query  981   FPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHDV  808
              P +ST IV W+ LKDRL S CP  S   YL      +TSS  YL+    + R GLLHDV
Sbjct  243   LPHTSTLIVKWSNLKDRLMSACPSSSVQFYLDHQPAHSTSSPVYLLKFLSLDRKGLLHDV  302

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T+ LCE EL I+RVKV+TTPD+RVLD+F I D+++LL+ K++Q++ CEQL AVLGESCIS
Sbjct  303   TRVLCELELTIQRVKVMTTPDERVLDLFFITDNMDLLHTKKRQDQTCEQLYAVLGESCIS  362

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CEL+L   GP Y        LSP+V  ELFRCE  ++ET+ + L+PD+ KLKK+ ++ DN
Sbjct  363   CELQLA--GPEYGGHQAILTLSPAVAEELFRCEPLKDETYSRALTPDLTKLKKTTISADN  420

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
              LS AHTL+QI  VD+K  LYDI R LK C++QI Y RFS    G R+LD+F+Q   G+K
Sbjct  421   TLSPAHTLLQIHSVDHKGLLYDIMRTLKDCSIQIAYGRFSPNVNGHRDLDLFIQQTGGKK  480

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             I+DPEKQ++L   LK+E+LHPLRV+IS+RGPDTELLVANP+ELSG GRPRVFYDVT ALK
Sbjct  481   IVDPEKQSALISRLKLEMLHPLRVIISSRGPDTELLVANPVELSGKGRPRVFYDVTLALK  540

Query  87    TLGICIFSV  61
              LGICIFS 
Sbjct  541   MLGICIFSA  549



>ref|XP_010535546.1| PREDICTED: uncharacterized protein LOC104810818 [Tarenaya hassleriana]
Length=421

 Score =   453 bits (1165),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 225/370 (61%), Positives = 280/370 (76%), Gaps = 4/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+VVIQ G K G+P++ITVNC DK GLGC+ICRIILDFGL I KGDV+TDG WCYVV+W
Sbjct  7     DDAVVIQKGKKAGEPHVITVNCPDKTGLGCDICRIILDFGLYITKGDVTTDGLWCYVVLW  66

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSN--LIYLPSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P S++ ++ W+ LK++L SVCP  S+  L+ L  P+  +T  YL+  +C+ R GLLHD
Sbjct  67    VVPHSNSLVIRWSNLKNQLLSVCPSCSSSFLLNLMPPRPRSTPVYLLKFFCLDRKGLLHD  126

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VTQ LCE EL I+ VKV TTPD RVLD+F I D+ +LL  K +Q+E  EQL +VLGESCI
Sbjct  127   VTQVLCELELTIQTVKVTTTPDGRVLDLFFITDNKDLLQTKGRQDETLEQLHSVLGESCI  186

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   GP YE      +LSP+V  ELFR ELS+ E   Q LSPD+ KLK SIVT+D
Sbjct  187   SCELQLA--GPEYECHQNIPSLSPTVAEELFRSELSDEEARTQALSPDMTKLKNSIVTVD  244

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS  HTL+QI CVD+K  LYD+ R LK  +++I Y RFS  ++G R+LD+F+Q  +G+
Sbjct  245   NSLSPTHTLLQICCVDHKGLLYDVLRPLKDRDIKICYGRFSPQSQGYRDLDLFIQLIDGK  304

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+DP+KQ  LC  L+ E+LHPLRV I+NRGPDTELLVANP+ELSG GRPRVFYDVT +L
Sbjct  305   KIVDPDKQRILCSRLRAEMLHPLRVTITNRGPDTELLVANPVELSGKGRPRVFYDVTLSL  364

Query  90    KTLGICIFSV  61
             K LGICIFS 
Sbjct  365   KMLGICIFSA  374



>gb|KHN33401.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=425

 Score =   451 bits (1161),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 223/365 (61%), Positives = 279/365 (76%), Gaps = 4/365 (1%)
 Frame = -2

Query  1149  IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMWVFPQS  970
             IQ  NKPGDP++ITVNC DK GL C+ICRIILDFGL I KGDVSTDG WCY+V+WV P S
Sbjct  16    IQQPNKPGDPFIITVNCPDKTGLACDICRIILDFGLCIAKGDVSTDGVWCYIVLWVIPYS  75

Query  969   ST-PI-VTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHDVTQFL  796
                P+  ++  LK+RL  +CPP     Y+    + ++  YL+   C+ R GLLHDVT+ L
Sbjct  76    VLLPMSCSYLILKERLQKICPPCLASFYVIQQPSRSSPVYLLKFCCLDRKGLLHDVTKVL  135

Query  795   CECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCISCELK  616
              E EL I++VKV TTPD RVLD+F + D+ ELL+ + +Q+E CE+L AVL +SCISCEL+
Sbjct  136   SELELTIQKVKVTTTPDGRVLDLFFVTDNKELLHTRNRQDETCERLNAVLRDSCISCELQ  195

Query  615   LVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDNALSS  436
             L   GP YE     S+LSP++  ELFRCELS+NE   Q LSPD+ KLKK+ VT+DN+LS 
Sbjct  196   LA--GPEYEYNQGISSLSPALAEELFRCELSDNEVRAQALSPDMTKLKKTNVTMDNSLSP  253

Query  435   AHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEKILDP  256
             AHTL+QI C D+K  LYDI R LK  N++I+Y RFS  + G R+LD+F+Q K+G+KILDP
Sbjct  254   AHTLVQIRCADHKGLLYDIMRTLKDLNMKISYGRFSPNSMGYRDLDIFIQQKDGKKILDP  313

Query  255   EKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALKTLGI  76
             EKQ++LC  LK E+LHPLRV+I+NRGPDTELLVANP+ELSGMGRPRVFYDVTFALKT+GI
Sbjct  314   EKQSALCSRLKQEMLHPLRVIIANRGPDTELLVANPVELSGMGRPRVFYDVTFALKTVGI  373

Query  75    CIFSV  61
             C+FS 
Sbjct  374   CVFSA  378



>ref|XP_003547397.2| PREDICTED: uncharacterized protein LOC100793459 [Glycine max]
Length=425

 Score =   451 bits (1161),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 223/365 (61%), Positives = 279/365 (76%), Gaps = 4/365 (1%)
 Frame = -2

Query  1149  IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMWVFPQS  970
             IQ  NKPGDP++ITVNC DK GL C+ICRIILDFGL I KGDVSTDG WCY+V+WV P S
Sbjct  16    IQQPNKPGDPFIITVNCPDKTGLACDICRIILDFGLCIAKGDVSTDGVWCYIVLWVIPYS  75

Query  969   ST-PI-VTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHDVTQFL  796
                P+  ++  LK+RL  +CPP     Y+    + ++  YL+   C+ R GLLHDVT+ L
Sbjct  76    VLLPMSCSYLILKERLQKICPPCLASFYVIQQPSRSSPVYLLKFCCLDRKGLLHDVTKVL  135

Query  795   CECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCISCELK  616
              E EL I++VKV TTPD RVLD+F + D+ ELL+ + +Q+E CE+L AVL +SCISCEL+
Sbjct  136   SELELTIQKVKVTTTPDGRVLDLFFVTDNKELLHTRNRQDETCERLNAVLRDSCISCELQ  195

Query  615   LVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDNALSS  436
             L   GP YE     S+LSP++  ELFRCELS+NE   Q LSPD+ KLKK+ VT+DN+LS 
Sbjct  196   LA--GPEYEYNQGISSLSPALAEELFRCELSDNEVRAQALSPDMTKLKKTNVTMDNSLSP  253

Query  435   AHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEKILDP  256
             AHTL+QI C D+K  LYDI R LK  N++I+Y RFS  + G R+LD+F+Q K+G+KILDP
Sbjct  254   AHTLVQIRCADHKGLLYDIMRTLKDLNMKISYGRFSPNSMGYRDLDIFIQQKDGKKILDP  313

Query  255   EKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALKTLGI  76
             EKQ++LC  LK E+LHPLRV+I+NRGPDTELLVANP+ELSGMGRPRVFYDVTFALKT+GI
Sbjct  314   EKQSALCSRLKQEMLHPLRVIIANRGPDTELLVANPVELSGMGRPRVFYDVTFALKTVGI  373

Query  75    CIFSV  61
             C+FS 
Sbjct  374   CVFSA  378



>ref|XP_004294579.1| PREDICTED: uncharacterized protein LOC101295495 [Fragaria vesca 
subsp. vesca]
Length=420

 Score =   449 bits (1155),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 226/369 (61%), Positives = 273/369 (74%), Gaps = 3/369 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVIQ   +PG+P +ITVNC DK GLGC+ICRIILDFGL IKK D STDG WCY+V+W
Sbjct  6     DDVVVIQKAKRPGEPCVITVNCPDKTGLGCDICRIILDFGLYIKKADFSTDGIWCYLVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL-PSPKTPATSSYLMTLYCIGRTGLLHDV  808
             V P SS+  V W+ L+ +L SVCP  S   Y  P P   A + YL+   C  R GLLHDV
Sbjct  66    VVPNSSSTAVKWSNLEKQLLSVCPSCSVPYYFYPQPTCSAPAVYLLKFLCSDRYGLLHDV  125

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T+ L + EL I+ VKV TTPDDRVLD+F I D++ELL+ KE+Q++  +QL+AVLGESC S
Sbjct  126   TEILSDLELAIQMVKVTTTPDDRVLDLFFITDNMELLHTKERQDKTLKQLQAVLGESCTS  185

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CEL+LV  GP Y+     S+LSP V  ELFRCEL + E   Q LSPD+ KLK + VTIDN
Sbjct  186   CELQLV--GPEYDPHHGISSLSPVVAEELFRCELLDKEIRSQALSPDMAKLKNANVTIDN  243

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
             +LS AHTL+QI CVD+K   YDI R LK  N++I Y RFS A KG R+LD+F+Q K+G+K
Sbjct  244   SLSPAHTLLQIHCVDHKGLFYDIMRTLKDSNIKIAYGRFSPATKGYRDLDLFIQRKDGKK  303

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             I DPE+Q+ LC  LKVE+LHPLRV+I+NRGPDTELLVANP+E SG GRP VF+DVT ALK
Sbjct  304   IQDPEEQSVLCLNLKVEMLHPLRVIIANRGPDTELLVANPVEKSGKGRPLVFFDVTRALK  363

Query  87    TLGICIFSV  61
              L ICIFS 
Sbjct  364   ALKICIFSA  372



>ref|XP_007150307.1| hypothetical protein PHAVU_005G142400g [Phaseolus vulgaris]
 gb|ESW22301.1| hypothetical protein PHAVU_005G142400g [Phaseolus vulgaris]
Length=423

 Score =   447 bits (1149),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 222/370 (60%), Positives = 279/370 (75%), Gaps = 4/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V IQ+ N PGDP+++T+NC DK GL C+IC IILDFGL I KGDVSTDG WCY+V+W
Sbjct  9     DDVVQIQHPNNPGDPFILTINCPDKTGLACDICSIILDFGLCIFKGDVSTDGVWCYIVLW  68

Query  984   VFPQSST-PI-VTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P S   P+  ++  LK+RL  +CPP     Y+    + ++  YL+   C+ R GLLHD
Sbjct  69    VIPHSLLLPMNSSYLILKERLQGICPPCLASFYIFQQPSRSSPVYLLKFCCLDRKGLLHD  128

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ L E EL I++VKV TTPD RVLD+F + D+ ELL+ +++Q+E CE+L  +L  SCI
Sbjct  129   VTKVLSELELTIQKVKVTTTPDGRVLDLFFVTDNKELLHTRKRQDETCERLNDILRGSCI  188

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   GP YE+    S+LSP++  ELFRCELSENE   Q LSPD+ KLKKS VT+D
Sbjct  189   SCELQLA--GPEYEHNQGISSLSPALAEELFRCELSENEVRSQALSPDMAKLKKSNVTLD  246

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS AHTL+QI C D+K  LYDI R LK  N++I+Y RFS  + G RELD+F+Q K G+
Sbjct  247   NSLSPAHTLVQIRCADHKGLLYDIMRTLKDMNIKISYGRFSPNSMGYRELDIFIQQKEGK  306

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KILD EKQ++LC  LK+E+LHPLRV+I+NRGPDTELLVANP+ELSG GRPRVFYDVTFAL
Sbjct  307   KILDVEKQSALCSRLKLEMLHPLRVIIANRGPDTELLVANPVELSGKGRPRVFYDVTFAL  366

Query  90    KTLGICIFSV  61
             KTLGIC+FS 
Sbjct  367   KTLGICVFSA  376



>ref|XP_004487024.1| PREDICTED: uncharacterized protein LOC101513308 isoform X1 [Cicer 
arietinum]
Length=424

 Score =   440 bits (1131),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 219/370 (59%), Positives = 280/370 (76%), Gaps = 4/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+V IQ+GN P DP++IT+NC DK GLGC++CR ILDFGL I KGD STDG WCY+V+W
Sbjct  10    NDAVQIQHGNNPDDPFIITINCPDKTGLGCDLCRFILDFGLCILKGDFSTDGVWCYIVLW  69

Query  984   VFPQSSTPI-VTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHDV  808
             V PQS   + +  + LKDRL ++CPP     YL      ++  YL+   C+ R GLLHDV
Sbjct  70    VIPQSVVLLPINCSYLKDRLRAICPPCLASFYLVHKPKTSSPLYLLKFCCLDRKGLLHDV  129

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T+ LCE EL I+R+KV TTPD +VLD+F I D+LELL+ +++Q+E C++L AVLG+SCI 
Sbjct  130   TKVLCELELTIQRLKVTTTPDSKVLDLFFITDNLELLHTRKRQDETCKRLNAVLGDSCII  189

Query  627   CELKLVAPGPLYE-NLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             CEL+L   G  YE N     +LSP +  ELF+CELS+N+   Q LS D+ KLKKS VT+D
Sbjct  190   CELQLA--GSEYEYNHGHGISLSPMLAKELFQCELSDNQVRSQALSSDMKKLKKSNVTVD  247

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS  HTL+QI CVD+K  LYDI R LK  N++I+Y RFS   KG R+LD+F+Q K+G+
Sbjct  248   NSLSPVHTLLQIRCVDHKGLLYDIMRTLKDMNLKISYGRFSPNAKGCRDLDIFIQQKDGK  307

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KILD EKQ++LC  LK+E+LHPLRV+I++RGPDTELLVANP+ELSG GRPRVFYDVT AL
Sbjct  308   KILDHEKQSALCSRLKLEMLHPLRVIIADRGPDTELLVANPVELSGKGRPRVFYDVTLAL  367

Query  90    KTLGICIFSV  61
             KTLGIC+FS 
Sbjct  368   KTLGICVFSA  377



>gb|EYU36259.1| hypothetical protein MIMGU_mgv1a007078mg [Erythranthe guttata]
Length=420

 Score =   437 bits (1124),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 229/368 (62%), Positives = 278/368 (76%), Gaps = 4/368 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+I+ G K G+PY++TVNC DK GLGC+IC  IL+FGL I +GDVSTDG WCYVV+W
Sbjct  6     DDAVLIEKGKKAGEPYVVTVNCPDKTGLGCDICHTILEFGLYITRGDVSTDGIWCYVVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHDV  808
             V P+ S+ +V W  LKDRL S+CPP     YLPSP+  ++S  YL+    + R GLLHDV
Sbjct  66    VIPRLSSRVVRWMNLKDRLLSICPPSIPSFYLPSPRPSSSSPVYLLKFCSLDRKGLLHDV  125

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             TQ L E E  I+RVKV TTPD  VLD+F IKD+LELL+ KE+Q+E CEQL  VLG+S IS
Sbjct  126   TQVLDELEHTIQRVKVTTTPDGCVLDLFFIKDNLELLHTKERQDETCEQLYNVLGDSIIS  185

Query  627   CELKLVAPGPLYENLPC-FSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             CELK+   G  Y+NL    S+L P V  ELFR  LS+ E   Q LS DV +LK++ V  D
Sbjct  186   CELKIA--GVQYDNLQHNSSSLPPLVAEELFRFTLSDKEPLSQALSRDVSELKRATVKTD  243

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS  HTL+QI+CVD K FLYDI R LK  N+QI Y RF   NK +RELD+F+Q+K+G+
Sbjct  244   NSLSPLHTLLQINCVDQKGFLYDIMRTLKDYNIQIAYGRFLPVNKDRRELDLFIQYKDGK  303

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+DPEKQ +LC  LK+ELLHPLRV+I+NRGPDTELLVANP ELSG GRPRVFYDVTFAL
Sbjct  304   KIVDPEKQDALCSLLKMELLHPLRVLIANRGPDTELLVANPTELSGRGRPRVFYDVTFAL  363

Query  90    KTLGICIF  67
             K+LGICIF
Sbjct  364   KSLGICIF  371



>gb|EPS73518.1| hypothetical protein M569_01237 [Genlisea aurea]
Length=411

 Score =   435 bits (1118),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 215/370 (58%), Positives = 274/370 (74%), Gaps = 9/370 (2%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             M DD+V+I+ G KPG+PY++TVNC DK GLG +IC  IL+FGL I KGDVSTDG+WCY+V
Sbjct  4     MNDDAVLIEEGKKPGEPYVLTVNCPDKTGLGSDICHTILEFGLYITKGDVSTDGKWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHD  811
              WV P S+   V+W  L+ RL S+CPP     YLP      +  YL+    I R GLLHD
Sbjct  64    FWVIPHSAVSDVSWMNLRQRLVSLCPPSIPTFYLPKASPSPSPIYLLKFCSIDRKGLLHD  123

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ L + EL I+RVKV TTPD RVLD+F IKD+L  L+   +QEE CE+L++VLGESC+
Sbjct  124   VTRVLHQLELSIQRVKVSTTPDGRVLDLFFIKDNLAQLHKSYRQEETCERLKSVLGESCV  183

Query  630   SCELKLVAPGPLYENLPCFS--ALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVT  457
             SCE++L  P P Y++L   +  +LSP ++ ELF    +E +   ++ S +  +LK++ V 
Sbjct  184   SCEIQL--PSPHYDSLQSNTTCSLSPRISQELF--GFAEPQ---RQASEEAAQLKRASVK  236

Query  456   IDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKN  277
             IDN LS  HTL+QI+CVDYK FLYDI R LK C++QI+Y RFS  ++GQRELD FVQH +
Sbjct  237   IDNTLSPGHTLLQINCVDYKGFLYDIMRTLKDCSIQISYGRFSRFSEGQRELDFFVQHAD  296

Query  276   GEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTF  97
             G+KI+DPEKQ SLC  LK+ELLHPLRVVI++RGPD EL VANP+E+ G GRPRVFYDVTF
Sbjct  297   GKKIIDPEKQQSLCSRLKLELLHPLRVVIASRGPDAELFVANPVEVCGRGRPRVFYDVTF  356

Query  96    ALKTLGICIF  67
             ALK+LGICIF
Sbjct  357   ALKSLGICIF  366



>ref|XP_006418981.1| hypothetical protein EUTSA_v10002542mg [Eutrema salsugineum]
 gb|ESQ37417.1| hypothetical protein EUTSA_v10002542mg [Eutrema salsugineum]
Length=422

 Score =   434 bits (1117),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 213/371 (57%), Positives = 278/371 (75%), Gaps = 5/371 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D VVI+   K G+ ++ITVNC D+ GLGC+ICRIILDFGL+I+K DV+TDG WCY+V+W
Sbjct  7     EDIVVIEKAKKAGEAHVITVNCPDRSGLGCDICRIILDFGLSIRKVDVTTDGVWCYIVLW  66

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSN--LIYLPSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P   + I+ W+ LK++L SVCP  S   ++ L SP T +T  YL+  +C+ R GLLHD
Sbjct  67    VVPHYDSLILRWSHLKNQLASVCPSCSTYFVLNLMSPCTSSTHVYLLKFFCLDRRGLLHD  126

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VTQ L E EL I+ VKV TTPD RVLD+F I D+++LL+ K++QEE  EQ R+VLG+SC+
Sbjct  127   VTQVLTELELSIQTVKVTTTPDGRVLDLFFITDNMDLLHTKKRQEETLEQFRSVLGDSCL  186

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCE-LSENETHLQELSPDVMKLKKSIVTI  454
             SCE++L   GP YEN     +LSP+V  ELF  E L++ +  +Q LS D+ KLK   VT+
Sbjct  187   SCEVQLA--GPEYENHQNIPSLSPAVAEELFTSEQLTDEDNRVQVLSDDMRKLKNFTVTV  244

Query  453   DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNG  274
             DN+LS AHTL+QI CVD++  LYD+ R LK  +++I+Y RFS   +G REL++F+Q K+G
Sbjct  245   DNSLSPAHTLLQIRCVDHRGLLYDVLRTLKDFDIKISYGRFSPQTQGHRELELFIQLKDG  304

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
              KI+DP+KQ SLC  LK E LHPLRV+I+NRGPDTELLVANP+ELSG GRPRVFYDVT +
Sbjct  305   NKIVDPDKQDSLCSRLKAETLHPLRVIITNRGPDTELLVANPVELSGKGRPRVFYDVTLS  364

Query  93    LKTLGICIFSV  61
             LK LGIC+FS 
Sbjct  365   LKVLGICVFSA  375



>ref|XP_010259961.1| PREDICTED: uncharacterized protein LOC104599213 isoform X2 [Nelumbo 
nucifera]
Length=428

 Score =   433 bits (1113),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 220/370 (59%), Positives = 266/370 (72%), Gaps = 25/370 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ G +PG+P +ITVNC DK GLGC++CRIIL+FGL I +GDVSTDGRWCYVV+W
Sbjct  6     DDVVLIQKGKQPGEPCVITVNCPDKTGLGCDLCRIILEFGLCITRGDVSTDGRWCYVVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             V P   +  ++W  LK+RL SVCP  S   Y     + +T S  YL+ L+C+ R GLLHD
Sbjct  66    VVPHPVSLTISWGNLKNRLLSVCPSCSVSFYFNQHSSRSTPSPVYLLKLFCLNRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VTQ LCE EL I+RVKV+TTPD RV+D+F I D +ELL+ K++Q+E CEQL +VLGESC+
Sbjct  126   VTQVLCELELTIQRVKVMTTPDGRVMDLFFITDGMELLHTKKRQDETCEQLNSVLGESCV  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   GP YE    FS++ P    ELF CEL + ET  Q LS D+ KLKK+ VTID
Sbjct  186   SCELQLA--GPEYEIQQEFSSILPVAAEELFGCELLDKETRTQALSADLTKLKKASVTID  243

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS AHTL Q+ CVD K  LYDI R LK CN+Q T                     +G+
Sbjct  244   NSLSPAHTLFQMHCVDQKCLLYDIMRTLKDCNIQQT---------------------DGK  282

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+DPEKQ++LC  LKVE+LHPLRV I+NRGPDTELLVANP+ELSG GRPRVFYDVT AL
Sbjct  283   KIVDPEKQSTLCSRLKVEMLHPLRVTIANRGPDTELLVANPVELSGKGRPRVFYDVTLAL  342

Query  90    KTLGICIFSV  61
             K LGICIFS 
Sbjct  343   KMLGICIFSA  352



>ref|XP_010920651.1| PREDICTED: uncharacterized protein LOC105044447 [Elaeis guineensis]
Length=416

 Score =   424 bits (1089),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 211/369 (57%), Positives = 264/369 (72%), Gaps = 6/369 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D VV++ G   G+P +ITVNC D+ GL C++CRIIL+FGL+I + D+S DG+WCY+V W
Sbjct  6     EDVVVVKLGKGDGEPSVITVNCPDQTGLSCDLCRIILEFGLSITRADISRDGQWCYLVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHDV  808
             V P  ++  + W  LKDRL SVCP  S   Y      P  S  YL+ L+ + R GLLHDV
Sbjct  66    VVPYFASINIQWTSLKDRLLSVCPSCSIAFYFDLANQPTASQVYLLKLFSVDRKGLLHDV  125

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T  LCE EL + RVKV TTPD RV+D+F I D +ELL+ K++Q+E CE+L +VLGESCIS
Sbjct  126   THVLCELELLLHRVKVSTTPDGRVMDLFFITDGMELLHSKKRQDETCERLNSVLGESCIS  185

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CE++L       +     S+L P+V  ELF  ELS+ E   Q LSPD+ KLKK+ V IDN
Sbjct  186   CEIQLAE-----DFQHGVSSLPPAVAEELFSSELSDIEVCSQALSPDMKKLKKANVNIDN  240

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
             +LS AHTL+QI CVD K  LYDI R LK  N QI Y RF +  KG RE+D+F+Q  +G+K
Sbjct  241   SLSPAHTLLQIHCVDQKGLLYDIVRTLKDSNSQIAYGRFLSDQKGYREVDLFIQQTDGKK  300

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             ++DPEKQ +LC  LK+E+LHPLRV+I NRGPDTELLVANP+ELSG GRPRVFYDVT ALK
Sbjct  301   VVDPEKQEALCSRLKLEMLHPLRVMIVNRGPDTELLVANPVELSGKGRPRVFYDVTLALK  360

Query  87    TLGICIFSV  61
              LGICIFS 
Sbjct  361   VLGICIFSA  369



>ref|XP_011089802.1| PREDICTED: uncharacterized protein LOC105170647 isoform X2 [Sesamum 
indicum]
Length=399

 Score =   422 bits (1086),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 219/368 (60%), Positives = 263/368 (71%), Gaps = 25/368 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+I+ G K G+PY+ITVNC DK GLGC+IC  IL+FGL I +GDVSTDG WCYVV+W
Sbjct  6     DDAVLIEKGKKAGEPYVITVNCPDKTGLGCDICHTILEFGLYITRGDVSTDGIWCYVVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             V P SS+ +V W  LK+RL S+CPP     YL  P   A+SS  YL+    + R GLLHD
Sbjct  66    VIPHSSSHVVRWMNLKERLQSICPPSIPSFYLNQPSQRASSSPVYLLKFCSLDRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ L E EL I+RVKV TTPD  VLD+F IKD+LELL+ K +Q+E CE+L  VLGESCI
Sbjct  126   VTEVLDELELTIQRVKVTTTPDGYVLDLFFIKDNLELLHTKARQDETCERLYTVLGESCI  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   GP  ENL   S+LS     ELFR  LSE E   Q LS D+ +LK++ V  D
Sbjct  186   SCELQLA--GPHCENLQGTSSLSSVAAEELFRFTLSEKEPRSQALSQDITELKRASVKTD  243

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS AHTL+QI+CVD+K FLYDI R LK  N                     ++HK GE
Sbjct  244   NSLSPAHTLLQINCVDHKGFLYDIMRTLKDWN---------------------IKHKGGE  282

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+DPEKQ +LC  LK+ELLHPLRV+I+NRGPDTELLVANP+E+SG GRPRVFYDVTFAL
Sbjct  283   KIVDPEKQDALCSRLKLELLHPLRVLITNRGPDTELLVANPVEVSGRGRPRVFYDVTFAL  342

Query  90    KTLGICIF  67
             K+LGICIF
Sbjct  343   KSLGICIF  350



>ref|XP_009794329.1| PREDICTED: uncharacterized protein LOC104241112 [Nicotiana sylvestris]
Length=419

 Score =   421 bits (1083),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 209/370 (56%), Positives = 267/370 (72%), Gaps = 5/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+++ G K GDP +ITVNC DK GLGC++CRI+L+FGL + +GD +TDG+WCY+V+W
Sbjct  6     DDVVLMEPGVKSGDPTVITVNCPDKAGLGCDLCRIVLEFGLYVNRGDFATDGKWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKT--PATSSYLMTLYCIGRTGLLHD  811
             V P+ S   V WA LK+RL S CP      YL    T  P  + YL+ ++C+ R GLLHD
Sbjct  66    VVPRPSGLKVDWASLKNRLMSACPSCMIPYYLSQQSTCSPRPTVYLLKVFCLDRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ LCE EL I+RVKV+TTPDD+VLD+F + D ++LL+ K++++E CE L  VLGE CI
Sbjct  126   VTKVLCELELTIQRVKVMTTPDDKVLDLFFLTDDMDLLHTKQRRDETCEHLSDVLGEYCI  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   GP  E    FS+L   V  ELF CELS+ E   +  S D  KLKK+ +T+D
Sbjct  186   SCELQLA--GPECEVQQGFSSLPQEVAEELFSCELSK-EAVPKSSSSDTAKLKKATITVD  242

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N LS  HTL+QI CVD K  +YDI R  K C++QI + R  ++ KG R +D+F+Q  +G+
Sbjct  243   NLLSPVHTLLQIQCVDQKGLIYDILRTSKDCDIQIAFGRILSSAKGYRTIDLFIQRTDGK  302

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KILD E QASLC  LK E+LHPLRV +++RGPDTELLVANP+ELSG GRPRVFYDVTFAL
Sbjct  303   KILDDENQASLCSRLKEEMLHPLRVTVASRGPDTELLVANPVELSGKGRPRVFYDVTFAL  362

Query  90    KTLGICIFSV  61
             K LGICIFS 
Sbjct  363   KKLGICIFSA  372



>ref|XP_009421343.1| PREDICTED: uncharacterized protein LOC104000914 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score =   421 bits (1081),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 206/369 (56%), Positives = 267/369 (72%), Gaps = 6/369 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+VVIQ   + G+P ++TVNC D+ GLGC++CR ILDFGL I +GDVSTDG+WCY+V W
Sbjct  6     EDAVVIQPAKRAGEPTVVTVNCPDQTGLGCDLCRAILDFGLYITRGDVSTDGKWCYLVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHDV  808
             V P+S++  + W  LK+RL S+CPP S   Y      P TS  YL+ L+ + R GLLHDV
Sbjct  66    VVPRSTSSNIQWPSLKNRLLSLCPPCSIPFYFDMANRPMTSQMYLLKLFSVDRKGLLHDV  125

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T+ LCE EL I RVKV TTPD RV+D+F I D +ELL+ K +Q++ C +L AVLGES  S
Sbjct  126   TKVLCELELTIHRVKVSTTPDGRVVDLFFITDAVELLHTKARQDDTCGRLSAVLGESMNS  185

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CE++L      ++    FS+L P+   ELFR E+S  E   Q LSP++ +LKK+ V IDN
Sbjct  186   CEIELAES---FQQ--GFSSLPPAALEELFRLEMSGGEVCSQTLSPEMKRLKKADVNIDN  240

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
             +LS +HTLIQI CVD K  LYDI R LK C++Q+ Y RF +  +G RE+D+FVQ  +G+K
Sbjct  241   SLSHSHTLIQIHCVDQKGLLYDILRTLKDCSIQVAYGRFLSDKRGSREVDLFVQQSDGKK  300

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             ++DP+KQ  L   LK+E+LHPLRVVI+NRGPD ELLVANP+EL G GRPRVF+DVT ALK
Sbjct  301   VIDPDKQDILSSRLKLEMLHPLRVVIANRGPDAELLVANPVELCGKGRPRVFHDVTLALK  360

Query  87    TLGICIFSV  61
              LGIC+FS 
Sbjct  361   LLGICVFSA  369



>ref|XP_009599789.1| PREDICTED: uncharacterized protein LOC104095372 [Nicotiana tomentosiformis]
Length=419

 Score =   420 bits (1080),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 209/370 (56%), Positives = 267/370 (72%), Gaps = 5/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+++ G K GDP +ITVNC DK GLGC++CRI+L+FGL + +GD +TDG+WCY+V+W
Sbjct  6     DDVVLMEPGVKSGDPTVITVNCPDKAGLGCDLCRIVLEFGLYVNRGDFATDGKWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKT--PATSSYLMTLYCIGRTGLLHD  811
             V P+ S   V WA LK+RL S CP      YL    T  P  + YL+ ++C+ R GLLHD
Sbjct  66    VIPRPSWLKVDWASLKNRLMSACPSCMIPYYLSQQSTCSPRPTVYLLKVFCLDRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ LCE EL I+RVKV+TTPDD+VLD+F + D ++LL+ K++++E CE L  VLGE CI
Sbjct  126   VTKVLCELELTIQRVKVMTTPDDKVLDLFFLTDDMDLLHTKQRRDETCEHLSDVLGEYCI  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   GP  E    FS+L   V  ELF CELS+ E   +  S D  KLKK+ +T+D
Sbjct  186   SCELQLA--GPECEVQQGFSSLPQEVAEELFSCELSK-EAVPKSSSSDTTKLKKATITVD  242

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N LS  HTL+QI CVD K  +YDI R  K C++QI + R  ++ KG R +D+F+Q  +G+
Sbjct  243   NLLSPVHTLLQIQCVDQKGLIYDILRTSKDCDIQIAFGRILSSAKGFRTIDLFIQRTDGK  302

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KILD E QASLC  LK E+LHPLRV +++RGPDTELLVANP+ELSG GRPRVFYDVTFAL
Sbjct  303   KILDDENQASLCSRLKEEMLHPLRVTVASRGPDTELLVANPVELSGKGRPRVFYDVTFAL  362

Query  90    KTLGICIFSV  61
             K LGICIFS 
Sbjct  363   KKLGICIFSA  372



>gb|KCW85595.1| hypothetical protein EUGRSUZ_B02387 [Eucalyptus grandis]
Length=575

 Score =   426 bits (1095),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 215/369 (58%), Positives = 266/369 (72%), Gaps = 25/369 (7%)
 Frame = -2

Query  1161  DSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMWV  982
             D+V+IQ   KPG+P++ITVNC DK GLGC+ICR ILDFGL I KGD+STDG WCY+V+WV
Sbjct  183   DAVLIQKPKKPGEPHVITVNCPDKTGLGCDICRTILDFGLCITKGDISTDGIWCYIVLWV  242

Query  981   FPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHDV  808
              P +ST IV W+ LKDRL S CP  S   YL      +TSS  YL+    + R GLLHDV
Sbjct  243   LPHTSTLIVKWSNLKDRLMSACPSSSVQFYLDHQPAHSTSSPVYLLKFLSLDRKGLLHDV  302

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T+ LCE EL I+RVKV+TTPD+RVLD+F I D+++LL+ K++Q++ CEQL AVLGESCIS
Sbjct  303   TRVLCELELTIQRVKVMTTPDERVLDLFFITDNMDLLHTKKRQDQTCEQLYAVLGESCIS  362

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CEL+L   GP Y        LSP+V  ELFRCE  ++ET+ + L+PD+ KLKK+ ++ DN
Sbjct  363   CELQLA--GPEYGGHQAILTLSPAVAEELFRCEPLKDETYSRALTPDLTKLKKTTISADN  420

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
              LS AHTL+QI  VD+K  LYDI R LK C++Q T                      G+K
Sbjct  421   TLSPAHTLLQIHSVDHKGLLYDIMRTLKDCSIQQT---------------------GGKK  459

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             I+DPEKQ++L   LK+E+LHPLRV+IS+RGPDTELLVANP+ELSG GRPRVFYDVT ALK
Sbjct  460   IVDPEKQSALISRLKLEMLHPLRVIISSRGPDTELLVANPVELSGKGRPRVFYDVTLALK  519

Query  87    TLGICIFSV  61
              LGICIFS 
Sbjct  520   MLGICIFSA  528



>ref|XP_006436032.1| hypothetical protein CICLE_v10031651mg [Citrus clementina]
 ref|XP_006486078.1| PREDICTED: uncharacterized protein LOC102612803 [Citrus sinensis]
 gb|ESR49272.1| hypothetical protein CICLE_v10031651mg [Citrus clementina]
Length=419

 Score =   416 bits (1068),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 206/370 (56%), Positives = 265/370 (72%), Gaps = 5/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V++Q G+ P +P ++TVNC DK GLGC++CRIIL+FGL I +GD STDGRWCY+V+W
Sbjct  6     DDIVLVQLGSTPTEPSVVTVNCPDKNGLGCDLCRIILEFGLFIVRGDFSTDGRWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL--PSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P +S+  V W  LK+RL SVCP      Y   PS  +   S YL+   C+ R GLLHD
Sbjct  66    VVPDASSDKVDWESLKNRLLSVCPSILVSYYFNQPSSNSSKPSLYLLKYCCVDRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
              T+ L E E  I+RVKV+TTPD RVLD+F I D LELL+ K+++EE CE + AVLGE  I
Sbjct  126   ATKVLTELEFTIQRVKVMTTPDGRVLDLFFITDGLELLHTKQRREETCEHMIAVLGEYSI  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCE++L   GP YE+L  F++L P+V  ELF  EL + E   + LS +V + K SI T+D
Sbjct  186   SCEIQLA--GPEYESLQAFTSLPPAVAEELFGSELLDKEDFSRVLSTEVTQNKASI-TVD  242

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N LS AHTL+QI C D K   YDI R  K  N+QI Y R S++ KG R +D+F++  +G+
Sbjct  243   NLLSPAHTLLQIKCADQKGLFYDILRTSKDLNIQIAYGRISSSVKGYRNMDLFIRQTDGK  302

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             K++DP++Q +LC+ LK E+LHPLRV+++NRGPDTELLVANP+EL G GRPRVFYDVT AL
Sbjct  303   KVVDPKQQTALCFHLKEEMLHPLRVMVTNRGPDTELLVANPVELCGKGRPRVFYDVTLAL  362

Query  90    KTLGICIFSV  61
             K LGICIFS 
Sbjct  363   KALGICIFSA  372



>ref|XP_006436031.1| hypothetical protein CICLE_v10031651mg [Citrus clementina]
 gb|ESR49271.1| hypothetical protein CICLE_v10031651mg [Citrus clementina]
Length=407

 Score =   414 bits (1065),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 206/369 (56%), Positives = 265/369 (72%), Gaps = 5/369 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V++Q G+ P +P ++TVNC DK GLGC++CRIIL+FGL I +GD STDGRWCY+V+W
Sbjct  6     DDIVLVQLGSTPTEPSVVTVNCPDKNGLGCDLCRIILEFGLFIVRGDFSTDGRWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL--PSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P +S+  V W  LK+RL SVCP      Y   PS  +   S YL+   C+ R GLLHD
Sbjct  66    VVPDASSDKVDWESLKNRLLSVCPSILVSYYFNQPSSNSSKPSLYLLKYCCVDRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
              T+ L E E  I+RVKV+TTPD RVLD+F I D LELL+ K+++EE CE + AVLGE  I
Sbjct  126   ATKVLTELEFTIQRVKVMTTPDGRVLDLFFITDGLELLHTKQRREETCEHMIAVLGEYSI  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCE++L   GP YE+L  F++L P+V  ELF  EL + E   + LS +V + K SI T+D
Sbjct  186   SCEIQLA--GPEYESLQAFTSLPPAVAEELFGSELLDKEDFSRVLSTEVTQNKASI-TVD  242

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N LS AHTL+QI C D K   YDI R  K  N+QI Y R S++ KG R +D+F++  +G+
Sbjct  243   NLLSPAHTLLQIKCADQKGLFYDILRTSKDLNIQIAYGRISSSVKGYRNMDLFIRQTDGK  302

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             K++DP++Q +LC+ LK E+LHPLRV+++NRGPDTELLVANP+EL G GRPRVFYDVT AL
Sbjct  303   KVVDPKQQTALCFHLKEEMLHPLRVMVTNRGPDTELLVANPVELCGKGRPRVFYDVTLAL  362

Query  90    KTLGICIFS  64
             K LGICIFS
Sbjct  363   KALGICIFS  371



>ref|XP_009404607.1| PREDICTED: uncharacterized protein LOC103987882 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score =   413 bits (1062),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 207/369 (56%), Positives = 266/369 (72%), Gaps = 6/369 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+VVIQ   + G+P +ITVNC D+ GLGC++CR ILDFGL I +GD+STDG+WCY+V W
Sbjct  6     EDAVVIQAAKRAGEPTIITVNCPDQTGLGCDLCRAILDFGLCITRGDISTDGQWCYLVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHDV  808
             V P+ ++  + W  LK+RL S+CP  S   Y      P +S  YL+ L+ + R GLLHDV
Sbjct  66    VVPRPTSSNIQWPSLKNRLLSLCPSCSIPFYFDMVNRPTSSQIYLLKLFSVDRKGLLHDV  125

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T+ LCE EL I RVKV TTP+ RV+D F I D +ELL+ K +Q++LCE+L AVLGES  S
Sbjct  126   TKVLCELELTIHRVKVSTTPNGRVVDFFFITDAMELLHTKMRQDDLCERLNAVLGESVNS  185

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CE++L A G  ++    FS+L P V  ELF+ ELS NE     LSP++ +LKK+ V IDN
Sbjct  186   CEIEL-AEG--FQQ--GFSSLPPVVAEELFKLELSGNEVCSAILSPEMKRLKKADVNIDN  240

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
             +LS +HTL+QI CVD K  LYDI R LK C++Q+ Y RF +  KG RE+D+F+   +G+K
Sbjct  241   SLSPSHTLLQIHCVDQKGLLYDIMRTLKDCSIQVAYGRFLSDMKGSREVDLFILQSDGKK  300

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             I+DP+KQ  LC  LK+E+LHPLRV+I NRGPD EL VANP+EL G GRPRVFYDVT ALK
Sbjct  301   IVDPDKQGVLCSRLKLEMLHPLRVIIVNRGPDMELFVANPVELCGKGRPRVFYDVTLALK  360

Query  87    TLGICIFSV  61
              LGICIFS 
Sbjct  361   VLGICIFSA  369



>emb|CDX68360.1| BnaC01g24380D [Brassica napus]
Length=410

 Score =   413 bits (1061),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 211/377 (56%), Positives = 274/377 (73%), Gaps = 21/377 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+VVI+ G K G+P++ITVN  D+ GLGC+ICRI+LDFGL IKKGDV+TDG WCY+V+W
Sbjct  7     EDAVVIEKGKKAGEPHVITVNSPDRTGLGCDICRIVLDFGLYIKKGDVTTDGVWCYIVLW  66

Query  984   VFPQSSTPIVTWAK-LKDRLWSVCP--PYSNLIYLPSPKTPATSSYLMTLYCIGRTGLLH  814
             V P   + I+ W+  LK +L SVCP  P   L+ L SP    TS YL+  +C+ RTGLLH
Sbjct  67    VVPHYDSLILRWSHDLKTQLLSVCPSCPTYFLLNLMSPSPTPTSVYLLNFFCLDRTGLLH  126

Query  813   DVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESC  634
             DVTQ L E EL I+ VKV TTPD+RVLD+F I D+L+LL+ K++Q+E  EQ R+VLGESC
Sbjct  127   DVTQVLTELELSIQSVKVTTTPDERVLDLFFITDNLDLLHTKKRQDETLEQFRSVLGESC  186

Query  633   ISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKK-SIVT  457
             ISCELKL   GP YE      +LSP V  ELF  +             D++K+KK S VT
Sbjct  187   ISCELKLA--GPEYEYHQKIPSLSPEVAEELFMID-------------DMIKMKKNSSVT  231

Query  456   IDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKN  277
             +DN+LS +HTL+QI C D++  LYD+ R L   +  I+Y RF    +G R++++FVQ K+
Sbjct  232   VDNSLSPSHTLLQIRCADHRGLLYDVLRTLGDISQFISYGRFLPRTQGHRDIELFVQVKD  291

Query  276   GEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTF  97
              +KILDP+KQ+SLC  LK E+LHPLRV+I+NRGPDTEL+VANP+ELSG GRPRVFYDVT 
Sbjct  292   EKKILDPDKQSSLCLRLKAEMLHPLRVIITNRGPDTELVVANPVELSGKGRPRVFYDVTL  351

Query  96    ALKTLGICIFS--VRKW  52
             +LK LGIC+FS  +R++
Sbjct  352   SLKVLGICVFSAEIRRY  368



>ref|XP_009337600.1| PREDICTED: uncharacterized protein LOC103930033 isoform X3 [Pyrus 
x bretschneideri]
Length=404

 Score =   409 bits (1052),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 203/375 (54%), Positives = 268/375 (71%), Gaps = 13/375 (3%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVI+ G  P +P ++TVNC DK GLGC++CRIIL FGL+I KGD STDGRWCY+V+W
Sbjct  6     DDIVVIKPGKAPDEPSVLTVNCPDKAGLGCDLCRIILQFGLSITKGDFSTDGRWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP------YSNLIY-LPSPKTPATSSYLMTLYCIGRT  826
             V P   +  V W +LKDRL S CP       Y N I  +P+P    +  YL+ L+C  + 
Sbjct  66    VVPHHESLKVDWERLKDRLSSACPSSRFFSFYLNQISNVPTP----SPVYLLKLWCHDQR  121

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             G LHDVT+ LCE E+ I+RVKV+ TPD RVLD+F I D LELL+ K++++++CE L A L
Sbjct  122   GSLHDVTKVLCELEILIQRVKVMPTPDGRVLDLFFITDCLELLHTKQRRDDICEHLMAAL  181

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             GE CI+CELKL  PGP YE+L   S+L P++ +ELF  +L + E + + L+ ++  + K+
Sbjct  182   GEYCITCELKL--PGPEYESLQGNSSLPPAIADELFSYQLKDEEAYPKALTRNMGTVNKT  239

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              +T+DN+LS  HT++QI CVD     YDI R  K CN+QI Y RFS+  KG R LD+F+Q
Sbjct  240   SITVDNSLSPVHTVLQIQCVDRNGLFYDIMRTSKDCNIQIAYGRFSSPVKGFRNLDLFIQ  299

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               NGEK+LDPE Q +LC  LK E++HPLRV+++NRGP+TELLVANP+ELSG GRP VFY+
Sbjct  300   QTNGEKLLDPEVQVALCNHLKKEMVHPLRVIVANRGPETELLVANPVELSGKGRPLVFYN  359

Query  105   VTFALKTLGICIFSV  61
             VT ALK LG+ IF+ 
Sbjct  360   VTLALKQLGVSIFAA  374



>ref|XP_009337599.1| PREDICTED: uncharacterized protein LOC103930033 isoform X2 [Pyrus 
x bretschneideri]
Length=421

 Score =   410 bits (1054),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 203/375 (54%), Positives = 268/375 (71%), Gaps = 13/375 (3%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVI+ G  P +P ++TVNC DK GLGC++CRIIL FGL+I KGD STDGRWCY+V+W
Sbjct  6     DDIVVIKPGKAPDEPSVLTVNCPDKAGLGCDLCRIILQFGLSITKGDFSTDGRWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP------YSNLIY-LPSPKTPATSSYLMTLYCIGRT  826
             V P   +  V W +LKDRL S CP       Y N I  +P+P    +  YL+ L+C  + 
Sbjct  66    VVPHHESLKVDWERLKDRLSSACPSSRFFSFYLNQISNVPTP----SPVYLLKLWCHDQR  121

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             G LHDVT+ LCE E+ I+RVKV+ TPD RVLD+F I D LELL+ K++++++CE L A L
Sbjct  122   GSLHDVTKVLCELEILIQRVKVMPTPDGRVLDLFFITDCLELLHTKQRRDDICEHLMAAL  181

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             GE CI+CELKL  PGP YE+L   S+L P++ +ELF  +L + E + + L+ ++  + K+
Sbjct  182   GEYCITCELKL--PGPEYESLQGNSSLPPAIADELFSYQLKDEEAYPKALTRNMGTVNKT  239

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              +T+DN+LS  HT++QI CVD     YDI R  K CN+QI Y RFS+  KG R LD+F+Q
Sbjct  240   SITVDNSLSPVHTVLQIQCVDRNGLFYDIMRTSKDCNIQIAYGRFSSPVKGFRNLDLFIQ  299

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               NGEK+LDPE Q +LC  LK E++HPLRV+++NRGP+TELLVANP+ELSG GRP VFY+
Sbjct  300   QTNGEKLLDPEVQVALCNHLKKEMVHPLRVIVANRGPETELLVANPVELSGKGRPLVFYN  359

Query  105   VTFALKTLGICIFSV  61
             VT ALK LG+ IF+ 
Sbjct  360   VTLALKQLGVSIFAA  374



>ref|XP_009357700.1| PREDICTED: uncharacterized protein LOC103948398 [Pyrus x bretschneideri]
Length=421

 Score =   410 bits (1053),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 201/371 (54%), Positives = 263/371 (71%), Gaps = 5/371 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVIQ G  P +P ++T+NC DK GLGC++CRIIL FGL+I K D STDGRWCY+V+W
Sbjct  6     DDVVVIQPGKTPDEPSVLTLNCPDKAGLGCDLCRIILQFGLSITKADFSTDGRWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP---YSNLIYLPSPKTPATSSYLMTLYCIGRTGLLH  814
             V P   +  V W  LKDRL S CP    +S  +   S     +  YL+  +C  + G LH
Sbjct  66    VVPHHQSLKVDWESLKDRLSSACPSSCFFSFYVNQISNDPTPSPVYLLKFWCHNQRGSLH  125

Query  813   DVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESC  634
             DVT+ LCE E+ I+RVKV+ TPD RVLD+F I D LELL+ K++++++CE L A LGE C
Sbjct  126   DVTKVLCELEILIQRVKVMPTPDGRVLDLFFITDCLELLHTKQRRDDICEHLMAALGEYC  185

Query  633   ISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTI  454
             I+CELKL  PGP YE+L   S+L P++ +ELF  +L E E + + L+ ++  +KK+ +T+
Sbjct  186   ITCELKL--PGPEYESLQGNSSLPPALADELFSYQLKEEEAYPKALTRNMRTVKKTSITV  243

Query  453   DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNG  274
             DN+LS  HT++QI CVD K   YDI R  K CN+QI Y RFS+  KG R LD+F+Q  NG
Sbjct  244   DNSLSPVHTVLQIQCVDRKGLFYDIMRTSKDCNIQIAYGRFSSPVKGFRNLDLFIQQTNG  303

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
             +KI+DPE Q +LC  LK E++HPLRV+++NRGP+TELLVANP+ELSG GRP VFYDVT A
Sbjct  304   KKIVDPEVQVALCARLKEEMVHPLRVIVANRGPETELLVANPVELSGKGRPLVFYDVTLA  363

Query  93    LKTLGICIFSV  61
             LK LG  IF+ 
Sbjct  364   LKQLGASIFAA  374



>ref|XP_008371493.1| PREDICTED: uncharacterized protein LOC103434895 [Malus domestica]
Length=421

 Score =   410 bits (1053),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 202/375 (54%), Positives = 267/375 (71%), Gaps = 13/375 (3%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVIQ G  P +P ++T+NC DK GLGC++CRIIL FGL+I K D STDGRWCY+V+W
Sbjct  6     DDVVVIQPGKTPDEPSVLTLNCPDKAGLGCDLCRIILQFGLSITKADFSTDGRWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP------YSNLIY-LPSPKTPATSSYLMTLYCIGRT  826
             V P   +  V W  LKDRL S CP       Y N I  +P+P    +  YL+  +C  + 
Sbjct  66    VVPHHQSLKVDWESLKDRLSSACPSSCFFSFYVNQISDVPTP----SPVYLLKFWCHNQR  121

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             G LHDVT+ LCE E+ I+RVKV+ TPD RVLD+F I D LELL+ K++++++CE L A L
Sbjct  122   GSLHDVTKVLCELEIVIQRVKVMPTPDGRVLDLFFITDCLELLHTKQRRDDICEHLMAAL  181

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             GE CI+CELKL  PGP YE+L   S+L P++ +ELF  +L + E + + L+ ++  +KK+
Sbjct  182   GEYCITCELKL--PGPEYESLQGNSSLPPALADELFSYQLKDEEAYPKALTRNMRTVKKT  239

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              +T+DN+LS  HT++QI CVD K+  YDI R  K CN+Q+ Y RFS+  KG R LD+F+Q
Sbjct  240   SITVDNSLSPVHTVLQIQCVDRKALFYDIMRTSKDCNIQVAYGRFSSPVKGFRNLDLFIQ  299

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               NG+KI+DPE Q +LC  LK E++HPLRV+++NRGP+TELLVANP+ELSG GRP VFYD
Sbjct  300   QTNGKKIVDPEVQVALCARLKEEMVHPLRVIVANRGPETELLVANPVELSGKGRPLVFYD  359

Query  105   VTFALKTLGICIFSV  61
             VT ALK LG  IF+ 
Sbjct  360   VTLALKQLGASIFAA  374



>ref|XP_010503205.1| PREDICTED: uncharacterized protein LOC104780408 [Camelina sativa]
Length=422

 Score =   409 bits (1052),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/376 (54%), Positives = 277/376 (74%), Gaps = 7/376 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+VVI+ G K GD ++ITVNC DK GL C++CRIILDFGL   KGDV+TDG WCY+V+W
Sbjct  7     EDTVVIELGKKLGDAHVITVNCPDKTGLCCDVCRIILDFGLYTTKGDVTTDGVWCYIVLW  66

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSN--LIYLPSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P   +  + W+ LK++L SVCP  S+  ++ L S    +T  YL+  +C+ R GLLHD
Sbjct  67    VVPYYDSLRLRWSHLKNQLVSVCPSCSSYFVLDLMSSCPASTPVYLLKFFCLDRNGLLHD  126

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ L E EL I+ VKV  TPD RV+D+F I D+++LL+ +++QE+   + R+VLGESCI
Sbjct  127   VTRVLTELELSIQTVKVTKTPDGRVMDLFFITDNMDLLHTEKRQEDTRGKFRSVLGESCI  186

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCE-LSENETHLQELSPDVMKLKKSIVTI  454
             SCEL+L   GP YE      +LSP+V  ELF  E L++ +  +Q LS D++KLK S++T+
Sbjct  187   SCELQLA--GPEYECHQNIPSLSPAVAEELFTSEQLTDEDNRVQLLSDDMIKLKDSVITV  244

Query  453   DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNG  274
             DN LS AHTL+QI CVD++  LYD+ R LK   +++ Y RFS   +G R+LD+F+Q K+G
Sbjct  245   DNCLSPAHTLLQIRCVDHRGLLYDVLRTLKDFEIKMCYGRFSPQTQGHRDLDLFIQLKDG  304

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
              KI+DP+KQ SLC  LK E+LHPLRV+I+NRGP+TEL+VANP+ELSG GRPRVFYDVT +
Sbjct  305   NKIVDPDKQNSLCSRLKAEMLHPLRVIITNRGPETELMVANPVELSGKGRPRVFYDVTLS  364

Query  93    LKTLGICIFS--VRKW  52
             LK LGIC+FS  +R++
Sbjct  365   LKVLGICVFSAEIRRY  380



>ref|XP_009337598.1| PREDICTED: uncharacterized protein LOC103930033 isoform X1 [Pyrus 
x bretschneideri]
Length=436

 Score =   410 bits (1053),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 203/375 (54%), Positives = 268/375 (71%), Gaps = 13/375 (3%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVI+ G  P +P ++TVNC DK GLGC++CRIIL FGL+I KGD STDGRWCY+V+W
Sbjct  6     DDIVVIKPGKAPDEPSVLTVNCPDKAGLGCDLCRIILQFGLSITKGDFSTDGRWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP------YSNLIY-LPSPKTPATSSYLMTLYCIGRT  826
             V P   +  V W +LKDRL S CP       Y N I  +P+P    +  YL+ L+C  + 
Sbjct  66    VVPHHESLKVDWERLKDRLSSACPSSRFFSFYLNQISNVPTP----SPVYLLKLWCHDQR  121

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             G LHDVT+ LCE E+ I+RVKV+ TPD RVLD+F I D LELL+ K++++++CE L A L
Sbjct  122   GSLHDVTKVLCELEILIQRVKVMPTPDGRVLDLFFITDCLELLHTKQRRDDICEHLMAAL  181

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             GE CI+CELKL  PGP YE+L   S+L P++ +ELF  +L + E + + L+ ++  + K+
Sbjct  182   GEYCITCELKL--PGPEYESLQGNSSLPPAIADELFSYQLKDEEAYPKALTRNMGTVNKT  239

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              +T+DN+LS  HT++QI CVD     YDI R  K CN+QI Y RFS+  KG R LD+F+Q
Sbjct  240   SITVDNSLSPVHTVLQIQCVDRNGLFYDIMRTSKDCNIQIAYGRFSSPVKGFRNLDLFIQ  299

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               NGEK+LDPE Q +LC  LK E++HPLRV+++NRGP+TELLVANP+ELSG GRP VFY+
Sbjct  300   QTNGEKLLDPEVQVALCNHLKKEMVHPLRVIVANRGPETELLVANPVELSGKGRPLVFYN  359

Query  105   VTFALKTLGICIFSV  61
             VT ALK LG+ IF+ 
Sbjct  360   VTLALKQLGVSIFAA  374



>ref|XP_008366335.1| PREDICTED: uncharacterized protein LOC103429983 isoform X2 [Malus 
domestica]
Length=399

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 214/373 (57%), Positives = 264/373 (71%), Gaps = 31/373 (8%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVIQ G +PG+P +ITVNC DK GLGC+ICRIILDFGL I+K D STDG WCY V+W
Sbjct  6     DDVVVIQKGRRPGEPCIITVNCPDKTGLGCDICRIILDFGLLIEKADFSTDGIWCYXVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLH-  814
             VFP SS+P+V  + LK++L SVCP  S   YL    T ++SS  YL+T  C+ R GLLH 
Sbjct  66    VFPDSSSPVVKLSNLKNQLQSVCPSCSVPFYLYQQATRSSSSPVYLLTFLCLDRKGLLHG  125

Query  813   --DVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGE  640
               ++    C                     + +++D   LL+ KE+Q+E  +QLR VLGE
Sbjct  126   NGNLPHLHC---------------------LIVLRD---LLHTKERQDETIKQLRDVLGE  161

Query  639   SCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIV  460
             SCISCEL+LV  GP YE+L    +LSP V  ELFRCEL + ET  Q LSPD+ KLKK+ V
Sbjct  162   SCISCELQLV--GPEYESLHGIPSLSPVVAEELFRCELLDKETRSQALSPDMTKLKKTNV  219

Query  459   TIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHK  280
             T+DN+LS AHTL+QI C D+K  LYDI R LK CN++I Y R S   KG R+LD+F+Q  
Sbjct  220   TMDNSLSPAHTLLQIHCADHKGLLYDILRTLKDCNIKIAYGRISPNIKGYRDLDLFIQQN  279

Query  279   NGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVT  100
             +G+K +DP+KQ++L   LKVE+LHPLRV+I+NRGPDTELLVANP+ELSG GRPRVFYDVT
Sbjct  280   DGKKFVDPDKQSALYLRLKVEMLHPLRVIIANRGPDTELLVANPVELSGKGRPRVFYDVT  339

Query  99    FALKTLGICIFSV  61
              ALKTLGICIFS 
Sbjct  340   TALKTLGICIFSA  352



>ref|XP_010514916.1| PREDICTED: uncharacterized protein LOC104790830 [Camelina sativa]
Length=422

 Score =   408 bits (1049),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 202/376 (54%), Positives = 279/376 (74%), Gaps = 7/376 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+V+I+ G K GD ++ITVNC D+ GL C++CRI+LDFGL I KGDV+TDG WCY+V+W
Sbjct  7     EDTVMIELGKKLGDAHVITVNCPDRTGLCCDVCRILLDFGLYITKGDVTTDGVWCYIVLW  66

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSN--LIYLPSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P   +  + W+ LK++L SVCP  S+  ++ L S    +T  YL+  +C+ R GLLHD
Sbjct  67    VVPYYDSLRLRWSHLKNQLVSVCPSCSSYFVLDLVSSCPASTPVYLLKFFCLDRNGLLHD  126

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ L E EL I+ VKV TTPD RV+D+F I D+++LL+ +++QE+   + R+VLGESCI
Sbjct  127   VTRVLTELELSIQTVKVTTTPDGRVMDLFFITDNMDLLHTEKRQEDTRGKFRSVLGESCI  186

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCE-LSENETHLQELSPDVMKLKKSIVTI  454
             SCEL+L   GP YE      +LSP+V  ELF  E L++ +  +Q LS D++KLK S++T+
Sbjct  187   SCELQLA--GPEYECHQNIPSLSPAVAEELFSSEQLTDEDNRVQLLSDDMIKLKDSVITV  244

Query  453   DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNG  274
             DN LS AHTL+QI CVD++  LYD+ R LK   +++ Y RFS   +G R+LD+F+Q K+G
Sbjct  245   DNCLSPAHTLLQIRCVDHRGLLYDVLRTLKDFEIKMCYGRFSPETQGHRDLDLFIQLKDG  304

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
              KI++P+KQ SLC  LK E+LHPLRV+I+NRGP+TEL+VANP+ELSG GRPRVFYDVT +
Sbjct  305   NKIVNPDKQNSLCSRLKAEMLHPLRVIITNRGPETELMVANPVELSGKGRPRVFYDVTLS  364

Query  93    LKTLGICIFS--VRKW  52
             LK LGIC+FS  +R++
Sbjct  365   LKVLGICVFSAEIRRY  380



>ref|XP_006291198.1| hypothetical protein CARUB_v10017326mg [Capsella rubella]
 gb|EOA24096.1| hypothetical protein CARUB_v10017326mg [Capsella rubella]
Length=422

 Score =   408 bits (1048),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 202/376 (54%), Positives = 277/376 (74%), Gaps = 7/376 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+VVI+ G K GD ++ITVNC D+ GL C+ICRI+LDFGL I KGDV+TDG WCY+V+W
Sbjct  7     EDTVVIELGKKVGDAHVITVNCPDRTGLCCDICRIVLDFGLYITKGDVTTDGVWCYIVLW  66

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSN--LIYLPSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P   +  + W+ LK++L SVCP  S   ++ L S    +T  YL+  +C+ R GLLHD
Sbjct  67    VVPYYDSLRLRWSHLKNQLVSVCPSCSTYFVLNLMSSCPASTPVYLLKFFCLDRKGLLHD  126

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ L E EL I+ VKV TTPD RV+D+F I D+++LL+ +++QE+   + R+VLGE+CI
Sbjct  127   VTRVLTELELSIQTVKVTTTPDGRVMDLFFITDNMDLLHTEKRQEDTRGKFRSVLGEACI  186

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCE-LSENETHLQELSPDVMKLKKSIVTI  454
             SCEL+L   GP YE      +LSP+V  ELF  E L+  +  +Q L+ D++KLK S +T+
Sbjct  187   SCELQLA--GPEYECHQNIPSLSPAVAEELFTSEELTYEDNRVQLLTDDMIKLKDSTITV  244

Query  453   DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNG  274
             DN LS AHTL++ISCVD++  LYD+ R  K  +++++Y RFS   +G R+LD+F+Q K+G
Sbjct  245   DNRLSPAHTLLRISCVDHRGLLYDVLRTFKDFDIKMSYGRFSPQTQGHRDLDLFIQLKDG  304

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
              KI+DP+ Q SLC  LK E+LHPLRV+I+NRGPDTEL+VANP+E+SG GRPRVFYDVT +
Sbjct  305   NKIVDPDTQNSLCSRLKAEMLHPLRVIITNRGPDTELVVANPVEISGKGRPRVFYDVTLS  364

Query  93    LKTLGICIFS--VRKW  52
             LK LGICIFS  +R++
Sbjct  365   LKVLGICIFSAEIRRY  380



>ref|XP_008233594.1| PREDICTED: uncharacterized protein LOC103332625 [Prunus mume]
Length=421

 Score =   407 bits (1045),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 202/375 (54%), Positives = 261/375 (70%), Gaps = 13/375 (3%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVI+ G  P +P + TVNC DK GLGC++CRIIL FGL I KGD STDGRWCY+V+W
Sbjct  6     DDVVVIKEGKTPSEPSVATVNCPDKAGLGCDLCRIILQFGLCITKGDFSTDGRWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP-------YSNLIYLPSPKTPATSSYLMTLYCIGRT  826
             V P  S+  V W  LKDRL S CPP        S +  +P+P       YL+  +C  + 
Sbjct  66    VVPHHSSLKVDWESLKDRLSSACPPSCFFSFYLSQVSNVPTP----PPVYLLKFWCHDQR  121

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             G LHDVT+ LCE E+ I+RVKV+ TPD RVLD+F I D L+LL+ K++++ +CE L A L
Sbjct  122   GSLHDVTKVLCELEILIQRVKVMPTPDGRVLDLFFITDCLDLLHTKQRRDNICEHLMAAL  181

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             GE CI+CELKL  PGP YE+L   S+L P++  ELF  +L + E + + +S ++  +KK+
Sbjct  182   GEYCITCELKL--PGPEYESLQGNSSLPPAIAEELFSYQLKDEEAYPKAISSNMGAVKKA  239

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              +T+DN+LS  HT++QI CVD K  LYDI R  K CN+QI Y RFS+  KG R LD+F+Q
Sbjct  240   SITVDNSLSPVHTVLQIQCVDQKGLLYDILRTSKDCNIQIAYGRFSSTKKGFRNLDLFIQ  299

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G+KI DPE Q +LC  LK E++HPLRV+I+NRGPD ELLVANP+EL G GRP VFYD
Sbjct  300   QTDGKKIGDPESQVALCSRLKEEMVHPLRVIIANRGPDIELLVANPVELCGKGRPLVFYD  359

Query  105   VTFALKTLGICIFSV  61
             VT ALK L + IF+ 
Sbjct  360   VTLALKKLRVSIFAA  374



>ref|XP_010466563.1| PREDICTED: uncharacterized protein LOC104746737 [Camelina sativa]
Length=422

 Score =   405 bits (1041),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 203/377 (54%), Positives = 274/377 (73%), Gaps = 9/377 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+V+I+ G K GD ++ITVNC DK GL C++CRIILDFGL I KGDV+TDG WCY+V+W
Sbjct  7     EDTVMIELGKKLGDAHVITVNCPDKTGLCCDVCRIILDFGLYITKGDVTTDGVWCYIVLW  66

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLP-SPKTPA-TSSYLMTLYCIGRTGLLHD  811
             V P   +  + W+ LK++L SVCP  S    L   P  PA T  YL+  +C+ R GLL D
Sbjct  67    VVPYYDSLRLRWSHLKNQLVSVCPSCSTYFVLDLMPSCPASTPVYLLKFFCLDRNGLLQD  126

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ L E EL I+ VKV TTPD RV+D+F I D+++LL+ +++QE+   + R+VLGESCI
Sbjct  127   VTRVLTELELSIQTVKVTTTPDGRVMDLFFITDNMDLLHTEKRQEDTRGKFRSVLGESCI  186

Query  630   SCELKLVAPG-PLYENLPCFSALSPSVTNELFRCE-LSENETHLQELSPDVMKLKKSIVT  457
             SCEL+L  P    ++N+P   +LSP+V  ELF  E L++ +  +Q L+ D++KLK S + 
Sbjct  187   SCELQLAGPEYDCHQNIP---SLSPAVAEELFSSEQLTDEDNRVQLLTDDMIKLKDSAIA  243

Query  456   IDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKN  277
             +DN LS AHTL+QI CVD++  LYD+ R LK    ++ Y RFS   +G R+LD+F+Q K+
Sbjct  244   VDNCLSPAHTLLQIRCVDHRGLLYDVLRTLKDFETKMCYGRFSPQTQGHRDLDLFIQLKD  303

Query  276   GEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTF  97
             G KI+DP+KQ SLC  LK E+LHPLRV+I+NRGPDTEL+VANP+ELSG GRPRVFYDV  
Sbjct  304   GNKIVDPDKQNSLCSRLKAEMLHPLRVIITNRGPDTELMVANPVELSGKGRPRVFYDVNL  363

Query  96    ALKTLGICIFS--VRKW  52
             +LK LGIC+FS  +R++
Sbjct  364   SLKVLGICVFSAEIRRY  380



>emb|CDP00065.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   405 bits (1040),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 196/370 (53%), Positives = 261/370 (71%), Gaps = 4/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I++G   G+P ++ VNC DK GLGC++ RIIL+FGL + +GD STDG+WCY+V+W
Sbjct  7     DDIVLIEHGKNSGEPSVVKVNCPDKAGLGCDLTRIILEFGLYVTRGDFSTDGKWCYIVLW  66

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL--PSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P+ S+  + W  LK RL S CP    L Y    S  +P    YL+ ++C+ R GLLHD
Sbjct  67    VVPRPSSLKIDWESLKSRLLSACPSCLILSYFNQQSSCSPPPQVYLLKVFCLDRKGLLHD  126

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ LCE EL I++VKV+TTPD +VLD+F I D ++LL+ +E++ + C+ L  VLG+ CI
Sbjct  127   VTKLLCELELSIQKVKVMTTPDGKVLDLFFITDGMDLLHTQERRNKTCKHLGLVLGDYCI  186

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   GP Y     FS+LSP V  +LF C+LS  +   Q ++  V ++ K+ +T+D
Sbjct  187   SCELELA--GPEYVGQQDFSSLSPEVAEDLFSCKLSHKDACSQVVTSKVARVNKATITVD  244

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N LS AHTL+QI C D K  +YDI R  K  ++QI Y R S   KG R +D+F+Q ++G+
Sbjct  245   NVLSPAHTLLQIQCTDQKGLIYDILRTFKDLDIQIAYGRISPTAKGYRNMDLFIQKRDGK  304

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+  E Q +LC  LK E+LHPLRV I++RGPDTELLVANP+ELSG GRPRVFYDVTFAL
Sbjct  305   KIVGHESQVALCSHLKEEMLHPLRVTITSRGPDTELLVANPVELSGKGRPRVFYDVTFAL  364

Query  90    KTLGICIFSV  61
             KTLGICIFS 
Sbjct  365   KTLGICIFSA  374



>ref|XP_002283917.1| PREDICTED: uncharacterized protein LOC100256399 [Vitis vinifera]
 emb|CBI31701.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   404 bits (1038),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 202/368 (55%), Positives = 260/368 (71%), Gaps = 10/368 (3%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+IQ GNKPG+P  IT+NC DK GLGC++CRIIL+FGL I +GD STDGRWCY+V  
Sbjct  6     DDAVLIQKGNKPGEPCSITINCPDKAGLGCDLCRIILEFGLCIARGDFSTDGRWCYIVFS  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCP-PYSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHDV  808
               P  S+  + W  LK+RL S CP P  +  +     +  +  Y++ L+C+ R GLLHDV
Sbjct  66    FVPCPSSLKIDWESLKNRLLSACPSPLFSYCFNQQYGSSPSPVYMLKLFCLDRNGLLHDV  125

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T+ L E E  IERVKV+TTPD RVLD+F I D +ELL+ K++Q++ C +L AVLGE  + 
Sbjct  126   TKVLSELEFTIERVKVMTTPDGRVLDLFFITDGMELLHTKKRQDDTCARLLAVLGEFNVI  185

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CE++L   GP Y +    S+LSP +  ELF  EL +N++++        KL+   +T+DN
Sbjct  186   CEIQLA--GPEYRSQQGCSSLSPEIAEELFGSELLDNKSNM-------TKLENGTITVDN  236

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
              LS AHTL+QI C+D K   YDI R  K CN+QI Y RF+ + KG R +D+F+Q  +G+K
Sbjct  237   FLSPAHTLLQIQCLDQKGLFYDIMRTSKDCNIQIAYGRFNPSVKGYRNMDLFIQKTDGKK  296

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             I+DPE QASLC  LK E+LHPLRV I+NRGPD ELLVANP+ELSG GRPRVFYDVT  LK
Sbjct  297   IIDPEYQASLCSRLKEEMLHPLRVTITNRGPDAELLVANPVELSGKGRPRVFYDVTCTLK  356

Query  87    TLGICIFS  64
             TLGICIFS
Sbjct  357   TLGICIFS  364



>ref|XP_007218067.1| hypothetical protein PRUPE_ppa006240mg [Prunus persica]
 gb|EMJ19266.1| hypothetical protein PRUPE_ppa006240mg [Prunus persica]
Length=421

 Score =   404 bits (1039),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 200/375 (53%), Positives = 262/375 (70%), Gaps = 13/375 (3%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVI+ G  P +P ++TVNC DK GLGC++CRIIL FGL + KGD STDGRWCY+V+W
Sbjct  6     DDVVVIKEGKTPSEPSVVTVNCPDKAGLGCDLCRIILQFGLCVTKGDFSTDGRWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP------YSNLIY-LPSPKTPATSSYLMTLYCIGRT  826
             V P  S+  V W  LKDRL S CPP      Y N +  +P+P       YL+  +C  + 
Sbjct  66    VVPHHSSLKVDWESLKDRLSSACPPSCFFSFYLNQVSNVPTP----PPVYLLKFWCHDQR  121

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             G LHDVT+ LCE E+ I+RVKV+ TPD RVLD+F I D L+LL+ K++++ +CE L A L
Sbjct  122   GSLHDVTKILCELEILIQRVKVMPTPDGRVLDLFFITDCLDLLHTKQRRDNICEHLMAAL  181

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             GE CI+CELKL  PGP YE+L   S+L P++  ELF  +L + E + + LS ++  +KK+
Sbjct  182   GEYCITCELKL--PGPEYESLQGNSSLPPAIAEELFSYQLKDEEAYPKALSSNMGAVKKA  239

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              +T+DN+LS  HT++QI CVD K   YD+ R  K CN+QI Y RFS+  KG R LD+F++
Sbjct  240   SITVDNSLSPVHTVLQIECVDQKGLFYDVLRTSKDCNIQIAYGRFSSTKKGFRNLDLFIR  299

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G+KI DPE Q +LC  LK E++HPLRV+I+NRGPD ELLVANP+EL G GRP VFYD
Sbjct  300   QTDGKKIGDPESQVALCSRLKEEMVHPLRVIIANRGPDIELLVANPVELCGKGRPLVFYD  359

Query  105   VTFALKTLGICIFSV  61
             VT ALK L + IF+ 
Sbjct  360   VTLALKKLRVSIFAA  374



>ref|XP_009414313.1| PREDICTED: uncharacterized protein LOC103995444 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score =   404 bits (1037),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 204/368 (55%), Positives = 259/368 (70%), Gaps = 6/368 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVI+   + G+P ++TVNC D+ GLGC+ICR+IL+FGL I +GDVSTDGRWCYVV W
Sbjct  6     DDVVVIEVAKRAGEPSVVTVNCPDQTGLGCDICRVILEFGLCITRGDVSTDGRWCYVVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHDV  808
             V   S++  + W  LK+RL S+CP  S   Y      P ++  YL+ L+ + R GLLHDV
Sbjct  66    VVKLSASMNIQWENLKNRLMSICPSCSIPFYFDLVNPPTSAQVYLLKLFSVDRKGLLHDV  125

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             TQ LCE EL I  VKV TTPD RV+D+F I D +ELL+ KE+Q+E CE+L AVLGES   
Sbjct  126   TQVLCELELLIHWVKVSTTPDGRVVDLFFITDGMELLHTKERQDETCERLIAVLGESVNR  185

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CE++L       +     S+L P    ELF  EL ++E   Q LSPD+ KLKK+ V IDN
Sbjct  186   CEIQLAE-----DFQQGVSSLPPVAAEELFSLELCDDEFCSQALSPDMKKLKKANVNIDN  240

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
             +LS +HTL+QI CVD K  LYDI R LK C++QI Y RF +  KG RE+D+F+Q  +G+K
Sbjct  241   SLSPSHTLLQIHCVDQKGLLYDIMRTLKDCDIQIAYGRFLSDMKGSREVDLFIQQTDGKK  300

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             I+DP KQ  L   L++E+LHP+RV+I+NRGPD ELLVANP+E+SG GRP VFY VT ALK
Sbjct  301   IVDPVKQDILSRRLRLEMLHPMRVMIANRGPDIELLVANPVEMSGKGRPLVFYHVTLALK  360

Query  87    TLGICIFS  64
              LGICIFS
Sbjct  361   LLGICIFS  368



>ref|XP_010095038.1| hypothetical protein L484_026344 [Morus notabilis]
 gb|EXB58144.1| hypothetical protein L484_026344 [Morus notabilis]
Length=420

 Score =   403 bits (1036),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/386 (52%), Positives = 269/386 (70%), Gaps = 21/386 (5%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD +VIQ G   G+P ++TVNC D+ GLGC++CRIIL+FGL I KGD STDGRWCY+V+W
Sbjct  6     DDVIVIQPGKSAGEPSVLTVNCPDQAGLGCDLCRIILEFGLCITKGDFSTDGRWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL------PSPKTPATSSYLMTLYCIGRTG  823
             V P  S+  V W  LK RL S+CP  +  +YL      PSP    +  YL+    +   G
Sbjct  66    VAPNPSSLKVDWESLKSRLVSICPSCAFPVYLNQHSNNPSP----SPVYLLKFLYLDWKG  121

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHDVT+ LCE EL I+RVK + TPD +VLD+F + D +ELL+ K +++ +CE L A LG
Sbjct  122   LLHDVTKVLCELELIIQRVKAMPTPDGKVLDLFFVTDCMELLHTKLRRDAICEHLMAALG  181

Query  642   ESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSI  463
             + CI+CE++L   GP YE L  +S+L+P++ +ELF  ELS++E  LQ LSPD    K + 
Sbjct  182   DYCIACEIQLA--GPEYEGLQGYSSLAPAIADELFGYELSDSEARLQALSPDTKLRKTAT  239

Query  462   VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQH  283
             +T+DN LS +HTL+ I CVD K   YDI R  K  N++I Y RF++  +G R++D+F+Q 
Sbjct  240   ITVDNLLSPSHTLLHIECVDQKGLFYDILRTSKDYNIRIAYGRFTSNVEGFRKIDLFIQQ  299

Query  282   KNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDV  103
              +G+K+LDPE Q +LC  LK ++++P+RV+I+NRGPDTELLVANP+ELSG GRPRVFYDV
Sbjct  300   TDGKKVLDPESQTALCSRLKEDMINPVRVIIANRGPDTELLVANPVELSGNGRPRVFYDV  359

Query  102   TFALKTLGICIFS---------VRKW  52
             T ALK LGI IFS         VR+W
Sbjct  360   TLALKMLGIFIFSAEIVRHTTPVRQW  385



>ref|XP_004239778.1| PREDICTED: uncharacterized protein LOC101260344 [Solanum lycopersicum]
Length=419

 Score =   403 bits (1036),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 199/370 (54%), Positives = 258/370 (70%), Gaps = 5/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I++  K G+P  ITVNC DK GLGC++CRI+L+FGL + +GD +TDG+WCY+V+W
Sbjct  6     DDVVLIEHRGKTGEPTSITVNCPDKAGLGCDLCRIVLEFGLYVTRGDFATDGKWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--YLMTLYCIGRTGLLHD  811
             V P+ S+  V W  LK+RL S CP      YL    T +     YL+ ++C+ R GLLHD
Sbjct  66    VVPRPSSLKVDWGSLKNRLMSTCPSCMISFYLNQQSTASAPPPVYLLKVFCLDRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ LCE EL I+RVKV TTPDD+VLD+F I D ++LL+ K++++E CE L  VLGE CI
Sbjct  126   VTKVLCELELTIQRVKVTTTPDDKVLDLFFITDCMDLLHTKQRRDETCEHLSNVLGEYCI  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   GP  E    F++L   V  ELF CELS+    +   S D  KLKK+ +T+D
Sbjct  186   SCELQL--SGPECEVQQGFASLPQEVAEELFSCELSKEAVPMSSAS-DTAKLKKATITVD  242

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N LS  HTL+QI CVD K+ +YDI R  K C++QI + R  +  KG R +D+F+Q  +G+
Sbjct  243   NLLSPVHTLLQIQCVDQKALIYDILRTSKDCDIQIAFGRIQSTAKGYRTIDLFIQTTDGK  302

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+D E   SLC  LK E+LHPLRV + +RGPDTELLVANP+EL G GRPRVFYDVT AL
Sbjct  303   KIIDDENIKSLCSRLKEEMLHPLRVTVGSRGPDTELLVANPVELCGKGRPRVFYDVTIAL  362

Query  90    KTLGICIFSV  61
             K LGIC+FS 
Sbjct  363   KELGICVFSA  372



>ref|XP_010534491.1| PREDICTED: uncharacterized protein LOC104810025 isoform X1 [Tarenaya 
hassleriana]
Length=415

 Score =   402 bits (1034),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 203/372 (55%), Positives = 260/372 (70%), Gaps = 11/372 (3%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + +D+V+IQ G  PGDP ++TVNC D+ GLGC++CRIIL+FGL+I + D STDGRWCY+V
Sbjct  4     LNEDAVLIQPGKLPGDPCVVTVNCPDQAGLGCDLCRIILEFGLSITRADFSTDGRWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL-PSPKTPATSS-YLMTLYCIGRTGLL  817
              WV PQ S+  + W  LK+RL S CP Y    Y       P+  S YL+  YC  R GLL
Sbjct  64    FWVTPQLSSHKIDWDSLKNRLLSNCPSYLGAFYFCQQSNVPSRPSVYLLKFYCRDRKGLL  123

Query  816   HDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDH-LELLNIKEKQEELCEQLRAVLGE  640
             HDVT+ L E E  I+RVKV+TTPD RVLD+F I D  + LL+ K++Q + C  L AVLGE
Sbjct  124   HDVTKVLTELEFTIQRVKVMTTPDGRVLDLFFITDDAINLLHTKQRQVDTCNHLTAVLGE  183

Query  639   SCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIV  460
               +SCEL+L   GP YE++  FS+L P+V +ELF    S      +  S D     K+++
Sbjct  184   HGVSCELELA--GPEYESVQGFSSLPPAVAHELFG---SSEPADTEIASSDT---NKAVI  235

Query  459   TIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHK  280
             T+DN LS  HTL+QI CVD K   YDI R  K CN+QI+Y RF++  KG R +D+F+Q K
Sbjct  236   TVDNQLSPVHTLLQIQCVDQKGLFYDILRTSKDCNIQISYGRFASKIKGDRNMDLFIQTK  295

Query  279   NGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVT  100
             +G+KILD + QA+LC  LK E++HPL+V I NRGPDTELL+ANP+ELSG GRPRVFYDVT
Sbjct  296   DGKKILDGKHQANLCARLKQEMVHPLKVTILNRGPDTELLIANPVELSGKGRPRVFYDVT  355

Query  99    FALKTLGICIFS  64
              ALKTLGIC+FS
Sbjct  356   LALKTLGICVFS  367



>ref|XP_004487025.1| PREDICTED: uncharacterized protein LOC101513308 isoform X2 [Cicer 
arietinum]
Length=404

 Score =   399 bits (1025),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 206/369 (56%), Positives = 265/369 (72%), Gaps = 22/369 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+V IQ+GN P DP++IT+NC DK GLGC++CR ILDFGL I KG              
Sbjct  10    NDAVQIQHGNNPDDPFIITINCPDKTGLGCDLCRFILDFGLCILKG-------------V  56

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHDVT  805
             + P      +  + LKDRL ++CPP     YL      ++  YL+   C+ R GLLHDVT
Sbjct  57    LLP------INCSYLKDRLRAICPPCLASFYLVHKPKTSSPLYLLKFCCLDRKGLLHDVT  110

Query  804   QFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCISC  625
             + LCE EL I+R+KV TTPD +VLD+F I D+LELL+ +++Q+E C++L AVLG+SCI C
Sbjct  111   KVLCELELTIQRLKVTTTPDSKVLDLFFITDNLELLHTRKRQDETCKRLNAVLGDSCIIC  170

Query  624   ELKLVAPGPLYE-NLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             EL+L   G  YE N     +LSP +  ELF+CELS+N+   Q LS D+ KLKKS VT+DN
Sbjct  171   ELQLA--GSEYEYNHGHGISLSPMLAKELFQCELSDNQVRSQALSSDMKKLKKSNVTVDN  228

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
             +LS  HTL+QI CVD+K  LYDI R LK  N++I+Y RFS   KG R+LD+F+Q K+G+K
Sbjct  229   SLSPVHTLLQIRCVDHKGLLYDIMRTLKDMNLKISYGRFSPNAKGCRDLDIFIQQKDGKK  288

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             ILD EKQ++LC  LK+E+LHPLRV+I++RGPDTELLVANP+ELSG GRPRVFYDVT ALK
Sbjct  289   ILDHEKQSALCSRLKLEMLHPLRVIIADRGPDTELLVANPVELSGKGRPRVFYDVTLALK  348

Query  87    TLGICIFSV  61
             TLGIC+FS 
Sbjct  349   TLGICVFSA  357



>ref|XP_006345943.1| PREDICTED: uncharacterized protein LOC102604712 [Solanum tuberosum]
Length=419

 Score =   399 bits (1024),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 198/370 (54%), Positives = 258/370 (70%), Gaps = 5/370 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I++  K  +P  ITVNC DK GLGC++CRI+L+FGL + +GD +TDG+WCY+V+W
Sbjct  6     DDVVLIEHRGKSDEPTSITVNCPDKAGLGCDLCRIVLEFGLYVTRGDFATDGKWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPAT--SSYLMTLYCIGRTGLLHD  811
             V P+ S+  V W  LK+RL S CP      YL    T +   S YL+ ++C+ R GLLHD
Sbjct  66    VVPRPSSLKVDWGSLKNRLMSSCPSCMISFYLNQQSTASAPPSVYLLEVFCLDRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ LCE EL I+RVKV+TTPDD+VLD+F I D ++LL+ K++++E CE L  VLGE CI
Sbjct  126   VTKILCELELTIQRVKVMTTPDDKVLDLFFITDCMDLLHTKQRRDETCEHLSNVLGEYCI  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   GP  E    F++L   V  ELF CELS+    +   S D  KLKK+ +T+D
Sbjct  186   SCELQL--SGPECEVQHGFTSLPQEVAEELFSCELSKEAVPMSSAS-DTAKLKKATITVD  242

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N LS  HTL+QI CVD K  +YDI +  K C+++I + R  +  KG R +D+F+Q  +G+
Sbjct  243   NLLSPVHTLLQIQCVDQKGLIYDILKTSKDCDIRIAFGRIQSTAKGYRTIDLFIQTTDGK  302

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+D E    LC  LK E+LHPLRV + +RGPDTELLVANP+ELSG GRPRVFYDVT AL
Sbjct  303   KIIDDENIKFLCSRLKEEMLHPLRVTVGSRGPDTELLVANPVELSGKGRPRVFYDVTIAL  362

Query  90    KTLGICIFSV  61
             K LGICIFS 
Sbjct  363   KELGICIFSA  372



>gb|EPS62989.1| hypothetical protein M569_11799 [Genlisea aurea]
Length=399

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 208/370 (56%), Positives = 256/370 (69%), Gaps = 25/370 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+VVI+ G KPGDPYMITVNC DK GLGC+IC  IL+FGL I KGD+STDG+WCYVV+W
Sbjct  6     DDAVVIEKGKKPGDPYMITVNCPDKTGLGCDICHTILEFGLYITKGDLSTDGKWCYVVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHDVT  805
             V P+ S   V W  L++RL SVCP      YLP P    +  YL+    + R GLLHDVT
Sbjct  66    VIPRESD--VMWMNLRERLLSVCPSTVPTFYLPKPCPSPSPIYLLKFCALDREGLLHDVT  123

Query  804   QFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI-S  628
             + L + EL IERVKV TTPD  VLD+F I+D L LL+   +QE+ CE+LR+VLGESCI S
Sbjct  124   RVLLQLELTIERVKVSTTPDGHVLDLFFIQDDLGLLHKACRQEQTCERLRSVLGESCIIS  183

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFR-CELSENETHLQELSPDVMKLKKSIVTID  451
             CE++    G L+      S++SPSV ++LF  C       H             +++ ID
Sbjct  184   CEIQ--QYGTLHH-----SSISPSVAHQLFTLCSEFNTSNH------------NTLLQID  224

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAA--NKGQRELDVFVQHKN  277
             N LS AHTL+QISCVD K FLYDI R LK  N+QI+Y R S +  +   R+LD+F+QH +
Sbjct  225   NTLSPAHTLLQISCVDSKGFLYDIMRTLKDYNIQISYGRLSHSTTSHAHRDLDLFIQHAD  284

Query  276   GEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTF  97
             G K++DP+K  +LC  L  ELLHPLRV+I+ RGPDTEL VANP+EL G GRPRVFYDVTF
Sbjct  285   GNKVVDPQKHQALCSRLNTELLHPLRVLITTRGPDTELFVANPVELCGRGRPRVFYDVTF  344

Query  96    ALKTLGICIF  67
             ALKTLGICIF
Sbjct  345   ALKTLGICIF  354



>ref|XP_007009386.1| ACT domain-containing protein [Theobroma cacao]
 gb|EOY18196.1| ACT domain-containing protein [Theobroma cacao]
Length=495

 Score =   400 bits (1029),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 199/379 (53%), Positives = 266/379 (70%), Gaps = 13/379 (3%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ    P +P ++TVNC DK GLGC++CRIIL+FGL+I + D STDGRWCY+V W
Sbjct  72    DDVVLIQLPKGPSEPTVVTVNCPDKPGLGCDLCRIILEFGLSIARADFSTDGRWCYIVFW  131

Query  984   VFPQ-SSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPK----------TPATSSYLMTLYC  838
             + P  S++  + W  LK+RL S+CP      Y  + +          T ++S YL+ L C
Sbjct  132   LVPNVSNSSRIDWESLKNRLVSICPSCLLPFYYFNQQGGDGNGNQNSTLSSSVYLLKLCC  191

Query  837   IGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQL  658
             + R GLL+DVT+ L E E  I++VKV+TTPD RV+D+F I D +ELL+ K+++++    L
Sbjct  192   LDRKGLLNDVTKILSELEFTIQKVKVMTTPDGRVVDLFYITDGMELLHTKQRRDDTTAHL  251

Query  657   RAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMK  478
               VLG+ CISCEL+L   GP YE++  FS+L P+V  ELF  EL++ E   +EL  D+M 
Sbjct  252   ITVLGKYCISCELQLA--GPEYESMKAFSSLPPAVAEELFSYELADKEASSKELKADLMA  309

Query  477   LKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELD  298
             LKK+ VTIDN LS  HTL+QI CVD K   YDI R  K C++QI Y RFS++ +G R +D
Sbjct  310   LKKATVTIDNQLSPVHTLLQIQCVDQKGLFYDILRTSKDCDIQIAYGRFSSSLRGYRNMD  369

Query  297   VFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPR  118
             +F++  +G+KI+DP+ Q +LC  LK E+LHP R++I NRGPDTELLVANP+ELSG GRPR
Sbjct  370   LFIRQADGKKIVDPKHQTALCSRLKEEMLHPFRLLIVNRGPDTELLVANPVELSGKGRPR  429

Query  117   VFYDVTFALKTLGICIFSV  61
             VF+DVT ALK LGICIFS 
Sbjct  430   VFHDVTLALKMLGICIFSA  448



>ref|XP_004307534.1| PREDICTED: uncharacterized protein LOC101293138 [Fragaria vesca 
subsp. vesca]
Length=423

 Score =   397 bits (1021),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 191/369 (52%), Positives = 259/369 (70%), Gaps = 5/369 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D V+IQ G  PGDP ++TVNC D+ GLGC++CRI+L FGL I KGD +TDGRWCY+V+W
Sbjct  8     EDVVIIQQGKSPGDPTVVTVNCPDEPGLGCDLCRIVLQFGLCISKGDFTTDGRWCYIVLW  67

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP---YSNLIYLPSPKTPATSSYLMTLYCIGRTGLLH  814
             V P  S+  V W  LK+RL S CP    Y   + + +     +  YL+  +C  + G LH
Sbjct  68    VVPNESSMKVDWDSLKERLLSACPSSCFYKVYLNIQTSAPSPSPVYLLKFWCFDQRGSLH  127

Query  813   DVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESC  634
             DVT+ LCE E+ I+RVKV+ TPD RVLD+F I D L+LL+ +E+++ +CE L A LGE C
Sbjct  128   DVTKVLCELEILIQRVKVMPTPDGRVLDLFFITDCLDLLHTQERRDHICEHLMAALGEYC  187

Query  633   ISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTI  454
             I+CE++L   GP YE+L    +L  ++  ELF    ++++   + LSP    LK + + +
Sbjct  188   ITCEVQLA--GPEYESLQGNYSLPSAIAEELFSYLPTDDKASSKALSPSSATLKNTSIMV  245

Query  453   DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNG  274
             DN LS  HTL++I CVD K   YDI R  K CN+QI+Y RFS+  KG R L++F+QHK+G
Sbjct  246   DNTLSPVHTLLKIQCVDQKGLFYDILRTSKDCNIQISYGRFSSTVKGIRNLELFIQHKDG  305

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
             +KILDPE+Q +LC  LK ++LHPLRV+++N+GPDTELLVANP+ELSG GRP VF+DVT A
Sbjct  306   KKILDPERQVALCSRLKEQMLHPLRVIVANKGPDTELLVANPVELSGKGRPLVFHDVTLA  365

Query  93    LKTLGICIF  67
             LK LG+ IF
Sbjct  366   LKKLGLSIF  374



>ref|XP_008343544.1| PREDICTED: uncharacterized protein LOC103406326 [Malus domestica]
Length=421

 Score =   395 bits (1016),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 195/371 (53%), Positives = 258/371 (70%), Gaps = 5/371 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVI+ G  P +P ++TVNC DK GLGC++C IIL FGL+I KGD STDGRWCY+V+W
Sbjct  6     DDIVVIKPGKAPDEPSVLTVNCPDKAGLGCDLCXIILQFGLSITKGDFSTDGRWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNL-IYLPSPKTPATSS--YLMTLYCIGRTGLLH  814
             V P   +  V W +LKDRL S CP       YL       T S  YL+  +C  + G LH
Sbjct  66    VVPHHESLKVDWERLKDRLSSACPSSCFFSFYLNQFSNVPTPSPVYLLKFWCHDQRGSLH  125

Query  813   DVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESC  634
             DVT+ LCE E+ I+RVKV+ TPD RVLD+F I D LELL+ K++++++CE L A LGE C
Sbjct  126   DVTKVLCELEILIQRVKVMPTPDGRVLDLFFITDCLELLHTKQRRDDICEHLMAALGEYC  185

Query  633   ISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTI  454
             I+CELKL  PGP YE+L   S+L P++ +ELF  +L + E + +    ++  + K+ +T+
Sbjct  186   ITCELKL--PGPEYESLQGNSSLPPAIADELFSYQLKDXEAYPKAJXQNMGTVNKTSITV  243

Query  453   DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNG  274
             DN+LS  HT++QI CVD     YDI R  K CN+QI Y RFS+  KG R LD+F+Q  NG
Sbjct  244   DNSLSPXHTVLQIQCVDRNGLFYDIMRTSKDCNIQIAYGRFSSPVKGFRNLDLFIQQTNG  303

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
             +K++D   Q +LC  LK E++HPLRV+++NRGP+TELLVANP+ELSG GRP VFY+VT A
Sbjct  304   KKLVDXXXQVALCNHLKEEMVHPLRVIVANRGPETELLVANPVELSGKGRPLVFYNVTLA  363

Query  93    LKTLGICIFSV  61
             LK LG+ IF+ 
Sbjct  364   LKQLGVSIFAA  374



>gb|EEC78396.1| hypothetical protein OsI_18182 [Oryza sativa Indica Group]
Length=457

 Score =   396 bits (1018),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 196/369 (53%), Positives = 260/369 (70%), Gaps = 7/369 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+VV+Q     G   +IT+NC D+ GLGC++CR IL+FGL I +GDVSTDG+WC+VV W
Sbjct  31    EDAVVMQVAGAEGQDSVITINCPDQAGLGCDLCRTILEFGLRITRGDVSTDGQWCFVVFW  90

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHDV  808
             V P++ +  V WA LK+RL S+CP    + + P    P  S  YL+ L+   R GLLHDV
Sbjct  91    VVPRTPSIKVRWANLKNRLMSMCPSNYPMTFYPEITQPGPSQFYLLKLFSADRKGLLHDV  150

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T  L E EL I RVKV TTPD RV+D+F I D +ELL+ KE+QEE C  L A LG S IS
Sbjct  151   THILSELELIIHRVKVSTTPDGRVIDLFFITDGMELLHTKERQEETCSMLIATLGPS-IS  209

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CE+ L+A G  ++    FS+L P+++ ELFR EL++ +   + +  ++ +++K+ +  DN
Sbjct  210   CEI-LLAEG--FQQ--GFSSLPPTISEELFRLELADGDNCSRSICAEMKRVQKATINFDN  264

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
              LS AHTL+QI+C D K  LYDI R +K C++Q+TY RF +  KG RE+D+F++  +G+K
Sbjct  265   TLSPAHTLLQINCADQKGLLYDILRTMKDCSIQVTYGRFWSDKKGFREVDLFIKQADGKK  324

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             I+DPEKQ  L   L+ E+LHPLRV+I NRGPD ELLVANP+ELSG GRPRVFYD TFALK
Sbjct  325   IIDPEKQDVLSSRLRSEMLHPLRVMIVNRGPDVELLVANPVELSGKGRPRVFYDATFALK  384

Query  87    TLGICIFSV  61
              LGICIFS 
Sbjct  385   ALGICIFSA  393



>gb|EEE62089.1| hypothetical protein OsJ_16873 [Oryza sativa Japonica Group]
Length=443

 Score =   395 bits (1016),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 196/369 (53%), Positives = 260/369 (70%), Gaps = 7/369 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+VV+Q     G   +IT+NC D+ GLGC++CR IL+FGL I +GDVSTDG+WC+VV W
Sbjct  31    EDAVVMQVAGAEGQDSVITINCPDQAGLGCDLCRTILEFGLRITRGDVSTDGQWCFVVFW  90

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHDV  808
             V P++ +  V WA LK+RL S+CP    + + P    P  S  YL+ L+   R GLLHDV
Sbjct  91    VVPRTPSIKVRWANLKNRLMSMCPSNYPMTFYPEITQPGPSQFYLLKLFSADRKGLLHDV  150

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T  L E EL I RVKV TTPD RV+D+F I D +ELL+ KE+QEE C  L A LG S IS
Sbjct  151   THILSELELIIHRVKVSTTPDGRVIDLFFITDGMELLHTKERQEETCSMLIATLGPS-IS  209

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CE+ L+A G  ++    FS+L P+++ ELFR EL++ +   + +  ++ +++K+ +  DN
Sbjct  210   CEI-LLAEG--FQQ--GFSSLPPTISEELFRLELADGDNCSRSICAEMKRVQKATINFDN  264

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
              LS AHTL+QI+C D K  LYDI R +K C++Q+TY RF +  KG RE+D+F++  +G+K
Sbjct  265   TLSPAHTLLQINCADQKGLLYDILRTMKDCSIQVTYGRFWSDKKGFREVDLFIKQADGKK  324

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             I+DPEKQ  L   L+ E+LHPLRV+I NRGPD ELLVANP+ELSG GRPRVFYD TFALK
Sbjct  325   IIDPEKQDVLSSRLRSEMLHPLRVMIVNRGPDVELLVANPVELSGKGRPRVFYDATFALK  384

Query  87    TLGICIFSV  61
              LGICIFS 
Sbjct  385   ALGICIFSA  393



>gb|KHN13889.1| hypothetical protein glysoja_016173 [Glycine soja]
Length=419

 Score =   395 bits (1014),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 199/372 (53%), Positives = 253/372 (68%), Gaps = 9/372 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVIQ G    +P ++TVNC DK GLGC++CRIIL+FGL I + D+STDGRWCY+V W
Sbjct  6     DDVVVIQQGKDHNEPCIVTVNCPDKAGLGCDLCRIILEFGLRITRADISTDGRWCYIVYW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP----YSNLIYLPSPKTPATSSYLMTLYCIGRTGLL  817
             V    ++  V W  LK RL S CP     Y    +  SP  P    YL+ ++C+ + GLL
Sbjct  66    VLAHPASLNVDWESLKTRLLSACPSCLLSYHFNQHSTSPSPPPI--YLLKVWCVDQKGLL  123

Query  816   HDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGES  637
             HD+ + LC  EL I+RVK + TPD RVLD+F I D +ELL+ K++Q+ +CE L   LGE 
Sbjct  124   HDINEILCNLELIIQRVKAMPTPDGRVLDMFFITDGMELLHTKKRQDYVCEYLMDALGER  183

Query  636   CISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVT  457
             CIS EL+L   GP Y +L  FS+L P+   ELF  EL  ++  L  LS D+  LK   VT
Sbjct  184   CISSELQLA--GPEYGHLQGFSSLPPAFAEELFSSELL-DKLSLHPLSQDMTTLKTPTVT  240

Query  456   IDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKN  277
             +DN+LS  HTL+QI CVD K   YDI R  K  ++++ + RFS++ KG R +D+FVQH +
Sbjct  241   VDNSLSPVHTLLQIQCVDQKGLCYDIMRISKDSDIKVAFGRFSSSVKGFRNIDLFVQHND  300

Query  276   GEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTF  97
             G+KI+DPE Q +LC CLK E+LHPLRV I NRGPDTELLVANP+ELSG GRPRVFYDVT 
Sbjct  301   GKKIIDPESQKTLCSCLKEEMLHPLRVTIVNRGPDTELLVANPVELSGKGRPRVFYDVTL  360

Query  96    ALKTLGICIFSV  61
              LK LG+ IFS 
Sbjct  361   TLKALGVGIFSA  372



>ref|NP_001054453.1| Os05g0113000 [Oryza sativa Japonica Group]
 gb|AAS75239.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16367.1| Os05g0113000 [Oryza sativa Japonica Group]
 dbj|BAG90256.1| unnamed protein product [Oryza sativa Japonica Group]
Length=458

 Score =   395 bits (1016),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 198/371 (53%), Positives = 262/371 (71%), Gaps = 8/371 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKG-DVSTDGRWCYVVM  988
             +D+VV+Q     G   +IT+NC D+ GLGC++CR IL+FGL I +G DVSTDG+WC+VV 
Sbjct  31    EDAVVMQVAGAEGQDSVITINCPDQAGLGCDLCRTILEFGLRITRGADVSTDGQWCFVVF  90

Query  987   WVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHD  811
             WV P++ +  V WA LK+RL S+CP    + + P    P  S  YL+ L+   R GLLHD
Sbjct  91    WVVPRTPSIKVRWANLKNRLMSMCPSNYPMTFYPEITQPGPSQFYLLKLFSADRKGLLHD  150

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT  L E EL I RVKV TTPD RV+D+F I D +ELL+ KE+QEE C  L A LG S I
Sbjct  151   VTHILSELELIIHRVKVSTTPDGRVIDLFFITDGMELLHTKERQEETCSMLIATLGPS-I  209

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCE+ L+A G  ++    FS+L P+++ ELFR EL++ +   + +  ++ +++K+ +  D
Sbjct  210   SCEI-LLAEG--FQQ--GFSSLPPTISEELFRLELADGDNCSRSICAEMKRVQKATINFD  264

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N LS AHTL+QI+C D K  LYDI R +K C++Q+TY RF +  KG RE+D+F++  +G+
Sbjct  265   NTLSPAHTLLQINCADQKGLLYDILRTMKDCSIQVTYGRFWSDKKGFREVDLFIKQADGK  324

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+DPEKQ  L   L+ E+LHPLRV+I NRGPD ELLVANP+ELSG GRPRVFYD TFAL
Sbjct  325   KIIDPEKQDVLSSRLRSEMLHPLRVMIVNRGPDVELLVANPVELSGKGRPRVFYDATFAL  384

Query  90    KTLGICIFSVR  58
             K LGICIFSVR
Sbjct  385   KALGICIFSVR  395



>ref|XP_002528441.1| amino acid binding protein, putative [Ricinus communis]
 gb|EEF33924.1| amino acid binding protein, putative [Ricinus communis]
Length=420

 Score =   394 bits (1011),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 196/375 (52%), Positives = 254/375 (68%), Gaps = 7/375 (2%)
 Frame = -2

Query  1173  SMP--DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWC  1000
              MP  DD V+I+     GDP ++TVNC D+ GLGC++CRIIL+FGL+I + D STDGRWC
Sbjct  2     GMPSSDDVVLIEPAKNSGDPTVVTVNCPDQAGLGCDLCRIILEFGLSISRADFSTDGRWC  61

Query  999   YVVMWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL--PSPKTPATSSYLMTLYCIGRT  826
             Y+V WV P S++  V W  LK+RL    PP     Y    S  T   S YL+    + R 
Sbjct  62    YIVFWVVPHSTSHKVNWDSLKNRLSCASPPCLGPFYFDQKSNVTSVPSLYLLKFCFVDRK  121

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDV + L E E  I+RVKV+TTPD +V+D+F I D L+LL+ ++++ + C  L +V 
Sbjct  122   GLLHDVAKILTELEFTIQRVKVMTTPDGKVVDLFFITDGLDLLHTEKRRSDTCRHLASVF  181

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
              E CISCEL+L   GP YE+L  FS+L   +  ELF CE  E +T  Q L  D +   K+
Sbjct  182   KECCISCELQLA--GPEYESLQAFSSLPLPIAEELFSCEQLEEKTCSQALCTDTIA-DKA  238

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              VT+DN +S AHTL+Q+ C+D K   YDI R  K CN+++ Y RFS++ KG R +D+F+Q
Sbjct  239   TVTVDNNMSPAHTLLQLKCIDQKGLFYDILRTSKDCNIRVAYGRFSSSLKGYRNMDLFIQ  298

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G+KI+DP+ Q  LC  LK E+L P RV+I+NRGPDTELLVANP+ELSG GRPRVFYD
Sbjct  299   QTDGKKIMDPKHQLMLCSRLKAEMLRPFRVIIANRGPDTELLVANPVELSGKGRPRVFYD  358

Query  105   VTFALKTLGICIFSV  61
             VT ALKTLGICIFS 
Sbjct  359   VTLALKTLGICIFSA  373



>ref|NP_001242111.1| uncharacterized protein LOC100787003 [Glycine max]
 gb|ACU18442.1| unknown [Glycine max]
Length=419

 Score =   390 bits (1003),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 198/372 (53%), Positives = 251/372 (67%), Gaps = 9/372 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVIQ G    +P ++TVNC DK GLGC++CRIIL+FGL I + D+STDGRWCY+V W
Sbjct  6     DDVVVIQQGKDHNEPCIVTVNCPDKAGLGCDLCRIILEFGLRITRADISTDGRWCYIVYW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP----YSNLIYLPSPKTPATSSYLMTLYCIGRTGLL  817
             V    ++  V W  LK RL S CP     Y    +  SP  P    YL  ++C+ + GLL
Sbjct  66    VLAHPASLNVDWESLKTRLLSACPSCLLSYHFNQHSTSPSPPPI--YLSKVWCVDQKGLL  123

Query  816   HDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGES  637
             HD+ + LC  EL I+RVK + TPD RVLD+F I D +ELL+ K++Q+ +CE L   LGE 
Sbjct  124   HDINEILCNLELIIQRVKAMPTPDGRVLDMFFITDGMELLHTKKRQDYVCEYLMDALGER  183

Query  636   CISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVT  457
             CIS EL+L   GP Y +L  FS+L P+   ELF  EL +  + L  LS D+  LK   VT
Sbjct  184   CISSELQLA--GPEYGHLQGFSSLPPAFAEELFSSELLDKLS-LHPLSQDMTTLKTPTVT  240

Query  456   IDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKN  277
             +DN+LS  HTL+QI CVD K   YDI R  K  ++++ + RFS++ KG R +D+FVQH +
Sbjct  241   VDNSLSPVHTLLQIQCVDQKGLCYDIMRISKDSDIKVAFGRFSSSVKGFRNIDLFVQHND  300

Query  276   GEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTF  97
             G+KI+DPE Q +LC CLK E+LHPLRV I NRGPDTELLVANP+ELSG GRPRVFYDVT 
Sbjct  301   GKKIIDPESQKTLCSCLKEEMLHPLRVTIVNRGPDTELLVANPVELSGKGRPRVFYDVTL  360

Query  96    ALKTLGICIFSV  61
              LK L + IFS 
Sbjct  361   TLKALRVGIFSA  372



>ref|XP_004492116.1| PREDICTED: uncharacterized protein LOC101495407 [Cicer arietinum]
Length=420

 Score =   389 bits (1000),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 195/371 (53%), Positives = 257/371 (69%), Gaps = 6/371 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVIQ+     +P ++TVNC DK GLGC++CRIIL+FGL I + D+STDGRWCY+V W
Sbjct  6     DDVVVIQHAKDSNEPSIVTVNCPDKAGLGCDLCRIILEFGLRITRADISTDGRWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP--YSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P  ++  V W  LK RL S CP   +S      S        YL+ ++ I + GLLHD
Sbjct  66    VIPHPASLKVDWESLKTRLLSPCPSCLFSYHFNQQSNNPSPPPIYLLKVWIIDQKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             + + LC  +L I+RVKV+ TPD R LD+F I D +EL + K++++++CE L+  LGE CI
Sbjct  126   INEILCNLQLTIQRVKVMPTPDGRALDLFFITDGMELFHTKKRRDDVCEYLKEALGERCI  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             S EL+L   GP Y +L  FS+L P+ + ELF  EL  ++  L  LS D+  LKK  VT+D
Sbjct  186   SSELQLA--GPEYGHLQGFSSLPPAFSEELFGPELL-DKVSLHPLSQDMTTLKKPTVTVD  242

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHK-NG  274
             N+LS AHTL+QI CVD K   YDI R  K  ++++ Y RF+++ KG + +D+FVQ K +G
Sbjct  243   NSLSPAHTLLQIQCVDQKGLCYDIMRISKDSDIKVAYGRFTSSVKGFQNIDLFVQQKEDG  302

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
             +KI+DPE+Q +LC CLK E+LHPLRV+I NRGPD ELLVANP+ELSG GRPRVFYDVT A
Sbjct  303   KKIIDPERQKTLCSCLKEEMLHPLRVIIVNRGPDIELLVANPVELSGTGRPRVFYDVTLA  362

Query  93    LKTLGICIFSV  61
             LK LG+ IFS 
Sbjct  363   LKALGVFIFSA  373



>ref|XP_003569001.1| PREDICTED: uncharacterized protein LOC100846101 isoform X2 [Brachypodium 
distachyon]
Length=445

 Score =   390 bits (1002),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 195/369 (53%), Positives = 261/369 (71%), Gaps = 7/369 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+VV++     G+  ++TVNC D+ GLGC++CR IL+FGL I +GDVSTDG+WCYV+ W
Sbjct  33    EDAVVMELAAAEGEDSVVTVNCPDQAGLGCDLCRTILEFGLRITRGDVSTDGQWCYVIFW  92

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHDV  808
             V P+S +  V W  LK+RL S+CP    + + P    PA    YL+ L+   R GLLHDV
Sbjct  93    VVPRSPSINVRWGSLKNRLMSMCPSSYAIPFYPEITQPAPPQFYLLKLFSTDRKGLLHDV  152

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T  L E EL I RVKV TTPD RV+++F I D +ELL+ KE+QEE C  L A LG S +S
Sbjct  153   THILSELELIIHRVKVSTTPDGRVVNLFFITDGMELLHTKERQEETCSMLIATLGPS-LS  211

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CE+ L+A G  ++    FS+L P+++ ELFR EL + E+  + L  ++ K++K+ +  DN
Sbjct  212   CEI-LLAEG--FQQ--GFSSLPPTISEELFRLELDDCESSSRSLCAEMKKMQKASINFDN  266

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
             ALS AHTL+QI CVD K  LYD+ R LK C++++TY RF +  KG RE+D+F++  +G+K
Sbjct  267   ALSPAHTLLQIICVDQKGLLYDMLRTLKDCSIKVTYGRFWSNKKGFREVDLFIKQADGKK  326

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             ++DPEKQ  L   ++ E+LHPLRV+I NRGPDTELLVANP+ELSG GRPRVFYD T ALK
Sbjct  327   VIDPEKQEVLRSRMRSEMLHPLRVMIVNRGPDTELLVANPVELSGKGRPRVFYDATLALK  386

Query  87    TLGICIFSV  61
              LGICIFS 
Sbjct  387   ALGICIFSA  395



>ref|XP_002312081.1| ACT domain-containing family protein [Populus trichocarpa]
 gb|EEE89448.1| ACT domain-containing family protein [Populus trichocarpa]
Length=421

 Score =   388 bits (997),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 197/371 (53%), Positives = 253/371 (68%), Gaps = 5/371 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ G+   DP ++TVNC DK GLGC++CRIIL+FGL+I + D  TDG+WCY+V W
Sbjct  6     DDVVLIQQGSGSNDPTVVTVNCPDKSGLGCDLCRIILEFGLHITRADFQTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLP---SPKTPATSSYLMTLYCIGRTGLLH  814
             V  +S++  + W  LK+RL  V PP    +Y     +  T A S YL+   C+ R GLLH
Sbjct  66    VVQRSNSLRLDWDSLKNRLLIVSPPCLAPLYYDHKLNGSTAAPSVYLLKFCCVDRKGLLH  125

Query  813   DVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESC  634
             D+T+ L E E  I+R+KV+TTPD++V+D+F I D  ELL+ KE+++  C  L  V  E C
Sbjct  126   DITEVLTELEFTIQRLKVMTTPDEKVVDLFFITDGRELLHTKERRDNTCGYLCDVFKEYC  185

Query  633   ISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTI  454
             ISCEL+L   GP  EN   FS+L  +V  ELF CELSE E+  Q L       KK+IVT+
Sbjct  186   ISCELQLA--GPECENQRTFSSLPMAVAEELFSCELSEKESCTQALGTATTPPKKAIVTV  243

Query  453   DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNG  274
             DN LS AHTL+QI CVD K   YDI R  K  N+Q+ Y RFS++ KG   +D+ ++  +G
Sbjct  244   DNLLSPAHTLLQIQCVDQKGLFYDILRTSKDLNIQVAYGRFSSSIKGYHNMDLLIRQTDG  303

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
             +KI+DPE  A+ C  LK E+LHPLRV+I+NRGPDTELLVANP+EL G GRPRVFYDVT  
Sbjct  304   KKIVDPELLANTCSRLKEEMLHPLRVIITNRGPDTELLVANPVELCGKGRPRVFYDVTLT  363

Query  93    LKTLGICIFSV  61
             LK LGICIFS 
Sbjct  364   LKKLGICIFSA  374



>ref|XP_007139241.1| hypothetical protein PHAVU_008G013100g [Phaseolus vulgaris]
 gb|ESW11235.1| hypothetical protein PHAVU_008G013100g [Phaseolus vulgaris]
Length=419

 Score =   388 bits (997),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 195/374 (52%), Positives = 254/374 (68%), Gaps = 13/374 (3%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVIQ G    +P ++TVNC DK GLGC++CRIIL+FGL I + D+STDGRWCY+V W
Sbjct  6     DDGVVIQQGKDANEPCIVTVNCPDKAGLGCDLCRIILEFGLRITRADISTDGRWCYIVYW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP------YSNLIYLPSPKTPATSSYLMTLYCIGRTG  823
             V P  ++  V W  LK RL S CP       ++ L   PSP       YL+ ++C+ + G
Sbjct  66    VLPHPASVKVDWESLKTRLLSACPSCLFSYCFNQLSTSPSPP----PIYLLKVWCVDKKG  121

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHD+ + LC  EL I+RVK + TPD RVL++  I D +ELL+ K++Q+ + E L   LG
Sbjct  122   LLHDINEILCNLELIIQRVKAMPTPDGRVLEMLFITDGMELLHTKKRQDHVSEFLMDALG  181

Query  642   ESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSI  463
             E CIS EL+L   GP Y +L  FS+L P+   ELF  EL  ++  L  LS D+  LK   
Sbjct  182   ERCISSELQLA--GPEYGHLQGFSSLPPAFAEELFSSELL-DKVSLHPLSQDMKTLKTPT  238

Query  462   VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQH  283
             VT+DN+LS  HTL+QI CVD K   YDI R  K  ++++ + RFS++ +G R +D+FVQ 
Sbjct  239   VTVDNSLSPVHTLLQIQCVDQKGLCYDIMRISKDSDIKVAFGRFSSSVEGFRNIDLFVQQ  298

Query  282   KNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDV  103
              +G+KI+D + Q +LC CLK E+LHPLRV+I +RGPDTELLVANP+ELSG GRPRVFYDV
Sbjct  299   NDGKKIIDLDSQKTLCSCLKEEMLHPLRVIIVSRGPDTELLVANPVELSGKGRPRVFYDV  358

Query  102   TFALKTLGICIFSV  61
             T ALK LGICIFS 
Sbjct  359   TLALKALGICIFSA  372



>ref|XP_002315234.2| ACT domain-containing family protein [Populus trichocarpa]
 gb|EEF01405.2| ACT domain-containing family protein [Populus trichocarpa]
Length=423

 Score =   388 bits (996),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 199/373 (53%), Positives = 253/373 (68%), Gaps = 7/373 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ GN P DP ++TVNC DK GLGC++CRIIL+FGL+I + D  TDG+WCY+V+W
Sbjct  6     DDVVLIQQGNSPHDPTIVTVNCPDKSGLGCDLCRIILEFGLHITRADFQTDGKWCYIVLW  65

Query  984   V--FPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSP---KTPATSSYLMTLYCIGRTGL  820
             V     S+   + W  LK+RL  V PP    +Y        + A S YL+   C+ R GL
Sbjct  66    VVQLQHSNLLRLDWDSLKNRLLRVSPPCLTPLYYDQKLNGSSAAPSVYLLKFCCVDRKGL  125

Query  819   LHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGE  640
             LHDVT+ L E E  I+R+KV+TTPD +V+D+F I D  ELL+ K+++++ C  L  V  E
Sbjct  126   LHDVTEVLTELEFTIQRLKVMTTPDGKVVDLFFITDGRELLHTKKRRDDTCRYLYDVFRE  185

Query  639   SCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIV  460
              CI CEL+L   GP  ++    S+L   V  ELF CELSE E+ +Q L       KK+IV
Sbjct  186   YCIGCELQLA--GPECDSQRNLSSLPLVVAEELFSCELSEKESCMQALRTATTSPKKAIV  243

Query  459   TIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHK  280
             T+DN LS AHTL+QI CVD K   YDI R  K  N+Q+ Y RFS++ KG R +D+FVQ  
Sbjct  244   TVDNLLSPAHTLLQIQCVDQKGLFYDILRISKDLNIQVAYGRFSSSIKGYRNMDLFVQQT  303

Query  279   NGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVT  100
             +G+KILDP+   +LC  LK E+LHPLRV+I+NRGPDTELLVANP+EL G GRPRVFYDVT
Sbjct  304   DGKKILDPKLLDNLCSRLKEEMLHPLRVIITNRGPDTELLVANPVELCGKGRPRVFYDVT  363

Query  99    FALKTLGICIFSV  61
              ALK LGICIFS 
Sbjct  364   LALKKLGICIFSA  376



>ref|XP_011026220.1| PREDICTED: uncharacterized protein LOC105126867 [Populus euphratica]
 ref|XP_011026305.1| PREDICTED: uncharacterized protein LOC105126867 [Populus euphratica]
 ref|XP_011026376.1| PREDICTED: uncharacterized protein LOC105126867 [Populus euphratica]
Length=421

 Score =   388 bits (996),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 196/371 (53%), Positives = 256/371 (69%), Gaps = 5/371 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ G+   DP ++TVNC DK GLGC++CRIIL+FGL+I + D  TDG+WCY+V W
Sbjct  6     DDVVLIQLGSGSNDPTVVTVNCPDKSGLGCDLCRIILEFGLHITRADFQTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLP---SPKTPATSSYLMTLYCIGRTGLLH  814
             V  +S++  + W  LK+RL  V PP    +Y     +  T A S YL+   C+ R GLLH
Sbjct  66    VVQRSNSLRLDWDSLKNRLLIVSPPCLAPLYYDHKLNGSTAAPSVYLLKFCCVDRKGLLH  125

Query  813   DVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESC  634
             D+T+ + E E  I+R+KV+TTPD++V+D+F I D  ELL+ KE+++  C  L  V  E C
Sbjct  126   DITEVITELEFTIQRLKVMTTPDEKVVDLFFITDGRELLHTKERRDNTCRYLCDVFKEYC  185

Query  633   ISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTI  454
             ISCEL+L   GP  EN   FS+L  +V  ELF CELSE E+  Q L   +   KK+IVT+
Sbjct  186   ISCELQLA--GPECENQRTFSSLPMAVAEELFSCELSEKESCTQALVTAITPPKKAIVTV  243

Query  453   DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNG  274
             DN LS AHTL+QI CVD K   YDI R  K  N+Q+ Y RFS++ KG R +D+ ++  +G
Sbjct  244   DNLLSPAHTLLQIQCVDQKGLFYDILRTSKDLNIQVAYGRFSSSIKGYRNMDLLIRQTDG  303

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
             +KI+DP+  A+ C  LK E+LHPLRV+I+NRGPDTELLVANP+EL G GRPRVFYDVT +
Sbjct  304   KKIVDPKLLANTCSRLKEEMLHPLRVIITNRGPDTELLVANPVELCGKGRPRVFYDVTLS  363

Query  93    LKTLGICIFSV  61
             LK LGICIFS 
Sbjct  364   LKKLGICIFSA  374



>ref|XP_002875758.1| hypothetical protein ARALYDRAFT_323253 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52017.1| hypothetical protein ARALYDRAFT_323253 [Arabidopsis lyrata subsp. 
lyrata]
Length=383

 Score =   386 bits (991),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 197/362 (54%), Positives = 249/362 (69%), Gaps = 29/362 (8%)
 Frame = -2

Query  1140  GNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMWVFPQSSTP  961
             G K GD ++ITVNC D+ GLGC+ICRIILDFGL I KGDV+TDG WCY+V+WV P   T 
Sbjct  2     GKKIGDAHVITVNCPDRTGLGCDICRIILDFGLYITKGDVTTDGVWCYIVLWVVPHYDTL  61

Query  960   IVTWAKLKDRLWSVCPPYSN--LIYLPSPKTPATSSYLMTLYCIGRTGLLHDVTQFLCEC  787
              + W+ LK++L SVCP  S   ++ L SP   +T  YL+  +C+ R GLLHDVTQ L E 
Sbjct  62    RLRWSHLKNQLVSVCPSCSTYFVLNLMSPCPASTPVYLLKFFCLDRNGLLHDVTQVLTEL  121

Query  786   ELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCISCELKLVA  607
             EL I+ VKV TTPD RVLD+F I D+++LL+ +++QEE   + R+VLGESCISCEL+L  
Sbjct  122   ELSIQTVKVTTTPDGRVLDLFFITDNMDLLHTEKRQEETRGKFRSVLGESCISCELQLAG  181

Query  606   PGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDNALSSAHT  427
             P                           E E H   LS D+ KLK   VT DN+LS A+T
Sbjct  182   P---------------------------EYECHQNVLSDDMTKLKNVSVTFDNSLSPANT  214

Query  426   LIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEKILDPEKQ  247
             L+QI CVD++  LYD+ R LK  +++I+Y RFS   +G  +LD+F+Q K+G KI+D +KQ
Sbjct  215   LLQIQCVDHRGLLYDVLRTLKDFDIKISYGRFSPQTQGHWDLDLFIQLKDGNKIVDLDKQ  274

Query  246   ASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALKTLGICIF  67
              SLC  LK E+LHPLRV+I+NRGPD ELLVANP+ELSG GRPRVFYDVT +LK LGICIF
Sbjct  275   NSLCSRLKAEMLHPLRVIITNRGPDAELLVANPVELSGKGRPRVFYDVTLSLKVLGICIF  334

Query  66    SV  61
             S 
Sbjct  335   SA  336



>ref|XP_003621862.1| hypothetical protein MTR_7g024320 [Medicago truncatula]
 gb|AES78080.1| ACT domain protein [Medicago truncatula]
Length=418

 Score =   385 bits (989),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 192/371 (52%), Positives = 257/371 (69%), Gaps = 8/371 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVIQ+     +P ++TVNC DK GLGC++CRIIL+FGL I + D+STDGRWC++V W
Sbjct  6     DDLVVIQHAKNANEPTIVTVNCPDKAGLGCDLCRIILEFGLRITRADISTDGRWCFIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP--YSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P  ++  + W  LK RL S CP   +S      +P  P    YL+ ++ I + GLLHD
Sbjct  66    VIPHPASLKIDWENLKTRLLSPCPSCLFSYNFNQRNPSPPPI--YLLKVWIIDQKGLLHD  123

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             + + LC  +L I+RVKV+ TPD R LD+F I D +EL + KE+++++C+ L   LGE CI
Sbjct  124   INEILCNLQLTIQRVKVMPTPDGRALDLFFITDEMELFHTKERRDDVCQYLSEALGERCI  183

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             S EL+L   GP Y +L  FS+L P+ + ELF  EL + +  L  LS D+  LK   VT+D
Sbjct  184   SSELQLA--GPEYGHLQGFSSLPPAYSEELFGPELVD-KVSLHPLSQDMTTLKTPTVTVD  240

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHK-NG  274
             N+LSS HTL+QI CVD KS  YD+ R  K  ++++ Y RF+++ KG + +D+FVQ K +G
Sbjct  241   NSLSSVHTLLQIQCVDQKSLCYDLMRISKDSDIKVAYGRFNSSAKGFQNIDLFVQQKEDG  300

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
             +KI+DPE+  +LC CLK E+LHPLRV+I NRGPD ELLVANP+ELSG GRPRVFYDVT A
Sbjct  301   QKIIDPERLKTLCTCLKEEMLHPLRVIIVNRGPDIELLVANPVELSGKGRPRVFYDVTLA  360

Query  93    LKTLGICIFSV  61
             LK LG+ IFS 
Sbjct  361   LKALGVFIFSA  371



>gb|KFK36847.1| hypothetical protein AALP_AA4G179500 [Arabis alpina]
Length=410

 Score =   385 bits (989),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 197/372 (53%), Positives = 250/372 (67%), Gaps = 14/372 (4%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD+V+I+ G   GDP ++TVNC D+ GLG  +CRIIL+FGL+I + D STDGRWCY+V
Sbjct  4     LNDDAVLIEPGKNSGDPNIVTVNCPDESGLGSTLCRIILEFGLSITRADFSTDGRWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIY--LPSPKTPATSSYLMTLYCIGRTGLL  817
              WV P SS   +    LK+RL S CP      Y  L S  +   S YL+  +C  R GLL
Sbjct  64    FWVIPDSSGAKIDLGSLKNRLLSACPSSLGAFYFCLQSNVSKPPSLYLLKFFCRDRKGLL  123

Query  816   HDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGES  637
             HDVT+ L E E  I+RVKV+TTPD RVLD+F I D ++LL+ K +Q E C+ L AVLGE 
Sbjct  124   HDVTKVLTELEFTIQRVKVMTTPDGRVLDMFFITDAMDLLHTKRRQTETCDHLTAVLGEH  183

Query  636   CISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVT  457
              +SCEL+L   GP  E++  FS+LSP   +ELF  +  +  +             K+++T
Sbjct  184   GVSCELELA--GPELESVQRFSSLSPVAADELFGLDGFDVSS----------SSNKAVLT  231

Query  456   IDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKN  277
             +DN LS AHTL+QI CVD K   YDI R  K C+V I Y RFS+  KG R LD+FV+  +
Sbjct  232   VDNELSPAHTLLQIHCVDQKGLFYDILRTSKDCDVHIAYGRFSSKVKGYRNLDLFVRGTD  291

Query  276   GEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTF  97
             G+KI DP+ QA+ C  LK E+L PLRV+I NRGPDTELLVANP+ELSG GRPRVF+DVT 
Sbjct  292   GKKIADPKHQANFCSRLKEEMLCPLRVIIVNRGPDTELLVANPVELSGKGRPRVFFDVTL  351

Query  96    ALKTLGICIFSV  61
             ALK+LGICIFS 
Sbjct  352   ALKSLGICIFSA  363



>ref|XP_010231766.1| PREDICTED: uncharacterized protein LOC100846101 isoform X1 [Brachypodium 
distachyon]
Length=446

 Score =   385 bits (990),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 195/370 (53%), Positives = 261/370 (71%), Gaps = 8/370 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKG-DVSTDGRWCYVVM  988
             +D+VV++     G+  ++TVNC D+ GLGC++CR IL+FGL I +G DVSTDG+WCYV+ 
Sbjct  33    EDAVVMELAAAEGEDSVVTVNCPDQAGLGCDLCRTILEFGLRITRGADVSTDGQWCYVIF  92

Query  987   WVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHD  811
             WV P+S +  V W  LK+RL S+CP    + + P    PA    YL+ L+   R GLLHD
Sbjct  93    WVVPRSPSINVRWGSLKNRLMSMCPSSYAIPFYPEITQPAPPQFYLLKLFSTDRKGLLHD  152

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT  L E EL I RVKV TTPD RV+++F I D +ELL+ KE+QEE C  L A LG S +
Sbjct  153   VTHILSELELIIHRVKVSTTPDGRVVNLFFITDGMELLHTKERQEETCSMLIATLGPS-L  211

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCE+ L+A G  ++    FS+L P+++ ELFR EL + E+  + L  ++ K++K+ +  D
Sbjct  212   SCEI-LLAEG--FQQ--GFSSLPPTISEELFRLELDDCESSSRSLCAEMKKMQKASINFD  266

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             NALS AHTL+QI CVD K  LYD+ R LK C++++TY RF +  KG RE+D+F++  +G+
Sbjct  267   NALSPAHTLLQIICVDQKGLLYDMLRTLKDCSIKVTYGRFWSNKKGFREVDLFIKQADGK  326

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             K++DPEKQ  L   ++ E+LHPLRV+I NRGPDTELLVANP+ELSG GRPRVFYD T AL
Sbjct  327   KVIDPEKQEVLRSRMRSEMLHPLRVMIVNRGPDTELLVANPVELSGKGRPRVFYDATLAL  386

Query  90    KTLGICIFSV  61
             K LGICIFS 
Sbjct  387   KALGICIFSA  396



>ref|XP_006411185.1| hypothetical protein EUTSA_v10016727mg [Eutrema salsugineum]
 gb|ESQ52638.1| hypothetical protein EUTSA_v10016727mg [Eutrema salsugineum]
Length=414

 Score =   384 bits (987),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 194/372 (52%), Positives = 252/372 (68%), Gaps = 10/372 (3%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD+V+I+ G   GDP ++TVNC D+ GLG  +CRIIL+FGL+I + D STDGRWCY+V
Sbjct  4     LNDDAVLIERGKNSGDPTIVTVNCPDESGLGSTLCRIILEFGLSITRADFSTDGRWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIY--LPSPKTPATSSYLMTLYCIGRTGLL  817
              WV P +S+P + W  LK+RL S CP      Y  L S  +   S YL+  +C+ R GLL
Sbjct  64    FWVTPDNSSPKIDWDSLKNRLLSACPSCLGSFYFCLQSNVSKPPSLYLLKFFCLDRKGLL  123

Query  816   HDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGES  637
             HDVT+ L E E  I+RVKV+TTPD RVLD+F I D ++LL+ K++Q E C+ L AVLGE 
Sbjct  124   HDVTKVLTELEFTIQRVKVMTTPDGRVLDMFFITDAMDLLHTKQRQTETCDHLTAVLGEH  183

Query  636   CISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVT  457
              + CEL+L   GP  E++  FS+L P   +ELF            +++       K+++T
Sbjct  184   GVICELELA--GPELESVQRFSSLPPVAADELF------GSDGSSDINSSSSSSNKAVLT  235

Query  456   IDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKN  277
             +DN LS AHTL+ I CVD K   YDI R  K C+V I Y RFS+  KG R LD+FV+  +
Sbjct  236   VDNQLSPAHTLLHIHCVDQKGLFYDILRTSKDCDVHIAYGRFSSKVKGYRNLDLFVRGTD  295

Query  276   GEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTF  97
             G+KI DP+ QA+ C  LK E++ PLRV+I NRGPD+ELLVANP+ELSG GRPRVFYDVT 
Sbjct  296   GKKIADPKHQANFCSRLKEEMVCPLRVIIVNRGPDSELLVANPVELSGKGRPRVFYDVTL  355

Query  96    ALKTLGICIFSV  61
             ALK+LGICIFS 
Sbjct  356   ALKSLGICIFSA  367



>ref|XP_002879806.1| ACT domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56065.1| ACT domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=411

 Score =   384 bits (986),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 195/370 (53%), Positives = 252/370 (68%), Gaps = 13/370 (4%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+I+ G   GDP ++TVNC D+ GLG  +CRIIL+FGL+I + D STDGRWCY+V W
Sbjct  6     DDAVLIEPGKISGDPTIVTVNCPDESGLGSTLCRIILEFGLSITRADFSTDGRWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIY--LPSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P  S+P + W  LK+RL S CP      Y  L S  +   S YL+  +C  R GLLHD
Sbjct  66    VTPDISSPRIDWDSLKNRLLSACPSCLGSFYFCLQSNVSKPPSLYLLKFFCRDRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ L E E  I+RVKV+TTPD RVLD+F I D ++LL+ K++Q + C+ L AVLGE  +
Sbjct  126   VTKVLTELEFTIQRVKVMTTPDGRVLDMFFITDAMDLLHTKQRQTKTCDHLTAVLGEHGV  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             SCEL+L   GP  E++  FS+L P   +ELF  +  +N               K+++T+D
Sbjct  186   SCELELA--GPELESVQRFSSLPPVAADELFGPDGFDNSGSSS---------NKAVLTVD  234

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N LS AHT++QI CVD K   YDI R  K C+V I Y RFS+  KG R L++FV+  +G+
Sbjct  235   NQLSPAHTVLQIRCVDQKGLFYDILRTSKDCDVHIAYGRFSSKVKGYRNLELFVRGTDGK  294

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             KI+DP+ QA+ C  LK E++ PLRV+I NRGPDTELLVANP+ELSG GRPRVFYDVT AL
Sbjct  295   KIVDPKHQANFCARLKEEMMCPLRVIIVNRGPDTELLVANPVELSGKGRPRVFYDVTLAL  354

Query  90    KTLGICIFSV  61
             K+LGICIFS 
Sbjct  355   KSLGICIFSA  364



>ref|XP_010253240.1| PREDICTED: uncharacterized protein LOC104594585 isoform X2 [Nelumbo 
nucifera]
Length=374

 Score =   383 bits (983),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 186/328 (57%), Positives = 238/328 (73%), Gaps = 3/328 (1%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ G KPG+P +ITVNC DK GLGC++CRIIL+FGL I +GDVSTDG+WCY+++W
Sbjct  6     DDVVLIQKGKKPGEPCVITVNCPDKAGLGCDLCRIILEFGLCITRGDVSTDGKWCYILLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHDV  808
             V P   +  V WA LK+RL SVCP  S   Y   P   + S  YL+   C+ R GLLHDV
Sbjct  66    VEPHPVSLTVRWASLKNRLLSVCPSCSVSFYFNQPSCSSPSPVYLLKFCCLDRKGLLHDV  125

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             TQ LCE EL I+RVKV+TTPD RV+D+F I D +ELL+ K +Q++ CE+L A+LGESC+S
Sbjct  126   TQVLCELELTIQRVKVMTTPDGRVMDLFFITDGMELLHTKRRQDDTCERLNAILGESCVS  185

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CEL+L   GP YE     S++S     ELF CE S+ ET  Q LS D+ KLKK+ VTIDN
Sbjct  186   CELQLA--GPEYEMQQGVSSISSEAAEELFNCEFSDKETRSQALSADLTKLKKACVTIDN  243

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
             +LS AHTLIQ+ CVD K  LYDI R +K CN+QI Y R++++ KG R++D+FVQ  +G+K
Sbjct  244   SLSPAHTLIQMHCVDQKGLLYDIMRTMKDCNIQIAYGRYTSSTKGYRDVDLFVQQMDGKK  303

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISN  184
             ++DPEKQ++LC  LKVE+LHPLR  I  
Sbjct  304   MVDPEKQSALCSRLKVEMLHPLRAEIGR  331



>ref|XP_006294312.1| hypothetical protein CARUB_v10023319mg [Capsella rubella]
 gb|EOA27210.1| hypothetical protein CARUB_v10023319mg [Capsella rubella]
Length=411

 Score =   384 bits (985),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 195/375 (52%), Positives = 251/375 (67%), Gaps = 23/375 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+++ G   GDP ++TVNC D+ GLG  +CRIIL+FGL+I + D STDGRWCY+V W
Sbjct  6     DDAVLVEPGKLSGDPTIVTVNCPDESGLGSTLCRIILEFGLSITRADFSTDGRWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLP--SPKTPATSSYLMTLYCIGRTGLLHD  811
             V P +S+P + W  LK+RL S CP      YL   S  +   S YL+  +C  R GLLHD
Sbjct  66    VTPDNSSPKIDWNSLKNRLLSACPSCLGSFYLSLQSNVSKPPSLYLLKFFCRDRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ L E E  I+RVKV+TTPD RVLD+F I D ++LL+ +++Q E C+ L AV GE  +
Sbjct  126   VTKVLTELEFTIQRVKVMTTPDGRVLDMFFITDAMDLLHTRQRQTETCDHLTAVFGEHGV  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLK-----KS  466
             SCEL+L   GP  E++  FS+L P   +ELF               PD   ++     K+
Sbjct  186   SCELELA--GPELESMQRFSSLPPLAADELF--------------GPDGSDIRGSNSNKA  229

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
             ++T+DN LS AHTL+QI CVD K   YDI R  K C+V I Y RFS+  KG R LD+FV+
Sbjct  230   VLTVDNHLSPAHTLLQIHCVDQKGLFYDILRTSKDCDVHIAYGRFSSKVKGYRNLDLFVR  289

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G+KI DP+ QA+ C  LK E+  PLRV+I NRGPD+ELLVANP+ELSG GRPRVFYD
Sbjct  290   GTDGKKIADPKHQANFCARLKEEMACPLRVIIVNRGPDSELLVANPVELSGKGRPRVFYD  349

Query  105   VTFALKTLGICIFSV  61
             VT ALK+LGICIFS 
Sbjct  350   VTLALKSLGICIFSA  364



>gb|AFK39044.1| unknown [Medicago truncatula]
Length=418

 Score =   384 bits (986),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 192/371 (52%), Positives = 257/371 (69%), Gaps = 8/371 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVIQ+     +P ++TVNC DK GLGC++CRIIL+FGL I + D+STDGRWC++V W
Sbjct  6     DDLVVIQHAKNANEPTIVTVNCPDKAGLGCDLCRIILEFGLRITRADISTDGRWCFIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP--YSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P  ++  + W  LK RL S CP   +S      +P  P    YL+ ++ I + GLLHD
Sbjct  66    VIPHPASLKIDWENLKTRLLSPCPSCLFSYNFNQRNPSPPPI--YLLKVWIIDQKGLLHD  123

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             + + LC  +L I+RVKV+ TPD R LD+F I D +EL + KE+++++C+ L   LGE CI
Sbjct  124   INEILCNLQLTIQRVKVMPTPDGRALDLFFITDEMELFHTKERRDDVCQCLSEALGERCI  183

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             S EL+L   GP Y +L  FS+L P+ + ELF  EL + +  L  LS D+  LK   VT+D
Sbjct  184   SSELQLA--GPEYGHLQGFSSLPPAYSEELFGPELVD-KVSLHPLSQDMTTLKTPTVTVD  240

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHK-NG  274
             N+LSS HTL+QI CVD KS  YD+ R  K  ++++ Y RF+++ KG + +D+FVQ K +G
Sbjct  241   NSLSSVHTLLQIQCVDQKSLCYDLMRISKDSDIKVAYGRFNSSAKGFQNIDLFVQQKEDG  300

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
             +KI+DPE+  +LC CLK E+LHPLRV+I NRGPD ELLVANP+ELSG GRPRVFYDVT A
Sbjct  301   QKIIDPERLKTLCTCLKEEMLHPLRVIIVNRGPDIELLVANPVELSGKGRPRVFYDVTLA  360

Query  93    LKTLGICIFSV  61
             LK LG+ IFS 
Sbjct  361   LKALGVFIFSA  371



>dbj|BAJ97213.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=446

 Score =   385 bits (988),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 191/369 (52%), Positives = 260/369 (70%), Gaps = 7/369 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+VV++     GD  ++TVNC D+ GLGC++CR IL+FGL I +GDVSTDG+WCYV+ W
Sbjct  34    EDAVVMELAAADGDDSVVTVNCPDQAGLGCDLCRTILEFGLRITRGDVSTDGQWCYVIFW  93

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHDV  808
             V P+S +  V W  LK+RL ++CP    + + P    P     YL+ L+   R GLLH V
Sbjct  94    VVPRSPSINVRWGSLKNRLMAMCPSSYAIPFYPEITEPCPPQFYLLKLFSTDRRGLLHGV  153

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T  L E E  I+RVKV TTPD RV+++F I D +ELL+ KE+QEE+C  L A LG S ++
Sbjct  154   THILSELEFIIQRVKVSTTPDGRVVNLFFITDGMELLHTKERQEEICSMLIATLGPS-LT  212

Query  627   CELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDN  448
             CE+ L A G  ++    FS+L P+++ ELFR EL + E+  + L  ++ K++K+ +  DN
Sbjct  213   CEI-LSAEG--FQQ--GFSSLPPTISEELFRLELDDCESSSRPLCAEMKKVQKATINFDN  267

Query  447   ALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEK  268
             +LS AHTL+QI CVD K  LYD+ R LK CN+++TY RF +  KG RE+D+F++  +G+K
Sbjct  268   SLSPAHTLLQILCVDQKGLLYDMLRTLKDCNIKVTYGRFWSDKKGFREVDLFIKQADGKK  327

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             ++DPEKQ +L   ++ E+LHPLRV+I NRGPDTELLVANP+ELSG GRPRVFYD T ALK
Sbjct  328   VIDPEKQDALRSRMRSEMLHPLRVMIVNRGPDTELLVANPVELSGKGRPRVFYDATLALK  387

Query  87    TLGICIFSV  61
              LGICIFS 
Sbjct  388   ALGICIFSA  396



>ref|NP_565908.1| ACT domain-containing protein [Arabidopsis thaliana]
 sp|O80644.1|ACR9_ARATH RecName: Full=ACT domain-containing protein ACR9; AltName: Full=Protein 
ACT DOMAIN REPEATS 9 [Arabidopsis thaliana]
 gb|AAC27848.1| expressed protein [Arabidopsis thaliana]
 gb|AEC09695.1| ACT domain-containing protein [Arabidopsis thaliana]
 gb|AEP31950.1| ACT domain-containing protein [Arabidopsis thaliana]
Length=411

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 197/375 (53%), Positives = 251/375 (67%), Gaps = 23/375 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+I+ G   GDP ++TVNC D+ GLG  +CRIIL+FGL+I + D STDGRWCY+V W
Sbjct  6     DDAVLIEPGKISGDPTVVTVNCPDESGLGSTLCRIILEFGLSITRADFSTDGRWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIY--LPSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P  S+P + W  LK+RL S CP      Y  L S  +   S YL+  +C  R GLLHD
Sbjct  66    VTPDISSPKIDWDSLKNRLLSACPSCLGSFYFCLQSNVSKPPSLYLLKFFCRDRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ L E E  I+RVKV+TTPD RVLD+F I D ++LL+ K++Q + C+ L AVLGE  +
Sbjct  126   VTKVLTELEFTIQRVKVMTTPDGRVLDMFFITDAMDLLHTKQRQTKTCDHLTAVLGEHGV  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKL-----KKS  466
             SCEL+L   GP  E++  FS+L P   +ELF               PD   +      K+
Sbjct  186   SCELELA--GPELESVQRFSSLPPLAADELF--------------GPDGFDISGSSSNKA  229

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
             ++T+DN LS AHTL+QI CVD K   YDI R  K C+V I Y RFS+  KG R L++FV+
Sbjct  230   VLTVDNQLSPAHTLLQIRCVDQKGLFYDILRTSKDCDVHIAYGRFSSKVKGYRNLELFVR  289

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G KI+DP+ QA+ C  LK E++ PLRV+I NRGPDTELLVANP+ELSG GRPRVFYD
Sbjct  290   GTDGNKIMDPKHQANFCARLKEEMVCPLRVIIVNRGPDTELLVANPVELSGKGRPRVFYD  349

Query  105   VTFALKTLGICIFSV  61
             VT ALK+LGICIFS 
Sbjct  350   VTLALKSLGICIFSA  364



>dbj|BAJ88654.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=445

 Score =   384 bits (985),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 192/370 (52%), Positives = 261/370 (71%), Gaps = 8/370 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKG-DVSTDGRWCYVVM  988
             +D+VV++     GD  ++TVNC D+ GLGC++CR IL+FGL I +G DVSTDG+WCYV+ 
Sbjct  32    EDAVVMELAAADGDDSVVTVNCPDQAGLGCDLCRTILEFGLRITRGADVSTDGQWCYVIF  91

Query  987   WVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHD  811
             WV P+S +  V W  LK+RL ++CP    + + P    P     YL+ L+   R GLLHD
Sbjct  92    WVVPRSPSINVRWGSLKNRLMAMCPSSYAIPFYPEITEPGPPQFYLLKLFSTDRRGLLHD  151

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT  L E E  I+RVKV TTPD RV+++F I D +ELL+ KE+QEE+C  L A LG S +
Sbjct  152   VTHILSELEFIIQRVKVSTTPDGRVVNLFFITDGMELLHTKERQEEICSMLIATLGPS-L  210

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             +CE+ L A G  ++    FS+L P+++ ELFR EL + E+  + L  ++ K++K+ +  D
Sbjct  211   TCEI-LSAEG--FQQ--GFSSLPPTISEELFRLELDDCESSSRPLCAEMKKVQKATINFD  265

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGE  271
             N+LS AHTL+QI CVD K  LYD+ R LK CN+++TY RF +  KG RE+D+F++  +G+
Sbjct  266   NSLSPAHTLLQILCVDQKGLLYDMLRTLKDCNIKVTYGRFWSDKKGFREVDLFIKQADGK  325

Query  270   KILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFAL  91
             K++DPEKQ +L   ++ E+LHPLRV+I NRGPDTELLVANP+ELSG GRPRVFYD T AL
Sbjct  326   KVIDPEKQDALRSRMRSEMLHPLRVMIVNRGPDTELLVANPVELSGKGRPRVFYDATLAL  385

Query  90    KTLGICIFSV  61
             K LGICIFS 
Sbjct  386   KALGICIFSA  395



>gb|ACJ84336.1| unknown [Medicago truncatula]
Length=418

 Score =   382 bits (982),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 191/371 (51%), Positives = 257/371 (69%), Gaps = 8/371 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVIQ+     +P ++TVNC DK GLGC++CRIIL+FGL I + D+STDGRWC++V W
Sbjct  6     DDLVVIQHAKNANEPTIVTVNCPDKAGLGCDLCRIILEFGLRITRADISTDGRWCFIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP--YSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P  ++  + W  LK RL S CP   +S      +P  P    YL+ ++ I + GLLHD
Sbjct  66    VIPHPASLKIDWENLKTRLLSPCPSCLFSYNFNQRNPSPPPI--YLLKVWIIDQKGLLHD  123

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             + + LC  +L I+RVKV+ TPD R LD+F I D +EL + KE+++++C+ L   LGE CI
Sbjct  124   INEILCNLQLTIQRVKVMPTPDGRALDLFFITDEMELFHTKERRDDVCQCLSEALGERCI  183

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTID  451
             S EL+L   GP Y +L  FS+L P+ + ELF  EL + +  L  LS D+  LK   VT+D
Sbjct  184   SSELQLA--GPEYGHLQGFSSLPPAYSEELFGPELVD-KVSLHPLSQDMTTLKTPTVTVD  240

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHK-NG  274
             N+LSS HTL+QI CVD KS  YD+ R  K  ++++ Y RF+++ KG + +D+FVQ K +G
Sbjct  241   NSLSSVHTLLQIQCVDQKSLCYDLMRISKDSDIKVAYGRFNSSAKGFQNIDLFVQQKEDG  300

Query  273   EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
             +KI+DPE+  +LC CLK ++LHPLRV+I NRGPD ELLVANP+ELSG GRPRVFYDVT A
Sbjct  301   QKIIDPERLKTLCTCLKEKMLHPLRVIIVNRGPDIELLVANPVELSGKGRPRVFYDVTLA  360

Query  93    LKTLGICIFSV  61
             LK LG+ IFS 
Sbjct  361   LKALGVFIFSA  371



>ref|XP_010508999.1| PREDICTED: uncharacterized protein LOC104785475 [Camelina sativa]
Length=414

 Score =   382 bits (981),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 196/373 (53%), Positives = 252/373 (68%), Gaps = 16/373 (4%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+I+ G   GDP ++TVNC D+ GLG  +CRIIL+FGL+I + D STDGRWCY+V W
Sbjct  6     DDAVLIEPGKISGDPTIVTVNCPDESGLGSTLCRIILEFGLSITRADFSTDGRWCYIVFW  65

Query  984   VFP-QSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKT----PATSSYLMTLYCIGRTGL  820
             V P  +S+P + W  LK+RL S CP      Y          P  S YL+  +C  RTGL
Sbjct  66    VTPDNNSSPKIDWESLKNRLLSACPSCLASFYFSLQSNVSIPPTPSLYLLKFFCRDRTGL  125

Query  819   LHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGE  640
             LHDVT+ L E E  I+RVKV+TTPD RVLD+F I D ++LL+ K++Q E C+ L AVLGE
Sbjct  126   LHDVTKVLTELEFTIQRVKVMTTPDGRVLDMFFITDAMDLLHTKQRQTETCDHLTAVLGE  185

Query  639   SCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIV  460
               +SCEL+L   GP  E+L  FS+L P   +ELF  + S+  +             K+++
Sbjct  186   HGVSCELELA--GPELESLQRFSSLPPLAADELFGPDGSDISS---------SSSNKAVL  234

Query  459   TIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHK  280
             T+D+ LS AHTL+QI CVD K   YDI R  K C+V I Y RFS+  KG R LD+FV+  
Sbjct  235   TVDDHLSPAHTLLQIRCVDQKGLFYDILRTSKDCDVHIAYGRFSSKVKGYRNLDLFVRGT  294

Query  279   NGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVT  100
             +G+KI DP+ QA+ C  LK E++ PLRV+I NRGPD+ELLVANP+ELSG GRPRVFYDVT
Sbjct  295   DGKKIADPKHQANFCARLKEEMVCPLRVIIVNRGPDSELLVANPVELSGKGRPRVFYDVT  354

Query  99    FALKTLGICIFSV  61
              ALK+LG+CIFS 
Sbjct  355   LALKSLGVCIFSA  367



>gb|AAK74028.1| At2g39570/F12L6.23 [Arabidopsis thaliana]
 gb|AAN18158.1| At2g39570/F12L6.23 [Arabidopsis thaliana]
Length=411

 Score =   380 bits (976),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 196/375 (52%), Positives = 250/375 (67%), Gaps = 23/375 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+I+ G   GDP ++TVNC D+ GLG  +CRIIL+FGL+I + D STDGRWCY+V W
Sbjct  6     DDAVLIEPGKISGDPTVVTVNCPDESGLGSTLCRIILEFGLSITRADFSTDGRWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIY--LPSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P  S+P + W  LK+RL S CP      Y  L S  +   S YL+  +C  R GLLHD
Sbjct  66    VTPDISSPKIDWDSLKNRLLSACPSCLGSFYFCLQSNVSKPPSLYLLKFFCRDRKGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             VT+ L E E  I+RVKV+TTPD RVLD+F I D ++LL+ K++Q + C+ L AVLGE  +
Sbjct  126   VTKVLTELEFTIQRVKVMTTPDGRVLDMFFITDAMDLLHTKQRQTKTCDHLTAVLGEHGV  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKL-----KKS  466
             SCEL+L   GP  E++  FS+L P   +ELF               PD   +      K+
Sbjct  186   SCELELA--GPELESVQRFSSLPPLAADELF--------------GPDGFDISGSSSNKA  229

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
             ++T+DN LS AHTL+QI CVD K   YDI R  K C+V I Y RFS+  KG R L++FV+
Sbjct  230   VLTVDNQLSPAHTLLQIRCVDQKGLFYDILRTSKDCDVHIAYGRFSSKVKGYRNLELFVR  289

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +  KI+DP+ QA+ C  LK E++ PLRV+I NRGPDTELLVANP+ELSG GRPRVFYD
Sbjct  290   GTDENKIMDPKHQANFCARLKEEMVCPLRVIIVNRGPDTELLVANPVELSGKGRPRVFYD  349

Query  105   VTFALKTLGICIFSV  61
             VT ALK+LGICIFS 
Sbjct  350   VTLALKSLGICIFSA  364



>ref|XP_009141822.1| PREDICTED: uncharacterized protein LOC103865730 [Brassica rapa]
Length=406

 Score =   380 bits (975),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 196/375 (52%), Positives = 248/375 (66%), Gaps = 22/375 (6%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD+V+I+ G   GDP M+TVNC D+ GLG  +CRIIL+FGL+I K D STDGRWCY+V
Sbjct  4     LNDDAVLIEPGKNSGDPTMVTVNCPDESGLGSTLCRIILEFGLSITKADFSTDGRWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPP-----YSNLIYLPSPKTPATSSYLMTLYCIGRT  826
              WV P + +    W  LK+RL S CP      YS+L      K P  S YL+  +C  R 
Sbjct  64    FWVSPDNGSSRFDWDSLKNRLLSACPSCLGSYYSSLQSSNVSKPP--SLYLLKFFCRDRK  121

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT+ L E E  I+RVKV TTPD RVLD+F I D ++LL+ K++Q + C+ L AVL
Sbjct  122   GLLHDVTKVLTELEFTIQRVKVTTTPDGRVLDMFFITDAMDLLHTKQRQTKTCDHLTAVL  181

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             GE  +SCE++L   GP  E+L  FSAL P   +ELF  +++                 K 
Sbjct  182   GEHGVSCEIELA--GPELESLQRFSALPPEAADELFGSDVTSISN-------------KV  226

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
             ++T+DN LS AHTL+ I+C+D K   YDI R  K C+V I Y RFS+  KG R LD+FV+
Sbjct  227   VLTVDNHLSPAHTLLHINCIDQKGLFYDILRTSKDCDVHIAYGRFSSKVKGYRNLDLFVR  286

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G+KI DP+ Q S C  LK E+  PLRV+I NRGPD+ELLVANP+ELSG GRPRVFYD
Sbjct  287   GTDGKKIADPKHQDSFCSRLKEEISCPLRVIIVNRGPDSELLVANPVELSGKGRPRVFYD  346

Query  105   VTFALKTLGICIFSV  61
             VT ALK+LGICIFS 
Sbjct  347   VTLALKSLGICIFSA  361



>gb|AGV54627.1| hypothetical protein [Phaseolus vulgaris]
Length=419

 Score =   380 bits (975),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 193/374 (52%), Positives = 252/374 (67%), Gaps = 13/374 (3%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVIQ G    +P ++TVNC DK GLGC++CRIIL+FGL I + D+STDGRWCY+V W
Sbjct  6     DDGVVIQQGKDANEPCIVTVNCPDKAGLGCDLCRIILEFGLRITRADISTDGRWCYIVYW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP------YSNLIYLPSPKTPATSSYLMTLYCIGRTG  823
             V P  ++  V W  LK RL S CP       ++ L   PSP       YL+ ++C+ + G
Sbjct  66    VLPHPASVKVDWESLKTRLLSACPSCLFSYCFNQLSTSPSP----PPIYLLKVWCVDKKG  121

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHD+ + LC  EL I+RVK + TPD RVL++  I + +ELL+ K++Q+ + E LR  LG
Sbjct  122   LLHDINEILCNLELIIQRVKAMPTPDGRVLEMLFITEGMELLHTKKRQDHVSEFLRNALG  181

Query  642   ESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSI  463
             +  IS EL+L   GP Y NL  F  L P+   ELF  EL  ++  L  LS D+  LK   
Sbjct  182   KRGISRELQL--GGPEYGNLQGFFFLPPAFAEELFSFELL-DKVSLHPLSQDMKTLKTPT  238

Query  462   VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQH  283
             VT+DN+LS  HTL+QI CVD K   YDI R  K  ++++ + RFS++ +G R +D+FVQ 
Sbjct  239   VTVDNSLSPVHTLLQIQCVDQKGLCYDIMRISKDSDIKVAFGRFSSSVEGFRNIDLFVQQ  298

Query  282   KNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDV  103
              +G+KI+D + Q +LC CLK E+LHPLRV+I +RGPDTELLVANP+ELSG GRPRVFYDV
Sbjct  299   NDGKKIIDLDSQKTLCSCLKEEMLHPLRVIIVSRGPDTELLVANPVELSGKGRPRVFYDV  358

Query  102   TFALKTLGICIFSV  61
             T ALK LGICIFS 
Sbjct  359   TLALKALGICIFSA  372



>ref|XP_011027156.1| PREDICTED: uncharacterized protein LOC105127517 [Populus euphratica]
Length=423

 Score =   380 bits (975),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 197/373 (53%), Positives = 251/373 (67%), Gaps = 7/373 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ G+   DP ++TVNC DK GLGC++CRIIL+FGL+I + D  TDG+WCY+V+W
Sbjct  6     DDVVLIQQGSSSHDPTIVTVNCPDKSGLGCDLCRIILEFGLHITRADFQTDGKWCYIVLW  65

Query  984   V--FPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSP---KTPATSSYLMTLYCIGRTGL  820
             V     S+   + W  LK+RL  V PP    +Y        + A S YL+   C+ R GL
Sbjct  66    VVQLQHSNLLRLDWDSLKNRLLRVSPPCLTPLYYDQKLNGSSAAPSVYLLKFCCVDREGL  125

Query  819   LHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGE  640
             LH VT+ L E E  I+R+KV+TTPD +V+D+F I D  ELL+ K+++++ C  L  V  E
Sbjct  126   LHHVTEVLTELEFTIQRLKVMTTPDGKVVDLFFITDGRELLHTKKRRDDTCGYLCDVFRE  185

Query  639   SCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIV  460
              CI CEL+L   GP  +N   FS+L   V  ELF CELSE E+ +Q         KK+IV
Sbjct  186   YCIGCELQLA--GPECDNQRNFSSLPLVVAEELFSCELSEKESCMQAPRAATTSPKKAIV  243

Query  459   TIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHK  280
             T+DN LS AHTL+QI CVD K   YDI R  K  N+Q+ Y RFS++ KG R +D+FVQ  
Sbjct  244   TVDNLLSPAHTLLQIQCVDQKGLFYDILRISKDLNIQVAYGRFSSSIKGYRNMDLFVQQT  303

Query  279   NGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVT  100
             +G+KILDP+   +LC  LK E+LHPLRV+I+NRGPDTELLVANP+EL G GRPRVFYDVT
Sbjct  304   DGKKILDPKLLDNLCSRLKEEMLHPLRVIITNRGPDTELLVANPVELCGKGRPRVFYDVT  363

Query  99    FALKTLGICIFSV  61
              ALK LGICIFS 
Sbjct  364   LALKKLGICIFSA  376



>emb|CDY07020.1| BnaA04g22950D [Brassica napus]
Length=406

 Score =   379 bits (973),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 196/375 (52%), Positives = 248/375 (66%), Gaps = 22/375 (6%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD+V+I+ G   GDP M+TVNC D+ GLG  +CRIIL+FGL+I K D STDGRWCY+V
Sbjct  4     LNDDAVLIEPGKNSGDPTMVTVNCPDESGLGSTLCRIILEFGLSITKADFSTDGRWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPP-----YSNLIYLPSPKTPATSSYLMTLYCIGRT  826
              WV P + +    W  LK+RL S CP      YS+L      K P  S YL+  +C  R 
Sbjct  64    FWVSPDNGSSRFDWDSLKNRLLSACPSCLGSYYSSLQSSNVSKPP--SLYLLKFFCRDRK  121

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT+ L E E  I+RVKV TTPD RVLD+F I D ++LL+ K++Q + C+ L AVL
Sbjct  122   GLLHDVTKVLTELEFTIQRVKVTTTPDGRVLDMFFITDAMDLLHTKQRQTKTCDHLTAVL  181

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             GE  +SCE++L   GP  E+L  FSAL P   +ELF  +++                 K 
Sbjct  182   GEHGVSCEIELA--GPELESLQRFSALPPEAADELFGSDVTSISN-------------KV  226

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
             ++T+DN LS AHTL+ I+C+D K   YDI R  K C+V I Y RFS+  KG R LD+FV+
Sbjct  227   VLTVDNHLSPAHTLLHINCIDQKGLFYDILRTSKDCDVHIAYGRFSSKVKGYRNLDLFVR  286

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G+KI DP+ Q S C  LK E+  PLRV+I NRGPD+ELLVANP+ELSG GRPRVFYD
Sbjct  287   GTDGKKIADPKHQDSFCSRLKEEISCPLRVIIVNRGPDSELLVANPVELSGKGRPRVFYD  346

Query  105   VTFALKTLGICIFSV  61
             VT ALK+LGICIFS 
Sbjct  347   VTLALKSLGICIFSA  361



>ref|XP_004960506.1| PREDICTED: uncharacterized protein LOC101766737 [Setaria italica]
Length=448

 Score =   380 bits (976),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 197/369 (53%), Positives = 252/369 (68%), Gaps = 12/369 (3%)
 Frame = -2

Query  1149  IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMWVFPQS  970
             +Q     G+  ++TVNC D+ GLGC++CR IL+FGL I +GDVSTDG WC+VV WV P+S
Sbjct  36    MQLAAAEGEETVVTVNCPDQAGLGCDLCRTILEFGLRITRGDVSTDGHWCFVVFWVMPRS  95

Query  969   STPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHDVTQFLC  793
             ST  + WA LK+RL S+CP   ++ + P    P  S  YL+ L    R GLLHDVT  L 
Sbjct  96    STIKIRWASLKNRLMSMCPSSYSIPFYPDISQPGPSKFYLLKLLSPDRKGLLHDVTHILS  155

Query  792   ECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCISCELKL  613
             E EL I RVKV TTPD RV+D+F I D +ELL+ KE+Q+E C  L A LG S ISCE+ L
Sbjct  156   ELELLIHRVKVSTTPDGRVVDLFFITDGMELLHTKERQDETCSTLIATLGPS-ISCEV-L  213

Query  612   VAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDNALSSA  433
              A G  ++    FS+L P +  ELFR EL+++E     LS ++ +++ + +  DNALS A
Sbjct  214   SAEG--FQQ--GFSSLPPKIAEELFRVELADSEICSSSLSAELKRVQTATINFDNALSPA  269

Query  432   HTLIQISCVDYKSFLYDITRALKGCNVQITYARF-----SAANKGQRELDVFVQHKNGEK  268
             HTL+QI C D K   YDI R +K CN+QI Y RF      + NKG RE+D+FV+  +G+K
Sbjct  270   HTLVQIICPDQKGLSYDILRTMKDCNIQIFYGRFRSDKKGSGNKGCREVDLFVKQVDGKK  329

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             ++DPEKQ  L   L+ E+LHPLRV+I +RGPDTELLVANP+ELSG GRPRVFYD T ALK
Sbjct  330   VIDPEKQEVLRSRLRSEMLHPLRVMIVSRGPDTELLVANPVELSGKGRPRVFYDATLALK  389

Query  87    TLGICIFSV  61
              LGICIFS 
Sbjct  390   ALGICIFSA  398



>ref|XP_002439153.1| hypothetical protein SORBIDRAFT_09g001450 [Sorghum bicolor]
 gb|EES17583.1| hypothetical protein SORBIDRAFT_09g001450 [Sorghum bicolor]
Length=447

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 196/369 (53%), Positives = 253/369 (69%), Gaps = 12/369 (3%)
 Frame = -2

Query  1149  IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMWVFPQS  970
             +Q     G+  +ITVNC D+ GLGC++CR IL+FGL I +GDVSTDG WC+VV WV P+S
Sbjct  35    MQLAAAEGEETVITVNCPDQAGLGCDLCRTILEFGLRITRGDVSTDGHWCFVVFWVVPRS  94

Query  969   STPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSSY-LMTLYCIGRTGLLHDVTQFLC  793
             S+  + WA LK+RL S+CP   ++ + P    P  S Y L+ L    R GLLHDVT  L 
Sbjct  95    SSIKIRWASLKNRLMSMCPSSYSIPFYPDISQPGPSQYYLLKLLSPDRKGLLHDVTHILS  154

Query  792   ECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCISCELKL  613
             + EL I RVKV TTPD RV+D+F I D +ELL+ KE+QEE C  L A LG S ISCE+ L
Sbjct  155   DLELIIHRVKVCTTPDGRVVDLFFITDGMELLHKKERQEETCSTLIATLGPS-ISCEV-L  212

Query  612   VAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDNALSSA  433
              A G  ++    FS+L P +  ELFR EL+++E     LS ++ K++ + +  DN+LS A
Sbjct  213   SAEG--FQQ--GFSSLPPKIAEELFRVELADSEICSSSLSVELKKVQTATINFDNSLSPA  268

Query  432   HTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQ-----RELDVFVQHKNGEK  268
             HTL+QI C D K  +YDI R +K CN+QI Y RF +  KG      RE+D+FV+  +G+K
Sbjct  269   HTLVQIICADQKGLIYDILRTMKDCNIQIFYGRFRSDKKGSVSKGCREVDLFVKQVDGKK  328

Query  267   ILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALK  88
             ++DPEKQ +L   L+ E+LHPLRV+I +RGPDTELLVANP+ELSG GRPRVFYD T ALK
Sbjct  329   VMDPEKQDALRSRLRSEMLHPLRVMIVSRGPDTELLVANPVELSGKGRPRVFYDATLALK  388

Query  87    TLGICIFSV  61
              LGICIFS 
Sbjct  389   ALGICIFSA  397



>ref|XP_010517312.1| PREDICTED: uncharacterized protein LOC104792784 [Camelina sativa]
Length=415

 Score =   376 bits (966),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 195/374 (52%), Positives = 250/374 (67%), Gaps = 17/374 (5%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+I+ G   GDP ++TVNC D+ GLG  +CRIIL+FGL+I + D STDGRWCY+V W
Sbjct  6     DDAVLIEPGKISGDPTIVTVNCPDESGLGSTLCRIILEFGLSITRADFSTDGRWCYIVFW  65

Query  984   VFP--QSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKT----PATSSYLMTLYCIGRTG  823
             V P   +S+P + W  LK+RL S CP      Y          P  S YL+  +C  R G
Sbjct  66    VTPDNNNSSPKIDWESLKNRLLSACPSCLGSFYFSLQSNVSIPPPPSLYLLKFFCRDRKG  125

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHDVT+ L E E  I+RVKV+TTPD RVLD+F I D ++LL+ K++Q E C+ L AVLG
Sbjct  126   LLHDVTKVLTELEFTIQRVKVMTTPDGRVLDMFFITDAMDLLHTKQRQTETCDHLTAVLG  185

Query  642   ESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSI  463
             E  +SCEL+L   GP  E+L  FS+L P   +ELF  + S+  +             K++
Sbjct  186   EHGVSCELELA--GPELESLQRFSSLPPLAADELFGPDGSDISS---------SSSNKAV  234

Query  462   VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQH  283
             +T+D+ LS AHTL+QI CVD K   YDI R  K C+V I Y RFS+  KG R LD+FV+ 
Sbjct  235   LTVDDHLSPAHTLLQIRCVDQKGLFYDILRTSKDCDVHIAYGRFSSKVKGYRNLDLFVRG  294

Query  282   KNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDV  103
              +G+KI D + QA+ C  LK E++ PLRV+I NRGPD+ELLVANP+ELSG GRPRVFYDV
Sbjct  295   TDGKKISDSKHQANFCARLKEEMVCPLRVIIVNRGPDSELLVANPVELSGKGRPRVFYDV  354

Query  102   TFALKTLGICIFSV  61
             T ALK+LGICIFS 
Sbjct  355   TLALKSLGICIFSA  368



>gb|KHG23446.1| [Protein-PII] uridylyltransferase [Gossypium arboreum]
Length=426

 Score =   375 bits (963),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 193/374 (52%), Positives = 250/374 (67%), Gaps = 10/374 (3%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ    P +P ++TVNC DK GLGC++CR +L+FGL+I + D STDGRWCY+V W
Sbjct  6     DDVVLIQLPKDPSEPTIVTVNCPDKPGLGCDLCRTLLEFGLSITRADFSTDGRWCYMVFW  65

Query  984   VFPQSSTPI-VTWAKLKDRLWSVCP----PYSNLIYLPSPKTPATSS---YLMTLYCIGR  829
             + P  S    + W  LK+RL S+CP    P+ +  Y       +T+    YL+ L C+ R
Sbjct  66    LVPSVSNSCEIDWESLKNRLVSMCPSCLVPFFSFNYQQGDGNGSTTHSLIYLLKLCCLDR  125

Query  828   TGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAV  649
              GLLHDVT+ L E +  I+RVKV+TTPD RV+ +  I D +ELL+ KE++++  E L +V
Sbjct  126   KGLLHDVTRILSELQFTIQRVKVMTTPDGRVMYLVFITDGMELLHTKERRDDTREHLISV  185

Query  648   LGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKK  469
             L   CISCEL+L   GP YENL    +L P+V  ELF  EL+  E   +EL  D+M LKK
Sbjct  186   LKNYCISCELQLA--GPEYENLKALPSLPPAVAEELFTYELAGKEASSKELKSDMMTLKK  243

Query  468   SIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFV  289
             + VT+DN LS AHTL+QI CVD K   YDI R  K  + QI Y RFS++ K  R LD+F+
Sbjct  244   ATVTVDNLLSPAHTLLQIQCVDQKGLFYDILRTSKDFDFQIAYGRFSSSVKSYRSLDLFI  303

Query  288   QHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFY  109
             +  NG KI+DP+   +LC  L+ E+L P RV++ NRGPDTELLVANP+E SG GRPRVFY
Sbjct  304   RQANGNKIVDPKHLNALCSRLQEEMLQPFRVIVVNRGPDTELLVANPVESSGKGRPRVFY  363

Query  108   DVTFALKTLGICIF  67
             DVT ALK LGI IF
Sbjct  364   DVTLALKMLGIRIF  377



>ref|XP_003621863.1| hypothetical protein MTR_7g024320 [Medicago truncatula]
Length=433

 Score =   375 bits (963),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 192/386 (50%), Positives = 257/386 (67%), Gaps = 23/386 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVIQ+     +P ++TVNC DK GLGC++CRIIL+FGL I + D+STDGRWC++V W
Sbjct  6     DDLVVIQHAKNANEPTIVTVNCPDKAGLGCDLCRIILEFGLRITRADISTDGRWCFIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP--YSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P  ++  + W  LK RL S CP   +S      +P  P    YL+ ++ I + GLLHD
Sbjct  66    VIPHPASLKIDWENLKTRLLSPCPSCLFSYNFNQRNPSPPPI--YLLKVWIIDQKGLLHD  123

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLE---------------LLNIKEKQE  676
             + + LC  +L I+RVKV+ TPD R LD+F I D +E               L + KE+++
Sbjct  124   INEILCNLQLTIQRVKVMPTPDGRALDLFFITDEIEKSVYLVYALIETLKELFHTKERRD  183

Query  675   ELCEQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQEL  496
             ++C+ L   LGE CIS EL+L   GP Y +L  FS+L P+ + ELF  EL  ++  L  L
Sbjct  184   DVCQYLSEALGERCISSELQLA--GPEYGHLQGFSSLPPAYSEELFGPELV-DKVSLHPL  240

Query  495   SPDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANK  316
             S D+  LK   VT+DN+LSS HTL+QI CVD KS  YD+ R  K  ++++ Y RF+++ K
Sbjct  241   SQDMTTLKTPTVTVDNSLSSVHTLLQIQCVDQKSLCYDLMRISKDSDIKVAYGRFNSSAK  300

Query  315   GQRELDVFVQHK-NGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLEL  139
             G + +D+FVQ K +G+KI+DPE+  +LC CLK E+LHPLRV+I NRGPD ELLVANP+EL
Sbjct  301   GFQNIDLFVQQKEDGQKIIDPERLKTLCTCLKEEMLHPLRVIIVNRGPDIELLVANPVEL  360

Query  138   SGMGRPRVFYDVTFALKTLGICIFSV  61
             SG GRPRVFYDVT ALK LG+ IFS 
Sbjct  361   SGKGRPRVFYDVTLALKALGVFIFSA  386



>gb|KDP44992.1| hypothetical protein JCGZ_01492 [Jatropha curcas]
Length=416

 Score =   374 bits (960),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 192/375 (51%), Positives = 249/375 (66%), Gaps = 17/375 (5%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ+     DP ++TVNC DK GLGC++CRIIL+FGL+I + D STDGRWCY+V W
Sbjct  7     DDVVLIQHAKTSADPSVVTVNCPDKAGLGCDLCRIILEFGLSITRADFSTDGRWCYIVFW  66

Query  984   VFPQS--STPIVTWAKLKDRLWSVCPPYSNLIYLP----SPKTPATSSYLMTLYCIGRTG  823
             V P S  S+  + W  LK+RL    PP     Y       P  P    YL+    + R G
Sbjct  67    VVPDSTSSSHKLDWDSLKNRLSFASPPCLIPFYFDQKSNGPSLPPL--YLLKFCFVDRKG  124

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHDVT+ L E +  I+RVKV+TTPD +V+D+F I D +ELL  ++++ + C  L AV  
Sbjct  125   LLHDVTKVLTELQFTIQRVKVMTTPDGKVVDLFFITDGMELLLTEKRRVDTCRHLFAVFK  184

Query  642   ESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSI  463
             E CISCEL+L   GP YE+L  FS+L  ++  ELF        +  Q +  D    KK+ 
Sbjct  185   EYCISCELQLA--GPEYESLQNFSSLPLTIAEELF-------SSCTQAILMDTSSSKKAS  235

Query  462   VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQH  283
             VT+DN LS AHTL+QI C+D K   YDI R  K C++QI Y RFS++ KG R +D+F+Q 
Sbjct  236   VTVDNHLSPAHTLLQIQCIDQKGLFYDILRTSKDCDIQIAYGRFSSSVKGHRNVDLFIQQ  295

Query  282   KNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDV  103
              +G+KI+DP+ Q +LC  LK E+LHP RV++ N+GPDTELLVANP+EL G GRPRVFYDV
Sbjct  296   SDGKKIIDPKLQLTLCSRLKAEMLHPFRVIVVNQGPDTELLVANPVELCGKGRPRVFYDV  355

Query  102   TFALKTLGICIFSVR  58
             T ALKTLGICIFS +
Sbjct  356   TLALKTLGICIFSAK  370



>ref|XP_008647291.1| PREDICTED: uncharacterized protein LOC100191634 isoform X1 [Zea 
mays]
Length=443

 Score =   367 bits (942),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 191/373 (51%), Positives = 251/373 (67%), Gaps = 16/373 (4%)
 Frame = -2

Query  1149  IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMWVFPQS  970
             +Q     G+  +ITVNC D+ GLGC++CR IL+FGL I +GDVSTDG WC+VV WV P+S
Sbjct  27    MQLAXAEGEETVITVNCPDQAGLGCDLCRTILEFGLRITRGDVSTDGHWCFVVFWVVPRS  86

Query  969   STPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHDVTQFLC  793
             S+  + WA LK+RL S+CP   ++ + P    P  S  YL+ L    R GLLHDVT  L 
Sbjct  87    SSIRIRWASLKNRLMSMCPSSYSIPFYPDMSQPGPSQFYLLKLLSPDRKGLLHDVTHILS  146

Query  792   ECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCISCELKL  613
             + EL I RVKV TTPD RV+D+F I D +ELL+ KE+QEE C  L A LG S ISCE+ L
Sbjct  147   DLELIIHRVKVSTTPDGRVVDLFFITDGMELLHKKERQEETCSTLIAALGPS-ISCEV-L  204

Query  612   VAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQE--LSPDVMKLKKSIVTIDNALS  439
              A G  ++    FS+L+P +  ELFR EL+ +        +S ++ K++ + +  DN+LS
Sbjct  205   SAEG--FQQ--GFSSLAPKIAEELFRVELAGDGEMCSSSLISAELKKVQTATINFDNSLS  260

Query  438   SAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSA-------ANKGQRELDVFVQHK  280
              AHTL+QI C D K  +YDI R +K CN+QI Y RF +        +KG RE+D+FV+  
Sbjct  261   PAHTLVQIICADQKGLIYDILRTMKDCNIQIFYGRFRSDKKGGRPGSKGCREVDLFVKQV  320

Query  279   NGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVT  100
             +G+K+ DPEKQ +L   L+ E+LHPLRV++ +RGPDTELLVANP+EL G GRPRVFYD T
Sbjct  321   DGKKVTDPEKQDALRARLRSEMLHPLRVMVVSRGPDTELLVANPVELCGKGRPRVFYDAT  380

Query  99    FALKTLGICIFSV  61
              ALK LG+CIFS 
Sbjct  381   LALKALGVCIFSA  393



>gb|KHN30188.1| hypothetical protein glysoja_010566 [Glycine soja]
Length=371

 Score =   362 bits (929),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 192/361 (53%), Positives = 240/361 (66%), Gaps = 51/361 (14%)
 Frame = -2

Query  1137  NKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMWVFPQSST-P  961
             NKPGDP++IT NC DK GL C+ICRIILDFGL I KGDVSTDG WCY V+WV P S   P
Sbjct  13    NKPGDPFIITFNCPDKTGLACDICRIILDFGLCITKGDVSTDGVWCYFVLWVIPHSVLLP  72

Query  960   IV-TWAKLKDRLWSVCPPYSNLIYLPSPKTPATSSYLMTLYCIGRTGLLHDVTQFLCECE  784
             I  ++  LK+RL  +CPP                                      C   
Sbjct  73    ITCSYLILKERLQEICPP--------------------------------------CLAS  94

Query  783   LYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCISCELKLVAP  604
              YI +    ++P      V+++K   ELL+ + +Q+E CE+L AVL +SC SCEL+L   
Sbjct  95    FYIIQQPSRSSP------VYLLK---ELLHTRNRQDETCERLNAVLRDSCTSCELQLA--  143

Query  603   GPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDNALSSAHTL  424
             GP YE     S+LSP++  ELFRCELS+N+   Q L+PD+ KLKK+ V IDN LS AHTL
Sbjct  144   GPEYEYNQGISSLSPAIAEELFRCELSDNQVRSQALTPDMTKLKKANVAIDNYLSPAHTL  203

Query  423   IQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEKILDPEKQA  244
             +QI C D+K  LYDI R LK  N++I+Y RFS  + G R+LD+F+Q  +G+KILD EKQ+
Sbjct  204   VQIRCADHKGRLYDIMRTLKDMNMKISYGRFSPNSMGYRDLDIFIQQNDGKKILDREKQS  263

Query  243   SLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALKTLGICIFS  64
             +LC  LK E+LHPLRV+I+NRGPDTELLVANP+ELSG+GRPRVFYDVTFALKTLGIC+FS
Sbjct  264   ALCSHLKQEMLHPLRVIIANRGPDTELLVANPVELSGIGRPRVFYDVTFALKTLGICVFS  323

Query  63    V  61
              
Sbjct  324   A  324



>ref|XP_008654649.1| PREDICTED: uncharacterized protein LOC100274521 isoform X2 [Zea 
mays]
 gb|AFW82846.1| hypothetical protein ZEAMMB73_547714 [Zea mays]
Length=543

 Score =   367 bits (941),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 192/379 (51%), Positives = 249/379 (66%), Gaps = 21/379 (6%)
 Frame = -2

Query  1149  IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMWVFPQS  970
             +Q G   G+  ++TVNC D+ GLGC++CR IL+FGL I + DVSTDG WC+VV WV P+S
Sbjct  95    MQLGGAEGEETVVTVNCPDQTGLGCDLCRTILEFGLRITRADVSTDGHWCFVVFWVVPRS  154

Query  969   STPIVTWAKLKDRLWSVCPPYSNLIY----LPSPKTPATSSYLMTLYCIGRTGLLHDVTQ  802
             S+  V WA LK+RL S+CP   ++ +    +  P+      YL+ L    R GLLHDVT 
Sbjct  155   SSIKVRWASLKNRLMSMCPSSYSIPFFYRDVSQPEPGPLQFYLLKLMSPDRKGLLHDVTH  214

Query  801   FLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCISCE  622
              L + EL I RVKV TTPD RV+D+F I D +ELL+ KE+QEE C  L A LG S ISCE
Sbjct  215   ILSDLELIIHRVKVSTTPDGRVVDLFFITDGMELLHRKERQEETCSALTATLGPS-ISCE  273

Query  621   LKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHL--QELSPDVMKLKK-SIVTID  451
                V P   ++    FS+L P +  ELFR EL++ ++ +    LS ++ K++  + V  D
Sbjct  274   ---VVPAEGFQQ--GFSSLPPEIAEELFRAELADTDSEVCSSPLSAELRKVRTTATVNFD  328

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQ--------RELDV  295
             N+LS AHTL+QI C D K  +YDI R +K CN+QI Y RF +  KG         RE+D+
Sbjct  329   NSLSPAHTLVQIVCADQKGLIYDILRTMKDCNIQIFYGRFRSDKKGSASKGSSGCREVDL  388

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             FV+  +G+K+ DP KQ +L   L+ E LHPLRV++  RGPDTELLVANP+E SG GRPRV
Sbjct  389   FVKQVDGKKVTDPAKQDALRSRLRSETLHPLRVMVVGRGPDTELLVANPVEASGKGRPRV  448

Query  114   FYDVTFALKTLGICIFSVR  58
             FYD T ALK LGICIFSVR
Sbjct  449   FYDATLALKALGICIFSVR  467



>gb|ACG35222.1| amino acid binding protein [Zea mays]
Length=443

 Score =   362 bits (929),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 189/373 (51%), Positives = 249/373 (67%), Gaps = 16/373 (4%)
 Frame = -2

Query  1149  IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMWVFPQS  970
             +Q     G+  +ITVNC D+ GLGC++CR IL+FGL I +GDVSTDG WC+VV WV P+S
Sbjct  27    MQLAXAEGEETVITVNCPDQAGLGCDLCRTILEFGLRITRGDVSTDGHWCFVVFWVVPRS  86

Query  969   STPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHDVTQFLC  793
             S+  + WA LK+RL S+CP   ++ + P    P  S  YL+ L    R GLLHDVT  L 
Sbjct  87    SSIRIRWASLKNRLMSMCPSSYSIPFYPDMSQPGPSQFYLLKLLSPDRKGLLHDVTHILS  146

Query  792   ECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCISCELKL  613
             + EL I RVKV TTPD RV+D+F I D +ELL+ KE+QEE C  L A LG S ISCE+ L
Sbjct  147   DLELIIHRVKVSTTPDGRVVDLFFITDGMELLHKKERQEETCSTLIAALGPS-ISCEV-L  204

Query  612   VAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQE--LSPDVMKLKKSIVTIDNALS  439
              A G  ++    FS+L+P +  ELFR EL+ +        +S ++ K++ + +  DN+LS
Sbjct  205   SAEG--FQQ--GFSSLAPEIAEELFRVELAGDGEMCSSSLISAELKKVQTATINFDNSLS  260

Query  438   SAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSA-------ANKGQRELDVFVQHK  280
              AHTL+QI C D K  +YDI R +K CN+QI Y RF +        +KG RE+D+FV+  
Sbjct  261   PAHTLVQIICADQKGLIYDILRTMKDCNIQIFYGRFRSDKKGGRPGSKGCREVDLFVKQV  320

Query  279   NGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVT  100
             +G+K+ DPEKQ +L   L+ E+LHPLRV++ +RGPDTELLVANP+EL G GRPRVFY  T
Sbjct  321   DGKKVTDPEKQDALRARLRSEMLHPLRVMVVSRGPDTELLVANPVELCGKGRPRVFYXAT  380

Query  99    FALKTLGICIFSV  61
              ALK  G+CIFS 
Sbjct  381   LALKAXGVCIFSA  393



>ref|XP_008654652.1| PREDICTED: uncharacterized protein LOC100274521 isoform X4 [Zea 
mays]
 gb|ACN33498.1| unknown [Zea mays]
 gb|AFW82847.1| hypothetical protein ZEAMMB73_547714 [Zea mays]
Length=516

 Score =   363 bits (931),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 190/378 (50%), Positives = 247/378 (65%), Gaps = 21/378 (6%)
 Frame = -2

Query  1149  IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMWVFPQS  970
             +Q G   G+  ++TVNC D+ GLGC++CR IL+FGL I + DVSTDG WC+VV WV P+S
Sbjct  95    MQLGGAEGEETVVTVNCPDQTGLGCDLCRTILEFGLRITRADVSTDGHWCFVVFWVVPRS  154

Query  969   STPIVTWAKLKDRLWSVCPPYSNLIY----LPSPKTPATSSYLMTLYCIGRTGLLHDVTQ  802
             S+  V WA LK+RL S+CP   ++ +    +  P+      YL+ L    R GLLHDVT 
Sbjct  155   SSIKVRWASLKNRLMSMCPSSYSIPFFYRDVSQPEPGPLQFYLLKLMSPDRKGLLHDVTH  214

Query  801   FLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCISCE  622
              L + EL I RVKV TTPD RV+D+F I D +ELL+ KE+QEE C  L A LG S ISCE
Sbjct  215   ILSDLELIIHRVKVSTTPDGRVVDLFFITDGMELLHRKERQEETCSALTATLGPS-ISCE  273

Query  621   LKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHL--QELSPDVMKLKK-SIVTID  451
                V P   ++    FS+L P +  ELFR EL++ ++ +    LS ++ K++  + V  D
Sbjct  274   ---VVPAEGFQQ--GFSSLPPEIAEELFRAELADTDSEVCSSPLSAELRKVRTTATVNFD  328

Query  450   NALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQ--------RELDV  295
             N+LS AHTL+QI C D K  +YDI R +K CN+QI Y RF +  KG         RE+D+
Sbjct  329   NSLSPAHTLVQIVCADQKGLIYDILRTMKDCNIQIFYGRFRSDKKGSASKGSSGCREVDL  388

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             FV+  +G+K+ DP KQ +L   L+ E LHPLRV++  RGPDTELLVANP+E SG GRPRV
Sbjct  389   FVKQVDGKKVTDPAKQDALRSRLRSETLHPLRVMVVGRGPDTELLVANPVEASGKGRPRV  448

Query  114   FYDVTFALKTLGICIFSV  61
             FYD T ALK LGICIFS 
Sbjct  449   FYDATLALKALGICIFSA  466



>gb|KDO67682.1| hypothetical protein CISIN_1g0447301mg, partial [Citrus sinensis]
Length=367

 Score =   357 bits (916),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 227/322 (70%), Gaps = 5/322 (2%)
 Frame = -2

Query  1020  STDGRWCYVVMWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL--PSPKTPATSSYLMT  847
             STDGRWCY+V+WV P +S+  V W  LK+RL SVCP      Y   PS  +   S YL+ 
Sbjct  2     STDGRWCYIVLWVVPDASSDKVDWESLKNRLLSVCPSILVSYYFNQPSSNSSKPSLYLLK  61

Query  846   LYCIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELC  667
               C+ R GLLHD T+ L E E  I+RVKV+TTPD RVLD+F I D LELL+ K+++EE C
Sbjct  62    YCCVDRKGLLHDATKVLTELEFTIQRVKVMTTPDGRVLDLFFITDGLELLHTKQRREETC  121

Query  666   EQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPD  487
             E + AVLGE  ISCE++L   GP YE+L  F++L P+V  ELF  EL + E   + LS +
Sbjct  122   EHMIAVLGEYSISCEIQLA--GPEYESLQAFTSLPPAVAEELFGSELPDKEDFSRVLSTE  179

Query  486   VMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQR  307
             V + K SI T+DN LS AHTL+QI C D K   YDI R  K  N+QI Y R S++ KG R
Sbjct  180   VTQNKASI-TVDNLLSPAHTLLQIKCADQKGLFYDILRTSKDLNIQIAYGRISSSVKGYR  238

Query  306   ELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMG  127
              +D+F++  +G+K++DP++Q +LC+ LK E+LHPLRV+++NRGPDTELLVANP+EL G G
Sbjct  239   NMDLFIRQTDGKKVVDPKQQTALCFHLKEEMLHPLRVMVTNRGPDTELLVANPVELCGKG  298

Query  126   RPRVFYDVTFALKTLGICIFSV  61
             RPRVFYDVT ALK LGICIFS 
Sbjct  299   RPRVFYDVTLALKALGICIFSA  320



>ref|XP_010243241.1| PREDICTED: uncharacterized protein LOC104587361 [Nelumbo nucifera]
Length=408

 Score =   358 bits (919),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 192/375 (51%), Positives = 250/375 (67%), Gaps = 23/375 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I+   KPGDP +ITVNC DK GLGC++CRIIL FGL+I +GD+STDG+WCY+V W
Sbjct  6     DDVVLIREPEKPGDPSVITVNCPDKTGLGCDLCRIILFFGLSIVRGDISTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIY----LPSPKTPATSSYLMTLYCIGRTGLL  817
             V  +   P   W+ LK RL   CP  S + Y    L  PK P    +L+ L C  RTGLL
Sbjct  66    VVGR---PATRWSLLKIRLAEACPSASGIYYYRAELQQPKPPDL--FLLKLCCYDRTGLL  120

Query  816   HDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGES  637
             HDVT+ L E EL I RVKV TTPD +V+D+F+IKD  ELL+ K++QE+ CE LRAVLG++
Sbjct  121   HDVTKVLGELELIIRRVKVSTTPDGKVMDLFVIKDTRELLHTKKRQEDTCEYLRAVLGDA  180

Query  636   CISCELKLVAPGPLYENLPC---FSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
              ISC++ L       E + C    S L  ++T E+F  E+ E++      S    +   S
Sbjct  181   MISCDIDLAGS----EMVSCPQGSSFLLSAITEEMFSLEMPEHK------SGSSAQCNVS  230

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              VT+DN LS +HT+IQI+C D+K  LYDI R LK  N+QI+Y RFSA  +G  E+++FV 
Sbjct  231   -VTMDNILSPSHTVIQITCQDHKGLLYDIMRTLKDYNIQISYGRFSAKQRGSCEVELFVM  289

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               + +KI+DP KQ +L   L++EL HPLRV + +RGPDTELLV NP+E SG GRP VFYD
Sbjct  290   QSDRKKIVDPNKQNALSSRLRMELFHPLRVAVVSRGPDTELLVVNPVEFSGKGRPLVFYD  349

Query  105   VTFALKTLGICIFSV  61
             +T AL+ L  CIFS 
Sbjct  350   ITLALRMLKTCIFSA  364



>ref|XP_008654648.1| PREDICTED: uncharacterized protein LOC100274521 isoform X1 [Zea 
mays]
 gb|AFW82848.1| hypothetical protein ZEAMMB73_547714 [Zea mays]
Length=544

 Score =   362 bits (929),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 192/380 (51%), Positives = 249/380 (66%), Gaps = 22/380 (6%)
 Frame = -2

Query  1149  IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNI-KKGDVSTDGRWCYVVMWVFPQ  973
             +Q G   G+  ++TVNC D+ GLGC++CR IL+FGL I +  DVSTDG WC+VV WV P+
Sbjct  95    MQLGGAEGEETVVTVNCPDQTGLGCDLCRTILEFGLRITRAADVSTDGHWCFVVFWVVPR  154

Query  972   SSTPIVTWAKLKDRLWSVCPPYSNLIY----LPSPKTPATSSYLMTLYCIGRTGLLHDVT  805
             SS+  V WA LK+RL S+CP   ++ +    +  P+      YL+ L    R GLLHDVT
Sbjct  155   SSSIKVRWASLKNRLMSMCPSSYSIPFFYRDVSQPEPGPLQFYLLKLMSPDRKGLLHDVT  214

Query  804   QFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCISC  625
               L + EL I RVKV TTPD RV+D+F I D +ELL+ KE+QEE C  L A LG S ISC
Sbjct  215   HILSDLELIIHRVKVSTTPDGRVVDLFFITDGMELLHRKERQEETCSALTATLGPS-ISC  273

Query  624   ELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHL--QELSPDVMKLKK-SIVTI  454
             E   V P   ++    FS+L P +  ELFR EL++ ++ +    LS ++ K++  + V  
Sbjct  274   E---VVPAEGFQQ--GFSSLPPEIAEELFRAELADTDSEVCSSPLSAELRKVRTTATVNF  328

Query  453   DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQ--------RELD  298
             DN+LS AHTL+QI C D K  +YDI R +K CN+QI Y RF +  KG         RE+D
Sbjct  329   DNSLSPAHTLVQIVCADQKGLIYDILRTMKDCNIQIFYGRFRSDKKGSASKGSSGCREVD  388

Query  297   VFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPR  118
             +FV+  +G+K+ DP KQ +L   L+ E LHPLRV++  RGPDTELLVANP+E SG GRPR
Sbjct  389   LFVKQVDGKKVTDPAKQDALRSRLRSETLHPLRVMVVGRGPDTELLVANPVEASGKGRPR  448

Query  117   VFYDVTFALKTLGICIFSVR  58
             VFYD T ALK LGICIFSVR
Sbjct  449   VFYDATLALKALGICIFSVR  468



>ref|XP_006851299.1| hypothetical protein AMTR_s00050p00129660 [Amborella trichopoda]
 gb|ERN12880.1| hypothetical protein AMTR_s00050p00129660 [Amborella trichopoda]
Length=411

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 192/375 (51%), Positives = 248/375 (66%), Gaps = 20/375 (5%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I++    GDP ++TVNC DK GLGC++CRIIL F L+I +GD+STDG+WCY+V+W
Sbjct  6     DDVVLIRHAQNEGDPTIVTVNCPDKTGLGCDLCRIILQFSLSIVRGDISTDGKWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL-------PSPKTPATSSYLMTLYCIGRT  826
             V  +     V W+ LK RL S CP  S+   L        SPK P    YL+      R+
Sbjct  66    VVSRPGHA-VRWSNLKKRLISACPSCSSAASLYCSPSLEASPKPPQV--YLLKFSSPNRS  122

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT+ LCE EL I+RVKV TTPD  V+D+F I D  EL++ K++Q + CEQLRAVL
Sbjct  123   GLLHDVTEVLCELELTIKRVKVSTTPDGNVMDLFFITDTRELMHTKKRQLDTCEQLRAVL  182

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             GES I CE++     P      C S + P++ +EL   +        +E SP + KL   
Sbjct  183   GESVIQCEIE--PADPEMGGHQCSSFILPAIPDELLNVDD-------EEPSP-LDKLNHL  232

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              VT+DN+L  +HTLIQI C D+K  LYDI R LK  N+QI+Y RFSA  K   E+D+FV 
Sbjct  233   SVTVDNSLRPSHTLIQILCRDHKGLLYDIMRTLKDYNIQISYGRFSARWKQLCEVDLFVM  292

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G+K++D EKQ +LC  L+ ELLHPLRV++  RGPDTELLVANP+ELSG GRP VF+D
Sbjct  293   QADGKKVVDAEKQNALCSRLRSELLHPLRVMVVGRGPDTELLVANPVELSGKGRPLVFFD  352

Query  105   VTFALKTLGICIFSV  61
             +T AL+ LGI IFS 
Sbjct  353   ITLALRMLGISIFSA  367



>ref|XP_008654650.1| PREDICTED: uncharacterized protein LOC100274521 isoform X3 [Zea 
mays]
Length=517

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 190/379 (50%), Positives = 247/379 (65%), Gaps = 22/379 (6%)
 Frame = -2

Query  1149  IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNI-KKGDVSTDGRWCYVVMWVFPQ  973
             +Q G   G+  ++TVNC D+ GLGC++CR IL+FGL I +  DVSTDG WC+VV WV P+
Sbjct  95    MQLGGAEGEETVVTVNCPDQTGLGCDLCRTILEFGLRITRAADVSTDGHWCFVVFWVVPR  154

Query  972   SSTPIVTWAKLKDRLWSVCPPYSNLIY----LPSPKTPATSSYLMTLYCIGRTGLLHDVT  805
             SS+  V WA LK+RL S+CP   ++ +    +  P+      YL+ L    R GLLHDVT
Sbjct  155   SSSIKVRWASLKNRLMSMCPSSYSIPFFYRDVSQPEPGPLQFYLLKLMSPDRKGLLHDVT  214

Query  804   QFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCISC  625
               L + EL I RVKV TTPD RV+D+F I D +ELL+ KE+QEE C  L A LG S ISC
Sbjct  215   HILSDLELIIHRVKVSTTPDGRVVDLFFITDGMELLHRKERQEETCSALTATLGPS-ISC  273

Query  624   ELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHL--QELSPDVMKLKK-SIVTI  454
             E   V P   ++    FS+L P +  ELFR EL++ ++ +    LS ++ K++  + V  
Sbjct  274   E---VVPAEGFQQ--GFSSLPPEIAEELFRAELADTDSEVCSSPLSAELRKVRTTATVNF  328

Query  453   DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQ--------RELD  298
             DN+LS AHTL+QI C D K  +YDI R +K CN+QI Y RF +  KG         RE+D
Sbjct  329   DNSLSPAHTLVQIVCADQKGLIYDILRTMKDCNIQIFYGRFRSDKKGSASKGSSGCREVD  388

Query  297   VFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPR  118
             +FV+  +G+K+ DP KQ +L   L+ E LHPLRV++  RGPDTELLVANP+E SG GRPR
Sbjct  389   LFVKQVDGKKVTDPAKQDALRSRLRSETLHPLRVMVVGRGPDTELLVANPVEASGKGRPR  448

Query  117   VFYDVTFALKTLGICIFSV  61
             VFYD T ALK LGICIFS 
Sbjct  449   VFYDATLALKALGICIFSA  467



>ref|XP_006654914.1| PREDICTED: uncharacterized protein LOC102712815 [Oryza brachyantha]
Length=375

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 230/324 (71%), Gaps = 7/324 (2%)
 Frame = -2

Query  1029  GDVSTDGRWCYVVMWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YL  853
              DVSTDG+WC+VV WV P+SS+  V WA LK+RL S+CP    + + P    P  S  YL
Sbjct  8     ADVSTDGQWCFVVFWVVPRSSSIKVRWASLKNRLMSMCPSSYPMSFYPEITQPGPSQFYL  67

Query  852   MTLYCIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEE  673
             + L+   R GLLHDVT  L E EL I+RVKV TTPD RV+D+F + D +ELL+ KE+QEE
Sbjct  68    LKLFSSDRKGLLHDVTHILSELELIIQRVKVSTTPDGRVIDLFFVTDGMELLHTKERQEE  127

Query  672   LCEQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELS  493
              C  L A LG S ISCE+ L+A G  ++    FS+L P+++ ELFR EL++ +   + LS
Sbjct  128   TCSMLIATLGPS-ISCEI-LLAEG--FQQ--GFSSLPPTISEELFRMELADGDNCSRSLS  181

Query  492   PDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKG  313
              ++ +++K+ +  DN LS AHTL+QI+C D K  LYDI R +K C++Q+TY RF +  KG
Sbjct  182   AEMKRVQKATINFDNFLSPAHTLLQINCADQKGLLYDILRTMKDCSIQVTYGRFWSDKKG  241

Query  312   QRELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSG  133
              RE+D+F++  +G+K++DPEKQ  L   L+ E+LHPLRV+I NRGPD ELLVANP+ELSG
Sbjct  242   FREVDLFIKQADGKKVIDPEKQDGLSSRLRSEMLHPLRVMIVNRGPDVELLVANPVELSG  301

Query  132   MGRPRVFYDVTFALKTLGICIFSV  61
              GRPRVFYD TFALK LGICIFS 
Sbjct  302   KGRPRVFYDATFALKALGICIFSA  325



>ref|XP_009400424.1| PREDICTED: uncharacterized protein LOC103984616 [Musa acuminata 
subsp. malaccensis]
Length=419

 Score =   349 bits (895),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 191/375 (51%), Positives = 239/375 (64%), Gaps = 16/375 (4%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+VVIQ     G P +I+V+C DK GLGC+ CR+IL FGL+I++GDVSTDG+WCYVV W
Sbjct  6     DDAVVIQAPEAAGGPSVISVSCPDKTGLGCDFCRVILFFGLSIRRGDVSTDGKWCYVVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYS------NLIYLPSPKTPATSS---YLMTLYCIG  832
             V  +   P   W  LK RL + CP  S      N  Y P     A      +L+   C  
Sbjct  66    VEERGGRP-TPWGLLKKRLLAACPAVSVASGLHNFYYGPQELMLAERPPQVFLLKFSCYD  124

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVTQ LC+ EL I RVKV TTPD RV+D+F I D  ELL+ K ++EE CEQLRA
Sbjct  125   RMGLLHDVTQVLCDLELIIRRVKVSTTPDGRVMDLFFISDTRELLHTKGRKEETCEQLRA  184

Query  651   VLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLK  472
             VLG+S  +CE++  A   + E L     L P++T ELF  EL E        SP  + +K
Sbjct  185   VLGDSMANCEIE-PANAQIVECLQASPFLPPAITEELFNLELPEESPVGSPSSPSNISVK  243

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                  +DN+LS +HTLIQI   D+K  LYDI R LK  N+Q++Y R  A+  G  E+D+F
Sbjct  244   -----MDNSLSPSHTLIQILGCDHKGLLYDIMRTLKDYNIQVSYGRVYASRNGSCEIDLF  298

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             V   +G+KILDP KQ ++C  L++EL HPLRV +  RGPD ELLVANP+ELSG GRP VF
Sbjct  299   VMQMDGKKILDPNKQRAVCSRLRMELFHPLRVAVMKRGPDMELLVANPVELSGKGRPLVF  358

Query  111   YDVTFALKTLGICIF  67
             YD+T ALK L I IF
Sbjct  359   YDITLALKILQIRIF  373



>ref|XP_008779018.1| PREDICTED: uncharacterized protein LOC103698750 isoform X1 [Phoenix 
dactylifera]
Length=416

 Score =   348 bits (893),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 186/375 (50%), Positives = 243/375 (65%), Gaps = 19/375 (5%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             D+ VVI+   +PG+P +IT++C DK GLGC++CR+IL FGLN+ +GD+STDG+WCY++ W
Sbjct  6     DEVVVIRQPERPGEPSVITISCPDKTGLGCDLCRVILLFGLNVVRGDMSTDGKWCYILFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPS------PKTPATSSYLMTLYCIGRTG  823
             V  +       W  LK RL   CP  S+L+ + S           +  +L+   C  R G
Sbjct  66    VVERGKKA-TRWGLLKKRLLGACPVASSLLGMDSYYHGQLETEHQSQVFLLKFSCYDRLG  124

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHDVTQ LCE EL I RVKV TTPD +V+D+F I D  ELL+ K +++E C QL+AVLG
Sbjct  125   LLHDVTQVLCELELTIRRVKVSTTPDGKVMDLFFITDTRELLHTKSRRDETCAQLKAVLG  184

Query  642   ESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS-  466
             +   SC+++ VA   +   L   S+L  SV  E+F  EL +         P    L  S 
Sbjct  185   DFMTSCDIE-VASSEVAACLLASSSLPYSVMEEMFNLELPDE--------PSTGSLPTSN  235

Query  465   --IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                V +DN LS AHTLIQ+ C D+KS LYDI RALK  N+QI+Y RF A++    E+D+F
Sbjct  236   NPSVIMDNTLSPAHTLIQLYCHDHKSLLYDIMRALKDYNIQISYGRFYASHNENCEIDLF  295

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             V   +G+KI+DP KQ +LC  L +EL  PLRV++ NRGPDTELLVANP+ELSG GRP VF
Sbjct  296   VTQIDGKKIVDPNKQKALCDRLTMELSRPLRVMVVNRGPDTELLVANPVELSGKGRPLVF  355

Query  111   YDVTFALKTLGICIF  67
             YD+T ALK LG CIF
Sbjct  356   YDITLALKMLGTCIF  370



>ref|XP_010267219.1| PREDICTED: uncharacterized protein LOC104604537 [Nelumbo nucifera]
Length=409

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 186/372 (50%), Positives = 243/372 (65%), Gaps = 16/372 (4%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I+   K G P +ITVNC DK GLGC++CRIIL FGL+I +GD+STDG+WCY+V W
Sbjct  6     DDVVLIREPEKQGGPSVITVNCPDKTGLGCDLCRIILFFGLSIVRGDISTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIY----LPSPKTPATSSYLMTLYCIGRTGLL  817
             V  +SST    W+ LK RL   CP  S + Y    L  PK P    +L+ L C  R GLL
Sbjct  66    VVGRSST---RWSLLKKRLAEACPSASGIYYYRPELQQPKPPDV--FLLKLCCHDREGLL  120

Query  816   HDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGES  637
             HDVT+ LCE EL I RVKV TTPD +V+D+F IKD  ELL+ K++QEE  + LRAVLG++
Sbjct  121   HDVTEVLCELELIIRRVKVSTTPDGKVMDLFFIKDTRELLHTKKRQEETDDHLRAVLGDA  180

Query  636   CISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVT  457
              ISC+++L A   +   L   S L  ++  E+F  E+ +      E            VT
Sbjct  181   MISCDIEL-AGSEMVSCLHGSSFLPSAIREEMFSLEMHD------EHPSRSSARSSVSVT  233

Query  456   IDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKN  277
             +DN LS +HTL QI C D+K  +YDI R LK  N+Q++Y RF+   +G  E+++FV   +
Sbjct  234   MDNKLSPSHTLFQIICQDHKGLVYDIMRTLKDYNIQVSYGRFTTNQRGSCEVELFVMQAD  293

Query  276   GEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTF  97
             G+KI+DP KQ +L   L++EL  PLRV + +RGPDTELLVANP+ELSG GRP VFYD+T 
Sbjct  294   GKKIVDPNKQNALSSRLRMELFRPLRVAVVSRGPDTELLVANPVELSGEGRPLVFYDITH  353

Query  96    ALKTLGICIFSV  61
             AL+ L  CIFS 
Sbjct  354   ALQMLNKCIFSA  365



>ref|XP_010918604.1| PREDICTED: uncharacterized protein LOC105042931 isoform X1 [Elaeis 
guineensis]
Length=419

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/375 (49%), Positives = 240/375 (64%), Gaps = 16/375 (4%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVI+    PG+P +IT++C DK GLGC++CR+IL FGL+I +GDVSTDG+WCY+V W
Sbjct  6     DDVVVIRQPESPGEPSVITISCPDKTGLGCDLCRVILFFGLSIVRGDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPY--SNLIYLPSPKTPATSS-------YLMTLYCIG  832
             V  +       W  LK RL  VCP    ++ +Y    +     +       +L+   C  
Sbjct  66    VVGRGEGA-TRWGLLKKRLLGVCPAVLSASGLYNSCYRQQEMMAAQQQAQLFLLKFSCYD  124

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVT  LCE EL I RVKV TTPD RV+D+F I D  ELL+ K ++EE CEQLRA
Sbjct  125   RMGLLHDVTLVLCELELTIRRVKVSTTPDGRVVDLFFITDTRELLHTKGRKEETCEQLRA  184

Query  651   VLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLK  472
             VLG+S  +CE++L A   +   +    ++ P++T E+   E+ E  +     S +     
Sbjct  185   VLGDSMTNCEIEL-ASAEIASRMQASPSVPPAITEEMLALEIPEQSSRESPFSSNYPS--  241

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                VT+DN+LS  HTLIQI C D+K  LYDI R LK  N+QI+Y RF AA  G  E D+F
Sbjct  242   ---VTMDNSLSPGHTLIQIFCRDHKGLLYDIMRTLKDYNIQISYGRFHAAQNGSCESDLF  298

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             V   +G+KI+DP KQ +LC  L++ L  PLRV + +RGPDTELLVANP+ELSG GRP VF
Sbjct  299   VIQMDGKKIIDPNKQKALCLRLRMVLFSPLRVTVVSRGPDTELLVANPVELSGKGRPLVF  358

Query  111   YDVTFALKTLGICIF  67
             +D+T ALK L ICIF
Sbjct  359   HDITLALKMLRICIF  373



>ref|XP_008787465.1| PREDICTED: uncharacterized protein LOC103705509 [Phoenix dactylifera]
Length=459

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 183/374 (49%), Positives = 242/374 (65%), Gaps = 17/374 (5%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVI+   +PG+P +IT++C DK GLGC++CR+IL FGL+I +GDVSTDG+WCY++ W
Sbjct  49    DDVVVIRQPERPGEPSVITISCPDKTGLGCDLCRVILLFGLSIVRGDVSTDGKWCYILFW  108

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLI--------YLPSPKTPATSSYLMTLYCIGR  829
             V  +       W  LK RL   CP  S L+         L + + P    +L+   C   
Sbjct  109   VVERGGEA-TRWGLLKKRLLGACPVPSLLLGIDGYFSRQLDAEQQPQV--FLLKFSCYDH  165

Query  828   TGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAV  649
              GLLHDVTQ LCE EL I RV V TTPD RV+D+F I D  ELL+   +++E C QL+AV
Sbjct  166   LGLLHDVTQVLCELELTIRRVNVSTTPDGRVMDLFFITDTRELLHTNSRKDETCAQLKAV  225

Query  648   LGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKK  469
             LG+S  SC+++  A   +   L   S+L  S+T E+F  EL +  +     +        
Sbjct  226   LGDSMTSCDIE-PASAEIAACLQASSSLPHSITEEMFSVELPDEPS-----TGSFPAFNS  279

Query  468   SIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFV  289
               VT+DN+LS AHTLIQ+ C D+K  LYDI R LK  N+QI+Y RF A++ G  E+D+FV
Sbjct  280   LSVTMDNSLSPAHTLIQLYCHDHKGLLYDIMRTLKDYNIQISYGRFYASHNGNCEIDLFV  339

Query  288   QHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFY  109
                +G+KI+DP KQ +LC  L++EL  PLRV++ +RGPDTELLVANP+ELSG GRP VFY
Sbjct  340   MQIDGKKIVDPNKQKALCDRLRMELFRPLRVMVVSRGPDTELLVANPVELSGKGRPLVFY  399

Query  108   DVTFALKTLGICIF  67
             D+TFALK LG  IF
Sbjct  400   DITFALKMLGTRIF  413



>ref|XP_009377043.1| PREDICTED: uncharacterized protein LOC103965693 [Pyrus x bretschneideri]
Length=412

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 182/379 (48%), Positives = 244/379 (64%), Gaps = 25/379 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I+   K GDP +IT+NC DK GLGC++CRIIL FGL+I +GDVSTDG+WC++V W
Sbjct  6     DDVVIIKQAEKEGDPSVITINCPDKTGLGCDLCRIILFFGLSIVRGDVSTDGKWCFLVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNL----IY---LPSPKTPATSSYLMTLYCIGRT  826
             V     +P   W  LK RL   CP  S+      Y   L  PK P    +L+   C  R 
Sbjct  66    VI---GSPETRWGLLKKRLVGTCPSCSSASGISFYRSELQPPKPPDV--FLLKFCCYNRR  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT  LCE EL I++VKV TTPD++V+D+F + D  EL++  +++EE+ + L+ V 
Sbjct  121   GLLHDVTGVLCELELTIKKVKVSTTPDEKVMDLFFVTDTRELMHTNKRKEEVYDYLKEVT  180

Query  645   GESCISCELKLVAPGPLYENLPCFSA---LSPSVTNELFRCELSENETHLQELSPDVMKL  475
             G++ ISC +++V P    E   C  A   L  ++T ++F  E+       +EL    +  
Sbjct  181   GDAMISCGIEMVGP----EITACSQASSFLPTAITEDMFDLEMP------KELRSGSLTS  230

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
             K   VT+DN LS  HTL+QISC+D+K  LYDI R LK  N+QI+Y RFS   K   E+D+
Sbjct  231   KSVSVTMDNTLSPGHTLVQISCIDHKGLLYDIMRTLKDYNIQISYGRFSIQQKRHCEIDL  290

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             FV   +G+KI+DP KQ +L   L++EL+ PLRV I NRGPDTELLVANP+ELSG GRP V
Sbjct  291   FVMQADGKKIVDPSKQTALTSRLQLELIRPLRVAIVNRGPDTELLVANPVELSGKGRPLV  350

Query  114   FYDVTFALKTLGICIFSVR  58
             FYD+T A K L + +FS +
Sbjct  351   FYDITLAFKMLDVGVFSAK  369



>ref|XP_010940513.1| PREDICTED: uncharacterized protein LOC105059061 [Elaeis guineensis]
Length=417

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 183/373 (49%), Positives = 244/373 (65%), Gaps = 14/373 (4%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVI+   +PG+P +IT++C DK GLGC++CR+IL FGLN+ +GD+STDG+WCY++ W
Sbjct  6     DDVVVIRQPERPGEPSVITISCPDKTGLGCDLCRVILLFGLNVVRGDMSTDGKWCYILFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLI------YLPSPKTPATSS-YLMTLYCIGRT  826
             V  + +     W  LK RL   CP   +L+      Y    +T   S  +L+   C  R 
Sbjct  66    VVARGNKA-TRWGLLKKRLLGACPVALSLLLGMDSYYYGQLETEQQSQVFLLKFSCYDRL  124

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVTQ L E EL I RVKV TTPD RV+D+F I D  ELL+ K +++E C QL+A L
Sbjct  125   GLLHDVTQVLSELELTIRRVKVSTTPDGRVIDLFFITDTRELLHTKSRKDETCAQLKAAL  184

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             G+   SC+++ VA   +   L   S+L  SV  E+F  EL +  +     +  +  L   
Sbjct  185   GDFMTSCDIE-VASSEIAACLLASSSLPHSVMEEMFSVELPDEPS-----TGSLPTLNNP  238

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              VT+DN+LS AHTLIQ+ C  +K+ LYDI RALK  N+QI+Y RF A++    E+D+FV 
Sbjct  239   SVTMDNSLSPAHTLIQLYCHGHKALLYDIMRALKDYNIQISYGRFYASHNENCEIDLFVM  298

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G+KI+DP KQ +LC  L++EL HPLRV++ NRGPDTELLVANP+EL G GRP VFYD
Sbjct  299   QVDGKKIVDPSKQKALCDRLRMELSHPLRVMVMNRGPDTELLVANPVELCGKGRPLVFYD  358

Query  105   VTFALKTLGICIF  67
             +T ALK LG  IF
Sbjct  359   ITLALKMLGTRIF  371



>ref|XP_010534493.1| PREDICTED: uncharacterized protein LOC104810025 isoform X2 [Tarenaya 
hassleriana]
Length=393

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 176/324 (54%), Positives = 221/324 (68%), Gaps = 11/324 (3%)
 Frame = -2

Query  1026  DVSTDGRWCYVVMWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL-PSPKTPATSS-YL  853
             D STDGRWCY+V WV PQ S+  + W  LK+RL S CP Y    Y       P+  S YL
Sbjct  30    DFSTDGRWCYIVFWVTPQLSSHKIDWDSLKNRLLSNCPSYLGAFYFCQQSNVPSRPSVYL  89

Query  852   MTLYCIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDH-LELLNIKEKQE  676
             +  YC  R GLLHDVT+ L E E  I+RVKV+TTPD RVLD+F I D  + LL+ K++Q 
Sbjct  90    LKFYCRDRKGLLHDVTKVLTELEFTIQRVKVMTTPDGRVLDLFFITDDAINLLHTKQRQV  149

Query  675   ELCEQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQEL  496
             + C  L AVLGE  +SCEL+L   GP YE++  FS+L P+V +ELF    S      +  
Sbjct  150   DTCNHLTAVLGEHGVSCELELA--GPEYESVQGFSSLPPAVAHELFG---SSEPADTEIA  204

Query  495   SPDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANK  316
             S D     K+++T+DN LS  HTL+QI CVD K   YDI R  K CN+QI+Y RF++  K
Sbjct  205   SSDT---NKAVITVDNQLSPVHTLLQIQCVDQKGLFYDILRTSKDCNIQISYGRFASKIK  261

Query  315   GQRELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELS  136
             G R +D+F+Q K+G+KILD + QA+LC  LK E++HPL+V I NRGPDTELL+ANP+ELS
Sbjct  262   GDRNMDLFIQTKDGKKILDGKHQANLCARLKQEMVHPLKVTILNRGPDTELLIANPVELS  321

Query  135   GMGRPRVFYDVTFALKTLGICIFS  64
             G GRPRVFYDVT ALKTLGIC+FS
Sbjct  322   GKGRPRVFYDVTLALKTLGICVFS  345



>ref|XP_006436512.1| hypothetical protein CICLE_v10031674mg [Citrus clementina]
 ref|XP_006485580.1| PREDICTED: uncharacterized protein LOC102614654 [Citrus sinensis]
 gb|ESR49752.1| hypothetical protein CICLE_v10031674mg [Citrus clementina]
 gb|KDO48245.1| hypothetical protein CISIN_1g015010mg [Citrus sinensis]
Length=414

 Score =   343 bits (881),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 189/380 (50%), Positives = 246/380 (65%), Gaps = 23/380 (6%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             M +D VVI    KPGD  +ITVNC DK GLGC++CRIIL FGL+I +GD+S DG+WCY+V
Sbjct  4     MYEDVVVISQAEKPGDCTVITVNCPDKTGLGCDLCRIILLFGLSISRGDLSKDGKWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPY--SNLIY------LPSPKTPATSSYLMTLYCI  835
              WV      P   W+ LK+RL  VCP Y  ++ IY         PK P    +L+  +C 
Sbjct  64    FWVV---GKPTTRWSLLKNRLLEVCPSYFSTSRIYSYRLENQQQPKPPDV--FLLKFWCF  118

Query  834   -GRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQL  658
               R GLLHDVT+ LCE EL I+RVKV TTPD RV+D+F I D  ELL+ ++++EE    L
Sbjct  119   QDRKGLLHDVTEVLCELELTIKRVKVSTTPDGRVMDLFFITDTRELLHTRKRREETIHHL  178

Query  657   RAVLGESCISCELKLVAPGPLYENLPCFSALSPS-VTNELFRCELSENETHLQELSPDVM  481
              AVLG++ ISCE++L  PGP        S+  PS +T+E+F  EL   + +    S  V 
Sbjct  179   EAVLGKTLISCEIEL--PGPEITACCHGSSFLPSAITDEMFSLELPAEQPNGFLASAPVS  236

Query  480   KLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
                   + +DN+ S +HTLIQI   D+K  +YD+ R LK  N Q++Y RF A  +G  E+
Sbjct  237   ------IAVDNSFSPSHTLIQILGQDHKGLIYDMMRTLKDYNTQVSYGRFFAKPRGNCEV  290

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             D+F+   +G+KI+DP KQ +LC  L++ELL PLRV + NRGPD ELLVANP+ELSG GRP
Sbjct  291   DLFIMQADGKKIVDPSKQDALCSRLRMELLRPLRVAVVNRGPDAELLVANPVELSGRGRP  350

Query  120   RVFYDVTFALKTLGICIFSV  61
              VFYD+T ALK L I IFSV
Sbjct  351   LVFYDITLALKILSISIFSV  370



>emb|CDX93251.1| BnaC04g46450D [Brassica napus]
Length=386

 Score =   342 bits (878),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 183/375 (49%), Positives = 233/375 (62%), Gaps = 42/375 (11%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD+V+I+ G   GDP M+TVNC D+                     D STDGRWCY+V
Sbjct  4     LNDDAVLIEPGKNSGDPTMVTVNCPDE--------------------SDFSTDGRWCYIV  43

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPP-----YSNLIYLPSPKTPATSSYLMTLYCIGRT  826
              WV P + +    W  LK+RL S CP      YS+L      K P  S YL+  +C  R 
Sbjct  44    FWVSPDNGSSRFDWDSLKNRLLSACPSCLGSYYSSLQSSNVSKPP--SLYLLKFFCRDRK  101

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT+ L E E  I+RVKV TTPD RVLD+F I D ++LL+ K++Q + C+ L AVL
Sbjct  102   GLLHDVTKVLTELEFTIQRVKVTTTPDGRVLDMFFITDAMDLLHTKQRQTKTCDHLTAVL  161

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             GE  +SCE++L   GP  E+L  FSAL P   +ELF  +++                 K 
Sbjct  162   GEHGVSCEIELA--GPELESLQRFSALPPEAADELFGSDVTSISN-------------KV  206

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
             ++T+DN LS AHTL+ I+C+D K   YDI R  K C+V I Y RFS+  KG R LD+FV+
Sbjct  207   VLTVDNHLSPAHTLLHINCIDQKGLFYDILRTSKDCDVHIAYGRFSSKVKGYRNLDLFVR  266

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G+KI DP+ Q S C  LK E+  PLRV+I+NRGPD+ELLVANP+ELSG GRPRVFYD
Sbjct  267   GTDGKKIADPKHQDSFCSRLKEEISCPLRVIIANRGPDSELLVANPVELSGKGRPRVFYD  326

Query  105   VTFALKTLGICIFSV  61
             VT ALK+LGICIFS 
Sbjct  327   VTLALKSLGICIFSA  341



>ref|XP_010935832.1| PREDICTED: uncharacterized protein LOC105055633 [Elaeis guineensis]
Length=416

 Score =   343 bits (880),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 181/372 (49%), Positives = 243/372 (65%), Gaps = 13/372 (3%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVI+   +PG+P +IT++C DK+GLGC++CR+IL FGL+I +GDVSTDG+WCY++ W
Sbjct  6     DDVVVIRQPERPGEPSVITISCPDKIGLGCDLCRVILLFGLSIVRGDVSTDGKWCYILFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS------YLMTLYCIGRTG  823
             V  +       W  LK RL   CP   +L+ + S  T    +      +L+   C  R G
Sbjct  66    VVERGGEA-TRWGLLKKRLLGACPLPPSLLGIDSYYTRQPDAEQQPRVFLLKFSCYDRLG  124

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHDVTQ LCE EL I RVKV TTPD RV+D+F I D  ELL+ K +++E C QL+AVLG
Sbjct  125   LLHDVTQVLCELELTIRRVKVSTTPDGRVMDLFFITDTRELLHTKSRKDETCAQLKAVLG  184

Query  642   ESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSI  463
             E   SC+++  A   +   L   S+   S+T E+F  EL +  +     +  +       
Sbjct  185   EFMTSCDIE-PARADIAACLQASSSPPYSITEEMFGLELPDEPS-----TGSLPTFNSLS  238

Query  462   VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQH  283
             VT+DN+LS AHTLIQ+ C D+K   YDI R LK  N+QI+Y RF+A++ G  E+D+FV  
Sbjct  239   VTMDNSLSPAHTLIQLCCYDHKGLSYDIMRTLKDYNIQISYGRFNASHNGNCEIDLFVMQ  298

Query  282   KNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDV  103
              +G+KI+DP KQ +LC  L++EL  PLRV + +RGPDTELLVANP+EL+G GRP VFYD+
Sbjct  299   IDGKKIVDPNKQKALCDRLRMELFRPLRVTVVSRGPDTELLVANPVELAGNGRPLVFYDI  358

Query  102   TFALKTLGICIF  67
             T ALK LG  IF
Sbjct  359   TLALKMLGTRIF  370



>ref|XP_007144373.1| hypothetical protein PHAVU_007G150800g [Phaseolus vulgaris]
 gb|ESW16367.1| hypothetical protein PHAVU_007G150800g [Phaseolus vulgaris]
Length=412

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 242/377 (64%), Gaps = 21/377 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I    K GDP ++TVNC DK GLGC++CRIIL FGLNI +GDVSTDG+WCY+V W
Sbjct  6     DDVVIISPPQKDGDPTVLTVNCPDKTGLGCDLCRIILLFGLNILRGDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP---YSNLIYLPSPKTPAT--SSYLMTLYCIGRTGL  820
             V  +  T    W+ LK RL   CP     S + Y  S   P+     +L+   C  R GL
Sbjct  66    VVGKQRT---RWSLLKKRLMEACPSCSSASGISYYRSELQPSKPPDVFLLNFCCHDRKGL  122

Query  819   LHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGE  640
             LHDVT+ LCE EL I++VKV TTPD +V+D+F I D  ELL+ K++++E  E L  +LG+
Sbjct  123   LHDVTEVLCELELTIKKVKVSTTPDGKVMDLFFITDTRELLHTKKRKDETIEHLTEILGD  182

Query  639   SCISCELKLVAPGPLYENLPCFSA---LSPSVTNELFRCELSENETHLQELSPDVMKLKK  469
             + IS +++LV P    E   C  A   L  ++T   F  EL  +      L  D +    
Sbjct  183   AIISIDIELVGP----EITACTQASQFLPTAITENAFDLELP-DLARSGTLRSDYVS---  234

Query  468   SIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFV  289
               VT+DN LS AHTL+QI C D+K  LYDI R LK  N+QI+Y RF+   +G+ E+D+F+
Sbjct  235   --VTMDNTLSPAHTLVQIMCQDHKGLLYDIMRTLKDYNIQISYGRFTTKPRGKCEIDLFI  292

Query  288   QHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFY  109
                +G+KI+DP KQ SL   L++EL  PLRV I +RGPDTELLVANP+ELSG GRP VF+
Sbjct  293   MQADGKKIVDPNKQNSLSSRLRMELFRPLRVAIVSRGPDTELLVANPVELSGKGRPLVFH  352

Query  108   DVTFALKTLGICIFSVR  58
             D+T ALK LG CIFS +
Sbjct  353   DITLALKMLGTCIFSAK  369



>ref|XP_003542564.1| PREDICTED: uncharacterized protein LOC100816138 [Glycine max]
 gb|KHN48246.1| hypothetical protein glysoja_007915 [Glycine soja]
Length=412

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 185/374 (49%), Positives = 246/374 (66%), Gaps = 21/374 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I    K GDP ++TVNC DK GLGC++CRIIL FGLNI +GDVSTDG+WCY+V W
Sbjct  6     DDVVIISPPEKDGDPTLLTVNCPDKTGLGCDLCRIILFFGLNILRGDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSN---LIYLPSPKTPATSS--YLMTLYCIGRTGL  820
             V  +  T    W+ LK RL   CP +S+   + Y  S   P+  S  +L+   C  R GL
Sbjct  66    VVGKQRT---RWSLLKKRLIEACPSFSSASGISYYRSDLQPSKPSDVFLLNFCCHDRKGL  122

Query  819   LHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGE  640
             LHDVT+ LCE EL I++VKV TTPD +V+D+F I D  ELL+ K++++E  E L  ++G+
Sbjct  123   LHDVTEVLCELELTIKKVKVSTTPDGKVIDLFFITDTRELLHTKKRKDETIEYLTEIMGD  182

Query  639   SCISCELKLVAPGPLYENLPCFSA---LSPSVTNELFRCELSENETHLQELSPDVMKLKK  469
             + IS +++LV P    E   C  A   L  ++T ++F  EL  +      L  D +    
Sbjct  183   AIISIDIELVGP----EITACSQAPPFLPTAITEDVFDLELP-DLARGGTLRSDYVS---  234

Query  468   SIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFV  289
               +T+DN LS AHTL+QI C D+K  LYDI R LK  N+QI+Y RF+A  +G+ E+D+F+
Sbjct  235   --ITMDNLLSPAHTLVQIMCQDHKGLLYDIMRTLKDYNIQISYGRFTAKPRGKCEIDLFI  292

Query  288   QHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFY  109
                +G+KI+DP KQ SL   L++ELL PLRV I +RGPDTELLV+NP+ELSG GRP VFY
Sbjct  293   MQADGKKIVDPNKQNSLSSRLRMELLRPLRVAIVSRGPDTELLVSNPVELSGKGRPLVFY  352

Query  108   DVTFALKTLGICIF  67
             D+T ALK L  CIF
Sbjct  353   DITLALKMLDTCIF  366



>ref|XP_008650906.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=379

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 180/376 (48%), Positives = 241/376 (64%), Gaps = 21/376 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V I++ +  G+P ++TV+C DK GLGC++CR++L F L++ KGD+STDGRWCY+V+W
Sbjct  6     DDVVQIRHADAAGEPTVVTVSCPDKTGLGCDLCRVVLLFRLSVVKGDMSTDGRWCYIVLW  65

Query  984   VFPQSSTPI-VTWAKLKDRLWSVCP---------PYSNLIYLPSPKTPATSSYLMTLYCI  835
             V P+   P+ V W  LKDRL  +CP          Y     L     P    +L+ L C 
Sbjct  66    VLPRGGRPVPVPWDLLKDRLLQLCPVAPPFGFDNAYLAAAGLQDLAPPPPKLFLLKLCCF  125

Query  834   GRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLR  655
              R GLLHDVT+ LCE EL I RVKV TTPD  VLD+F I D  ELL+ K ++EE  ++L 
Sbjct  126   DRMGLLHDVTRVLCELELTIRRVKVSTTPDGSVLDLFFITDARELLHTKSRREETQDKLE  185

Query  654   AVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKL  475
             AVLG+S   CE+   A   +   L  +++L+P++T ++F  E     T    +S      
Sbjct  186   AVLGDSLTCCEID-PAGEDMLSCLQSWASLTPAITEQMFNTEEQPISTRGGTIS------  238

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
                 VT+DN+LSS HTLIQI C D+K  LYDI R +K  N+Q++Y RF A+  G+ E+D+
Sbjct  239   ----VTMDNSLSSVHTLIQIQCGDHKGLLYDIMRTVKDGNIQVSYGRFYASQNGRCEIDL  294

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F    +G+KILD  +Q +LC  L++ELL PLRV + NRGPDTELLVANP+E+SG GRP V
Sbjct  295   FAVQSDGKKILDQHRQRALCCRLRMELLRPLRVALVNRGPDTELLVANPVEVSGKGRPLV  354

Query  114   FYDVTFALKTLGICIF  67
             FYD+T ALK L   IF
Sbjct  355   FYDITLALKNLQKRIF  370



>ref|XP_008345381.1| PREDICTED: uncharacterized protein LOC103408303 [Malus domestica]
Length=412

 Score =   342 bits (876),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 184/381 (48%), Positives = 244/381 (64%), Gaps = 25/381 (7%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+I    K GDP +IT+NC DK GLGC++CRIIL FGL+I +GDVSTDG+WCY+V
Sbjct  4     LQDDVVIITQAAKEGDPSVITINCPDKTGLGCDLCRIILFFGLSIVRGDVSTDGKWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNL----IY---LPSPKTPATSSYLMTLYCIG  832
              WV     +P   WA LK RL   CP  S+      Y   L  PK P    +L+   C  
Sbjct  64    FWVI---GSPETRWALLKKRLVGTCPSCSSASGISFYRSELQPPKPPDV--FLLKFCCYD  118

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVT  LCE EL I++VKV TTPD++V+D+F I D  EL++  +++EE+   L+ 
Sbjct  119   RRGLLHDVTGVLCELELTIKKVKVSTTPDEKVMDLFFITDTRELMHTNKRKEEVYGYLKE  178

Query  651   VLGESCISCELKLVAPGPLYENLPCFSA---LSPSVTNELFRCELSENETHLQELSPDVM  481
             V G + ISCE+++V P    E   C  A   L  ++T ++F  E+       +EL    +
Sbjct  179   VTGNAMISCEIEMVGP----EITACSQASSFLPTAITEDMFDLEMP------KELRSGSL  228

Query  480   KLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
               K   VT+DN LS +HTL+QI C+D+K  LYDI R LK  N+QI+Y RFS   K   E+
Sbjct  229   TSKSVSVTMDNTLSPSHTLVQIICIDHKGLLYDIMRTLKDYNIQISYGRFSIXXKKHCEI  288

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             D+F+   +G+KI+DP KQ +L   L++EL+ PLRV I NRGPDTELLVANP+ELSG GRP
Sbjct  289   DLFIMQADGKKIVDPSKQNALTSRLQLELIRPLRVAIVNRGPDTELLVANPVELSGKGRP  348

Query  120   RVFYDVTFALKTLGICIFSVR  58
              VF+D+T A K L I +FS +
Sbjct  349   LVFHDITLAFKMLDIGVFSAK  369



>gb|EMT05218.1| hypothetical protein F775_20811 [Aegilops tauschii]
Length=424

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 188/377 (50%), Positives = 249/377 (66%), Gaps = 16/377 (4%)
 Frame = -2

Query  1167  PDDSVV-IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             P D VV I +G+  GDP ++TV+C DK GLGC++CR++L FGLN+ KGD+STDGRWCY+V
Sbjct  6     PSDEVVQIVHGDSAGDPTVVTVSCPDKTGLGCDLCRLVLLFGLNVLKGDMSTDGRWCYIV  65

Query  990   MWVFP-QSSTPIVTWAKLKDRLWSVCP---PYS-NLIYLPSP--KTPATSS--YLMTLYC  838
             +WV   +   P V W  LK+RL  +CP   P+  +  YL +   + PA     +L+   C
Sbjct  66    LWVAASRRGRPPVAWDLLKERLVDLCPVPAPFGVDSAYLAAAGLQEPAGEPQVFLLKFCC  125

Query  837   IGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQL  658
               R GLLHDVT  LCE EL I RVKV TTPD RV+D+F I D  ELL+ K ++EE  E+L
Sbjct  126   YDRMGLLHDVTCVLCEMELTIRRVKVSTTPDGRVMDLFFITDARELLHTKSRREEAYEKL  185

Query  657   RAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMK  478
             ++VLG+S  SCE++  A   +   L   + LSP V  ++F    SE +  ++E S     
Sbjct  186   QSVLGDSVTSCEIE-SATEDMSSCLQASALLSPLVLEQMF----SEVDV-IEEQSSRSRS  239

Query  477   LKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELD  298
               +  VT+DN+LS AHTLIQI C D+K  LYDI R +K CN+QI+Y RF A  KG+ E+D
Sbjct  240   DSRLSVTMDNSLSPAHTLIQIQCGDHKGLLYDIMRTVKDCNIQISYGRFYAGQKGRCEVD  299

Query  297   VFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPR  118
             +F    +G+KILD +KQ ++C  L+ ELL PLRV + NRGPD ELLVANP+E+SG GRP 
Sbjct  300   LFAVQSDGKKILDQQKQRTMCSRLRTELLRPLRVALVNRGPDAELLVANPVEVSGKGRPL  359

Query  117   VFYDVTFALKTLGICIF  67
             VFYD+T ALK L   +F
Sbjct  360   VFYDITLALKNLHRRVF  376



>ref|XP_003535183.1| PREDICTED: uncharacterized protein LOC100789465 isoform X1 [Glycine 
max]
 gb|KHN39027.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=411

 Score =   341 bits (875),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 183/376 (49%), Positives = 244/376 (65%), Gaps = 20/376 (5%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I+   K GDP ++TVNC DK GLGC++CRI+L FGLNI +GDVSTDG+WCY+V W
Sbjct  6     DDVVIIRPPEKDGDPTLLTVNCPDKTGLGCDLCRIMLFFGLNIIRGDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP---YSNLIYLPSPKTPATSS--YLMTLYCIGRTGL  820
             V  +  T    W+ LK RL   CP     S + Y  S   P+  S  +L+   C  R GL
Sbjct  66    VVGKQRT---RWSLLKKRLIEACPSCSSASGISYYRSDLQPSKPSDVFLLNFSCHDRKGL  122

Query  819   LHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGE  640
             LHDVT+ LCE EL I++VKV TTPD +V+D+F I D  ELL+ K++++E  E L  ++G+
Sbjct  123   LHDVTEVLCELELTIKKVKVSTTPDGKVMDLFFITDTRELLHTKKRKDETIEHLTEIMGD  182

Query  639   SCISCELKLVAPGPLYENLPCFSA--LSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             + IS +++LV P    E   C  A    P+   ++F  EL  +      L  D +     
Sbjct  183   AIISIDIELVGP----EITACSKAPPFLPTAITDIFDLELP-DLARGGTLRSDYVS----  233

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              +T+DN LS AHTL+QI C D+K  LYDI R LK  N+QI+Y RF+   +G+ E+D+F+ 
Sbjct  234   -ITMDNLLSPAHTLVQIMCQDHKGLLYDIMRTLKDYNIQISYGRFTTKPRGKCEIDLFIM  292

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G+KI+DP KQ SL   L++ELL PLRV I +RGPDTELLV+NP+ELSG GRP VFYD
Sbjct  293   QADGKKIVDPNKQNSLSSRLRMELLRPLRVAIVSRGPDTELLVSNPVELSGKGRPLVFYD  352

Query  105   VTFALKTLGICIFSVR  58
             +T ALK L  CIFS +
Sbjct  353   ITLALKMLDTCIFSAK  368



>ref|XP_008650905.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA60720.1| TPA: hypothetical protein ZEAMMB73_962452 [Zea mays]
Length=418

 Score =   340 bits (873),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 180/376 (48%), Positives = 241/376 (64%), Gaps = 21/376 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V I++ +  G+P ++TV+C DK GLGC++CR++L F L++ KGD+STDGRWCY+V+W
Sbjct  6     DDVVQIRHADAAGEPTVVTVSCPDKTGLGCDLCRVVLLFRLSVVKGDMSTDGRWCYIVLW  65

Query  984   VFPQSSTPI-VTWAKLKDRLWSVCP---------PYSNLIYLPSPKTPATSSYLMTLYCI  835
             V P+   P+ V W  LKDRL  +CP          Y     L     P    +L+ L C 
Sbjct  66    VLPRGGRPVPVPWDLLKDRLLQLCPVAPPFGFDNAYLAAAGLQDLAPPPPKLFLLKLCCF  125

Query  834   GRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLR  655
              R GLLHDVT+ LCE EL I RVKV TTPD  VLD+F I D  ELL+ K ++EE  ++L 
Sbjct  126   DRMGLLHDVTRVLCELELTIRRVKVSTTPDGSVLDLFFITDARELLHTKSRREETQDKLE  185

Query  654   AVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKL  475
             AVLG+S   CE+   A   +   L  +++L+P++T ++F  E     T    +S      
Sbjct  186   AVLGDSLTCCEID-PAGEDMLSCLQSWASLTPAITEQMFNTEEQPISTRGGTIS------  238

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
                 VT+DN+LSS HTLIQI C D+K  LYDI R +K  N+Q++Y RF A+  G+ E+D+
Sbjct  239   ----VTMDNSLSSVHTLIQIQCGDHKGLLYDIMRTVKDGNIQVSYGRFYASQNGRCEIDL  294

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F    +G+KILD  +Q +LC  L++ELL PLRV + NRGPDTELLVANP+E+SG GRP V
Sbjct  295   FAVQSDGKKILDQHRQRALCCRLRMELLRPLRVALVNRGPDTELLVANPVEVSGKGRPLV  354

Query  114   FYDVTFALKTLGICIF  67
             FYD+T ALK L   IF
Sbjct  355   FYDITLALKNLQKRIF  370



>ref|XP_006428457.1| hypothetical protein CICLE_v10011863mg [Citrus clementina]
 ref|XP_006491660.1| PREDICTED: uncharacterized protein LOC102628967 isoform X1 [Citrus 
sinensis]
 gb|ESR41697.1| hypothetical protein CICLE_v10011863mg [Citrus clementina]
 gb|KDO44433.1| hypothetical protein CISIN_1g015208mg [Citrus sinensis]
Length=411

 Score =   340 bits (873),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 182/374 (49%), Positives = 239/374 (64%), Gaps = 20/374 (5%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I   +K GDP +ITVNC DK GLGC++CRIIL FGL+I +GDVSTDG+WCY+V W
Sbjct  6     DDVVIISQSDKEGDPCVITVNCPDKTGLGCDLCRIILFFGLSIVRGDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSN----LIYLPSPKTPATSS-YLMTLYCIGRTGL  820
             V   S T    W  LK RL   CP  S+    L Y    + P  S  +L+ L C  R GL
Sbjct  66    VIGDSQT---RWGLLKKRLMGACPSCSSASVVLYYRAEMQAPKPSDVFLLKLSCYDRKGL  122

Query  819   LHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGE  640
             L+DVT  LCE EL IE+VK+ TTPD +V+D+F + D  ELL+ ++++E+  E L+ +LG 
Sbjct  123   LYDVTAVLCELELTIEKVKISTTPDGKVMDLFFVTDTRELLHTRKRKEDTYEHLKTILGN  182

Query  639   SCISCELKLVAPGPLYENLPCFSALS--PSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             + ISC++++V      E   C  A S  PS   ++   ++        EL    +     
Sbjct  183   AMISCDVEMVGT----EITACSQASSFLPSAIIDMLHLDMP------VELPSGSLTCSNV  232

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              VTIDN+LS  HTL+QI C D+K  LYDI R LK  N+Q++Y RFS   +G  E+D+F+ 
Sbjct  233   SVTIDNSLSPGHTLVQIVCQDHKGLLYDIMRTLKDYNIQVSYGRFSRRQRGNCEIDLFIM  292

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G+KI+DP KQ  L   L +ELL PLRV + +RGPDTELLVANP+ELSG GRP VF+D
Sbjct  293   QADGKKIVDPSKQNGLSSRLWMELLQPLRVTVVSRGPDTELLVANPVELSGKGRPLVFHD  352

Query  105   VTFALKTLGICIFS  64
             +T ALK L ICIFS
Sbjct  353   ITLALKMLDICIFS  366



>ref|XP_002266940.1| PREDICTED: uncharacterized protein LOC100266711 [Vitis vinifera]
 emb|CBI31401.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 186/380 (49%), Positives = 242/380 (64%), Gaps = 27/380 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D V+I+   KPGDP  ITVNC DK GLGC++CRIIL FGL+I +GDVSTDG+WCY++ W
Sbjct  8     EDVVLIRQAEKPGDPAEITVNCPDKTGLGCDLCRIILQFGLSITRGDVSTDGKWCYILFW  67

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNL----IYLP----SPKTPATSSYLMTLYCI-G  832
             V      P   W  L  RL  VCP  S+      Y P     PK P    +L+  +C   
Sbjct  68    VV---GKPNTRWNLLHKRLMEVCPSCSSASGISFYKPEFQQQPKPPDV--FLLKFWCYHD  122

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVT+ LCE EL I+RVKV T PD RV+D+F + D    L+ K++QE+   +L+A
Sbjct  123   RKGLLHDVTEVLCELELTIKRVKVSTAPDGRVMDLFFVTDTRNELHTKKRQEDTIHRLKA  182

Query  651   VLGESCISCELKLVAPGPLYENLPCF---SALSPSVTNELFRCELSENETHLQELSPDVM  481
             VLG++ +S E++L  P    E   C    S L P++T E+F  EL    ++    S  + 
Sbjct  183   VLGDAMMSVEIELAGP----EVTACSQGSSFLPPAITEEIFSLELPNERSNGSAASNSLS  238

Query  480   KLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
                   VT+DN+LS +HTLIQI C D+K  +YDI R LK  N+Q +Y RFSA  KG  E 
Sbjct  239   ------VTMDNSLSPSHTLIQIICQDHKGLIYDIMRTLKDYNIQTSYGRFSANAKGMCEA  292

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             D+ V+  +G+KI+DP K+ +L   L++EL  PLRV + +RGPDTELLVANP+ELSG GRP
Sbjct  293   DLLVRQVDGKKIVDPNKRNALSSRLRMELFRPLRVAVRSRGPDTELLVANPVELSGRGRP  352

Query  120   RVFYDVTFALKTLGICIFSV  61
              VFYD+T ALK L I IFSV
Sbjct  353   LVFYDITLALKLLNIQIFSV  372



>gb|KHN18678.1| hypothetical protein glysoja_021429 [Glycine soja]
Length=412

 Score =   340 bits (871),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 185/378 (49%), Positives = 247/378 (65%), Gaps = 25/378 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I+   K G+  +ITVNC DK GLGC++CRIIL FGL+I +GDVSTDG+WCY+V W
Sbjct  6     DDVVIIREPEKEGEATVITVNCPDKTGLGCDLCRIILFFGLSIVRGDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCP---PYSNLIY----LPSPKTPATSSYLMTLYCIGRT  826
             V  +     + W+ LK RL   CP     S + Y    L  PK P  + +L+T  C  R 
Sbjct  66    VVGKQR---MRWSLLKKRLIEACPTCSSASGISYYRSELQPPKPP--NVFLLTFCCHDRK  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT+ L E EL I +VKV TTPD +V+D+F I D  ELL+ K+++++  EQL A+L
Sbjct  121   GLLHDVTEVLSELELIIHKVKVSTTPDGKVVDLFFITDTRELLHTKKRRDDTIEQLAAIL  180

Query  645   GESCISCELKLVAPGPLYENLPCFSA---LSPSVTNELFRCELSENETHLQELSPDVMKL  475
             G+  I+ +++LV P    E   C  A   L  +++ ++F  EL ++       S  V   
Sbjct  181   GDPLIAIDIELVGP----ETAACSQASSFLPSAISEDMFDLELPDSIRSGTSTSDSVS--  234

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
                 +T+DN+LS AHTL+QI C D+K  LYDI R LK  N+QI+Y RFS   +G+ ELD+
Sbjct  235   ----ITMDNSLSPAHTLVQIICQDHKGLLYDIMRTLKDYNIQISYGRFSPKPRGKCELDL  290

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F+   +G+KI+DP KQ SL   L++ELL PLR+ + +RGPDTELLVANP+ELSG GRP V
Sbjct  291   FIVQADGKKIVDPSKQKSLTSRLRMELLRPLRITVVSRGPDTELLVANPVELSGKGRPLV  350

Query  114   FYDVTFALKTLGICIFSV  61
             FYD+T ALK LG CIFS 
Sbjct  351   FYDITLALKMLGPCIFSA  368



>ref|XP_008241389.1| PREDICTED: uncharacterized protein LOC103339815 [Prunus mume]
Length=412

 Score =   340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 183/379 (48%), Positives = 242/379 (64%), Gaps = 25/379 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I    K GDP +IT+NC DK GLGC++CRIIL FGL+I +GDVSTDG+WCY+V W
Sbjct  6     DDVVIITQAEKEGDPSVITINCPDKTGLGCDLCRIILFFGLSIVRGDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNL----IY---LPSPKTPATSSYLMTLYCIGRT  826
             V     +P   W  LK RL   CP  S+      Y   L  PK P    +L+   C  R 
Sbjct  66    VI---GSPETRWGLLKKRLVGTCPSCSSASGISFYRSELQPPKPPDV--FLLKFCCYDRR  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT+ LCE EL I++VKV TTPD++V+D+F I D  ELL+  +++EE+ + L+AV 
Sbjct  121   GLLHDVTRVLCELELTIKKVKVSTTPDEKVMDLFFITDTRELLHTDKRKEEVSDYLKAVT  180

Query  645   GESCISCELKLVAPGPLYENLPCF---SALSPSVTNELFRCELSENETHLQELSPDVMKL  475
             G++ ISCE+++V P    E   C    S L  ++T ++F  E+        EL    +  
Sbjct  181   GDAMISCEIEMVGP----EITACSQGSSFLPSAITEDIFDLEMP------AELPSGSLTS  230

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
             +   VT+DN LS  HTL+QI C D+K  LYDI R LK  N+QI+Y RF+   +   E+D+
Sbjct  231   RSVSVTMDNTLSPGHTLVQIICKDHKGLLYDIMRTLKDYNIQISYGRFTIKQRRHCEIDL  290

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F+   +G+KI+DP KQ +L   L++ELL PLRV I NRGPDTELLVANP+ELSG GRP V
Sbjct  291   FIVQADGKKIVDPSKQNALRSRLQLELLRPLRVAIVNRGPDTELLVANPVELSGKGRPLV  350

Query  114   FYDVTFALKTLGICIFSVR  58
             FYD+T A K L   +FS +
Sbjct  351   FYDITLAFKMLNTGVFSAK  369



>ref|XP_002311991.1| hypothetical protein POPTR_0008s03320g [Populus trichocarpa]
 gb|EEE89358.1| hypothetical protein POPTR_0008s03320g [Populus trichocarpa]
Length=412

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 188/377 (50%), Positives = 240/377 (64%), Gaps = 18/377 (5%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + +D VVI  G KPG+   ITVNC DK GLGC++CR+IL FGL+I KGD  TDG+WCYVV
Sbjct  4     LQEDVVVISEGEKPGESTEITVNCPDKAGLGCDLCRVILLFGLSICKGDGQTDGKWCYVV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNL----IYLPSPKTPATSS-YLMTLYC-IGR  829
              WV  + ST    W  LK RL  VCP Y +      Y P  + P     +L+  +C    
Sbjct  64    FWVVGKPST---RWNLLKQRLLEVCPSYFSTSEIDFYKPENQQPRPPDVFLLKFWCSYDY  120

Query  828   TGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAV  649
              GLLHDVT+ LCE EL IERVKV T PD RV+D+F I D  ELL  K +QEE    L+ V
Sbjct  121   EGLLHDVTEVLCELELTIERVKVSTAPDGRVMDLFYITDTRELLRTKMRQEETIHYLKKV  180

Query  648   LGESCISCELKLVAPGPLYENLPCFSALSPS-VTNELFRCELSENETHLQELSPDVMKLK  472
             LG++ ISCE++L   GP +      S   PS +T ++F  EL  N           +   
Sbjct  181   LGKALISCEIELA--GPEFTACSQGSPFLPSAITEDMFSLELPNNH------RSGFLAHN  232

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                VT+DNA S +HTL++I C D+K  +YDITR LK  N+QI+Y RF A+ KG  E+D+F
Sbjct  233   PVSVTVDNAFSPSHTLVKILCKDHKGLIYDITRTLKDYNIQISYGRFLASRKGNCEVDLF  292

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             +   +G+KI+DP KQ +LC  L++ELL PLR+ + +RGPDTELLVANP+ELSG GRP VF
Sbjct  293   LMQADGKKIVDPNKQNALCSRLRMELLCPLRLAVVSRGPDTELLVANPVELSGRGRPLVF  352

Query  111   YDVTFALKTLGICIFSV  61
             +D+T ALK L   IFSV
Sbjct  353   HDITLALKNLNTPIFSV  369



>ref|XP_011031650.1| PREDICTED: uncharacterized protein LOC105130709 [Populus euphratica]
Length=412

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 185/377 (49%), Positives = 239/377 (63%), Gaps = 18/377 (5%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD VVI  G KPG+  +ITVNC D+ GLGC++CR+IL FG +I KGD  TDG+WCY+V
Sbjct  4     LQDDVVVISKGEKPGESTVITVNCPDRAGLGCDLCRVILLFGFSICKGDGQTDGKWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNL----IYLPSPKTPATSS-YLMTLYC-IGR  829
              WV   +  P   W  LK RL  VCP Y +      Y P  + P     +L+  +C    
Sbjct  64    FWV---AGKPSTRWNLLKQRLLEVCPSYFSTSEIDFYKPENQQPRLPDVFLLKFWCSYDY  120

Query  828   TGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAV  649
              GLLHDVT+ LCE EL IERVKV T PD RV+D+F I D  ELL  K +QEE    L+ V
Sbjct  121   EGLLHDVTEVLCELELTIERVKVSTAPDGRVMDLFYITDTRELLRTKTRQEETTHYLKNV  180

Query  648   LGESCISCELKLVAPGPLYENLPCFSALSPS-VTNELFRCELSENETHLQELSPDVMKLK  472
             LG++ ISCE++L   GP +      S   PS +T ++F  EL  N           +   
Sbjct  181   LGKALISCEIELA--GPEFTACSQGSPFLPSAITEDMFSLELPNNP------RSGFLAHN  232

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                VT+DNA S +HTL++I C D+K  +YDITR LK  N+QI+Y RF A+ KG  E+D+F
Sbjct  233   PVSVTVDNAFSPSHTLVKILCKDHKGLIYDITRTLKDYNIQISYGRFFASRKGNCEVDLF  292

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             +   +G+KI+DP KQ +LC  L++ELL PLR+ + +RGPDTELLVANP+ELSG GRP VF
Sbjct  293   LMQADGKKIVDPNKQNALCSRLRMELLCPLRLAVVSRGPDTELLVANPVELSGRGRPLVF  352

Query  111   YDVTFALKTLGICIFSV  61
             +D+T ALK L   IFSV
Sbjct  353   HDITLALKNLNTPIFSV  369



>ref|XP_008387533.1| PREDICTED: uncharacterized protein LOC103449993 [Malus domestica]
Length=412

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 181/381 (48%), Positives = 243/381 (64%), Gaps = 25/381 (7%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + +D V+I+   K GDP +IT+NC DK GLGC++CRIIL FGL+I +GDVSTDG+WCY+V
Sbjct  4     LHEDVVLIKQAEKEGDPSVITINCPDKTGLGCDLCRIILFFGLSIVRGDVSTDGKWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNL----IY---LPSPKTPATSSYLMTLYCIG  832
              WV     +P   W  LK RL   CP  S+      Y   L  PK P    +L+   C  
Sbjct  64    FWVI---GSPETRWGLLKKRLVGTCPSCSSASGISFYRSELQPPKPPDV--FLLKFCCYN  118

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVT  LCE EL I++VKV TTPD++V+D+F + D  EL++  +++EE+ + L+ 
Sbjct  119   RRGLLHDVTGVLCELELTIKKVKVSTTPDEKVMDLFFVTDTRELMHTNKRREEVYDYLKE  178

Query  651   VLGESCISCELKLVAPGPLYENLPCFSA---LSPSVTNELFRCELSENETHLQELSPDVM  481
             V+G++ ISCE++   P    E   C  A   L  ++T ++F  E+       +EL    +
Sbjct  179   VMGDAMISCEIETAGP----EITACTQASSFLPTAITEDMFDLEMP------KELRSGSL  228

Query  480   KLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
               K   VT+DN LS  HTL+QI C+D+K  LYDI R LK  N+QI+Y RFS   K   E+
Sbjct  229   TSKSVSVTMDNTLSPGHTLVQIICIDHKGLLYDIMRTLKDYNIQISYGRFSIKQKRHCEI  288

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             D+FV   +G+KI+D  KQ +L   L++EL+ PLRV I NRGPDTELLVANP+ELSG GRP
Sbjct  289   DLFVMQADGKKIVDSSKQTALTSRLQLELIRPLRVAIVNRGPDTELLVANPVELSGKGRP  348

Query  120   RVFYDVTFALKTLGICIFSVR  58
              VFYD+T A K L I +FS +
Sbjct  349   LVFYDITLAFKMLDIGVFSAK  369



>ref|XP_009385681.1| PREDICTED: uncharacterized protein LOC103972979 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=415

 Score =   338 bits (867),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 186/375 (50%), Positives = 244/375 (65%), Gaps = 20/375 (5%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I+   +PG+P +IT++C DK GLGC++CR+IL FGLNI +GD STDG+WCYV+ W
Sbjct  6     DDVVIIRPPERPGEPSLITISCPDKTGLGCDLCRVILLFGLNIVRGDFSTDGKWCYVLFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLI-----YLPSPKTPATSS----YLMTLYCIG  832
             V  +       WA LK RL + CPP S+ +     Y    +  AT      +L+   C  
Sbjct  66    VVERGRKA-TRWALLKKRLIAACPPASSPLGIDSYYFNRRQETATEQNPQVFLLMFSCYD  124

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVT+ LCE EL I RVKV TTPD RV+D+F++ D  ELL+ K +++E C QL A
Sbjct  125   RMGLLHDVTEVLCELELTIRRVKVSTTPDGRVVDLFLVTDTRELLHTKNRKDEACTQLSA  184

Query  651   VLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLK  472
             VLG+S  SC+++L A   L E L   S L PSVT +L   E  E  +           L 
Sbjct  185   VLGDSMCSCDIEL-ASAELAECLQASSFLPPSVTEDLITLEFQEEPS---------SSLP  234

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
             +S V++DN+LS AH+LIQI C D+K  LYDI R LK  N+QI+Y RF+AA  G   +D+F
Sbjct  235   RSSVSVDNSLSHAHSLIQIQCHDHKGLLYDIMRTLKDYNIQISYGRFNAAENGNCNIDLF  294

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             V   +G+KI+D  KQ +LC  L++EL   LRV + +RGPDTEL+VANP+ELSG GRP VF
Sbjct  295   VVQNDGKKIVDSNKQKALCSRLRMELSCSLRVNLISRGPDTELIVANPVELSGKGRPLVF  354

Query  111   YDVTFALKTLGICIF  67
             +D+T ALK L I IF
Sbjct  355   FDITLALKILKIRIF  369



>ref|XP_002533376.1| amino acid binding protein, putative [Ricinus communis]
 gb|EEF29007.1| amino acid binding protein, putative [Ricinus communis]
Length=413

 Score =   338 bits (867),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 185/375 (49%), Positives = 244/375 (65%), Gaps = 18/375 (5%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D VVI    KPGD  +ITVNC DK GLGC++CRIIL FGL+I +GD+ TDG+WCY+V+W
Sbjct  6     EDVVVISQAEKPGDSTVITVNCPDKTGLGCDLCRIILLFGLSISRGDLQTDGKWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNL----IYLPSPKTPATSS-YLMTLYC-IGRTG  823
             V  + ST    W+ LK RL  VCP Y +      Y P  + P     +L+  +C   R G
Sbjct  66    VVGKPST---RWSLLKMRLLEVCPSYFSTSEISYYRPKDQQPKKPDVFLLKFWCSYDREG  122

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHDVT+ LCE EL I+RVKV T PD RV+D+F I D  ELL+ K +QEE    L+ VLG
Sbjct  123   LLHDVTEVLCELELTIKRVKVSTAPDGRVMDLFFITDTRELLHTKHRQEETIHYLKDVLG  182

Query  642   ESCISCELKLVAPGPLYENLPCFSALSPS-VTNELFRCELSENETHLQELSPDVMKLKKS  466
             ++ ISCE++  + G         S+L PS +T ++F  EL + +     L+P+ +     
Sbjct  183   DALISCEIE--SAGAEVTACSQGSSLLPSAITEDMFNMELPDKQRK-GFLTPNPVS----  235

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              V++DN LS +HTL+Q  C D+K  +YDI R LK  N+QI+Y RF A  KG  E+D+F+ 
Sbjct  236   -VSMDNTLSRSHTLLQFLCKDHKGLMYDIMRTLKDYNIQISYGRFYATPKGHCEVDLFIM  294

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G+KI+D  KQ +LC  L++ELL PLRV + +RGPDTELLVANP+ELS  GRP VFYD
Sbjct  295   QADGKKIIDSYKQDALCSRLRMELLRPLRVAVVSRGPDTELLVANPVELSERGRPLVFYD  354

Query  105   VTFALKTLGICIFSV  61
             +T ALK L   IFSV
Sbjct  355   ITLALKILNTRIFSV  369



>ref|XP_008442722.1| PREDICTED: uncharacterized protein LOC103486511 isoform X2 [Cucumis 
melo]
Length=371

 Score =   335 bits (859),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 184/377 (49%), Positives = 241/377 (64%), Gaps = 24/377 (6%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+++   K  +P +ITVNC DK GLGC++CRIIL FGLNI +GDV+TDG+WCY+V
Sbjct  4     LHDDVVLVRPSEKDDEPTVITVNCPDKTGLGCDLCRIILFFGLNIVRGDVTTDGKWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL-------PSPKTPATSSYLMTLYCIG  832
             +WV   SST    W  LK RL  VCP  S+   L       PS K P    +L+   C  
Sbjct  64    LWVTGNSST---RWGLLKQRLMEVCPSCSSASMLSYFRPEPPSSKPP--DMFLLKFCCHD  118

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVT  LCE EL IE+VKV TTPD +V+D+F I D  EL++  ++Q + C+ L+ 
Sbjct  119   RRGLLHDVTWVLCELELLIEKVKVSTTPDGKVMDLFFIVDTRELMHTAKRQRDTCDHLKH  178

Query  651   VLGESCISCELKLVAPGPLYENLPC--FSALSPSVTNELFRCELSENETHLQELSPDVMK  478
             VLG++ ISCE++++      E + C   S+L   +  E    EL+E        S DV  
Sbjct  179   VLGDAVISCEIEMIDA----EVMLCSQASSLPSEIVEESCSLELNEKSPSRSLASKDVS-  233

Query  477   LKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELD  298
                  VT+DN+LS +HTL+QI C D+K  +YDI R LK  N+QI+Y RFS   K   E+D
Sbjct  234   -----VTLDNSLSPSHTLVQIVCQDHKGLIYDIMRTLKDYNIQISYGRFSKKQKKICEID  288

Query  297   VFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPR  118
             +F+   +G+KILD  KQ +L   L++EL+ PLRV + +RGPDTELLVANP ELSG GRP 
Sbjct  289   LFIMQADGKKILDQSKQNALSTRLQIELIRPLRVAVLSRGPDTELLVANPTELSGKGRPL  348

Query  117   VFYDVTFALKTLGICIF  67
             VFYD+T ALK L I IF
Sbjct  349   VFYDITLALKLLDIGIF  365



>ref|XP_011094592.1| PREDICTED: uncharacterized protein LOC105174256 [Sesamum indicum]
Length=409

 Score =   336 bits (862),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 178/375 (47%), Positives = 245/375 (65%), Gaps = 22/375 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+I+   K G+P +ITVNC DK GLG ++CRIIL FGL + + DVSTDG+WCY+V W
Sbjct  6     DDAVIIRQSEKEGEPSVITVNCPDKTGLGSDLCRIILFFGLTVVRTDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIY----LPSPKTPATSSYLMTLYCIGRTGLL  817
             V  + ST    W+ LK RL   CP  S + Y    L  P+ P    +L+   C  R GLL
Sbjct  66    VVGKPST---RWSLLKKRLMGACPSCSGISYYRPELQPPRPPDV--FLLKFCCHDRRGLL  120

Query  816   HDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGES  637
             HDVT+ LCE EL I+RVKV TTPD +V+D+F I D  ELL+ K +Q++  + L+AVLG++
Sbjct  121   HDVTEVLCELELTIKRVKVSTTPDGKVMDLFFITDTRELLHTKNRQDDTYDHLKAVLGDA  180

Query  636   CISCELKLVAPGPLYENLPCF---SALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
              I C++++V P    E   C    S LS ++T ++F    S+      E   D +  K  
Sbjct  181   MICCDIEMVGP----EIAACSQGPSFLSDAITEDMFNIATSD------ESPDDCVAFKPP  230

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              +T+DN+LS +HTL+QI C D+K  LYD+ R LK  N+QI+Y RF+   K + E+D+F+ 
Sbjct  231   SITMDNSLSPSHTLVQIVCEDHKGLLYDVMRTLKDYNIQISYGRFTTKGKSECEMDLFIM  290

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G+KI+DP KQ+SL   L++EL  PLRV + +RGPD+ELLVANP+E++G GRP VFYD
Sbjct  291   QADGKKIIDPSKQSSLRSRLQMELSRPLRVALISRGPDSELLVANPVEITGNGRPLVFYD  350

Query  105   VTFALKTLGICIFSV  61
             +T ALK L   IFS 
Sbjct  351   ITLALKMLDRPIFSA  365



>ref|XP_008809905.1| PREDICTED: uncharacterized protein LOC103721458 [Phoenix dactylifera]
Length=419

 Score =   337 bits (863),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 182/375 (49%), Positives = 236/375 (63%), Gaps = 16/375 (4%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVI++   PG+P +IT++C DK GLGC++CR+IL FGL+I +GDVSTDG+WCY+V W
Sbjct  6     DDVVVIRHPESPGEPSVITISCPDKTGLGCDLCRVILFFGLSIVRGDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP------YSNLIYLPSPKTPATSS---YLMTLYCIG  832
             V  +       W  LK RL  VCP         N  Y       A      +L+   C  
Sbjct  66    VVGRGDRA-TRWGLLKKRLLGVCPTVLSASGLYNSYYRQQEMVAAQQEAQLFLLKFCCYD  124

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVTQ LCE EL I +VKV TTPD RV+D+F I D  ELL+ K ++EE C+QLRA
Sbjct  125   RMGLLHDVTQVLCELELTIRKVKVSTTPDGRVMDLFFITDTRELLHTKRRKEEACDQLRA  184

Query  651   VLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLK  472
             VLG+S  +C+++L A   +   +     L P++  ELF  EL E     +         K
Sbjct  185   VLGDSMTNCDIEL-ASAEIASFMQASPFLPPAIPEELFDLELPE-----ESPKKSPSSSK  238

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                VT+DN+LS  HTLIQI C D+K  LYD+ R LK  N+QI+Y RF A   G  E+D+F
Sbjct  239   NPSVTMDNSLSPGHTLIQILCRDHKGLLYDLMRTLKDYNIQISYGRFYATQNGSCEIDLF  298

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             V   +G+KI+D  KQ +LC  L++EL  PLRV + +RGPDTELLVANP+ELSG GRP VF
Sbjct  299   VIQVDGKKIVDTNKQKALCSRLRMELSSPLRVTVVSRGPDTELLVANPVELSGKGRPLVF  358

Query  111   YDVTFALKTLGICIF  67
             +D+T++LK L   IF
Sbjct  359   HDITWSLKMLHTRIF  373



>emb|CAN63142.1| hypothetical protein VITISV_034576 [Vitis vinifera]
Length=498

 Score =   339 bits (869),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 165/251 (66%), Positives = 199/251 (79%), Gaps = 2/251 (1%)
 Frame = -2

Query  813  DVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESC  634
            DVTQ L E EL I+RVKV TTPD RVLD+F I D +ELL+ K++Q++  EQL  VLGESC
Sbjct  52   DVTQVLSELELTIQRVKVTTTPDGRVLDLFFITDXMELLHTKKRQDDTLEQLYXVLGESC  111

Query  633  ISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTI  454
            ISCEL+L   GP YEN  C S+LSP +  ELFRCELS+ E+H Q LSPD+  LKK+ V +
Sbjct  112  ISCELQL--AGPEYENHQCVSSLSPGIAEELFRCELSDKESHSQALSPDMTILKKASVIV  169

Query  453  DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNG  274
            DN+LS AHTL+QI CVD+K  +YDI R LK CN++I+Y R S   KG R+LD+F+Q K+G
Sbjct  170  DNSLSPAHTLLQIYCVDHKGLVYDILRTLKDCNIKISYGRLSQNTKGYRDLDLFIQQKDG  229

Query  273  EKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFA  94
            +KI+DPEKQ++LC  LKVE+LHPLRVVISNRGPDTELLVANP+ELSG GRPRVF+D T A
Sbjct  230  KKIVDPEKQSALCSRLKVEMLHPLRVVISNRGPDTELLVANPVELSGKGRPRVFFDATLA  289

Query  93   LKTLGICIFSV  61
            LK LGICIFS 
Sbjct  290  LKMLGICIFSA  300


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVS  1018
             + DD V+IQ G K G+P +ITVNC DK GLGC+ICR IL+FGL I KGDV+
Sbjct  4     LNDDVVLIQKGTKLGEPCVITVNCPDKTGLGCDICRTILNFGLYITKGDVT  54



>gb|KDP30487.1| hypothetical protein JCGZ_16166 [Jatropha curcas]
Length=413

 Score =   336 bits (862),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 182/374 (49%), Positives = 239/374 (64%), Gaps = 16/374 (4%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D VVI    KPGD  +ITVNC DK GLGC++CRIIL FGL+I +GD+ TDG+WCY+++W
Sbjct  6     EDLVVISEAEKPGDSTLITVNCPDKTGLGCDLCRIILLFGLSISRGDLQTDGKWCYILLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNL----IYLPSPKTPATSS-YLMTLYC-IGRTG  823
             V  +   P   W  LK RL  VCP Y +      Y P  + P     +L+  +C   R G
Sbjct  66    VVGK---PNTRWNLLKKRLLEVCPSYFSTSEISYYRPQNQEPRKPDVFLLKFWCSYDREG  122

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHDVT+ LCE EL I+RVKV T PD RV+D+F I D  ELL+ + +Q+E    L+ VLG
Sbjct  123   LLHDVTEVLCELELTIKRVKVSTAPDGRVMDLFYITDTRELLHTQHRQQETILYLKDVLG  182

Query  642   ESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSI  463
             ++ ISC+++  A   +       S L+ ++T ++F  EL      L +     +      
Sbjct  183   DALISCDIE-SAGAEVTACSQGLSYLASAITEDMFSLEL------LGQQRNGFLTSNPIS  235

Query  462   VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQH  283
             VTIDN LS +HTLIQ  C D+K  LYDI R LK  N+QI+Y RF A+ KG  E+D+F+  
Sbjct  236   VTIDNNLSPSHTLIQFHCKDHKGLLYDIMRTLKDYNIQISYGRFYASPKGNCEVDLFIMQ  295

Query  282   KNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDV  103
              +G+KI+DP KQ +LC  LK+ELL PLRV + +RGPDTEL+V NP+ELSG GRP VFYD+
Sbjct  296   ADGKKIVDPNKQDALCCRLKMELLRPLRVAVVSRGPDTELIVTNPVELSGRGRPLVFYDI  355

Query  102   TFALKTLGICIFSV  61
             T ALK L   IFSV
Sbjct  356   TLALKVLNTAIFSV  369



>ref|XP_004137843.1| PREDICTED: uncharacterized protein LOC101221909 [Cucumis sativus]
 ref|XP_004165701.1| PREDICTED: uncharacterized LOC101221909 [Cucumis sativus]
 gb|KGN58994.1| hypothetical protein Csa_3G741840 [Cucumis sativus]
Length=411

 Score =   336 bits (861),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 183/375 (49%), Positives = 241/375 (64%), Gaps = 20/375 (5%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+++   K  +P +ITVNC DK GLGC++CRIIL FGLNI +GDV+TDG+WCY+V
Sbjct  4     LQDDVVLVRPSEKDDEPTVITVNCPDKTGLGCDLCRIILFFGLNIVRGDVTTDGKWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL----PSPKTPATSS-YLMTLYCIGRT  826
              WV   SST    W  LK RL  VCP  S+   L    P P++      +L+   C  R 
Sbjct  64    FWVTGNSST---RWGLLKQRLMEVCPSCSSASMLSYFRPEPQSSKPPDMFLLKFCCHDRR  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT  LCE EL IE+VKV TTPD +V+D+F I D  EL++  ++Q + CE L+ VL
Sbjct  121   GLLHDVTWVLCELELLIEKVKVSTTPDGKVMDLFFIIDTRELMHTAKRQRDTCEHLKHVL  180

Query  645   GESCISCELKLVAPGPLYENLPC--FSALSPSVTNELFRCELSENETHLQELSPDVMKLK  472
             G++ ISCE++++      E + C   S+L P +  E    EL+E        S DV    
Sbjct  181   GDAVISCEIEMIDT----EVMLCSQASSLPPEIVEESCSLELNEKSPSRSLASKDVS---  233

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                VT+DN+LS +HTL+QI C D+K  +YDI R LK  N+QI+Y RF+   K   E+D+F
Sbjct  234   ---VTLDNSLSPSHTLVQIVCQDHKGLIYDIMRTLKDYNIQISYGRFNKKQKKICEIDLF  290

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             +   +G+KILD  KQ +L   L++EL+ PLRV + +RGPDTELLVANP ELSG GRP VF
Sbjct  291   IMQADGKKILDQSKQNALSTRLQIELIRPLRVAVLSRGPDTELLVANPTELSGKGRPLVF  350

Query  111   YDVTFALKTLGICIF  67
             YD+T ALK L I IF
Sbjct  351   YDITLALKLLDIGIF  365



>emb|CAN64495.1| hypothetical protein VITISV_004035 [Vitis vinifera]
Length=465

 Score =   338 bits (866),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 181/375 (48%), Positives = 249/375 (66%), Gaps = 20/375 (5%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I+   K G+P ++TVNC DK GLGC++CRIIL FGL+I + DVSTDG+WCY+V W
Sbjct  48    DDVVIIRPSEKEGEPRVLTVNCPDKTGLGCDLCRIILFFGLSIVRVDVSTDGKWCYIVFW  107

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSN-----LIYLPSPKTPATSSYLMTLYCIGRTGL  820
             +  +S+T    W+ L+DRL   CP  S+        L  PK P    +L+   C  R GL
Sbjct  108   IIGKSTT---RWSLLQDRLSEACPSCSSASGFSYFQLQPPKPPDV--FLLKFCCYDRKGL  162

Query  819   LHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGE  640
             LHDVT+ LCE EL I++VKV TTPD RV+D+F I D  ELL+ K++QE+    L+ VLG+
Sbjct  163   LHDVTEVLCELELTIKKVKVSTTPDGRVMDLFFITDTRELLHTKKRQEDTHNHLKTVLGD  222

Query  639   SCISCELKLVAPGPLYENLPCFSALSPS-VTNELFRCELS-ENETHLQELSPDVMKLKKS  466
             + ISC++ +V  G         S L PS +T E+F  +   E  + L ++S ++      
Sbjct  223   AMISCDISMV--GSEITACSQTSTLLPSAITREIFGSKFEDEPPSGLPQVSGNIS-----  275

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              VT+DN+LS AHTL+QI C D+K  LYD+ R LK  N++I+Y R +   +   E+D+F+ 
Sbjct  276   -VTMDNSLSPAHTLVQIVCQDHKGLLYDMMRTLKDYNIKISYGRLTTKPRRNCEVDLFIM  334

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G+K++DP KQ +LC  L++ELL PLRV + +RGPDTELLVANP+ELSG GRP VF+D
Sbjct  335   QADGKKVVDPYKQNALCSRLQMELLRPLRVAVVSRGPDTELLVANPVELSGKGRPLVFFD  394

Query  105   VTFALKTLGICIFSV  61
             +T ALK L +CIFSV
Sbjct  395   ITHALKMLNVCIFSV  409



>ref|XP_011040578.1| PREDICTED: uncharacterized protein LOC105136793 isoform X2 [Populus 
euphratica]
Length=391

 Score =   335 bits (859),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 185/383 (48%), Positives = 245/383 (64%), Gaps = 26/383 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I++  K GDP +ITVNC DK GLGC++CRIIL FGL+I +GDVSTDG+WCY+V W
Sbjct  6     DDVVIIRHSEKEGDPAVITVNCPDKTGLGCDLCRIILFFGLSIVRGDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP---YSNLIY----LPSPKTPATSSYLMTLYCIGRT  826
             V  +S+T    W  LK RL   CP     S + Y    L  P+ P    +L+ L C  R 
Sbjct  66    VVGKSTT---RWGLLKKRLVGACPSCSSASGISYYSAELQPPRPPDV--FLLKLACHDRK  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT  LCE EL I++VKV TTPD RV+D+F + D  ELL+  +++E+  + LRAV+
Sbjct  121   GLLHDVTGVLCELELTIKKVKVSTTPDGRVMDLFFVTDTRELLHTTKRKEDTYDHLRAVM  180

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQ---ELSPDVMKL  475
             G S ISC++++V P    E   C      S  +      ++EN   LQ   EL P  +  
Sbjct  181   GNSMISCDIEMVGP----EITAC------SAESSFLPTAITENILPLQMPDEL-PSSLTS  229

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
                 V +DN LS AHTL+QI C D+K  LYDI R LK  N+QI+Y RF   ++   E+D+
Sbjct  230   TSVSVIMDNLLSPAHTLVQIVCQDHKGLLYDIMRTLKDYNIQISYGRFYIKHRRTCEIDL  289

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F+   +G+KI+DP KQ +L   L++EL+ PLRV + +RGPDTEL+VANP+ELSG GRP V
Sbjct  290   FIVQADGKKIVDPNKQKALSSRLEMELVRPLRVAVVSRGPDTELMVANPVELSGKGRPLV  349

Query  114   FYDVTFALKTLGICIFSVRKWFL  46
             F+D+T AL  L  CIFSV  + L
Sbjct  350   FHDITLALTMLDSCIFSVLSYLL  372



>ref|NP_001063990.1| Os09g0570900 [Oryza sativa Japonica Group]
 dbj|BAD46603.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25904.1| Os09g0570900 [Oryza sativa Japonica Group]
 dbj|BAG92415.1| unnamed protein product [Oryza sativa Japonica Group]
Length=427

 Score =   336 bits (861),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 181/382 (47%), Positives = 244/382 (64%), Gaps = 25/382 (7%)
 Frame = -2

Query  1167  PDDSVV-IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             P D VV +++G+  G+P ++T++C DK GLGC++CR++L FGLNI KGD+STDGRWCY+V
Sbjct  6     PSDEVVQVRHGDVAGEPTVVTISCPDKTGLGCDLCRLVLLFGLNIVKGDMSTDGRWCYIV  65

Query  990   MWVFPQSSTPI-VTWAKLKDRLWSVCP---PY--------SNLIYLPSPKTPATSS--YL  853
             +WV  +    + + W  LKDRL  +CP   P+        +  ++L     PA S   +L
Sbjct  66    LWVVARPGRAMAMRWDLLKDRLIQLCPVAAPFGLDNHHLAAAGLHLHDHDAPAPSPNIFL  125

Query  852   MTLYCIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEE  673
             +  +C  R GLLHDVT+ LCE EL I RVKV TTPD RVLD+F I D  ELL+ K ++EE
Sbjct  126   LKFFCYDRMGLLHDVTRVLCELELTIRRVKVSTTPDGRVLDLFFITDARELLHTKSRREE  185

Query  672   LCEQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELS  493
               ++L++VLG+S  SCE++  A   +   L   + L  S   E+F  E+ E ++      
Sbjct  186   TYDKLQSVLGDSLTSCEIE-SATEEMSSCLQASTLLPHSAVEEMFNVEVVEEQSR-----  239

Query  492   PDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKG  313
                       V +DN+LS AHTLIQI C D+K  +YDI R LK CN+QI+Y RF A+  G
Sbjct  240   ----SCGGLSVAMDNSLSPAHTLIQIQCGDHKGLVYDIMRTLKDCNIQISYGRFYASQNG  295

Query  312   QRELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSG  133
               E+D+F    +G+KI+D  KQ +LC  L+ EL  PLRV + NRGPDTELLVANP+E+SG
Sbjct  296   SCEVDLFAVQSDGKKIVDQHKQRALCCRLRTELHRPLRVALVNRGPDTELLVANPVEVSG  355

Query  132   MGRPRVFYDVTFALKTLGICIF  67
              GRP VFYD+T ALK L   IF
Sbjct  356   KGRPLVFYDITLALKKLHKRIF  377



>ref|XP_007218084.1| hypothetical protein PRUPE_ppa006415mg [Prunus persica]
 gb|EMJ19283.1| hypothetical protein PRUPE_ppa006415mg [Prunus persica]
Length=413

 Score =   335 bits (860),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 185/379 (49%), Positives = 245/379 (65%), Gaps = 20/379 (5%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + +D VVI    K G+P +ITVNC DK GLGC++CR+IL FGL+I +GDVSTDG+WCY+V
Sbjct  4     LHEDVVVINQAKKAGEPTVITVNCPDKTGLGCDLCRVILLFGLSICRGDVSTDGKWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSN----LIYLPSPKTPATSS-YLMTLYC-IGR  829
              WV  + +T    W  L  RL  VCP Y +      Y P  + P     +L+  +C   R
Sbjct  64    FWVVEKPNT---RWNLLTKRLLEVCPSYLSTSGIFYYHPENQLPKPPDVFLLEFWCSYER  120

Query  828   TGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAV  649
              GLLHDVT+ LCE EL I RVKV TTPD RV+D+F + D  ELL+ K +Q+E    L+AV
Sbjct  121   EGLLHDVTEVLCELELTIHRVKVSTTPDGRVMDLFFVTDTRELLHAKRRQDETILCLKAV  180

Query  648   LGESCISCELKLVAP--GPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKL  475
             LG++ +SC+++L         +  PC   L  ++T E+F  EL         LS  V   
Sbjct  181   LGDALLSCKIELARSEVTACSQGSPC---LPSAITEEIFSLELPNGR-----LSRSVASN  232

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
               S VT+DN LS +HTL+QI C D+K  +YDI R LK  N+Q++Y RF A+ KG  E+D+
Sbjct  233   PIS-VTVDNNLSPSHTLVQIFCQDHKGLVYDIMRTLKDYNIQVSYGRFYASPKGNCEVDL  291

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F+   +G+KI+DP KQ +LC  L++ELL PLRV + +RGPDTEL+VANP+ELSG GRP V
Sbjct  292   FIMQADGKKIVDPNKQNALCSRLRMELLRPLRVAVVSRGPDTELVVANPVELSGRGRPLV  351

Query  114   FYDVTFALKTLGICIFSVR  58
             FYD+T ALK L   IFSV+
Sbjct  352   FYDITHALKVLKTHIFSVK  370



>ref|XP_002268949.1| PREDICTED: uncharacterized protein LOC100265834 [Vitis vinifera]
 emb|CBI30153.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   335 bits (860),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 180/375 (48%), Positives = 248/375 (66%), Gaps = 20/375 (5%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I+   K G+P ++TVNC DK GLGC++CRIIL FGL+I + DVSTDG+WCY+V W
Sbjct  6     DDVVIIRPSEKEGEPRVLTVNCPDKTGLGCDLCRIILFFGLSIVRVDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSN-----LIYLPSPKTPATSSYLMTLYCIGRTGL  820
             +  +S+T    W+ L+DRL   CP  S+        L  PK P    +L+   C  R GL
Sbjct  66    IIGKSTT---RWSLLQDRLSEACPSCSSASGFSYFQLQPPKPPDV--FLLKFCCYDRKGL  120

Query  819   LHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGE  640
             LHDVT+ LCE EL I++VKV TTPD RV+D+F I D  ELL+ K++QE+    L+ VLG+
Sbjct  121   LHDVTEVLCELELTIKKVKVSTTPDGRVMDLFFITDTRELLHTKKRQEDTHNHLKTVLGD  180

Query  639   SCISCELKLVAPGPLYENLPCFSALSPS-VTNELFRCELS-ENETHLQELSPDVMKLKKS  466
             + ISC++ +V  G         S L PS +T E+F  +   E  + L ++S ++      
Sbjct  181   AMISCDISMV--GSEITACSQTSTLLPSAITREIFGSKFEDEPPSGLPQVSGNIS-----  233

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              VT+DN+LS AHTL+QI C D+K  LYD+ R LK  N++I+Y R +   +   E+D+F+ 
Sbjct  234   -VTMDNSLSPAHTLVQIVCQDHKGLLYDMMRTLKDYNIKISYGRLTTKPRRNCEVDLFIM  292

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G+K++DP KQ +LC  L++ELL PLRV + +RGPDTELLVANP+ELSG GRP VF+D
Sbjct  293   QADGKKVVDPYKQNALCSRLQMELLRPLRVAVVSRGPDTELLVANPVELSGKGRPLVFFD  352

Query  105   VTFALKTLGICIFSV  61
             +T ALK L +CIFS 
Sbjct  353   ITHALKMLNVCIFSA  367



>ref|XP_008442721.1| PREDICTED: uncharacterized protein LOC103486511 isoform X1 [Cucumis 
melo]
Length=411

 Score =   335 bits (860),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 184/377 (49%), Positives = 241/377 (64%), Gaps = 24/377 (6%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+++   K  +P +ITVNC DK GLGC++CRIIL FGLNI +GDV+TDG+WCY+V
Sbjct  4     LHDDVVLVRPSEKDDEPTVITVNCPDKTGLGCDLCRIILFFGLNIVRGDVTTDGKWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYL-------PSPKTPATSSYLMTLYCIG  832
             +WV   SST    W  LK RL  VCP  S+   L       PS K P    +L+   C  
Sbjct  64    LWVTGNSST---RWGLLKQRLMEVCPSCSSASMLSYFRPEPPSSKPP--DMFLLKFCCHD  118

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVT  LCE EL IE+VKV TTPD +V+D+F I D  EL++  ++Q + C+ L+ 
Sbjct  119   RRGLLHDVTWVLCELELLIEKVKVSTTPDGKVMDLFFIVDTRELMHTAKRQRDTCDHLKH  178

Query  651   VLGESCISCELKLVAPGPLYENLPC--FSALSPSVTNELFRCELSENETHLQELSPDVMK  478
             VLG++ ISCE++++      E + C   S+L   +  E    EL+E        S DV  
Sbjct  179   VLGDAVISCEIEMIDA----EVMLCSQASSLPSEIVEESCSLELNEKSPSRSLASKDVS-  233

Query  477   LKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELD  298
                  VT+DN+LS +HTL+QI C D+K  +YDI R LK  N+QI+Y RFS   K   E+D
Sbjct  234   -----VTLDNSLSPSHTLVQIVCQDHKGLIYDIMRTLKDYNIQISYGRFSKKQKKICEID  288

Query  297   VFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPR  118
             +F+   +G+KILD  KQ +L   L++EL+ PLRV + +RGPDTELLVANP ELSG GRP 
Sbjct  289   LFIMQADGKKILDQSKQNALSTRLQIELIRPLRVAVLSRGPDTELLVANPTELSGKGRPL  348

Query  117   VFYDVTFALKTLGICIF  67
             VFYD+T ALK L I IF
Sbjct  349   VFYDITLALKLLDIGIF  365



>ref|XP_011084278.1| PREDICTED: uncharacterized protein LOC105166577 [Sesamum indicum]
Length=412

 Score =   335 bits (860),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 180/378 (48%), Positives = 245/378 (65%), Gaps = 25/378 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+V+I+   + G+  +ITVNC DK GLGC++CRIIL FGL+I +GDVSTDG+WCY+V W
Sbjct  6     EDAVLIKEAERAGEHTVITVNCPDKTGLGCDLCRIILLFGLSIVRGDVSTDGKWCYLVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCP---PYSNLIY-----LPSPKTPATSSYLMTLYC-IG  832
             V  +   P   W  L+ RL  VCP   P ++ I+        P+ P    +L+  +C   
Sbjct  66    VVGK---PTTRWNLLRKRLLEVCPKCTPSASGIFYFIPEFQQPRPPQI--FLLKFWCSYD  120

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVT+ L E EL I+RVK+ T PD RV+D+F I D  ELL   +++EE  + L+ 
Sbjct  121   RKGLLHDVTEVLYELELTIKRVKIYTAPDGRVMDLFFITDTRELLQTSKRREETIKSLKV  180

Query  651   VLGESCISCELKLVAPGPLYENLPCFSALSPS-VTNELFRCELSENETHLQELSPDVMKL  475
             VLG++ +SC++++ AP    E   C  +  PS V+ ++F   LS       ELS  V+  
Sbjct  181   VLGDTMMSCDIEVAAP----EVASCLQSFLPSSVSEDIFSLPLS------GELSSGVLAS  230

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
                 + +DNALS +HTL+QI C D+K  +YDI R LK  N+QI+Y RF A  KG  ELD+
Sbjct  231   DSVSIVVDNALSPSHTLVQIFCQDHKGLIYDIMRTLKDYNIQISYGRFFANTKGNCELDL  290

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F+   +G+KI D  K+ +LC  L++EL+HPLRV + +RGPDTELLV NP+ELSG GRP V
Sbjct  291   FIMQTDGKKITDTHKKNALCSRLRMELIHPLRVDVVSRGPDTELLVVNPVELSGRGRPLV  350

Query  114   FYDVTFALKTLGICIFSV  61
             FYD+T ALK L I IFSV
Sbjct  351   FYDITLALKVLNISIFSV  368



>ref|XP_009762913.1| PREDICTED: uncharacterized protein LOC104214888 [Nicotiana sylvestris]
Length=412

 Score =   335 bits (859),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 188/408 (46%), Positives = 251/408 (62%), Gaps = 42/408 (10%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V++ +  + GDP +ITVNC DK GLG ++CRIIL FGL+I + DVSTDG WCY+V W
Sbjct  6     DDVVLVNHSEREGDPSVITVNCPDKTGLGSDLCRIILFFGLSIVRVDVSTDGIWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP---YSNLIY----LPSPKTPATSSYLMTLYCIGRT  826
             V     TP   W+ LK RL  VCP     S + Y    L SP+ P    +L+T  C  R 
Sbjct  66    VV---GTPKTRWSLLKKRLMGVCPSCSSASGMSYYCAELQSPRPPDV--FLLTFCCYDRR  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT  LC+ EL I++VKV TTPD +V+D+F I D  ELL+ K++QE+  +QL++VL
Sbjct  121   GLLHDVTAVLCDLELTIKKVKVSTTPDGKVMDLFFITDTRELLHTKKRQEDTYDQLKSVL  180

Query  645   GESCISCELKLVAP-------GPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPD  487
             G++ ISC++++V         GP        S L   +  ++F  E+      L E    
Sbjct  181   GDAMISCDIEMVGSEITGCSQGP--------SFLPQEIAEDMFSFEI------LNEHQSR  226

Query  486   VMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQR  307
              +   K+ + +DN LS  HTL+QI C D+K  LYDI R LK  N+QI+Y RF++  K + 
Sbjct  227   SLACNKASIAVDNLLSPGHTLVQIVCQDHKGLLYDIMRTLKDYNIQISYGRFTSKTKTEC  286

Query  306   ELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMG  127
             ELD+F+   +G+KI+DP K  +LC  L++EL  PLRV + NRGPDTELLVANP+ELSG G
Sbjct  287   ELDLFIMQADGKKIVDPSKLNALCSRLQMELCRPLRVALMNRGPDTELLVANPVELSGKG  346

Query  126   RPRVFYDVTFALKTLGICIFSV---------RKWFLI*MNFLNKNGIG  10
             RP VFYD+T ALK L I IFS          R+W +  +     NG G
Sbjct  347   RPIVFYDITLALKMLNIGIFSAEIGRYVIGDREWEIYRILLDEGNGSG  394



>ref|XP_003554396.1| PREDICTED: uncharacterized protein LOC100818216 [Glycine max]
 gb|KHN02308.1| hypothetical protein glysoja_002332 [Glycine soja]
Length=412

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 185/378 (49%), Positives = 241/378 (64%), Gaps = 25/378 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I    K G   +ITVNC DK GLGC++CRIIL FGL+I +GDVSTDG+WCY+V W
Sbjct  6     DDVVIIGEAEKEGKATVITVNCPDKTGLGCDLCRIILFFGLSIVRGDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP---YSNLIY----LPSPKTPATSSYLMTLYCIGRT  826
             V  +       W+ LK RL   CP     S + Y    L  PK P    +L+   C  R 
Sbjct  66    VVGKQRA---RWSLLKKRLIEACPSCSSASGISYYRSELQPPKPPDV--FLLKFCCHDRK  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT+ L E EL I +VKV TTPD +V+D+F I D  ELL+ K+++++  EQL A+L
Sbjct  121   GLLHDVTEVLSELELIIHKVKVSTTPDGKVVDLFFITDTRELLHTKKRRDDTIEQLSAIL  180

Query  645   GESCISCELKLVAPGPLYENLPCFSA---LSPSVTNELFRCELSENETHLQELSPDVMKL  475
             G+  I+ +++LV P    E   C  A   L  ++T ++F  EL  +       S  V   
Sbjct  181   GDPLITIDIELVGP----EIAACSQASSFLPSAMTEDMFDLELPGSIQSGTSTSDSVS--  234

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
                 +T+DN+LS AHTL+QI C D+K  LYDI R LK  N+QI+Y RFS   +G+ ELD+
Sbjct  235   ----ITMDNSLSPAHTLVQIICQDHKGLLYDIMRTLKDYNIQISYGRFSTKPRGKCELDL  290

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F+   +G+KI++P KQ SL   L++ELL PLRV + +RGPDTELLVANP+ELSG GRP V
Sbjct  291   FIMQADGKKIVNPSKQKSLSSRLRMELLRPLRVTVVSRGPDTELLVANPVELSGKGRPLV  350

Query  114   FYDVTFALKTLGICIFSV  61
             FYD+T ALK LG CIFS 
Sbjct  351   FYDITHALKMLGPCIFSA  368



>ref|XP_004956244.1| PREDICTED: uncharacterized protein LOC101773426 [Setaria italica]
Length=423

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 183/382 (48%), Positives = 246/382 (64%), Gaps = 20/382 (5%)
 Frame = -2

Query  1173  SMPDDSVV-IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCY  997
              +P D VV I++ +  GDP ++TV+C DK GLGC++CR++L FGL++ KGD+STDGRWCY
Sbjct  2     GIPSDEVVQIRHADAAGDPAVVTVSCPDKTGLGCDLCRVVLLFGLSVVKGDLSTDGRWCY  61

Query  996   VVMWVFPQSSTPI--VTWAKLKDRLWSVCPPYSNLIY---------LPSPKTPATSS-YL  853
             +V+WV P+       V W  LKDRL  +CP  +   +         +     PA    +L
Sbjct  62    IVLWVLPRRGRGRRPVPWDLLKDRLLQLCPVAAPFGFDAACLAAAGIQDAANPAPPQLFL  121

Query  852   MTLYCIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEE  673
             + LYC  R GLLHDVT+ LCE E  I RVKV TTPD  VLD+F I D  ELL+ K ++EE
Sbjct  122   LKLYCFDRMGLLHDVTRVLCELEFTIRRVKVSTTPDGNVLDLFFITDTRELLHTKSRREE  181

Query  672   LCEQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELS  493
               ++L +VLG+S  S E+ L A   +   L   ++L P+V  ++F  +L E E  +    
Sbjct  182   AYDKLDSVLGDSLTSREIDL-ATEDMLSCLQACASLMPAVVEQMFNMDLIE-EQSISTRG  239

Query  492   PDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKG  313
              D +      VT+DN+LSS HTLIQI C D K  LYDI R +K CN+QI+Y RF A+   
Sbjct  240   GDTIS-----VTMDNSLSSVHTLIQIQCGDRKGLLYDIMRTVKDCNIQISYGRFYASQNR  294

Query  312   QRELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSG  133
             + ++D+FV   +G+KILD ++Q SLC  L++ELL PLRV + +RGPDTELLVANP+E+SG
Sbjct  295   RCDVDLFVVQSDGKKILDLQRQGSLCCRLRMELLRPLRVALVDRGPDTELLVANPVEVSG  354

Query  132   MGRPRVFYDVTFALKTLGICIF  67
              GRP VFYD+T ALK L   IF
Sbjct  355   KGRPLVFYDITLALKNLQKRIF  376



>ref|XP_002315327.1| hypothetical protein POPTR_0010s23520g [Populus trichocarpa]
 gb|EEF01498.1| hypothetical protein POPTR_0010s23520g [Populus trichocarpa]
Length=411

 Score =   334 bits (857),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 185/377 (49%), Positives = 244/377 (65%), Gaps = 20/377 (5%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + +D VVI    KPG+P +ITVNC DK GLGC++CR+IL FGL+I + D  TDG+WCY+V
Sbjct  4     LQEDVVVISQAEKPGEPAVITVNCPDKTGLGCDLCRVILLFGLSICREDAQTDGKWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNL----IYLPSPKTPATSS-YLMTLYCI-GR  829
              WV  + +T    W  LK RL  VCP Y +      Y P  + P     +L+  +C   R
Sbjct  64    FWVVGKPNT---RWDLLKKRLLEVCPSYFSTSEFDYYKPENQQPKPPDVFLLKFWCAYDR  120

Query  828   TGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAV  649
              GLLHDVT+ L E EL I+RVKV T PD RVLD+F I D+ ELL+ K +QEE    L+ V
Sbjct  121   EGLLHDVTEVLWELELTIKRVKVSTAPDGRVLDLFFITDNRELLHTKMRQEETIHYLKNV  180

Query  648   LGESCISCELKLVAPGPLYENLPCF-SALSPSVTNELFRCELSENETHLQELSPDVMKLK  472
             LG++ ISCE++L       E   C  S L P++T ++F  EL  N+     L+P+ +   
Sbjct  181   LGKALISCEIELAGA----EVTACSQSFLPPAITEDMFNLELP-NKHRSGFLAPNPVS--  233

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                VT+DN  S +HTLIQI C D+K   YDI R LK  ++QI+Y RF A  KG  E+D+F
Sbjct  234   ---VTVDNTFSPSHTLIQILCKDHKGLSYDIMRTLKDYHIQISYGRFFANRKGNCEVDLF  290

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             +   +G+KI+DP KQ +LC  L++ELL P+R+ + +RGPDTELLVANP+ELSG GRP VF
Sbjct  291   LMQADGKKIVDPNKQNALCSRLRMELLRPVRLAVVSRGPDTELLVANPVELSGRGRPLVF  350

Query  111   YDVTFALKTLGICIFSV  61
             +D+T ALKTL   IFSV
Sbjct  351   HDITLALKTLNTRIFSV  367



>gb|KDP29171.1| hypothetical protein JCGZ_16560 [Jatropha curcas]
Length=412

 Score =   333 bits (855),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 182/377 (48%), Positives = 245/377 (65%), Gaps = 23/377 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D V+I+   K  D  +ITVNC DK GLGC++CRIIL FGLNI KGD+STDG+WCYV+ W
Sbjct  6     EDVVIIRQAEKESDLSLITVNCPDKTGLGCDLCRIILFFGLNIVKGDISTDGKWCYVIFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNL----IYLPSPKTPAT--SSYLMTLYCIGRTG  823
             V   SST    W+ LK RL  VCP  S+      Y P  + P      +L+ L C  R G
Sbjct  66    VGGNSST---RWSLLKKRLLEVCPSCSSASGISYYRPELQQPPRPPDVFLLKLCCHDRKG  122

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLH+VT+ LCE EL I++VKV TTPD RV+D+F + D  ELL+  +++E+  E LRAV+G
Sbjct  123   LLHNVTEVLCELELTIKKVKVSTTPDGRVMDLFFVTDIRELLHTNKRKEDTYEHLRAVMG  182

Query  642   ESCISCELKLVAPGPLYENLPCF---SALSPSVTNELFRCELSENETHLQELSPDVMKLK  472
             ++ ISC+++ V      E   C    S L  ++T ++   E+ +      ELS       
Sbjct  183   DALISCDIETVGS----EITACSQESSFLPTTITEDILNLEIPD------ELSGSQTSTG  232

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
              S VT+DN+LS AHTL+Q++C D+K  LYDI R LK  N++I+Y R+S   +   E+D+F
Sbjct  233   VS-VTMDNSLSPAHTLVQVACQDHKGVLYDIMRTLKDYNIKISYGRYSIIQRRNCEIDLF  291

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             +   +G+KI+DP KQ +L   LK+ELL P+RV + +RGPDTELLVANP+ELSG GRP VF
Sbjct  292   IVQADGKKIVDPSKQRALLSRLKMELLRPIRVAVVSRGPDTELLVANPVELSGKGRPLVF  351

Query  111   YDVTFALKTLGICIFSV  61
             +D+T ALK L  CIFS 
Sbjct  352   HDITLALKMLNTCIFSA  368



>ref|XP_008446832.1| PREDICTED: uncharacterized protein LOC103489440 isoform X1 [Cucumis 
melo]
Length=412

 Score =   333 bits (854),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 177/378 (47%), Positives = 245/378 (65%), Gaps = 24/378 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +DSVVI +G K GDP++ITVNC DK GLGC++CRIIL FGL+I +GD STDG+WCY+V+W
Sbjct  6     EDSVVITSGEKQGDPHVITVNCPDKTGLGCDLCRIILLFGLSISRGDFSTDGKWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPY---SNLIYLPSPK--TPATSSYLMTLYCIGR-TG  823
             V  +   P   W  LK RL  VCP +   S + +    K        +L+  +C     G
Sbjct  66    VVGK---PTTRWPLLKKRLLEVCPSHFSTSGIRFYQQEKEIQKPPDVFLLKFWCSSHPKG  122

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHDVT+ LCE EL I RVKV T PD +++D+F I D  ELL+ +++QEE   +L+ +L 
Sbjct  123   LLHDVTEVLCELELTIRRVKVSTAPDGKMMDLFFITDTRELLHTRKRQEETMHRLKMILA  182

Query  642   ESCISCELKLVAPGPLYENLPCFSALSP----SVTNELFRCELSENETHLQELSPDVMKL  475
             +  +SCE++L  P    E   C S  SP    S++ ELF  EL    ++    S  V   
Sbjct  183   DVLMSCEIELAGP----EFTAC-SQRSPYLPSSISEELFSLELQNGPSNRHLPSNSV---  234

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
                +V++DNA+S +HT+IQ+ C+D+K  +YDI R LK  N+Q++Y RF   +KG+ ++++
Sbjct  235   ---VVSMDNAISRSHTVIQLLCLDHKGLMYDIMRTLKDYNIQVSYGRFHLNSKGKCDIEL  291

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F    +G KI+DP KQ +LC  L++EL  PLR  + +RGPDTELLVANP+ELSG GRP V
Sbjct  292   FTMQSDGCKIVDPNKQNALCSRLRMELTRPLRAAVVSRGPDTELLVANPVELSGRGRPLV  351

Query  114   FYDVTFALKTLGICIFSV  61
             F+D+T ALK L + IFSV
Sbjct  352   FHDITLALKQLNMSIFSV  369



>gb|EYU38569.1| hypothetical protein MIMGU_mgv1a007289mg [Erythranthe guttata]
Length=412

 Score =   333 bits (854),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 175/375 (47%), Positives = 241/375 (64%), Gaps = 19/375 (5%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+I+   + G+P +ITVNC DK GLGC++CRIIL FGL + + DVSTDG+WCY+V+W
Sbjct  6     DDAVLIRQSEEEGEPSVITVNCPDKTGLGCDLCRIILFFGLTVVRIDVSTDGKWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPY-------SNLIYLPSPKTPATSSYLMTLYCIGRT  826
             V  + ST    W+ LK RL   CP +        +   L  PK P    +L+   C  R 
Sbjct  66    VLGKPST---RWSLLKKRLMGACPSFLLACGISFDRADLQPPKPPDV--FLLKFCCNDRN  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT  LCE EL I+RVKV TTPD +V+D+F I D  ELL+ ++++E+  + L+ V+
Sbjct  121   GLLHDVTGVLCELELTIKRVKVSTTPDGKVMDLFFITDTRELLHTEQRKEDTVDHLKDVI  180

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             G+S I+C++++V  GP   +     +     T  +F  E+ E           ++  K+ 
Sbjct  181   GDSTITCDIQMV--GPEIASCSLVPSFHSDNTEGIFDIEMLEKNGE-----DSIVAFKRP  233

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              +T+DN LS +HTL+QI C D+K  LYD+ R LK  N+QI+Y RF+A  K + ELD+F+ 
Sbjct  234   SITMDNLLSPSHTLVQIVCRDHKGLLYDVMRTLKDYNIQISYGRFTAKGKTECELDLFIM  293

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               NGEKI+DP KQ SL   L+VEL  P+RV + +RGPDTEL+VANP+EL+G GRP VFYD
Sbjct  294   EANGEKIVDPTKQNSLKSRLEVELSRPIRVSLISRGPDTELIVANPVELAGKGRPMVFYD  353

Query  105   VTFALKTLGICIFSV  61
             +T ALK L   IFS 
Sbjct  354   ITLALKKLNRSIFSA  368



>ref|XP_002298947.1| hypothetical protein POPTR_0001s43320g [Populus trichocarpa]
 ref|XP_006370497.1| ACT domain-containing family protein [Populus trichocarpa]
 gb|EEE83752.1| hypothetical protein POPTR_0001s43320g [Populus trichocarpa]
 gb|ERP67066.1| ACT domain-containing family protein [Populus trichocarpa]
Length=413

 Score =   333 bits (854),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 185/378 (49%), Positives = 243/378 (64%), Gaps = 26/378 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVI+   K GDP +ITVNC DK GLGC++CRIIL FGL+I +GDVSTDG+WCY+V W
Sbjct  7     DDVVVIRQSEKEGDPTVITVNCPDKTGLGCDLCRIILFFGLSIVRGDVSTDGKWCYLVFW  66

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP---YSNLIY----LPSPKTPATSSYLMTLYCIGRT  826
             V  +S+T    W  LK RL   CP     S L +    L  P+ P    +L+ L C  R 
Sbjct  67    VVGKSTT---RWGLLKKRLVEACPSCSSASGLSFYRSELQPPRPPDV--FLLKLSCQDRR  121

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT  LCE EL I++VKV TTPD RV+D+F I D+ ELL+  +++E+ C+ L+AV 
Sbjct  122   GLLHDVTSVLCELELTIKKVKVSTTPDGRVIDLFFITDNRELLHTNKRKEDTCDHLKAVT  181

Query  645   GESCISCELKLVAPGPLYENLPCF---SALSPSVTNELFRCELSENETHLQELSPDVMKL  475
             G S ISC++++V P    E   C    S L  ++T  +   E+ +      EL P  +  
Sbjct  182   GNSMISCDIEIVGP----EITACSAESSFLPTAITENILPLEMPD------EL-PSSLTS  230

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
                 V +DN+LS  HTL+QI C D+K  LYDI R LK  N+QI+Y RFS  +    ++D+
Sbjct  231   TSVSVNMDNSLSPGHTLVQIVCQDHKGLLYDIMRTLKDYNIQISYGRFSMNHGRACDIDL  290

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F+   +G+KI+DP KQ +L   L++EL+ PLRV   +RGPDTELLVANP+ELSG GRP V
Sbjct  291   FLVQTDGKKIVDPRKQKALSSRLEMELVRPLRVATVSRGPDTELLVANPVELSGKGRPLV  350

Query  114   FYDVTFALKTLGICIFSV  61
             F+D+T ALK L  CIFS 
Sbjct  351   FHDITLALKMLNTCIFSA  368



>ref|XP_007162783.1| hypothetical protein PHAVU_001G180200g [Phaseolus vulgaris]
 gb|ESW34777.1| hypothetical protein PHAVU_001G180200g [Phaseolus vulgaris]
Length=412

 Score =   333 bits (854),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 180/378 (48%), Positives = 241/378 (64%), Gaps = 21/378 (6%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+I+   K G+  +ITVNC DK GLGC++CRIIL FGL+I +GDVSTDG+WCY+V
Sbjct  4     LHDDVVIIREAEKEGETTVITVNCPDKTGLGCDLCRIILFFGLSIVRGDVSTDGKWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPP---YSNLIYLPSPKTPATSS--YLMTLYCIGRT  826
              WV  +  T    W+ LK RL   CP     S + Y  S   P   S  +L+   C  R 
Sbjct  64    FWVAGKQRT---RWSLLKKRLIEACPSCSSASGISYYRSELKPPKPSDVFLLKFCCHDRK  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHD+T+ L E EL I +VK+ TTPD RV+D+F + D  ELL+ K+++++  EQL  +L
Sbjct  121   GLLHDITEVLSELELIIHKVKISTTPDGRVVDLFFVTDTRELLHTKKRRDDTIEQLLVIL  180

Query  645   GESCISCELKLVAPGPLYENLPCF---SALSPSVTNELFRCELSENETHLQELSPDVMKL  475
             G+  I+ +++LV P    E   C    S L  ++T +++  EL ++       S  V   
Sbjct  181   GDPSITIDIELVGP----EITACSQSSSFLPSAITEDIYDLELPDSLQSGTSTSDSVS--  234

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
                 + IDN+LS AHTL+QI C D+K  LYDI R LK  N+QI+Y RFS   +G+ ELD+
Sbjct  235   ----IAIDNSLSPAHTLVQIICQDHKGLLYDIMRTLKDYNIQISYGRFSTKPRGKCELDL  290

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F+   +G+KI+DP KQ SL   L++ELL P RV + +RGPDTELLVANP+ELSG GRP V
Sbjct  291   FIVQADGKKIVDPSKQKSLSSRLRIELLRPFRVTVVSRGPDTELLVANPVELSGKGRPLV  350

Query  114   FYDVTFALKTLGICIFSV  61
             FYD+T ALK LG  IFS 
Sbjct  351   FYDITLALKMLGPSIFSA  368



>ref|XP_011024365.1| PREDICTED: uncharacterized protein LOC105125549 [Populus euphratica]
Length=413

 Score =   333 bits (853),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 185/379 (49%), Positives = 243/379 (64%), Gaps = 22/379 (6%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + +D VVI    KPG+P +ITVNC DK GLGC++CR+IL FGL+I + D  TDG+WCY+V
Sbjct  4     LHEDVVVISQAEKPGEPAVITVNCPDKTGLGCDLCRVILLFGLSICREDAQTDGKWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNL----IYLPSPKTPATSS-YLMTLYC-IGR  829
              WV   +  P   W  LK RL  VCP Y +      Y P  + P     +L+  +C   R
Sbjct  64    FWV---AGKPNTRWNLLKKRLLEVCPSYFSTSEFDYYKPENQQPKPPDVFLLKFWCSYDR  120

Query  828   TGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAV  649
              GLLHDVT+ L E EL I+RVKV T PD RVLD+  I D+ ELL+ K +QEE    L+ V
Sbjct  121   EGLLHDVTEVLWELELTIKRVKVSTAPDGRVLDLLFITDNRELLHTKMRQEETIHYLKNV  180

Query  648   LGESCISCELKLVAPGPLYENLPCF---SALSPSVTNELFRCELSENETHLQELSPDVMK  478
             LG++ ISCE++L       E   C    S L P++T ++F  EL  N+     L+P+ + 
Sbjct  181   LGKALISCEIELAGA----EVTACSQGSSFLPPAITEDMFNLELP-NKHRSGFLAPNPVS  235

Query  477   LKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELD  298
                  VT+DN LS +HTLIQI C D+K   YDI R LK  ++QI+Y RF A  KG  E+D
Sbjct  236   -----VTVDNTLSPSHTLIQILCKDHKGLSYDIMRTLKDYHIQISYGRFFANRKGNCEVD  290

Query  297   VFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPR  118
             +F+   +G+KI+DP KQ +LC  L++ELL P+R+ + +RGPDTELLVANP+ELSG GRP 
Sbjct  291   LFLMQADGKKIVDPNKQNALCSRLRMELLRPVRLAVVSRGPDTELLVANPVELSGRGRPL  350

Query  117   VFYDVTFALKTLGICIFSV  61
             VF+D+T ALKTL   IFSV
Sbjct  351   VFHDITLALKTLNTRIFSV  369



>ref|XP_008233260.1| PREDICTED: uncharacterized protein LOC103332312 [Prunus mume]
Length=413

 Score =   333 bits (853),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 180/379 (47%), Positives = 242/379 (64%), Gaps = 20/379 (5%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + +D VVI    K G+P +ITVNC DK GLGC++CR+IL FGL+I +GDVSTDG+WCY+V
Sbjct  4     LHEDVVVINQAKKAGEPTVITVNCPDKTGLGCDLCRVILLFGLSICRGDVSTDGKWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSN----LIYLPSPKTPATSS-YLMTLYC-IGR  829
              WV  + +T    W  L  RL  VCP Y +      Y P  + P     +L+  +C   R
Sbjct  64    FWVVGKPNT---RWNLLTKRLLEVCPSYLSTSGIFYYHPENQQPKPPDVFLLEFWCSYER  120

Query  828   TGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAV  649
              GLLHDVT+ LCE EL I RVKV TTPD RV+D+F + D  ELL+ K +Q+E    L+AV
Sbjct  121   EGLLHDVTEVLCELELTIHRVKVSTTPDGRVMDLFFVTDTRELLHAKRRQDETILCLKAV  180

Query  648   LGESCISCELKLVAP--GPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKL  475
             LG++ +SC+++L         +  PC   L  ++T E+F  EL          S  +   
Sbjct  181   LGDALLSCKIELAGSEVTACSQGSPC---LPSAITEEIFSLELPNGRLGRSVASNPIS--  235

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
                 +T+DN LS +HTL+QI C D+K  +YDI R LK  N+Q++Y RF A+ KG  E+D+
Sbjct  236   ----LTVDNNLSPSHTLVQIFCQDHKGLVYDIMRTLKDYNIQVSYGRFYASPKGNCEVDL  291

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F+   +G+KI+DP KQ +LC  L++ELL PLRV + +RGPDTEL+VANP+ELSG GRP V
Sbjct  292   FIMQADGKKIVDPNKQNALCSRLRMELLRPLRVAVVSRGPDTELVVANPVELSGRGRPLV  351

Query  114   FYDVTFALKTLGICIFSVR  58
             FYD+T ALK     IFSV+
Sbjct  352   FYDITHALKVQKTHIFSVK  370



>ref|XP_010050712.1| PREDICTED: uncharacterized protein LOC104439324 isoform X2 [Eucalyptus 
grandis]
 gb|KCW89360.1| hypothetical protein EUGRSUZ_A01656 [Eucalyptus grandis]
Length=408

 Score =   331 bits (849),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 182/376 (48%), Positives = 244/376 (65%), Gaps = 25/376 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I+   + G+P MIT+NC DK GLGC++CRIIL FGL+I +GDVSTDG+WCY++ W
Sbjct  6     DDVVIIRQSEREGEPSMITINCPDKTGLGCDLCRIILFFGLSIARGDVSTDGKWCYILFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLI------YLPSP-KTPATSSYLMTLYCIGRT  826
             V   +  P   W+ LK RL   CP  S+        Y P P K P    +L+ L C  R 
Sbjct  66    V---TGNPKTRWSLLKMRLVEACPSCSSASRILFDNYGPQPSKDPDV--FLLKLACCDRR  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLL+DVT+ LCE EL I+RVKV TTPD++V+D+F I D  ELL+ K++Q+++   L+AV+
Sbjct  121   GLLYDVTRVLCEFELIIKRVKVSTTPDEKVMDLFFITDTRELLHTKKRQDDVSNYLKAVI  180

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             GE+ ISC++++V  GP        S L P++T +            +     D     KS
Sbjct  181   GEAMISCDIEMV--GPEITECSQDSFLPPAITED----------KEIPNYQLDGSLTSKS  228

Query  465   I-VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFV  289
             I V IDN LS AHTL+QISC D+K  LYDI R LK  N+QI+Y RF    +   E+D+F+
Sbjct  229   ISVKIDNMLSPAHTLVQISCQDHKGLLYDIMRTLKDYNIQISYGRFFTKQRRNCEIDLFI  288

Query  288   QHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFY  109
                +G+KI+ P KQ +L   L++ELL PLRV + +RGP+TELLVANP++L G GRP VF+
Sbjct  289   MQVDGKKIVAPSKQQALSSRLEMELLQPLRVAVVSRGPETELLVANPVQLCGKGRPLVFH  348

Query  108   DVTFALKTLGICIFSV  61
             D+T ALKTL I IFSV
Sbjct  349   DITLALKTLNIGIFSV  364



>ref|XP_011040576.1| PREDICTED: uncharacterized protein LOC105136793 isoform X1 [Populus 
euphratica]
 ref|XP_011040577.1| PREDICTED: uncharacterized protein LOC105136793 isoform X1 [Populus 
euphratica]
Length=412

 Score =   331 bits (849),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 181/376 (48%), Positives = 241/376 (64%), Gaps = 24/376 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I++  K GDP +ITVNC DK GLGC++CRIIL FGL+I +GDVSTDG+WCY+V W
Sbjct  6     DDVVIIRHSEKEGDPAVITVNCPDKTGLGCDLCRIILFFGLSIVRGDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP---YSNLIY----LPSPKTPATSSYLMTLYCIGRT  826
             V  +S+T    W  LK RL   CP     S + Y    L  P+ P    +L+ L C  R 
Sbjct  66    VVGKSTT---RWGLLKKRLVGACPSCSSASGISYYSAELQPPRPPDV--FLLKLACHDRK  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT  LCE EL I++VKV TTPD RV+D+F + D  ELL+  +++E+  + LRAV+
Sbjct  121   GLLHDVTGVLCELELTIKKVKVSTTPDGRVMDLFFVTDTRELLHTTKRKEDTYDHLRAVM  180

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQ--ELSPDVMKLK  472
             G S ISC++++V P    E   C      S  +      ++EN   LQ  +  P  +   
Sbjct  181   GNSMISCDIEMVGP----EITAC------SAESSFLPTAITENILPLQMPDELPSSLTST  230

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                V +DN LS AHTL+QI C D+K  LYDI R LK  N+QI+Y RF   ++   E+D+F
Sbjct  231   SVSVIMDNLLSPAHTLVQIVCQDHKGLLYDIMRTLKDYNIQISYGRFYIKHRRTCEIDLF  290

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             +   +G+KI+DP KQ +L   L++EL+ PLRV + +RGPDTEL+VANP+ELSG GRP VF
Sbjct  291   IVQADGKKIVDPNKQKALSSRLEMELVRPLRVAVVSRGPDTELMVANPVELSGKGRPLVF  350

Query  111   YDVTFALKTLGICIFS  64
             +D+T AL  L  CIFS
Sbjct  351   HDITLALTMLDSCIFS  366



>ref|XP_002519483.1| amino acid binding protein, putative [Ricinus communis]
 gb|EEF42897.1| amino acid binding protein, putative [Ricinus communis]
Length=409

 Score =   331 bits (848),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 178/376 (47%), Positives = 239/376 (64%), Gaps = 24/376 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I+   K  D  +ITVNC DK GLGC++CRIIL FGL+I +GD STDG+WCY+V W
Sbjct  6     DDVVIIRQSEKESDLSVITVNCPDKTGLGCDLCRIILFFGLSIVRGDFSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCP--------PYSNLIYLPSPKTPATSSYLMTLYCIGR  829
             V   SST    W  LK RL  VCP        PY     L  P+ P    +L+ L C  R
Sbjct  66    VAGNSST---RWGLLKKRLLGVCPSCSSASGIPYYRDELLQPPRPPDV--FLLKLCCHDR  120

Query  828   TGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAV  649
              GLLH+VT+ LCE EL I +VKV TTPD RV+D+F + D  ELL+  +++EE   QL++V
Sbjct  121   RGLLHNVTEVLCELELTIRKVKVSTTPDGRVMDLFFVTDTRELLHTNKRKEETYGQLKSV  180

Query  648   LGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKK  469
             +G+  ISC++++V P     +L   S+L  ++T ++             E+ P  +    
Sbjct  181   IGDGMISCDIEMVGPEITACSLES-SSLPTTITEDMLH----------WEVPPGSLTSIS  229

Query  468   SIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFV  289
               VT+DN+LS  HTL+QI+C D+K  LYDI R LK  N++I+Y RFS   +   E+D+F+
Sbjct  230   VSVTMDNSLSPGHTLVQIACQDHKGLLYDIMRTLKDYNIKISYGRFSIKQRRNCEIDLFI  289

Query  288   QHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFY  109
                +G+KI+DP KQ +LC  L++ELL PLRV + +RGPD ELLVANP+ELSG GRP VF+
Sbjct  290   VQADGKKIVDPSKQGALCSRLEMELLRPLRVAVVSRGPDIELLVANPVELSGNGRPLVFH  349

Query  108   DVTFALKTLGICIFSV  61
             D+T ALK L   IFS 
Sbjct  350   DITLALKMLSTGIFSA  365



>ref|XP_004142413.1| PREDICTED: uncharacterized protein LOC101203151 [Cucumis sativus]
 ref|XP_004157538.1| PREDICTED: uncharacterized protein LOC101230856 [Cucumis sativus]
 gb|KGN52243.1| hypothetical protein Csa_5G622580 [Cucumis sativus]
Length=412

 Score =   331 bits (848),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 174/378 (46%), Positives = 244/378 (65%), Gaps = 24/378 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +DSVVI +G K GDP++ITVNC DK GLGC++CRIIL FGL+I +GD STDG+WCY+V+W
Sbjct  6     EDSVVITSGEKQGDPHVITVNCPDKTGLGCDLCRIILLFGLSISRGDFSTDGKWCYIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPY---SNLIYLPSPK--TPATSSYLMTLYCIGR-TG  823
             V  +   P   W  LK RL  VCP +   S + +    K        +L+  +C     G
Sbjct  66    VVGK---PTTRWPLLKKRLLEVCPSHFSTSGIRFYQQEKEIQKPPDVFLLKFWCSSHPKG  122

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHDVT+ LCE EL I RVKV T PD +++D+F I D  ELL+ +++QEE    L+ +L 
Sbjct  123   LLHDVTEVLCELELTIRRVKVSTAPDGKMMDLFFITDTRELLHTRKRQEETMHHLKMILA  182

Query  642   ESCISCELKLVAPGPLYENLPCFSALSP----SVTNELFRCELSENETHLQELSPDVMKL  475
             +  +SCE++L  P    E   C S  SP    S++ ELF  EL    ++        +  
Sbjct  183   DVLMSCEIELAGP----EFTAC-SQRSPNLPSSISEELFSLELPHGPSNRH------LPS  231

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
               ++V+IDN++S +HT+IQ+ C+D+K  +YDI R LK  N+Q++Y RF   +KG+ ++++
Sbjct  232   HSAVVSIDNSISRSHTVIQLLCLDHKGLMYDIMRTLKDYNIQVSYGRFHLNSKGKCDIEL  291

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F    +G KI+DP K+ +LC  L++EL  PLR  + +RGPDTELLVANP+ELSG GRP V
Sbjct  292   FTMQSDGCKIVDPNKKNALCSRLRMELTRPLRAAVVSRGPDTELLVANPVELSGRGRPLV  351

Query  114   FYDVTFALKTLGICIFSV  61
             F+D+T ALK L + IFSV
Sbjct  352   FHDITLALKQLNMSIFSV  369



>ref|XP_011011060.1| PREDICTED: uncharacterized protein LOC105115755 [Populus euphratica]
 ref|XP_011011061.1| PREDICTED: uncharacterized protein LOC105115755 [Populus euphratica]
 ref|XP_011011062.1| PREDICTED: uncharacterized protein LOC105115755 [Populus euphratica]
 ref|XP_011011063.1| PREDICTED: uncharacterized protein LOC105115755 [Populus euphratica]
 ref|XP_011011064.1| PREDICTED: uncharacterized protein LOC105115755 [Populus euphratica]
Length=413

 Score =   330 bits (846),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 183/378 (48%), Positives = 243/378 (64%), Gaps = 26/378 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I+   K G+P +ITVNC DK GLGC++CRIIL FGL+I +GDVSTDG+WCY+V W
Sbjct  7     DDVVIIKKSEKEGEPTVITVNCPDKTGLGCDLCRIILFFGLSIVRGDVSTDGKWCYLVFW  66

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP---YSNLIYLPS----PKTPATSSYLMTLYCIGRT  826
             V  +S+T    W+ LK RL   CP     S L +  S    P+ P    +L+ L C  R 
Sbjct  67    VVGKSTT---RWSLLKKRLVEACPSCSSASGLSFYRSELRPPRPPDV--FLLKLSCQDRR  121

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT  LCE EL I++VKV TTPD RV+D+F I D  ELL+  +++E+ C+ L+AV 
Sbjct  122   GLLHDVTSVLCELELTIKKVKVSTTPDGRVIDLFFITDTRELLHTNKRKEDTCDHLKAVT  181

Query  645   GESCISCELKLVAPGPLYENLPCF---SALSPSVTNELFRCELSENETHLQELSPDVMKL  475
             G S ISC++++V P    E   C    S L  ++T  +   E+ +      EL P  +  
Sbjct  182   GNSMISCDIEIVGP----EITACSAESSFLPTAITENILPLEMPD------EL-PSSLTS  230

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
                 V +DN+LS  HTL+QI C D+K  LYDI R LK  N+QI+Y RFS  +    ++D+
Sbjct  231   TSVSVNMDNSLSPGHTLVQIVCQDHKGLLYDIMRTLKDYNIQISYGRFSMNHGRACDIDL  290

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F+   +G+KI+DP KQ +L   L++EL+ PLRV   +RGPDTELLVANP+ELSG GRP V
Sbjct  291   FLVQTDGKKIVDPRKQKALSSRLEMELVRPLRVATVSRGPDTELLVANPVELSGKGRPLV  350

Query  114   FYDVTFALKTLGICIFSV  61
             F+D+T ALK L  CIFS 
Sbjct  351   FHDITLALKMLNTCIFSA  368



>ref|XP_007027446.1| ACT-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY07948.1| ACT-like superfamily protein isoform 1 [Theobroma cacao]
Length=417

 Score =   330 bits (846),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 184/382 (48%), Positives = 238/382 (62%), Gaps = 28/382 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I+   K G+P +ITVNC DK GLGC++CRI+L FGL+I +GDVSTDG+WCY+V W
Sbjct  6     DDVVIIRQSEKEGEPNVITVNCPDKTGLGCDLCRILLFFGLSIVRGDVSTDGKWCYIVFW  65

Query  984   VF--PQSSTPIVTWAKLKDRLWSVCPP---YSNLIY----LPSPKTPATSSYLMTLYCIG  832
             V   P +      W  LK RL   CP     S + Y    L  PK P    +L+ L C  
Sbjct  66    VVCKPATRWGSSRWELLKKRLIGACPSCSSASGISYYRSELQPPKPPDV--FLLKLCCYD  123

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVT+ LC  EL I++VKV TTPD  V+D+F + D  ELL+  ++QEE C+ L  
Sbjct  124   RKGLLHDVTEVLCCLELNIKKVKVSTTPDGTVMDLFFVTDTRELLHTTKRQEETCKALED  183

Query  651   VLGESCISCELKLVAPGPLYENLPCFSALSP----SVTNELFRCELSENETHLQELSPDV  484
             V+ E+ ISC ++ V P      +   S  SP     +T ++F  E+S          P V
Sbjct  184   VMQEAVISCNIQKVGP-----QITACSQASPFLPSQITEDIFHLEMSNK-------LPSV  231

Query  483   MKLKKSI-VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQR  307
                  S+ VT+DN+LS AHTL+QI C DYK  LYDI R LK  N+QI+Y RF      + 
Sbjct  232   SLTSNSVSVTMDNSLSPAHTLVQIICQDYKGLLYDIMRTLKDYNIQISYGRFYIKQGRKC  291

Query  306   ELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMG  127
             E+D+F+   +G+KI+DP KQ +L   L++ELL PLRV + +RGPDTELLVANP+ELS  G
Sbjct  292   EIDLFIMQADGKKIVDPSKQNALSSRLQMELLQPLRVAVMSRGPDTELLVANPVELSSKG  351

Query  126   RPRVFYDVTFALKTLGICIFSV  61
             RP VFYD+T ALK L  CIFS 
Sbjct  352   RPLVFYDITLALKMLDTCIFSA  373



>ref|XP_008343479.1| PREDICTED: uncharacterized protein LOC103406256 [Malus domestica]
Length=413

 Score =   330 bits (845),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 182/380 (48%), Positives = 237/380 (62%), Gaps = 22/380 (6%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + +D VVI    K G+P +ITVNCLDK GLGC++CR+IL FGL+I +GDVSTDG+WCY+V
Sbjct  4     LHEDVVVINQAEKAGEPTVITVNCLDKTGLGCDLCRVILLFGLSICRGDVSTDGKWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSN----LIYLPSPKTPATSS-YLMTLYC-IGR  829
              WV  + ST    W  L  RL + CP Y +      Y P  + P     +L+  +C   R
Sbjct  64    FWVVGKPST---RWNLLTKRLLAACPSYFSTSGIFYYRPENQQPKPPDVFLLKFWCSYER  120

Query  828   TGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAV  649
              GLLHDVT+ LCE EL I  VKV TTPD RV+D+F I D  E+L+ K +Q+E  + L+AV
Sbjct  121   DGLLHDVTEVLCELELTINSVKVSTTPDGRVMDLFFITDTREILHTKRRQDETIDSLKAV  180

Query  648   LGESCISCELKLVAPGPLYENLPCFSA---LSPSVTNELFRCELSENETHLQELSPDVMK  478
             L  + +SCE++L       E   C      L  ++T E+F  EL          S  V  
Sbjct  181   LCNALLSCEIELAGS----EVTACSQGSMYLPSAITEEMFSLELPNGRLSRSVASNPVS-  235

Query  477   LKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELD  298
                  VT+DN LS + TL+QI C D+K  +YDI R LK  N+Q+ Y RF A  +G  ELD
Sbjct  236   -----VTVDNHLSPSLTLVQIFCQDHKGLIYDIMRTLKDYNIQVRYGRFCANPRGNCELD  290

Query  297   VFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPR  118
             +F+   +G+KI+D  KQ +LC  L++ELL PLRV + +RGPDTELLVANP+ELSG GRP 
Sbjct  291   LFIMQADGKKIVDRNKQNALCSRLRMELLRPLRVAVVSRGPDTELLVANPVELSGRGRPL  350

Query  117   VFYDVTFALKTLGICIFSVR  58
             VFYD+T ALK L   IFSV+
Sbjct  351   VFYDITLALKVLKTRIFSVK  370



>ref|XP_004494076.1| PREDICTED: uncharacterized protein LOC101505514 [Cicer arietinum]
Length=405

 Score =   329 bits (844),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 178/375 (47%), Positives = 238/375 (63%), Gaps = 22/375 (6%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+++   K GD  +ITVNC DK GLG ++CRI+L F L I +GDVSTDG+WCY+V
Sbjct  4     LHDDVVIMRQPEKEGDATIITVNCPDKTGLGSDLCRILLFFRLTILRGDVSTDGKWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPP---YSNLIYLPSPKTPATSS--YLMTLYCIGRT  826
              WV  + +T    W+ LK RL   CP     S + Y  S   P   S  +L+T  C  RT
Sbjct  64    FWVMGKENT---RWSLLKMRLIGACPSCSSASGMYYYCSDLQPPRPSDVFLLTFCCNDRT  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT  LCE EL I++VKV TTPD +V+D+F I D  ELL+ + ++++  E+L A+L
Sbjct  121   GLLHDVTTVLCELELTIKKVKVSTTPDGKVVDLFFITDTRELLHTQTRRDDTIEKLTAIL  180

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             G+ C + +++LV    +      FS  S S+ N +         T + +L          
Sbjct  181   GDGCTTIDIELVGSERI-----AFSQASLSLPNAI---------TDVFDLESGTSTSDSV  226

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              V IDN LS AHTL+QI C  +K  LYDI R LK  N+QI+Y RFS  ++G+ E+D+F+ 
Sbjct  227   SVVIDNTLSPAHTLVQIMCQHHKGLLYDIMRTLKDFNIQISYGRFSTKDRGKCEIDLFIM  286

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G+KI+DP KQ SL   LK ELL PL+V + +RGPDTELLVANP+ELSG GRP VF+D
Sbjct  287   QVDGKKIVDPSKQESLSSRLKTELLRPLKVAVMSRGPDTELLVANPVELSGKGRPLVFHD  346

Query  105   VTFALKTLGICIFSV  61
             +T ALK LG+CIFS 
Sbjct  347   ITLALKMLGLCIFSA  361



>dbj|BAK02727.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=425

 Score =   330 bits (845),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 181/385 (47%), Positives = 242/385 (63%), Gaps = 31/385 (8%)
 Frame = -2

Query  1167  PDDSVV-IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             P D VV I++G+  GDP ++TV+C DK GLGC++CR++L FGLN+ KGD+STDGRWCY+V
Sbjct  6     PSDEVVQIRHGDAAGDPTVVTVSCPDKTGLGCDLCRLVLLFGLNVLKGDMSTDGRWCYIV  65

Query  990   MWVF--PQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS--------------  859
             +W+   P      V W  LKDR+  +CP       +P+P    T+               
Sbjct  66    LWLAASPPPRARTVAWDLLKDRIVQLCP-------VPAPFGVDTAYLAAAGLALADGEPQ  118

Query  858   -YLMTLYCIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEK  682
              +L+   C  R GLLHDVT  LCE EL I RVKV TTPD RV+D+F I D  ELL+ K +
Sbjct  119   VFLLKFCCYDRIGLLHDVTCVLCEMELTIRRVKVSTTPDGRVMDLFFITDARELLHTKSR  178

Query  681   QEELCEQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQ  502
             +EE  E+L++VLG+S  SCE++  A   +   L   + L P V  ++F    SE +  + 
Sbjct  179   REEAYEKLQSVLGDSVTSCEIE-SATQDMSSCLQASALLPPLVLEQMF----SEVDV-VD  232

Query  501   ELSPDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAA  322
             E S       +  VT+DN+LS  HTLIQI C D+K  LYDI R +K CN+Q++Y RF A 
Sbjct  233   EQSNRSRSDSRLSVTMDNSLSPVHTLIQIQCGDHKGLLYDIMRTVKDCNIQVSYGRFYAG  292

Query  321   NKGQRELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLE  142
              KG+ E+D+F    +G+KILD +KQ ++C  L+ ELL PL V + NRGPD ELLVANP+E
Sbjct  293   QKGRCEVDLFAVQSDGKKILDQQKQRTMCSRLRTELLRPLHVALVNRGPDAELLVANPVE  352

Query  141   LSGMGRPRVFYDVTFALKTLGICIF  67
             +SG GRP VFYD+T ALK L   +F
Sbjct  353   VSGKGRPLVFYDITLALKNLHRRVF  377



>ref|XP_003578696.1| PREDICTED: uncharacterized protein LOC100833127 [Brachypodium 
distachyon]
Length=421

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 177/380 (47%), Positives = 243/380 (64%), Gaps = 19/380 (5%)
 Frame = -2

Query  1173  SMPDDSVV-IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCY  997
              +P D VV I++ +  GDP ++T++C DK GLGC++CR++L FGLN+ KGD+STDGRWCY
Sbjct  2     GIPSDEVVQIRHPDVAGDPTVVTISCPDKTGLGCDLCRVVLLFGLNVLKGDMSTDGRWCY  61

Query  996   VVMWVFPQSSTPIVTWAKLKDRLWSVCPPYS----NLIYLPSP------KTPATSSYLMT  847
             +V+WV  +    +  W  LK+RL  +CP  S    +  YL +       +  A   +L+ 
Sbjct  62    IVLWVVARRGRTM-AWDLLKERLVELCPVSSLCGLDSSYLAAAGLQEDLEPAAPRVFLLK  120

Query  846   LYCIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELC  667
               C  R GLLHDVT  L E EL I RVKV TTPD RV+D+F I D  +LL+ K ++EE  
Sbjct  121   FSCYDRMGLLHDVTHVLSEMELTIRRVKVSTTPDGRVMDLFFITDARDLLHTKNRREEAY  180

Query  666   EQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPD  487
             E+L++VLG+S  SCE++  A   +   L   + L P V  ++F  +L      ++E    
Sbjct  181   EKLQSVLGDSVTSCEIE-CATEDMSSCLQASALLPPLVVEQMFNTDL------IEEQLSR  233

Query  486   VMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQR  307
                  K  VT+DN+LS  H+LIQI C D+K  LYDI R LK C++QI+Y+RF A  K + 
Sbjct  234   SRSSSKLSVTMDNSLSPVHSLIQIQCGDHKGLLYDIMRTLKDCDIQISYSRFYAGRKDRC  293

Query  306   ELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMG  127
             E+D+F    +G+KILD +KQ +LC  L++ELLHPLRV + NRGPD ELLVANP+E+SG G
Sbjct  294   EVDLFAVQSDGKKILDQQKQRALCSRLRMELLHPLRVALVNRGPDMELLVANPVEISGKG  353

Query  126   RPRVFYDVTFALKTLGICIF  67
             RP V +D+T ALK L   IF
Sbjct  354   RPLVLHDITLALKNLHRRIF  373



>ref|XP_009368933.1| PREDICTED: uncharacterized protein LOC103958404 [Pyrus x bretschneideri]
Length=413

 Score =   328 bits (842),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 181/378 (48%), Positives = 235/378 (62%), Gaps = 22/378 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D VVI    K G+P +ITVNC DK GL C++CR+IL FGL+I +GDVSTDG+WCY+V W
Sbjct  6     EDVVVINQAEKAGEPTVITVNCPDKTGLECDLCRVILLFGLSICRGDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSN----LIYLPSPKTPATSS-YLMTLYC-IGRTG  823
             V  + ST    W  L  RL + CP Y +      Y P  + P     +L+  +C   R G
Sbjct  66    VVGKPST---RWNLLTKRLLAACPSYFSTSGIFYYRPENQQPKPPDVFLLKFWCSYERDG  122

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHDVT+ LCE EL I  VKV TTPD RV+D+F I D  E+L+ K +Q+E  + L+AVL 
Sbjct  123   LLHDVTEVLCELELTINSVKVSTTPDGRVMDLFFITDTREILHTKRRQDETIDSLKAVLC  182

Query  642   ESCISCELKLVAPGPLYENLPCFSA---LSPSVTNELFRCELSENETHLQELSPDVMKLK  472
              + +SCE++L       E   C      L  ++T E+F  EL          S  V    
Sbjct  183   NALLSCEIELAGS----EVTACLQGSPYLPSAITEEMFSLELPNGHLSRSVASNPVS---  235

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                VT+DN LS +HTL+QI C D+K  +YDI R LK  N+Q+ Y RF A  +G  ELD+F
Sbjct  236   ---VTVDNHLSPSHTLVQIFCQDHKGLIYDIMRTLKDYNIQVRYGRFCANPRGNCELDLF  292

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             +   +G+KI+DP KQ +L   L++ELL PLRV + +RGPDTELLVANP+ELSG GRP VF
Sbjct  293   IMQADGKKIVDPNKQNALSSRLRMELLRPLRVAVVSRGPDTELLVANPVELSGRGRPLVF  352

Query  111   YDVTFALKTLGICIFSVR  58
             YD+T ALK L   IFSV+
Sbjct  353   YDITLALKVLKTRIFSVK  370



>ref|XP_004304473.1| PREDICTED: uncharacterized protein LOC101301029 [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   328 bits (841),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 176/377 (47%), Positives = 243/377 (64%), Gaps = 21/377 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I    K GDP +IT+NC DK GLGC++CRIIL FGL+I +GDVSTDG+WC++V W
Sbjct  6     DDVVIITEPEKEGDPSVITINCPDKTGLGCDLCRIILFFGLSIVRGDVSTDGKWCFLVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSN---LIY----LPSPKTPATSSYLMTLYCIGRT  826
             V      P   W  LK RL   CP +S+   + Y    L SPKTP    +L+   C  R 
Sbjct  66    VV---GNPGTRWGLLKKRLMETCPSFSSASGISYYRHELQSPKTPDV--FLLKFCCYDRK  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             G+LHDVT  LCE EL I++VKV TTPD++V+D+F + D  ELL+  ++++E+ + L+A  
Sbjct  121   GILHDVTGVLCELELTIKKVKVSTTPDEKVMDLFFVTDTRELLHTNKRKDEVSDHLKAAT  180

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNE-LFRCELSENETHLQELSPDVMKLKK  469
             G + ISC++++V  GP        S+  PSV  E +F  E+ +      EL   ++    
Sbjct  181   GNAMISCDIEMV--GPEITACSQSSSFLPSVLMEDMFHLEMPD------ELPSGLVTSSC  232

Query  468   SIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFV  289
               V +DN+LS  HTL+QI C D+K  LYDI R LK  N+QI+Y RFS+  +   E+D+F+
Sbjct  233   VSVNMDNSLSPGHTLVQIMCKDHKGLLYDIMRTLKDYNIQISYGRFSSKQRRNCEIDLFI  292

Query  288   QHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFY  109
                +G+K++DP KQ +L   L++ELL PLRV + ++GPDTELLVANP+ELSG GRP VF+
Sbjct  293   VQADGKKMVDPSKQNALKSRLQMELLRPLRVAVVSKGPDTELLVANPVELSGKGRPLVFH  352

Query  108   DVTFALKTLGICIFSVR  58
             D+T ALK     IFS +
Sbjct  353   DITLALKMSNTGIFSAK  369



>gb|KFK36561.1| hypothetical protein AALP_AA4G139300 [Arabis alpina]
Length=411

 Score =   328 bits (841),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 176/381 (46%), Positives = 237/381 (62%), Gaps = 28/381 (7%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+I+   K GDP +IT+NC DK GLGC++CRI+L FGLN+ +GDVSTDG+WCY+V
Sbjct  4     LSDDVVIIRQSEKEGDPSVITINCPDKTGLGCDLCRILLFFGLNVIRGDVSTDGKWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYS-----NLIYLP-----SPKTPATSSYLMTLY  841
              WV  +   P   W  LK RL    P +S     +  YLP     S K P    +L+ L 
Sbjct  64    FWVIGK---PNTRWNLLKMRLVEASPSFSWAFGISRCYLPDSELLSSKLPDL--FLLKLA  118

Query  840   CIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQ  661
             C  RTGLL+DVT+ L + E+ IE+VK+ TTPD +V+D+F + D  ELL   ++++E+ E 
Sbjct  119   CSDRTGLLYDVTEVLYKLEISIEKVKISTTPDGKVMDLFFVTDTRELLGTGKRRDEVYEY  178

Query  660   LRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVM  481
             LR  +G+S +S +++LV P      +   S  S S    LF  ++S          P  +
Sbjct  179   LRDAIGDSLMSYDIELVGP-----EITVRSQASASFAETLFSSDVSGEH-------PSGL  226

Query  480   KLKKSI-VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRE  304
                  + +T+DN+LS AHTLIQISC D+K  LYDI R  K  N+QI+Y RF+       E
Sbjct  227   NTSNCVSITVDNSLSPAHTLIQISCQDHKGLLYDIMRTFKDFNIQISYGRFTIKRGRNFE  286

Query  303   LDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGR  124
             +D+F+   +G KILD  KQ +L   L+ EL  PLRVV+ NRGPDTELLV NP+ELSG GR
Sbjct  287   MDLFIVQSDGRKILDSSKQTALISRLRAELQQPLRVVMMNRGPDTELLVTNPVELSGKGR  346

Query  123   PRVFYDVTFALKTLGICIFSV  61
             P+VF+D+ FALK L  CIFS 
Sbjct  347   PQVFHDIAFALKKLNTCIFSA  367



>ref|XP_006588800.1| PREDICTED: uncharacterized protein LOC100789465 isoform X2 [Glycine 
max]
Length=433

 Score =   328 bits (842),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 183/398 (46%), Positives = 244/398 (61%), Gaps = 42/398 (11%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I+   K GDP ++TVNC DK GLGC++CRI+L FGLNI +GDVSTDG+WCY+V W
Sbjct  6     DDVVIIRPPEKDGDPTLLTVNCPDKTGLGCDLCRIMLFFGLNIIRGDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP---YSNLIYLPSPKTPATSS--YLMTLYCIGRTGL  820
             V  +  T    W+ LK RL   CP     S + Y  S   P+  S  +L+   C  R GL
Sbjct  66    VVGKQRT---RWSLLKKRLIEACPSCSSASGISYYRSDLQPSKPSDVFLLNFSCHDRKGL  122

Query  819   LHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHL----------------------  706
             LHDVT+ LCE EL I++VKV TTPD +V+D+F I D                        
Sbjct  123   LHDVTEVLCELELTIKKVKVSTTPDGKVMDLFFITDTRITVILMVTLLVSIKKSFWVCSG  182

Query  705   ELLNIKEKQEELCEQLRAVLGESCISCELKLVAPGPLYENLPCFSA--LSPSVTNELFRC  532
             ELL+ K++++E  E L  ++G++ IS +++LV P    E   C  A    P+   ++F  
Sbjct  183   ELLHTKKRKDETIEHLTEIMGDAIISIDIELVGP----EITACSKAPPFLPTAITDIFDL  238

Query  531   ELSENETHLQELSPDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNV  352
             EL  +      L  D +      +T+DN LS AHTL+QI C D+K  LYDI R LK  N+
Sbjct  239   ELP-DLARGGTLRSDYVS-----ITMDNLLSPAHTLVQIMCQDHKGLLYDIMRTLKDYNI  292

Query  351   QITYARFSAANKGQRELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPD  172
             QI+Y RF+   +G+ E+D+F+   +G+KI+DP KQ SL   L++ELL PLRV I +RGPD
Sbjct  293   QISYGRFTTKPRGKCEIDLFIMQADGKKIVDPNKQNSLSSRLRMELLRPLRVAIVSRGPD  352

Query  171   TELLVANPLELSGMGRPRVFYDVTFALKTLGICIFSVR  58
             TELLV+NP+ELSG GRP VFYD+T ALK L  CIFS +
Sbjct  353   TELLVSNPVELSGKGRPLVFYDITLALKMLDTCIFSAK  390



>ref|NP_001150201.1| LOC100283831 [Zea mays]
 gb|ACG38235.1| amino acid binding protein [Zea mays]
 tpg|DAA39589.1| TPA: amino acid binding protein [Zea mays]
Length=433

 Score =   328 bits (841),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 177/386 (46%), Positives = 243/386 (63%), Gaps = 27/386 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V I++ +  G+P ++TV+C DK GLGC++CR +L FGL++ KGD+STDGRWCY+V W
Sbjct  8     DDVVQIRHADAAGEPTVVTVSCPDKTGLGCDLCRAVLLFGLSVVKGDMSTDGRWCYIVFW  67

Query  984   VFPQSSTPI-VTWAKLKDRLWSVCP---PY---SNLIYLPSPKT------PATSSYLMTL  844
             + P+   P+ V W  LKDRL  +CP   P+   S+  YL +         PA   +L+ L
Sbjct  68    LLPRGRRPVAVPWDLLKDRLLQLCPVAPPFGFGSHDAYLAAAAGLQDVPPPAPQLFLLKL  127

Query  843   YCIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCE  664
              C  R GLLHDVT+ LCE EL I RVKV TTPD  VLD+F I D   LL+ K ++EE  +
Sbjct  128   CCFDRMGLLHDVTRVLCELELTIRRVKVSTTPDGSVLDLFFITDARGLLHTKSRREETQD  187

Query  663   QLRAVLGESCISCELKLVAPGPLYENLP-------CFSALSPSVTNELFRCELSENETHL  505
             +L +VLG+S   CE+      P  E++         +++L+P+V  ++F    ++     
Sbjct  188   RLESVLGDSLTCCEID-----PAGEDMVSCCLQSWAWASLTPAVIAQMF--STADRVEEQ  240

Query  504   QELSPDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSA  325
                +          VT+DN+LS AHTLIQI C D+K  LYD+ R +K CN+QI+Y RF A
Sbjct  241   PIGTRGGGGGTIISVTMDNSLSPAHTLIQIQCGDHKGLLYDVMRIVKDCNIQISYGRFYA  300

Query  324   ANKGQRELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPL  145
             +  G+ E+D+F    +G+KILD  +Q +LC  L++EL  PL V + NRGPDTELLVANP+
Sbjct  301   SQNGRCEIDLFAVQSDGKKILDQHRQRALCCRLRMELRRPLHVALVNRGPDTELLVANPV  360

Query  144   ELSGMGRPRVFYDVTFALKTLGICIF  67
             E+SG GRP VFYD+T ALK L   IF
Sbjct  361   EVSGKGRPLVFYDITLALKNLQRRIF  386



>ref|XP_004307345.1| PREDICTED: uncharacterized protein LOC101307536 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   327 bits (839),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 181/376 (48%), Positives = 235/376 (63%), Gaps = 16/376 (4%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + +D VVI  G K GDP ++TVNC DK GLGC++CR+IL FGL+I +GDVSTDG+WCY+V
Sbjct  4     LHEDVVVISQGEKAGDPTVVTVNCPDKTGLGCDLCRVILLFGLSICRGDVSTDGKWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSN----LIYLPSPKTPA-TSSYLMTLYC-IGR  829
              WV  +   P   W  L  RL  VCP Y        Y P  + P     +L+  +C   +
Sbjct  64    FWVVGK---PETRWNLLTKRLLEVCPSYFTTSGIYYYRPENQQPKPLDVFLLKFWCSYEQ  120

Query  828   TGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAV  649
              GLLHDVT+ LCE EL IERVKV TTPD +V+D+F + D  ELL+ K +Q+E    L+AV
Sbjct  121   EGLLHDVTKVLCELELTIERVKVSTTPDGKVMDLFFVTDTRELLHTKRRQDETIHCLKAV  180

Query  648   LGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKK  469
             LG   + CE++L A   +         L   +T E+   E +    HL+     +     
Sbjct  181   LGNVLLGCEIEL-AESKVTACSQGSHYLPSEITEEMLSLEWTNG--HLKRPFASI----P  233

Query  468   SIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFV  289
               +T+DN LS +HTL+QI C D+K  +YDI R LK CN+Q++Y RF    KG  ELD+FV
Sbjct  234   ISITVDNNLSPSHTLVQIFCPDHKGLVYDIMRTLKDCNLQVSYGRFYENTKGNCELDLFV  293

Query  288   QHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFY  109
                +G+KI+D +KQ +LC  L+ ELL PLRV + NRGPDTELLVANP+ELSG GRP VFY
Sbjct  294   VQPDGKKIVDSKKQDALCSRLRAELLCPLRVAVVNRGPDTELLVANPVELSGRGRPLVFY  353

Query  108   DVTFALKTLGICIFSV  61
             D+T ALK L   IFS 
Sbjct  354   DITLALKDLSTRIFSA  369



>gb|EYU29887.1| hypothetical protein MIMGU_mgv1a007224mg [Erythranthe guttata]
Length=414

 Score =   327 bits (839),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 177/378 (47%), Positives = 244/378 (65%), Gaps = 25/378 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+I+      +  ++TVNC DK GLG ++CRIIL FGL + + DVSTDG+WCY+V W
Sbjct  6     DDAVIIRQSENDEEASVVTVNCPDKTGLGSDLCRIILCFGLTVVRTDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCP---PYSNLIY----LPSPKTPATSSYLMTLYCIGRT  826
             V  +   P   W+ LK RL   CP     S + Y    L +PK   +  +L+   C  R 
Sbjct  66    VLGK---PNTRWSLLKHRLMGACPCSTLASGISYYRAELQNPK--PSDIFLLKFCCPDRG  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT+ LCE EL I+RVKV TTPD +V+D+F I D  ELL+ KE++EE  + LRAVL
Sbjct  121   GLLHDVTEVLCELELTIKRVKVSTTPDGKVMDLFFITDTRELLHTKERKEETYDNLRAVL  180

Query  645   GESCISCELKLVAPGPLYENLPC---FSALSPSVTNELFRCELSENETHLQELSPDVMKL  475
             G+  ISC+++LV P    E   C    S LS ++  E+F  E  +   +      D + L
Sbjct  181   GDDVISCDIELVGP----EITACSQGASFLSDAIAEEMFNAEKPDENQN------DEIAL  230

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
             K   +T+DN+LS +HTL+QI+C ++K  LYD+ R LK  N+QI+Y RF+   + + E+D+
Sbjct  231   KCPSITMDNSLSPSHTLLQIACQNHKGLLYDVMRTLKDYNIQISYGRFTTKGQTECEMDL  290

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F+   +G+KI+DP KQ++L   L++EL  P+RV + +RGPDTELLVANP+ELSG GRP V
Sbjct  291   FIMQADGKKIVDPTKQSALTSRLQIELSRPVRVSLISRGPDTELLVANPIELSGNGRPLV  350

Query  114   FYDVTFALKTLGICIFSV  61
             FYD+T ALK L   IFS 
Sbjct  351   FYDITLALKLLSTPIFSA  368



>ref|XP_008803450.1| PREDICTED: uncharacterized protein LOC103717002 [Phoenix dactylifera]
Length=419

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 181/378 (48%), Positives = 234/378 (62%), Gaps = 22/378 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVI+     G+P +ITV+C DK GLGC++CR+IL FGL+I +GDVSTDG+WC++V+W
Sbjct  6     DDVVVIRQPESAGEPSVITVSCPDKTGLGCDLCRVILFFGLSIVRGDVSTDGKWCFIVLW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP------YSNLIYLPSPKTPATSS---YLMTLYCIG  832
             V  +       W  LK RL  VCP         N  Y       A      +L+   C  
Sbjct  66    VVGRGEGA-TRWGLLKKRLLGVCPAVLSASGLYNSCYRQQEMVAAQQQAQLFLLKFSCYD  124

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVTQ LCE EL I RVKV TTPD RV+D+F I D  ELL+ K ++EE  +QLRA
Sbjct  125   RMGLLHDVTQVLCELELTIRRVKVSTTPDGRVMDLFFITDTRELLHTKGRKEETYDQLRA  184

Query  651   VLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSE---NETHLQELSPDVM  481
             VLG+   +C+++L A   +   +     L  ++T E+   EL E    E+     +P V+
Sbjct  185   VLGDFMTNCDIEL-AGAEIASYMQASPFLPSAITEEMLHLELPEESPRESPFPYNNPSVI  243

Query  480   KLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
                     +DN+LS  HTLIQI C D+K  LYDI R LK  N+QI+Y R  AA  G  E+
Sbjct  244   --------MDNSLSPGHTLIQILCRDHKGLLYDIMRTLKDYNIQISYGRCYAAQNGSCEI  295

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             D+FV   +G+KI+D  KQ +LC  L++EL  PLRV + +RGPDTELLVANP+ELSG GRP
Sbjct  296   DLFVMQMDGKKIVDTNKQKALCSRLRMELFSPLRVTVVSRGPDTELLVANPVELSGKGRP  355

Query  120   RVFYDVTFALKTLGICIF  67
              VF+D+T ALK L I IF
Sbjct  356   LVFHDITLALKMLRIRIF  373



>ref|XP_006661009.1| PREDICTED: uncharacterized protein LOC102710812 [Oryza brachyantha]
Length=418

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 173/370 (47%), Positives = 234/370 (63%), Gaps = 13/370 (4%)
 Frame = -2

Query  1167  PDDSVV-IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             P D VV +++ +  GDP +IT++C DK GLGC++CR++L FGLNI KGD+STDGRWCY+V
Sbjct  6     PSDEVVQVRHADVAGDPTVITISCPDKTGLGCDLCRVVLLFGLNILKGDMSTDGRWCYIV  65

Query  990   MWVFPQSSTPIVT--WAKLKDRLWSVCPPYSNLIYLPSPKTPATSSYLMTLYCIGRTGLL  817
             +WV        +T  W  LKDRL  +CP  +   +  +     +  YL+   C  R GLL
Sbjct  66    LWVVASPGRRAITLRWDLLKDRLLHLCPVTAPFAFDAAAPPAPSRIYLLKFCCYDRLGLL  125

Query  816   HDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGES  637
             HDVT+ LCE EL I RVKV TTPD RV+D+F I D  ELL+ K ++EE  ++L++VLG+S
Sbjct  126   HDVTRVLCELELTIRRVKVSTTPDGRVIDLFFITDARELLHTKSRREETYDKLQSVLGDS  185

Query  636   CISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVT  457
               SCE++  A   +   L   + L  SV  ++F  ++ E ++                V 
Sbjct  186   LTSCEIE-SATEEMSACLQASALLPQSVVEQMFNVDVVEEQSR---------SCGNLSVA  235

Query  456   IDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKN  277
             +DN+LS  HTLIQI C D+K  +YDI R LK CN+QI+Y RF A+  G  E+D+F    +
Sbjct  236   MDNSLSPVHTLIQIQCGDHKGLVYDIMRTLKDCNIQISYGRFYASQNGNCEVDLFAVQSD  295

Query  276   GEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTF  97
             G+KIL+  KQ +LC  L++EL  PLRV + +RGPDTELLVANP+E  G GRP V YD+T 
Sbjct  296   GKKILEQHKQRALCSRLRMELHRPLRVALVDRGPDTELLVANPVEACGKGRPLVLYDITL  355

Query  96    ALKTLGICIF  67
             ALK L   IF
Sbjct  356   ALKKLHRRIF  365



>ref|XP_009141611.1| PREDICTED: uncharacterized protein LOC103865562 [Brassica rapa]
Length=406

 Score =   326 bits (835),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 171/375 (46%), Positives = 235/375 (63%), Gaps = 21/375 (6%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+I+   K GDP +IT+NC DK GLGC++CRI+L FGLNI +GDVSTDGRWCY+V
Sbjct  4     LSDDVVIIRQSEKEGDPSVITINCPDKTGLGCDLCRILLFFGLNIVRGDVSTDGRWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYS-----NLIYLPSPKTPATSSYLMTLYCIGRT  826
              WV  +   P   W  LK RL    P ++     +  YL   ++     +L+ L C  RT
Sbjct  64    FWVIGK---PNTRWNLLKTRLVEASPAFAWAFGISRCYLSDSESQPPDLFLLKLACSDRT  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLL+DVT+ L + E+ IE+VK+ TTPD +V+D+F + D  ELL  +++++E+ E LR  +
Sbjct  121   GLLYDVTEVLYKLEINIEKVKISTTPDGKVMDLFFVTDTRELLGTEKRRDEVYEYLRDAI  180

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             G++ +S ++KLV+       +   S  S S    LF   L E+ + LQ  S         
Sbjct  181   GDAMMSYDIKLVSS-----EVTARSPASSSFAETLF-SSLEEHPSGLQTSS-------SV  227

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
              + +DN+LS AHTLIQI+C D+K  LYDI R  K  N+QI+Y RF+       E+D+F+ 
Sbjct  228   SIAVDNSLSRAHTLIQITCQDHKGLLYDIMRTFKDFNIQISYGRFTIKRGKNCEIDLFIV  287

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
               +G KILD  KQ +L   L+ EL  PLRVV+ N+GPDTELLV NP+ELSG GRP+VFYD
Sbjct  288   QSDGRKILDSSKQDALVSRLRAELQQPLRVVMMNKGPDTELLVTNPVELSGKGRPQVFYD  347

Query  105   VTFALKTLGICIFSV  61
             +  ALK +  CIFS 
Sbjct  348   IALALKKINTCIFSA  362



>gb|KEH42165.1| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=412

 Score =   326 bits (835),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 179/378 (47%), Positives = 240/378 (63%), Gaps = 25/378 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+++   K GDP +ITVNC DK GLGC++CRIIL FGLNI +GDVSTDG+WCY+V W
Sbjct  6     DDVVIMRPPEKEGDPTVITVNCPDKTGLGCDLCRIILFFGLNIVRGDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCP---PYSNLIY----LPSPKTPATSSYLMTLYCIGRT  826
             V  +  T    W+ LK R+   CP     S + Y    L  PK P    +L+   C  R 
Sbjct  66    VVGKQKT---RWSLLKKRMVEACPTCSSASGISYYRTDLQPPKVPDV--FLLKFCCHDRK  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT  LCE EL I +VKV TTPD +V+D+F I D  ELL  K+++++  +QL+ VL
Sbjct  121   GLLHDVTAVLCELELIITKVKVSTTPDGKVMDLFFITDTRELLQTKKRKDDTIQQLKDVL  180

Query  645   GESCISCELKLVAPGPLYENLPCFSA---LSPSVTNELFRCELSENETHLQELSPDVMKL  475
              +S ++ +++LV P    E   C  A   L  ++T + +   L ++      L  D +  
Sbjct  181   EDSVLTIDIELVGP----EITACAQASSFLPAAITEDNYNLMLPDS-ARSGTLRSDYVS-  234

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
                 +T+DN LS AHTL QI C D+K  LYDI R LK  N++I++ RF+   + + E+D+
Sbjct  235   ----ITMDNLLSPAHTLFQIMCQDHKGLLYDIMRTLKDYNIKISFGRFTTKPRRKCEMDL  290

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F+   +G+KI+DP KQ SL    ++ELL PLRV I +RGPDTELLVANP+ELSG GRP V
Sbjct  291   FIMQADGKKIVDPNKQNSLASRFRMELLRPLRVAIVSRGPDTELLVANPVELSGNGRPLV  350

Query  114   FYDVTFALKTLGICIFSV  61
             FYD+T ALK L +CIFS 
Sbjct  351   FYDITLALKMLDVCIFSA  368



>emb|CDY66646.1| BnaAnng22650D [Brassica napus]
Length=406

 Score =   326 bits (835),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 171/376 (45%), Positives = 236/376 (63%), Gaps = 23/376 (6%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+I+   K GDP +IT+NC DK GLGC++CRI+L FGLNI +GDVSTDGRWCY+V
Sbjct  4     LSDDVVIIRQSEKEGDPSVITINCPDKTGLGCDLCRILLFFGLNIVRGDVSTDGRWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYS-----NLIYLPSPKTPATSSYLMTLYCIGRT  826
              WV  +   P   W  LK RL    P ++     +  YL   ++     +L+ L C  RT
Sbjct  64    FWVIGK---PNTRWNLLKTRLVEASPAFAWAFGISRCYLSDSESQPPDLFLLKLACSDRT  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLL+DVT+ L + E+ IE+VK+ TTPD +V+D+F + D  ELL  ++++ E+ E LR  +
Sbjct  121   GLLYDVTEVLYKLEINIEKVKISTTPDGKVMDLFFVTDTRELLGTEKRRHEVYEYLRDAI  180

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             G++ +S +++LV+       +   S  S S    LF    S  E H     P+ ++   S
Sbjct  181   GDAMMSYDIELVSS-----EVTARSPASSSFAETLF----SSLEEH-----PNGLQTSSS  226

Query  465   I-VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFV  289
             + + +DN+LS AHTLIQI+C D+K  LYDI R  K  N+QI+Y RF+       E+D+F+
Sbjct  227   VSIAVDNSLSRAHTLIQITCQDHKGLLYDIMRTFKDFNIQISYGRFTIKRGKNCEIDLFI  286

Query  288   QHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFY  109
                +G KILD  KQ +L   L+ EL  PLRVV+ NRGPDTELLV NP+ELSG GRP+VFY
Sbjct  287   VQSDGRKILDSSKQDALVSRLRAELQQPLRVVMMNRGPDTELLVTNPVELSGKGRPQVFY  346

Query  108   DVTFALKTLGICIFSV  61
             D+  ALK +  CIFS 
Sbjct  347   DIALALKKINTCIFSA  362



>gb|EMS64248.1| hypothetical protein TRIUR3_00431 [Triticum urartu]
Length=433

 Score =   326 bits (835),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 185/390 (47%), Positives = 245/390 (63%), Gaps = 33/390 (8%)
 Frame = -2

Query  1167  PDDSVV-IQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             P D VV I +G+  GDP ++TV+C DK GLGC++CR++L FGLN+ KGD+ST GRWCY+V
Sbjct  6     PSDEVVQIVHGDGAGDPTVVTVSCPDKTGLGCDLCRLVLLFGLNVHKGDMSTAGRWCYIV  65

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCP---PYS-NLIYLPSPKTPATSS----YLMTLYCI  835
             +WV  +     V W  LKDRL  +CP   P+  +  YL +       +    +L+   C 
Sbjct  66    LWVAARRGRA-VAWDVLKDRLVDLCPVPAPFGVDSAYLAAAGLQDPDAEPQVFLLKFCCY  124

Query  834   GRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDH--------------LELL  697
              R GLLHDVT  L E EL I RVKV TTPD RV+D+F I D                ELL
Sbjct  125   DRMGLLHDVTCVLSEMELTIRRVKVSTTPDGRVMDLFFITDASLLGNLQLCSLCLLRELL  184

Query  696   NIKEKQEELCEQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSEN  517
             + K ++EE  E+L++VLG+S  SCE++  A   +   L   + LSP V  ++F    SE 
Sbjct  185   HTKSRREEAYEKLQSVLGDSVTSCEIE-SATEDMSSCLQASALLSPVVLEQMF----SEV  239

Query  516   ETHLQELSPDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYA  337
             +  ++E S     L    VT+DN+LS  HTLIQI C D+K  LYDI R +K CN+QI+Y 
Sbjct  240   DA-IEEQSRSSGSLS---VTMDNSLSPVHTLIQIQCGDHKGLLYDIMRTVKDCNIQISYG  295

Query  336   RFSAANKGQRELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLV  157
             RF A  KG+ E+D+F    +G+KILD +KQ S+C  L++ELL PLRV + NRGPD+ELLV
Sbjct  296   RFYAGQKGRCEVDLFAVQSDGKKILDQQKQRSMCSRLRMELLRPLRVALVNRGPDSELLV  355

Query  156   ANPLELSGMGRPRVFYDVTFALKTLGICIF  67
             ANP+E+SG GRP VFYD+T ALK L   +F
Sbjct  356   ANPVEVSGKGRPLVFYDITLALKNLHRRVF  385



>ref|XP_009605627.1| PREDICTED: uncharacterized protein LOC104100160 [Nicotiana tomentosiformis]
Length=412

 Score =   324 bits (830),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 178/382 (47%), Positives = 239/382 (63%), Gaps = 33/382 (9%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V++ +  + GDP +ITVNC DK GLG ++CRIIL FGL+I + DVSTDG WCY+V W
Sbjct  6     DDVVLVNHSEREGDPSVITVNCPDKTGLGSDLCRIILFFGLSIVRVDVSTDGIWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIY-------LPSPKTPATSSYLMTLYCIGRT  826
             V     TP   W+ LK RL  VCP  S+          L SP  P    +L+T  C  R 
Sbjct  66    VV---GTPKTRWSLLKKRLMGVCPSCSSASSISYYRAELQSPSPPDV--FLLTFCCYDRR  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHD+T  LC+ EL I++VKV TTPD +V+D+F I D  ELL+ K++QE+  +QL++VL
Sbjct  121   GLLHDMTAVLCDLELTIKKVKVSTTPDGKVMDLFFITDTRELLHTKKRQEDTYDQLKSVL  180

Query  645   GESCISCELKLVAP-------GPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPD  487
             G++ IS ++++V         GP        S L   +  ++F  E+      L E    
Sbjct  181   GDAMISFDIEMVGSEITGCSQGP--------SFLPEEIAEDVFSFEI------LNEHQSR  226

Query  486   VMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQR  307
              +   K+ + +DN LS  HTL+QI C D+K  LYDI R LK  N+QI+Y RF++  K + 
Sbjct  227   SLACNKASIAVDNLLSPGHTLVQIVCQDHKGLLYDIMRTLKEYNIQISYGRFTSKTKTEC  286

Query  306   ELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMG  127
             ELD+F+   +G+KI+DP K  +LC  L++EL  PLRV + NRGPD ELLVANP+ELSG G
Sbjct  287   ELDLFIMQADGKKIVDPSKLNALCSRLQMELCRPLRVALMNRGPDAELLVANPVELSGKG  346

Query  126   RPRVFYDVTFALKTLGICIFSV  61
             RP VFYD+T ALK L I +FS 
Sbjct  347   RPIVFYDITLALKMLNIGVFSA  368



>ref|XP_004515911.1| PREDICTED: uncharacterized protein LOC101492421 [Cicer arietinum]
Length=412

 Score =   323 bits (828),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 178/378 (47%), Positives = 239/378 (63%), Gaps = 25/378 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+++   K GDP +ITVNC DK GLGC++CRIIL F LNI +GDVSTDG+WCY+V W
Sbjct  6     DDVVIMRPPEKEGDPTVITVNCPDKTGLGCDLCRIILFFRLNILRGDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP---YSNLIY----LPSPKTPATSSYLMTLYCIGRT  826
             V  +  T    W+ LK R+   CP     S + Y    L  PK P    +L+   C  R 
Sbjct  66    VVGKQKT---RWSLLKKRMVEACPSCSSASGISYYRSDLQPPKPPDV--FLLKFCCHDRK  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT  LCE EL I +VKV TTPD +V+D+F I D  ELL+ K+++++  EQL+ VL
Sbjct  121   GLLHDVTAVLCELELTITKVKVSTTPDGKVMDLFFITDTRELLHTKKRKDDTIEQLKEVL  180

Query  645   GESCISCELKLVAPGPLYENLPCFSA---LSPSVTNELFRCELSENETHLQELSPDVMKL  475
              +  ++ +++LV P    E   C  A   L  ++T++ F  EL ++      +    ++ 
Sbjct  181   EDLILTIDIELVGP----EITACSQASSFLPAAITDDDFNLELPDS------VRSGTLRA  230

Query  474   KKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
                 +T+DN LS AHTL+QI C D+K  LYDI R LK  N +I++ RF+   + + E+D+
Sbjct  231   DYVSITMDNLLSPAHTLVQIMCQDHKGLLYDIMRTLKDYNNKISFGRFTTKPRRKCEIDL  290

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F+   +G+KI+DP KQ SL    K ELL PLRV + +RGPDTELLVANP+ELSG GRP V
Sbjct  291   FIMQADGKKIVDPNKQNSLSSRFKAELLRPLRVAVVSRGPDTELLVANPVELSGNGRPLV  350

Query  114   FYDVTFALKTLGICIFSV  61
             FYD+T ALK L  CIFS 
Sbjct  351   FYDITLALKMLDTCIFSA  368



>ref|XP_009612956.1| PREDICTED: uncharacterized protein LOC104106170 isoform X2 [Nicotiana 
tomentosiformis]
Length=349

 Score =   321 bits (822),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 166/281 (59%), Positives = 206/281 (73%), Gaps = 19/281 (7%)
 Frame = -2

Query  855  LMTLYCIGRTGL------------LH----DVTQFLCECELYIERVKVITTPDDRVLDVF  724
            ++T+ C  +TGL            LH    DV + L E EL I+RVKV  TPD   +D+F
Sbjct  25   VITVNCPDKTGLGCDICRTILDFGLHIIKGDVNEVLSELELTIQRVKVTRTPDGHAVDLF  84

Query  723  IIKDHLELLNIKEKQEELCEQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNE  544
             I D+LELL+ K +Q+E  EQLRAVLGESC   EL+L   GP Y+NL   S+L PSV  E
Sbjct  85   FITDNLELLHTKARQDETYEQLRAVLGESC-GFELQLA--GPKYDNLQYISSLPPSVAEE  141

Query  543  LFRCELSENETHLQELSPDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALK  364
            LFRC++ +NE H Q LS ++ KLKK+ VTIDN+LS  HTL+QISC+D+K FLYDI R LK
Sbjct  142  LFRCKIEDNEFHAQALSSEMTKLKKASVTIDNSLSPGHTLLQISCIDHKGFLYDIMRTLK  201

Query  363  GCNVQITYARFSAANKGQRELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISN  184
              ++QI++ RFS  NKGQRELD+F++ K+G KI+DPEKQ ++C  LKVE+LHPLRV+I+N
Sbjct  202  DFSIQISFGRFSPVNKGQRELDLFIRQKDGRKIVDPEKQDAICSRLKVEMLHPLRVIITN  261

Query  183  RGPDTELLVANPLELSGMGRPRVFYDVTFALKTLGICIFSV  61
            RGPDTELLVANP+ELSG GRPRV YDVT ALK LGICIFS 
Sbjct  262  RGPDTELLVANPIELSGNGRPRVSYDVTLALKNLGICIFSA  302


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  1161  DSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVS  1018
             D+V+IQ G +  +P +ITVNC DK GLGC+ICR ILDFGL+I KGDV+
Sbjct  10    DTVIIQKGKRGEEPNVITVNCPDKTGLGCDICRTILDFGLHIIKGDVN  57



>ref|XP_002881473.1| hypothetical protein ARALYDRAFT_482665 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57732.1| hypothetical protein ARALYDRAFT_482665 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score =   323 bits (827),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 175/383 (46%), Positives = 235/383 (61%), Gaps = 26/383 (7%)
 Frame = -2

Query  1179  FNSMPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWC  1000
               ++ DD V+I    K GDP +IT+NC DK GLGC++CRI+L FGLNI +GDVSTDG+WC
Sbjct  1     MGNLSDDVVIISQSEKEGDPSVITINCPDKTGLGCDLCRILLFFGLNIVRGDVSTDGKWC  60

Query  999   YVVMWVFPQSSTPIVTWAKLKDRLWSVCPPYS-----NLIYLPS-----PKTPATSSYLM  850
             Y+V WV  +   P   W  LK RL    P +S     +  YL       PK P    +L+
Sbjct  61    YLVFWVIGK---PNTRWNLLKMRLVEASPSFSWAFGISRCYLSDSESQPPKLPDL--FLL  115

Query  849   TLYCIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEEL  670
              L C  RTGLL+DVT+ L + E+ IE+VK+ TTPD +V+D+F + D  ELL   ++++E+
Sbjct  116   KLACSDRTGLLYDVTEVLYKLEINIEKVKISTTPDGKVMDLFFVTDTRELLGTVKRRDEV  175

Query  669   CEQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSP  490
              E LR  +G+S IS +++LV P      +   S  S SV   LF  ++S       + S 
Sbjct  176   YEYLRDAIGDSMISYDIELVGP-----EITARSQASSSVAETLFSSDVSGEHPSGLQTSS  230

Query  489   DVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQ  310
             +V       +T+DN LSSAHTLI I+C D+K  LYDI R  K  N+QI+Y RF+      
Sbjct  231   NVS------ITVDNLLSSAHTLIHITCQDHKGLLYDIMRTFKDFNIQISYGRFTIKRGRN  284

Query  309   RELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGM  130
              E+D+F+   +G KILD  K  +L   L+ EL  PLRVV+ NRGPDTELLV NP+ELSG 
Sbjct  285   CEIDLFIVQSDGRKILDSSKLNALITRLRAELQQPLRVVMMNRGPDTELLVTNPVELSGK  344

Query  129   GRPRVFYDVTFALKTLGICIFSV  61
             GRP+VF+D+  ALK +  CIFS 
Sbjct  345   GRPQVFHDIALALKKINTCIFSA  367



>emb|CDO99796.1| unnamed protein product [Coffea canephora]
Length=407

 Score =   322 bits (826),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 173/376 (46%), Positives = 239/376 (64%), Gaps = 26/376 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+V+I+      D  +ITVNC DK GLGC++CR+IL FGL+I +GDV TDG+WCY+V W
Sbjct  6     EDAVLIKEAESAVDHTVITVNCPDKTGLGCDLCRVILLFGLSIARGDVQTDGKWCYLVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCP---PYSNLIYLPSPKTPATSS---YLMTLYC-IGRT  826
             V  +   P+  W+ LK RL  VCP   P ++ IY   P+         +L+  +C   R 
Sbjct  66    VVGK---PMTRWSLLKTRLQEVCPTCTPAASGIYYYRPEFQQPRPLDIFLLKFWCSYDRK  122

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVTQ LCE EL I+RVKV   PD  V+D+F + D  ELL+ K++QEE  + L+AVL
Sbjct  123   GLLHDVTQVLCELELTIKRVKVSIAPDGGVMDLFFVTDTRELLHTKKRQEEAIDHLKAVL  182

Query  645   GESCISCELKLVAPG-PLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKK  469
             G++ ++CE++L  P    Y      S L  SVT ++FR E+             V+    
Sbjct  183   GDAMLNCEIELAIPEVTAYSQ----SFLPSSVTEDMFRLEML-----------GVLASSS  227

Query  468   SIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFV  289
               + +DN+L  +HTL+++ C D+K  +YDI R LK  N+QI Y RF A  K   E+D+F+
Sbjct  228   VSIEVDNSLRPSHTLVRVLCQDHKGLIYDIMRTLKDYNIQIAYGRFFANPKRNCEVDLFI  287

Query  288   QHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFY  109
                +G+++ DP K+ +LC  L++EL HPLRV + +RGPDTELLVANP+ELSG GRP VFY
Sbjct  288   TQADGKQMSDPNKKNALCSRLRMELAHPLRVDVISRGPDTELLVANPVELSGRGRPLVFY  347

Query  108   DVTFALKTLGICIFSV  61
             D+T ALK + I IFSV
Sbjct  348   DITLALKNMNISIFSV  363



>ref|XP_004246614.1| PREDICTED: uncharacterized protein LOC101258588 [Solanum lycopersicum]
Length=411

 Score =   322 bits (826),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 176/374 (47%), Positives = 237/374 (63%), Gaps = 18/374 (5%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V++ +  + G+P +ITVNC DK GLG ++CRIIL FGL + + DVSTDG WCY+V W
Sbjct  6     DDVVLLNHSEREGEPSVITVNCPDKTGLGSDLCRIILFFGLTVVRVDVSTDGIWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLP------SPKTPATSSYLMTLYCIGRTG  823
             V  +   P   W  LK RL   CP  S+   +       SP+ P    +L+T  C  R G
Sbjct  66    VVGR---PDTRWNLLKKRLMGACPSCSSASGISYYRAELSPRPPEV--FLLTFCCNDRRG  120

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHDVT  L E EL I++VKV TTPD +V+D+F I D  ELL+ K++QE+   QL++VLG
Sbjct  121   LLHDVTAVLSELELTIKKVKVSTTPDGKVMDLFFITDTRELLHTKKRQEDTHYQLKSVLG  180

Query  642   ESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKSI  463
             ++ ISC++++V    + E     S L   +  ++F  E+      L E     +   K+I
Sbjct  181   DAMISCDIEMVG-SEITECSQGPSFLPQEIAEDMFSFEI------LHEQLSTSLACNKAI  233

Query  462   VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQH  283
             +T+DN +S  HTLI+I+C D+K  LYDI R LK  N+QI+Y RF+A  K + ELD+F+  
Sbjct  234   ITVDNLMSPGHTLIKIACQDHKGLLYDIMRTLKDYNIQISYGRFAAKTKTECELDLFIMQ  293

Query  282   KNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDV  103
              +G+KI+D  K   LC  L++EL  PLRV + NRGPD ELLVANP+ELSG GRP VFYD+
Sbjct  294   ADGKKIVDHSKLNGLCSRLQMELCRPLRVSLMNRGPDAELLVANPVELSGKGRPIVFYDI  353

Query  102   TFALKTLGICIFSV  61
             T ALK L I IFS 
Sbjct  354   TLALKMLNIGIFSA  367



>ref|XP_002271915.1| PREDICTED: uncharacterized protein LOC100259822 [Vitis vinifera]
 emb|CBI31402.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   323 bits (827),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 183/380 (48%), Positives = 236/380 (62%), Gaps = 27/380 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D V+I+   KPGDP  ITVNC DK+GLGC++CRIIL FGL+I +GD STDG+WCY++ W
Sbjct  8     EDVVLIRQAEKPGDPTEITVNCPDKIGLGCDLCRIILRFGLSISRGDSSTDGKWCYILFW  67

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNL----IYLP----SPKTPATSSYLMTLYCI-G  832
             V      P   W  L  RL  VCP  S+      Y P     PK P    +L+  +C   
Sbjct  68    VV---GKPNTRWNLLHRRLLEVCPSCSSASGISFYKPEFQQQPKPPDV--FLLKFWCYYD  122

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
               GLLHD+T+ LCE EL I+RVKV T PD RV+D+F + D    L+ +E+++E    L+ 
Sbjct  123   WKGLLHDITEALCELELTIKRVKVSTAPDGRVMDLFFVTDTRNELHTQERRDEAIYHLKD  182

Query  651   VLGESCISCELKLVAPGPLYENLPCF---SALSPSVTNELFRCELSENETHLQELSPDVM  481
             VLG++ ISCE++L  P    E   C    S L P++T E+F  EL +     Q  SP   
Sbjct  183   VLGDAMISCEIELAGP----EVTGCSQGSSFLPPAITEEIFSLELPDGH---QNGSPASN  235

Query  480   KLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
              L   IVT+DN+LS +HT + I C D K  +YDI R LK  N+Q +Y RF A  KG  E 
Sbjct  236   AL---IVTMDNSLSPSHTHVHIICQDQKGRIYDIMRTLKDYNIQTSYGRFFANAKGIFEA  292

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             D+ V   +G+K++DP KQ +L   LK+EL  PLRV + +RGPDTELLVANP+EL G GRP
Sbjct  293   DLLVMQADGKKLVDPNKQNALSSRLKMELFCPLRVAVESRGPDTELLVANPVELCGRGRP  352

Query  120   RVFYDVTFALKTLGICIFSV  61
              VFYD+T ALK L I IFSV
Sbjct  353   LVFYDITLALKILKIQIFSV  372



>gb|AFW74931.1| hypothetical protein ZEAMMB73_542989 [Zea mays]
Length=384

 Score =   322 bits (824),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 170/333 (51%), Positives = 222/333 (67%), Gaps = 16/333 (5%)
 Frame = -2

Query  1029  GDVSTDGRWCYVVMWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YL  853
              DVSTDG WC+VV WV P+SS+  + WA LK+RL S+CP   ++ + P    P  S  YL
Sbjct  8     ADVSTDGHWCFVVFWVVPRSSSIRIRWASLKNRLMSMCPSSYSIPFYPDMSQPGPSQFYL  67

Query  852   MTLYCIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEE  673
             + L    R GLLHDVT  L + EL I RVKV TTPD RV+D+F I D +ELL+ KE+QEE
Sbjct  68    LKLLSPDRKGLLHDVTHILSDLELIIHRVKVSTTPDGRVVDLFFITDGMELLHKKERQEE  127

Query  672   LCEQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQE--  499
              C  L A LG S ISCE+ L A G  ++    FS+L+P +  ELFR EL+ +        
Sbjct  128   TCSTLIAALGPS-ISCEV-LSAEG--FQQ--GFSSLAPKIAEELFRVELAGDGEMCSSSL  181

Query  498   LSPDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSA--  325
             +S ++ K++ + +  DN+LS AHTL+QI C D K  +YDI R +K CN+QI Y RF +  
Sbjct  182   ISAELKKVQTATINFDNSLSPAHTLVQIICADQKGLIYDILRTMKDCNIQIFYGRFRSDK  241

Query  324   -----ANKGQRELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELL  160
                   +KG RE+D+FV+  +G+K+ DPEKQ +L   L+ E+LHPLRV++ +RGPDTELL
Sbjct  242   KGGRPGSKGCREVDLFVKQVDGKKVTDPEKQDALRARLRSEMLHPLRVMVVSRGPDTELL  301

Query  159   VANPLELSGMGRPRVFYDVTFALKTLGICIFSV  61
             VANP+EL G GRPRVFYD T ALK LG+CIFS 
Sbjct  302   VANPVELCGKGRPRVFYDATLALKALGVCIFSA  334



>emb|CDY67381.1| BnaAnng24140D [Brassica napus]
Length=407

 Score =   321 bits (823),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 171/376 (45%), Positives = 235/376 (63%), Gaps = 22/376 (6%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+I+   K GDP +IT+NC DK GLGC++CRI+L FGLNI +GDVSTDGRWCY+V
Sbjct  4     LSDDVVIIRQSEKEGDPSVITINCPDKTGLGCDLCRILLFFGLNIVRGDVSTDGRWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYS-----NLIYLPSPKTPATSSYLMTLYCIGRT  826
              WV  +   P   W  LK RL    P ++     +  YL   ++     +L+ L C  RT
Sbjct  64    FWVIGK---PNTRWNLLKTRLVEASPAFAWAFGISRCYLSESESQPPDLFLLKLACSDRT  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLL+DVT+ L + E+ IE+VK+ TTPD +V+D+F + D  ELL  +++++E+ E LR  +
Sbjct  121   GLLYDVTEVLYKLEINIEKVKISTTPDGKVMDLFFVTDTRELLGTEKRRDEVYEYLRDAI  180

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             G++ +S ++KLV+       +   S  S S    LF   L E+ + LQ  S         
Sbjct  181   GDAMMSYDIKLVSS-----EVTARSPASSSFAETLF-SSLEEHPSGLQTSS-------SV  227

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQ-ITYARFSAANKGQRELDVFV  289
              + +DN+LS AHTLIQI+C D+K  LYDI R  K  N+Q I+Y RF+       E+D+F+
Sbjct  228   SIAVDNSLSRAHTLIQITCQDHKGLLYDIMRTFKDFNIQQISYGRFTIKRGKNCEIDLFI  287

Query  288   QHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFY  109
                +G KILD  KQ +L   L+ EL  PLRVV+ N+GPDTELLV NP+ELSG GRP+VFY
Sbjct  288   VQSDGRKILDSSKQDALVSRLRAELQQPLRVVMMNKGPDTELLVTNPVELSGKGRPQVFY  347

Query  108   DVTFALKTLGICIFSV  61
             D+  ALK +  CIFS 
Sbjct  348   DIALALKKINTCIFSA  363



>ref|XP_010908509.1| PREDICTED: uncharacterized protein LOC105034890 [Elaeis guineensis]
Length=419

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 176/375 (47%), Positives = 231/375 (62%), Gaps = 16/375 (4%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD VVI++ + PG+P +IT++C DK GLG ++CR+IL FGL+I +GDVSTDG+WCY+V W
Sbjct  6     DDVVVIRHPDSPGEPSVITISCPDKTGLGYDLCRVILFFGLSIVRGDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP------YSNLIYLPSPKTPATSS---YLMTLYCIG  832
             V  +       W  L  RL  VCP         N  Y       A      +L+   C  
Sbjct  66    VVGRGDRA-TRWGLLMKRLLEVCPAVLSASVLYNSYYRQQEMVAAQQEEQLFLLKFSCYD  124

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVTQ LCE EL I +VKV TTPD RV+D+F I D  ELL+ K ++EE+C+ LRA
Sbjct  125   RMGLLHDVTQVLCELELTIRKVKVSTTPDGRVMDLFFITDIRELLHTKRRKEEVCDLLRA  184

Query  651   VLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLK  472
             VLG+S   C+++L A   +  ++     L P++  E+F  +L E  +             
Sbjct  185   VLGDSMTKCDIEL-ASAEIASSMQASPFLPPTIPEEMFDLDLLEESSKES-----PSSSN  238

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                VT+DN+LS  HTLIQI C D+K  LYDI R LK  N+QI+Y R  AA  G  E+D+ 
Sbjct  239   NPSVTMDNSLSPGHTLIQILCRDHKGLLYDIMRTLKDYNIQISYGRLYAAQNGNCEIDLL  298

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             V   +G+KI+D  KQ +LC  L++EL  PLRV + +RGPDTELLVANP+ELSG GRP VF
Sbjct  299   VMQMDGKKIVDTNKQKALCSRLRLELSSPLRVTVVSRGPDTELLVANPVELSGKGRPLVF  358

Query  111   YDVTFALKTLGICIF  67
             +D+T  LK L   IF
Sbjct  359   HDITCCLKMLQTRIF  373



>ref|XP_006294313.1| hypothetical protein CARUB_v10023321mg [Capsella rubella]
 gb|EOA27211.1| hypothetical protein CARUB_v10023321mg [Capsella rubella]
Length=411

 Score =   321 bits (823),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 173/380 (46%), Positives = 233/380 (61%), Gaps = 26/380 (7%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+I    K GDP +IT+NC DK GLGC++CRI+L FGLNI +GDVSTDG+WCY+V
Sbjct  4     LSDDVVIISQSEKEGDPSVITINCPDKTGLGCDLCRILLFFGLNIVRGDVSTDGKWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYS-----NLIYLPS-----PKTPATSSYLMTLY  841
              WV  +   P   W  LK RL    P +S     +  YL       PK P    +L+ L 
Sbjct  64    FWVIGK---PNTRWNLLKMRLVEASPSFSWAFGISRCYLSDSESQPPKLPDL--FLLKLA  118

Query  840   CIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQ  661
             C  RTGLL+DVT+ L + E+ IE+VK+ TTPD +V+D+F + D  ELL   ++++E+ E 
Sbjct  119   CSDRTGLLYDVTEILYKLEINIEKVKISTTPDGKVMDLFFVTDTRELLGTVKRRDEVYEY  178

Query  660   LRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVM  481
             LR  +GES IS +++LV P      +   S  S SV   LF  ++S  +      S +V 
Sbjct  179   LRDAIGESLISYDIELVGP-----EIAARSQASSSVAETLFSSDVSGEQLSGLHTSSNVS  233

Query  480   KLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
                   + +DN+LS  HTLI I+C D+K  LYDI R  K  N+QI+Y RF+       E+
Sbjct  234   ------IAVDNSLSLVHTLIHITCQDHKGLLYDIMRTFKDFNIQISYGRFTIKRGRNCEI  287

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             D+F+   +G KILD  K  +L + L+ EL  PLRVV+ NRGPDTELLV NP+ELSG GRP
Sbjct  288   DLFIVQSDGRKILDSSKLNALIFRLRAELQQPLRVVMMNRGPDTELLVTNPVELSGKGRP  347

Query  120   RVFYDVTFALKTLGICIFSV  61
             +VF+D+  ALK +  CIFS 
Sbjct  348   QVFHDIALALKKINTCIFSA  367



>ref|XP_010050706.1| PREDICTED: uncharacterized protein LOC104439324 isoform X1 [Eucalyptus 
grandis]
Length=424

 Score =   321 bits (823),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 182/392 (46%), Positives = 244/392 (62%), Gaps = 41/392 (10%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I+   + G+P MIT+NC DK GLGC++CRIIL FGL+I +GDVSTDG+WCY++ W
Sbjct  6     DDVVIIRQSEREGEPSMITINCPDKTGLGCDLCRIILFFGLSIARGDVSTDGKWCYILFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLI------YLPSP-KTPATSSYLMTLYCIGRT  826
             V   +  P   W+ LK RL   CP  S+        Y P P K P    +L+ L C  R 
Sbjct  66    V---TGNPKTRWSLLKMRLVEACPSCSSASRILFDNYGPQPSKDPDV--FLLKLACCDRR  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKD----------------HLELLN  694
             GLL+DVT+ LCE EL I+RVKV TTPD++V+D+F I D                  ELL+
Sbjct  121   GLLYDVTRVLCEFELIIKRVKVSTTPDEKVMDLFFITDTRYDISVCSSPTYKSISRELLH  180

Query  693   IKEKQEELCEQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENE  514
              K++Q+++   L+AV+GE+ ISC++++V  GP        S L P++T +          
Sbjct  181   TKKRQDDVSNYLKAVIGEAMISCDIEMV--GPEITECSQDSFLPPAITED----------  228

Query  513   THLQELSPDVMKLKKSI-VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYA  337
               +     D     KSI V IDN LS AHTL+QISC D+K  LYDI R LK  N+QI+Y 
Sbjct  229   KEIPNYQLDGSLTSKSISVKIDNMLSPAHTLVQISCQDHKGLLYDIMRTLKDYNIQISYG  288

Query  336   RFSAANKGQRELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLV  157
             RF    +   E+D+F+   +G+KI+ P KQ +L   L++ELL PLRV + +RGP+TELLV
Sbjct  289   RFFTKQRRNCEIDLFIMQVDGKKIVAPSKQQALSSRLEMELLQPLRVAVVSRGPETELLV  348

Query  156   ANPLELSGMGRPRVFYDVTFALKTLGICIFSV  61
             ANP++L G GRP VF+D+T ALKTL I IFSV
Sbjct  349   ANPVQLCGKGRPLVFHDITLALKTLNIGIFSV  380



>emb|CDP15279.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   320 bits (821),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 176/377 (47%), Positives = 238/377 (63%), Gaps = 24/377 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+++   K G+P +ITVNC DK GLGC++CRIIL FGL I + DVSTDG+WCY++ W
Sbjct  6     DDLVIVRQSEKEGEPSVITVNCPDKTGLGCDLCRIILFFGLFIDRVDVSTDGKWCYLLFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSN------LIYLPSPKTPATSSYLMTLYCIGRTG  823
             V      P   W  LK RL   CP  S+         L  PK P    +L+ L C  R G
Sbjct  66    VV---GKPTTRWGLLKKRLVEACPSCSSASGISFYTELQPPKPPDV--FLLKLCCYDRRG  120

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHDVT+ LCE EL I++VKV TTP+ +V+D+F I D  ELL+ K++Q++  ++L+ V G
Sbjct  121   LLHDVTEVLCELELVIKKVKVSTTPEGKVMDLFFITDTRELLHTKKRQQDTYDRLKEVTG  180

Query  642   ESCISCELKLVAPGPLYENLPCF---SALSPSVTNELFRCELSENETHLQELSPDVMKLK  472
              + I+C+++++ P    E   C    S L   +T+ +   E+  +E     L PD +   
Sbjct  181   NALINCDIEMIGP----EATACSQGPSFLPHEITDGMLNLEML-DEQQSGYLPPDSVS--  233

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                +T+DN LS  HTL+QI C D+K  LYDI R LK  N+QI+Y RFS   K + ELD+F
Sbjct  234   ---ITMDNLLSPGHTLVQIVCQDHKGLLYDIMRTLKDYNIQISYGRFSTKRKTECELDLF  290

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             +   +G+KI+DP KQ++L   L +EL  PLRV + +RGPDTELLVANP+ELSG GRP VF
Sbjct  291   IMQTDGKKIVDPSKQSALRSRLWMELCRPLRVALVSRGPDTELLVANPVELSGKGRPLVF  350

Query  111   YDVTFALKTLGICIFSV  61
             +D+T ALK L   IFS 
Sbjct  351   HDITLALKMLKTGIFSA  367



>ref|XP_010509430.1| PREDICTED: uncharacterized protein LOC104785838 isoform X3 [Camelina 
sativa]
Length=371

 Score =   319 bits (817),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 174/381 (46%), Positives = 235/381 (62%), Gaps = 27/381 (7%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+I    K G+P +IT+NC DK GLGC++CRI+L FGLNI +GDV+TDG+WCY+V
Sbjct  4     LSDDVVIISQSEKEGEPSVITINCPDKTGLGCDLCRILLFFGLNIVRGDVTTDGKWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYS-----NLIYLPS-----PKTPATSSYLMTLY  841
              WV  +   P   W  LK RL    P +S     +  YL       PK P    +L+ L 
Sbjct  64    FWVIGK---PNTRWNLLKMRLVEASPSFSWAFGISRYYLSDSESQPPKFPDL--FLLKLA  118

Query  840   CIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQ  661
             C  RTGLL+DVT+ L + E+ IE+VK+ TTPD +V+D+F + D  ELL   +++EE+ E 
Sbjct  119   CSDRTGLLYDVTEVLYKLEINIEKVKISTTPDGKVMDLFFVTDTRELLGTGKRREEVYEY  178

Query  660   LRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCE-LSENETHLQELSPDV  484
             LR  +G+S IS +++LV        +   S  S SV   LF  + L E  +     S +V
Sbjct  179   LRDAIGDSMISYDIELVG-----SEITARSQASSSVAETLFSSDVLGEQPSGGLHTSSNV  233

Query  483   MKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRE  304
                    +++DN+LS AHTLI I+C D+K  LYDI R  K  N+QI+Y RF+       E
Sbjct  234   S------ISVDNSLSPAHTLIHITCQDHKGLLYDIMRTFKDFNIQISYGRFTIKRGRNCE  287

Query  303   LDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGR  124
             +D+F+   +G KILD  K  +L Y L+ EL  PLRVV+ NRGPDTELLV NP+ELSG GR
Sbjct  288   IDLFIVQSDGRKILDSSKLNALVYRLRAELQQPLRVVMMNRGPDTELLVTNPVELSGKGR  347

Query  123   PRVFYDVTFALKTLGICIFSV  61
             P+VF+D+  ALK +  CIFSV
Sbjct  348   PQVFHDIALALKKINTCIFSV  368



>ref|XP_010067351.1| PREDICTED: uncharacterized protein LOC104454251 [Eucalyptus grandis]
 gb|KCW65465.1| hypothetical protein EUGRSUZ_G02875 [Eucalyptus grandis]
Length=415

 Score =   320 bits (820),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 174/380 (46%), Positives = 235/380 (62%), Gaps = 24/380 (6%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + +D+VVI       D  ++TVNC DK GLGC++CRIIL F L+I +GD++TDG+WCY++
Sbjct  4     LQEDAVVISPAGNGSDSTVVTVNCPDKTGLGCDLCRIILQFNLSICRGDLTTDGKWCYIL  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPY----SNLIYLPSPKTPATSS-YLMTLYC-IGR  829
              W+  +   P   W  LK RL   CP Y        Y P  K P     +L+  +C   R
Sbjct  64    FWLVGR---PTTRWNLLKKRLLDACPSYFLTTEIEYYRPVIKQPRPPDVFLLKFWCSYDR  120

Query  828   TGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAV  649
              GLLHDVT+ LCE EL I+RVKV TTPD RV+D+F + D  ELL+ K +QEE   +LR+V
Sbjct  121   KGLLHDVTEVLCELELTIKRVKVSTTPDGRVMDLFFVTDPRELLHTKMRQEETINRLRSV  180

Query  648   LGESCISCELKLVAPGPLYENLPCFSALSP----SVTNELFRCELSENETHLQELSPDVM  481
             LG++ +SCE++L       + +   S  SP    ++T E    EL +        S  V 
Sbjct  181   LGDTMVSCEIELAG-----QEVTACSQGSPFLPSAITEETSSLELLDGNQSSSHFSNPVF  235

Query  480   KLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
                   V++DN LS AHT++QI C D+K  +YDI R LK  N+QI+Y RF A ++G  E+
Sbjct  236   ------VSMDNTLSPAHTIVQIECQDHKGLIYDIMRTLKDLNIQISYGRFWANSRGNCEV  289

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             + F  H +G KI+D  +Q  L  CLK EL  PL+V + +RGP+TELLVANP+ELSG GRP
Sbjct  290   EFFTMHADGSKIVDLTEQNDLSACLKRELRSPLKVAVGSRGPETELLVANPVELSGRGRP  349

Query  120   RVFYDVTFALKTLGICIFSV  61
              VFYD+TFAL++L   IFSV
Sbjct  350   LVFYDITFALESLNAPIFSV  369



>ref|XP_006354381.1| PREDICTED: uncharacterized protein LOC102581329 isoform X1 [Solanum 
tuberosum]
Length=411

 Score =   320 bits (820),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 177/381 (46%), Positives = 236/381 (62%), Gaps = 32/381 (8%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V++ +  + GDP +ITVNC DK GLG ++CRIIL FGL + + DVSTDG WCY+V W
Sbjct  6     DDVVLLNHSEREGDPSVITVNCPDKTGLGSDLCRIILFFGLTVVRVDVSTDGIWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLP------SPKTPATSSYLMTLYCIGRTG  823
             V  +   P   W  LK RL   CP  S+   +       SP+ P    +L+T  C  R G
Sbjct  66    VVGR---PDTRWNLLKKRLMGACPSCSSASGISYYRAELSPRPPDV--FLLTFCCNDRRG  120

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHDVT  L E EL I++VKV TTPD +V+D+F I D  ELL+ K++QE+   QL++VLG
Sbjct  121   LLHDVTAVLSELELTIKKVKVSTTPDGKVMDLFFITDTRELLHTKKRQEDTHYQLKSVLG  180

Query  642   ESCISCELKLVAP-------GPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDV  484
             ++ ISC++++V         GP        S L   +  ++F  E+      L E     
Sbjct  181   DAMISCDIEMVGSEIAGCSQGP--------SFLPQEIAEDMFSFEI------LHEQLSTS  226

Query  483   MKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRE  304
             +   K+I+T+DN +S  HTLI+I+C D+K  LYDI R LK  N+QI+Y RF+A  K   E
Sbjct  227   LACNKAIITVDNLMSPGHTLIKIACQDHKGLLYDIMRTLKDYNIQISYGRFAAKAKTDCE  286

Query  303   LDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGR  124
             L++F+   +G+KI+D  K   LC  L++EL  PLRV + NRGPD ELLVANP+ELSG GR
Sbjct  287   LELFIMQADGKKIVDHSKLNGLCSRLQMELSRPLRVSLMNRGPDAELLVANPVELSGKGR  346

Query  123   PRVFYDVTFALKTLGICIFSV  61
             P VFYD+T ALK L I IFS 
Sbjct  347   PIVFYDITLALKMLNIGIFSA  367



>gb|AAM61017.1| unknown [Arabidopsis thaliana]
Length=410

 Score =   320 bits (819),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 175/380 (46%), Positives = 234/380 (62%), Gaps = 27/380 (7%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+I    K GDP +IT+NC DK GLGC++CRI+L FGLNI +GDVSTDG+WCY+V
Sbjct  4     LSDDVVIISQSEKEGDPSVITINCPDKTGLGCDLCRILLFFGLNIVRGDVSTDGKWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYS-----NLIYLPS-----PKTPATSSYLMTLY  841
              WV  +   P   W  LK RL    P +S     +  YL       PK P    +L+ L 
Sbjct  64    FWVIGK---PNTRWNLLKMRLVEASPSFSWAFGISRCYLSDSESQPPKLPDL--FLLKLA  118

Query  840   CIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQ  661
             C  RTGLL+DVT+ L + E+ IE+VK+ TTPD +V+D+F + D  ELL   +++ E+ E 
Sbjct  119   CSDRTGLLYDVTEVLYKLEINIEKVKISTTPDGKVMDLFFVTDTRELLGTVKRRNEVYEY  178

Query  660   LRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVM  481
             LR  +G+S IS +++LV P    E   C  + S SV   LF  ++S   +     S +V 
Sbjct  179   LRDAIGDSMISYDIELVGP----EITAC--STSSSVAETLFSSDVSGEHSSGLHTSSNVS  232

Query  480   KLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
                   + +DN+LSSAHTLI I+C D+K  LYDI R  K  N+QI+Y RF+       E+
Sbjct  233   ------IAVDNSLSSAHTLIHITCQDHKGLLYDIMRTFKDFNIQISYGRFTIKRGKNCEI  286

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             D+F+   +G KILD  K  +L   L+ EL  PLRVV+ NRGPDTELLV NP+ELSG GRP
Sbjct  287   DLFIVQSDGRKILDSSKLNALITRLRAELQQPLRVVMMNRGPDTELLVTNPVELSGKGRP  346

Query  120   RVFYDVTFALKTLGICIFSV  61
             +VF+D+  ALK +  CIFS 
Sbjct  347   QVFHDIALALKKIDTCIFSA  366



>ref|XP_010530480.1| PREDICTED: uncharacterized protein LOC104807065 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530482.1| PREDICTED: uncharacterized protein LOC104807065 isoform X2 [Tarenaya 
hassleriana]
Length=440

 Score =   320 bits (820),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 183/377 (49%), Positives = 237/377 (63%), Gaps = 26/377 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I+   K GDP +ITVNC DK GLGC++CRI+L FGLNI +GDVSTDG+WCYVV W
Sbjct  37    DDVVIIRQSEKEGDPSVITVNCPDKTGLGCDLCRILLFFGLNIVRGDVSTDGKWCYVVFW  96

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP---------YSNLIYLPSPKTPATSSYLMTLYCIG  832
             V  +   P   W  LK RL  VCP          Y N + +  P       +L+ L C  
Sbjct  97    VMGK---PNTRWNLLKKRLVGVCPSCSSASGISYYRNELQIQKP----PDVFLLKLCCFD  149

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLL+DVT+ LCE EL +++VKV TTPD +V+D+F + D  ELL  K++QEE  + LR 
Sbjct  150   RKGLLYDVTEALCELELNVKKVKVSTTPDGKVMDLFFLTDTRELLGTKKRQEEAYQCLRN  209

Query  651   VLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLK  472
              +G+  IS  ++LV P  +  +    S+++ +VT  +F   L EN   L   S DV    
Sbjct  210   AIGDLMISYNIELVGP-EITAHSQASSSVASAVTETVF--PLDENHKGLYT-SGDVS---  262

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                + IDN+LS AHTL QISC D+K  LYDI R LK  N++I+Y RF+   +   E+D+F
Sbjct  263   ---IAIDNSLSPAHTLFQISCQDHKGLLYDIMRTLKDYNIKISYGRFTFKKRRNCEIDLF  319

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             +   +G KILD  KQ +L   LK EL  PL+V + NRGPDTELLVANP+ELSG GRP VF
Sbjct  320   IVQSDGRKILDTSKQNALTSRLKAELEQPLKVAMMNRGPDTELLVANPVELSGKGRPLVF  379

Query  111   YDVTFALKTLGICIFSV  61
             +D+T ALK L  CIFS 
Sbjct  380   HDITVALKKLNTCIFSA  396



>gb|KEH24036.1| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=374

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 175/377 (46%), Positives = 235/377 (62%), Gaps = 26/377 (7%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+++   K G+  +ITVNC DK GLG ++CRIIL F L I + DVSTDG+WCY+V
Sbjct  4     LHDDVVIMREPEKEGETTIITVNCPDKTGLGSDLCRIILLFHLTILRADVSTDGKWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCP---PYSNLIY----LPSPKTPATSSYLMTLYCIG  832
              WV  +  T    W+ LK RL + CP     S   Y    L + K P    +L+   C  
Sbjct  64    FWVVGKEKT---RWSLLKKRLIAACPTCSSASGFSYFCSDLQNQKPPDV--FLLKFCCKD  118

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVT+ LCE EL I++VKV TTPD +VLD+F I D  ELL+ ++++++  E+L  
Sbjct  119   RKGLLHDVTEVLCELELTIKKVKVSTTPDGKVLDLFFITDTRELLHTEKRKDDTIEKLTT  178

Query  651   VLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLK  472
             VL +   + +++LV P         FS  S S+ N +         T + +L        
Sbjct  179   VLEDFFTTIDIELVGP-----ETTAFSQPSSSLPNAI---------TDVFDLQSGTSTSD  224

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                + +DN LS AHTL+QI C D+K  LYDI R LK  N+QI+Y RFS   +G+ E+D+F
Sbjct  225   SVSIVMDNTLSPAHTLVQIMCQDHKGLLYDIMRTLKDFNIQISYGRFSKKPRGKCEIDLF  284

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             +   +G+KI+DP K+ SL   LK ELL PLRV + +RGPDT+LLVANP+ELSG GRP VF
Sbjct  285   IMQVDGKKIVDPSKKESLSSRLKTELLRPLRVAVVSRGPDTQLLVANPVELSGKGRPLVF  344

Query  111   YDVTFALKTLGICIFSV  61
             YD+T ALK LG+CIFSV
Sbjct  345   YDITLALKMLGLCIFSV  361



>ref|XP_010032142.1| PREDICTED: uncharacterized protein LOC104421765 [Eucalyptus grandis]
 gb|KCW51544.1| hypothetical protein EUGRSUZ_J01053 [Eucalyptus grandis]
Length=415

 Score =   318 bits (815),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 176/378 (47%), Positives = 234/378 (62%), Gaps = 24/378 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+V I    K     +ITV+C DK GLGC++CR+IL FGL+I +GD+STDG+WCY+  W
Sbjct  8     EDAVQISESEKAKGTTVITVSCPDKTGLGCDLCRVILLFGLSIARGDMSTDGKWCYIKFW  67

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPY---SNLIYLPSP--KTPATSSYLMTLYCIG-RTG  823
             V  +   P  +W+ LK RL  VCP Y   S + Y  S   +      +L+  +C   R G
Sbjct  68    VVGK---PTASWSLLKKRLLEVCPSYISMSGIEYYRSEMDQPKPHDVFLLKFWCSSDRKG  124

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHDVT+ LCE EL I+RVKV T PD RV+D+F + D   LL+ +++QEE    LR VLG
Sbjct  125   LLHDVTRVLCELELTIKRVKVSTAPDGRVMDLFFVTDSRALLHTQQRQEETIRCLRDVLG  184

Query  642   ESCISCELKLVAPGPLYENLPCFSA---LSPSVTNELFRCELSENETHLQELSPDVMKLK  472
              S +SCE+ +V P    E   C      L  +VT ++F  ELS         +P      
Sbjct  185   ASILSCEIGMVGP----EVTACSQKSLFLPSAVTEDMFSLELSSE-------NPTGSLFS  233

Query  471   KSIVTI-DNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDV  295
               + TI DN+LS +HTL+QI C D+K  +YDI R LK  N+Q++Y RF    KG  E+++
Sbjct  234   NPLSTIMDNSLSRSHTLVQILCQDHKGLIYDIMRTLKDYNIQVSYGRFCTKAKGNCEVEL  293

Query  294   FVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRV  115
             F+   +G KI DP K+ +LC  L++EL  PLRV + NRGPDTELLVANP+ELSG GRP V
Sbjct  294   FIMQVDGNKIADPNKKNALCSRLRMELWRPLRVAVVNRGPDTELLVANPVELSGRGRPLV  353

Query  114   FYDVTFALKTLGICIFSV  61
             F D+T AL+TL   IFSV
Sbjct  354   FRDITLALETLDTRIFSV  371



>ref|NP_030235.1| ACT domain-containing protein [Arabidopsis thaliana]
 sp|Q9SJM1.1|ACR10_ARATH RecName: Full=ACT domain-containing protein ACR10; AltName: Full=Protein 
ACT DOMAIN REPEATS 10 [Arabidopsis thaliana]
 gb|AAD31570.1| expressed protein [Arabidopsis thaliana]
 gb|AAM13209.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15524.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09305.1| ACT domain-containing protein [Arabidopsis thaliana]
 gb|AEP31951.1| ACT domain-containing protein [Arabidopsis thaliana]
Length=410

 Score =   318 bits (815),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 175/380 (46%), Positives = 234/380 (62%), Gaps = 27/380 (7%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+I    K GDP +IT+NC DK GLGC++CRI+L FGLNI +GDVSTDG+WCY+V
Sbjct  4     LSDDVVIISQSEKEGDPSVITINCPDKTGLGCDLCRILLFFGLNIVRGDVSTDGKWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYS-----NLIYLPS-----PKTPATSSYLMTLY  841
              WV  +   P   W  LK RL    P +S     +  YL       PK P    +L+ L 
Sbjct  64    FWVIGK---PNTRWNLLKMRLVEASPSFSWAFGISRCYLSDSESQPPKLPDL--FLLKLA  118

Query  840   CIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQ  661
             C  RTGLL+DVT+ L + E+ IE+VK+ TTPD +V+D+F + D  ELL   +++ E+ E 
Sbjct  119   CSDRTGLLYDVTEVLYKLEINIEKVKISTTPDGKVMDLFFVTDTRELLGTVKRRNEVYEY  178

Query  660   LRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVM  481
             LR  +G+S IS +++LV P    E   C  + S SV   LF  ++S   +     S +V 
Sbjct  179   LRDAIGDSMISYDIELVGP----EITAC--STSSSVAETLFSSDVSGEHSSGLHTSSNVS  232

Query  480   KLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
                   + +DN+LSSAHTLI I+C D+K  LYDI R  K  N+QI+Y RF+       E+
Sbjct  233   ------IAVDNSLSSAHTLIHITCQDHKGLLYDIMRTFKDFNIQISYGRFTIKLGKNCEI  286

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             D+F+   +G KILD  K  +L   L+ EL  PLRVV+ NRGPDTELLV NP+ELSG GRP
Sbjct  287   DLFIVQSDGRKILDSSKLNALITRLRAELQQPLRVVMMNRGPDTELLVTNPVELSGKGRP  346

Query  120   RVFYDVTFALKTLGICIFSV  61
             +VF+D+  ALK +  CIFS 
Sbjct  347   QVFHDIALALKKIDTCIFSA  366



>ref|XP_010505230.1| PREDICTED: uncharacterized protein LOC104782103 isoform X1 [Camelina 
sativa]
Length=412

 Score =   318 bits (814),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 171/380 (45%), Positives = 234/380 (62%), Gaps = 25/380 (7%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+I    K G+P +IT+NC DK GLGC++CRI+L FGLNI +GDV+TDG+WCY+V
Sbjct  4     LSDDVVIISQSEKEGEPSVITINCPDKTGLGCDLCRILLFFGLNIVRGDVTTDGKWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYS-----NLIYLPS-----PKTPATSSYLMTLY  841
              WV  +   P   W  LK RL    P +S     +  YL       PK P    +L+ L 
Sbjct  64    FWVIGK---PNTRWNLLKMRLVEASPSFSWAFGISRCYLSDSESQPPKIPDL--FLLKLA  118

Query  840   CIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQ  661
             C  RTGLL+DVT+ L + E+ IE+VK+ TTPD +V+D+F + D  ELL   +++EE+ E 
Sbjct  119   CSDRTGLLYDVTEVLYKLEINIEKVKISTTPDGKVMDLFFVTDTRELLGTGKRREEVYEY  178

Query  660   LRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVM  481
             LR  +G+S IS +++LV        +   S  S SV   LF  ++S      ++ S  + 
Sbjct  179   LRDAIGDSLISYDIELVG-----SEITARSQASSSVAETLFSSDVSG-----EQPSGGLH  228

Query  480   KLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
                   +++DN+LS AHTLI I+C D+K  LYDI R  K  N+QI+Y RF+       E+
Sbjct  229   TSSNVSISVDNSLSPAHTLIHITCQDHKGLLYDIMRTFKDFNIQISYGRFTIKRGRNCEI  288

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             D+F+   +G KILD  K  +L Y L+ EL  PLRVV+ NRGPDTELLV NP+ELSG GRP
Sbjct  289   DLFIVQSDGRKILDSSKLNALVYRLRAELQQPLRVVMMNRGPDTELLVTNPVELSGKGRP  348

Query  120   RVFYDVTFALKTLGICIFSV  61
             +VF+D+  ALK +  CIFS 
Sbjct  349   QVFHDIALALKKINTCIFSA  368



>ref|XP_010509428.1| PREDICTED: uncharacterized protein LOC104785838 isoform X1 [Camelina 
sativa]
Length=412

 Score =   317 bits (813),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 173/381 (45%), Positives = 234/381 (61%), Gaps = 27/381 (7%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+I    K G+P +IT+NC DK GLGC++CRI+L FGLNI +GDV+TDG+WCY+V
Sbjct  4     LSDDVVIISQSEKEGEPSVITINCPDKTGLGCDLCRILLFFGLNIVRGDVTTDGKWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYS-----NLIYLPS-----PKTPATSSYLMTLY  841
              WV  +   P   W  LK RL    P +S     +  YL       PK P    +L+ L 
Sbjct  64    FWVIGK---PNTRWNLLKMRLVEASPSFSWAFGISRYYLSDSESQPPKFPDL--FLLKLA  118

Query  840   CIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQ  661
             C  RTGLL+DVT+ L + E+ IE+VK+ TTPD +V+D+F + D  ELL   +++EE+ E 
Sbjct  119   CSDRTGLLYDVTEVLYKLEINIEKVKISTTPDGKVMDLFFVTDTRELLGTGKRREEVYEY  178

Query  660   LRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCE-LSENETHLQELSPDV  484
             LR  +G+S IS +++LV        +   S  S SV   LF  + L E  +     S +V
Sbjct  179   LRDAIGDSMISYDIELVG-----SEITARSQASSSVAETLFSSDVLGEQPSGGLHTSSNV  233

Query  483   MKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRE  304
                    +++DN+LS AHTLI I+C D+K  LYDI R  K  N+QI+Y RF+       E
Sbjct  234   S------ISVDNSLSPAHTLIHITCQDHKGLLYDIMRTFKDFNIQISYGRFTIKRGRNCE  287

Query  303   LDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGR  124
             +D+F+   +G KILD  K  +L Y L+ EL  PLRVV+ NRGPDTELLV NP+ELSG GR
Sbjct  288   IDLFIVQSDGRKILDSSKLNALVYRLRAELQQPLRVVMMNRGPDTELLVTNPVELSGKGR  347

Query  123   PRVFYDVTFALKTLGICIFSV  61
             P+VF+D+  ALK +  CIFS 
Sbjct  348   PQVFHDIALALKKINTCIFSA  368



>ref|XP_006377899.1| ACT domain-containing family protein [Populus trichocarpa]
 gb|ERP55696.1| ACT domain-containing family protein [Populus trichocarpa]
Length=404

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 177/376 (47%), Positives = 235/376 (63%), Gaps = 32/376 (9%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+I++  K GDP +ITVNC DK GLGC++CRIIL FGL+I +GDVSTDG+WCY+V  
Sbjct  6     DDVVIIRHSEKEGDPAVITVNCPDKTGLGCDLCRIILFFGLSIVRGDVSTDGKWCYIVFS  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPP---YSNLIY----LPSPKTPATSSYLMTLYCIGRT  826
             V  +S+T    W  LK RL   CP     S + Y    L  P+ P    +L+ L C  R 
Sbjct  66    VVGKSTT---RWGLLKKRLVGACPSCSSASGISYYTAELQPPRPPDV--FLLKLACHDRK  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT  LCE EL I++VKV TTPD RV+D+F + D         ++E+  + LRAV+
Sbjct  121   GLLHDVTGVLCELELTIKKVKVSTTPDGRVMDLFFVTD--------TRKEDTYDHLRAVM  172

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQ--ELSPDVMKLK  472
             G S ISC++++V P    E   C      S  +      ++EN   LQ  +  P  +   
Sbjct  173   GNSMISCDIEMVGP----EITAC------SAESSFLPTAITENILPLQMPDELPSSLTST  222

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                V +DN LS AHTL+QI C D+K  LYDI R LK  N+QI+Y RF   ++   E+D+F
Sbjct  223   SVSVIMDNLLSPAHTLVQIVCQDHKGLLYDIMRTLKDYNIQISYGRFYIKHRRTCEIDLF  282

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             +   +G+KI+DP KQ +L   L++EL+ PLRV + +RGPDTEL+VANP+ELSG GRP VF
Sbjct  283   IMQADGKKIVDPNKQKALSSRLEMELVRPLRVAVVSRGPDTELMVANPVELSGKGRPLVF  342

Query  111   YDVTFALKTLGICIFS  64
             +D+T AL  L  CIFS
Sbjct  343   HDITLALTMLNSCIFS  358



>ref|XP_006410856.1| hypothetical protein EUTSA_v10016601mg [Eutrema salsugineum]
 gb|ESQ52309.1| hypothetical protein EUTSA_v10016601mg [Eutrema salsugineum]
Length=474

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 171/380 (45%), Positives = 234/380 (62%), Gaps = 26/380 (7%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+I+   K GDP +IT+NC DK GLGC++CRI+L FGLNI +GDVSTDG+WCY+V
Sbjct  67    LSDDVVIIRQSEKEGDPSVITINCPDKTGLGCDLCRILLFFGLNIVRGDVSTDGKWCYLV  126

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYS-----NLIYLPSP-----KTPATSSYLMTLY  841
              WV  +   P   W  LK RL    P +S     +  YL        K P    +L+ L 
Sbjct  127   FWVIGK---PNTRWNLLKMRLVEASPSFSWAFGISRSYLSDSELQPLKLPDL--FLLKLA  181

Query  840   CIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQ  661
             C  RTGLL+DVT+ L + E+ IE+VK+ TTPD +V+D+F + D  ELL  +++++E+ E 
Sbjct  182   CSDRTGLLYDVTEVLYKLEINIEKVKISTTPDGKVMDLFFVTDTRELLGTEKRRDEVYEC  241

Query  660   LRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVM  481
             L+  +G+S +S +++LV P      +   S  S SV   LF  ++      L E S  + 
Sbjct  242   LKDAIGDSMMSYDIELVGP-----EITARSPASSSVAETLFSSDV------LAEHSSGLH  290

Query  480   KLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
                   + +DN+LS  HTLIQI+C D+K  LYDI R  K  N+QI+Y RF+       E+
Sbjct  291   TSSSVSIAVDNSLSPGHTLIQITCQDHKGLLYDIMRTFKDFNIQISYGRFTIKRVKNCEI  350

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             D+F+   +G KILD  KQ +L   L+ EL  PLRVV+ NRGPDTELLV NP+ELSG GRP
Sbjct  351   DLFIVQSDGRKILDSSKQDALISRLRAELQQPLRVVMMNRGPDTELLVTNPVELSGKGRP  410

Query  120   RVFYDVTFALKTLGICIFSV  61
             +VF+D+  ALK +  CIFS 
Sbjct  411   QVFHDIALALKKINTCIFSA  430



>ref|XP_004487026.1| PREDICTED: uncharacterized protein LOC101513308 isoform X3 [Cicer 
arietinum]
Length=352

 Score =   314 bits (804),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/283 (57%), Positives = 209/283 (74%), Gaps = 19/283 (7%)
 Frame = -2

Query  858  YLMTLYCIGRTGL----------------LHDVTQFLCECELYIERVKVITTPDDRVLDV  727
            +++T+ C  +TGL                  DVT+ LCE EL I+R+KV TTPD +VLD+
Sbjct  25   FIITINCPDKTGLGCDLCRFILDFGLCILKGDVTKVLCELELTIQRLKVTTTPDSKVLDL  84

Query  726  FIIKDHLELLNIKEKQEELCEQLRAVLGESCISCELKLVAPGPLYE-NLPCFSALSPSVT  550
            F I D+LELL+ +++Q+E C++L AVLG+SCI CEL+L   G  YE N     +LSP + 
Sbjct  85   FFITDNLELLHTRKRQDETCKRLNAVLGDSCIICELQLA--GSEYEYNHGHGISLSPMLA  142

Query  549  NELFRCELSENETHLQELSPDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRA  370
             ELF+CELS+N+   Q LS D+ KLKKS VT+DN+LS  HTL+QI CVD+K  LYDI R 
Sbjct  143  KELFQCELSDNQVRSQALSSDMKKLKKSNVTVDNSLSPVHTLLQIRCVDHKGLLYDIMRT  202

Query  369  LKGCNVQITYARFSAANKGQRELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVI  190
            LK  N++I+Y RFS   KG R+LD+F+Q K+G+KILD EKQ++LC  LK+E+LHPLRV+I
Sbjct  203  LKDMNLKISYGRFSPNAKGCRDLDIFIQQKDGKKILDHEKQSALCSRLKLEMLHPLRVII  262

Query  189  SNRGPDTELLVANPLELSGMGRPRVFYDVTFALKTLGICIFSV  61
            ++RGPDTELLVANP+ELSG GRPRVFYDVT ALKTLGIC+FS 
Sbjct  263  ADRGPDTELLVANPVELSGKGRPRVFYDVTLALKTLGICVFSA  305


 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVS  1018
             +D+V IQ+GN P DP++IT+NC DK GLGC++CR ILDFGL I KGDV+
Sbjct  10    NDAVQIQHGNNPDDPFIITINCPDKTGLGCDLCRFILDFGLCILKGDVT  58



>ref|XP_010696293.1| PREDICTED: uncharacterized protein LOC104908830 [Beta vulgaris 
subsp. vulgaris]
Length=412

 Score =   316 bits (809),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 175/381 (46%), Positives = 235/381 (62%), Gaps = 27/381 (7%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+ +   K GDP +ITVNC DKLGL C++CRI+L FG NI + D +TDG+WCY+V
Sbjct  4     LQDDVVIFKAPEKEGDPTIITVNCPDKLGLACDLCRILLFFGFNITRVDFATDGKWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPP--------YSNLIYLPSPKTPATSSYLMTLYCI  835
             +WV  +++T    W  +K RL  VCP         Y     L  PK P    +L+ L C 
Sbjct  64    LWVVGKATTK---WGLVKKRLVGVCPSCYSASGMSYYRTELLQPPKPPDI--FLLKLCCH  118

Query  834   GRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLR  655
              R GLLHD+T+ LCE EL I++VKV TTPD +VLD+F I D  ELL+ K++QE+  E LR
Sbjct  119   DRRGLLHDITEVLCELELNIQKVKVSTTPDGKVLDLFFITDTRELLHTKKRQEDAKEHLR  178

Query  654   AVLGESCISCELKLVAPGPLYENLPCFSA---LSPSVTNELFRCELSENETHLQELSPDV  484
             A L E  + C+++ V      E   C  A   L   +T+E F  E+ +   +    +   
Sbjct  179   ATL-EDAVICDIEKVD----LEVTACSQASPFLPSVITDETFNFEIPDKHRNGTSFT---  230

Query  483   MKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRE  304
                  + +T+DN+LS +HTL+QI C DYK  LYD+ R  K  N+QI+Y R +   K   E
Sbjct  231   ---NCASITLDNSLSPSHTLVQIVCRDYKGLLYDLMRTFKDYNIQISYGRGTTKQKKNCE  287

Query  303   LDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGR  124
             +D+F+   +G+KI+D  KQ +L   L  EL  PLRV + +RGPDTELLVANP+E+SG GR
Sbjct  288   IDLFIVQADGKKIVDSSKQNALRSRLCRELARPLRVAVVSRGPDTELLVANPVEISGRGR  347

Query  123   PRVFYDVTFALKTLGICIFSV  61
             PRVFYDVT ALK L +CIFS 
Sbjct  348   PRVFYDVTLALKMLNLCIFSA  368



>ref|XP_003625701.1| hypothetical protein MTR_7g102330 [Medicago truncatula]
 gb|AES81919.1| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=405

 Score =   315 bits (807),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 174/377 (46%), Positives = 234/377 (62%), Gaps = 26/377 (7%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+++   K G+  +ITVNC DK GLG ++CRIIL F L I + DVSTDG+WCY+V
Sbjct  4     LHDDVVIMREPEKEGETTIITVNCPDKTGLGSDLCRIILLFHLTILRADVSTDGKWCYIV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCP---PYSNLIY----LPSPKTPATSSYLMTLYCIG  832
              WV  +  T    W+ LK RL + CP     S   Y    L + K P    +L+   C  
Sbjct  64    FWVVGKEKT---RWSLLKKRLIAACPTCSSASGFSYFCSDLQNQKPPDV--FLLKFCCKD  118

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVT+ LCE EL I++VKV TTPD +VLD+F I D  ELL+ ++++++  E+L  
Sbjct  119   RKGLLHDVTEVLCELELTIKKVKVSTTPDGKVLDLFFITDTRELLHTEKRKDDTIEKLTT  178

Query  651   VLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLK  472
             VL +   + +++LV P         FS  S S+ N +         T + +L        
Sbjct  179   VLEDFFTTIDIELVGP-----ETTAFSQPSSSLPNAI---------TDVFDLQSGTSTSD  224

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                + +DN LS AHTL+QI C D+K  LYDI R LK  N+QI+Y RFS   +G+ E+D+F
Sbjct  225   SVSIVMDNTLSPAHTLVQIMCQDHKGLLYDIMRTLKDFNIQISYGRFSKKPRGKCEIDLF  284

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             +   +G+KI+DP K+ SL   LK ELL PLRV + +RGPDT+LLVANP+ELSG GRP VF
Sbjct  285   IMQVDGKKIVDPSKKESLSSRLKTELLRPLRVAVVSRGPDTQLLVANPVELSGKGRPLVF  344

Query  111   YDVTFALKTLGICIFSV  61
             YD+T ALK LG+CIFS 
Sbjct  345   YDITLALKMLGLCIFSA  361



>ref|XP_006846099.1| hypothetical protein AMTR_s00012p00123010 [Amborella trichopoda]
 gb|ERN07774.1| hypothetical protein AMTR_s00012p00123010 [Amborella trichopoda]
Length=362

 Score =   313 bits (801),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 177/370 (48%), Positives = 230/370 (62%), Gaps = 58/370 (16%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V+IQ   +P +  +ITVNC ++ G GC++CRI+L+FG +I +GDVSTDGRWCY+V+W
Sbjct  6     DDLVLIQPSQRPDESSVITVNCPNQTGFGCDLCRIVLEFGPSIVRGDVSTDGRWCYIVLW  65

Query  984   VFPQSSTPI--VTWAKLKDRLWSVCP---PYSNLIYLPSPKTPATSSYLMTLYCIGRTGL  820
             V   SS P+  V W+ +  RL   CP    Y N +Y P PK   +S +L+ L C+ R+GL
Sbjct  66    VL-HSSGPLRDVKWSSIHKRLLYACPHPISYYNELYTP-PK--PSSMFLLKLCCLDRSGL  121

Query  819   LHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGE  640
             LHDVT  LCE EL + RVK  +                     +++ E+ CE+L AVLGE
Sbjct  122   LHDVTHVLCELELTVHRVKRASAH-------------------QKETEDACERLNAVLGE  162

Query  639   SCISCELKLVAPGPLYENLPCFSA-LSPSVTNELFRCELSENETHLQELSPDVMKLKKSI  463
             SCISCE++L   GP YE     S+ L P+V  ELF  EL E+E H   L PD ++ K   
Sbjct  163   SCISCEIQLA--GPEYEIYHRGSSFLPPTVAEELFGSELLESEAHQLALLPDSLRQKTVS  220

Query  462   VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQH  283
             +T+DN+LS AHTL+QI+ +D K  LYDI R LK  N+QI                     
Sbjct  221   MTMDNSLSPAHTLLQITTIDQKGLLYDIMRTLKDYNIQI---------------------  259

Query  282   KNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDV  103
                   +DPEKQ +LC  L++E+LHPLR++I +RGPD ELLVANP+ELSG GRPRVFYDV
Sbjct  260   ------VDPEKQKALCSLLRMEMLHPLRIMIISRGPDPELLVANPVELSGKGRPRVFYDV  313

Query  102   TFALKTLGIC  73
             TFALK LGIC
Sbjct  314   TFALKMLGIC  323



>ref|XP_010516911.1| PREDICTED: uncharacterized protein LOC104792465 [Camelina sativa]
 ref|XP_010516913.1| PREDICTED: uncharacterized protein LOC104792465 [Camelina sativa]
Length=412

 Score =   313 bits (801),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 170/380 (45%), Positives = 232/380 (61%), Gaps = 25/380 (7%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+I    K G+P +IT+NC DK GLGC++CRI+L FGLNI +GDV+TDG+WCY+V
Sbjct  4     LSDDVVIISQSEKEGEPSVITINCPDKTGLGCDLCRILLFFGLNIVRGDVTTDGKWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYS-----NLIYLPS-----PKTPATSSYLMTLY  841
              WV  +   P   W  LK RL    P +S     +  YL       PK P    +L+ L 
Sbjct  64    FWVIGK---PNTRWNLLKMRLVEASPSFSWAFGISRCYLSDSESQPPKLPDL--FLLKLA  118

Query  840   CIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQ  661
             C  RTGLL+DVT+ L + E+ IE+VK+ TTPD +V+D+F + D  ELL   +++EE+ E 
Sbjct  119   CSDRTGLLYDVTEVLYKLEINIEKVKISTTPDGKVMDLFFVTDTRELLGTGKRREEVYEY  178

Query  660   LRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVM  481
             LR  +G+S IS ++ LV        +   S  S SV   LF  ++S      ++ S  + 
Sbjct  179   LRDAIGDSMISYDIGLVG-----SEITARSQASSSVAETLFSSDVSG-----EQPSGGLH  228

Query  480   KLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
                   +++DN+LS AHTLI I+C D+K  LYDI R  K  N+QI+Y RF+       E+
Sbjct  229   TSSNVSISVDNSLSPAHTLIHITCQDHKGLLYDIMRTFKDFNIQISYGRFTIKRGRNCEI  288

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             D+F+   +G KILD  K  +L   L+ EL  PLRVV+ NRGPDTELLV NP+ELSG GRP
Sbjct  289   DLFIVQSDGRKILDSSKLNALVCRLRAELQQPLRVVMMNRGPDTELLVTNPVELSGKGRP  348

Query  120   RVFYDVTFALKTLGICIFSV  61
             +VF+D+  ALK +  CIFS 
Sbjct  349   QVFHDIALALKKINTCIFSA  368



>ref|XP_011077308.1| PREDICTED: uncharacterized protein LOC105161352 [Sesamum indicum]
Length=412

 Score =   310 bits (794),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 170/376 (45%), Positives = 231/376 (61%), Gaps = 21/376 (6%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD+V+I+   K  +P +ITVNC DK GLGC++CRIIL FGL +   DVSTDG+WCY+V W
Sbjct  6     DDAVIIRQSEKEDEPSVITVNCPDKTGLGCDLCRIILFFGLTVAGTDVSTDGKWCYIVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPY-------SNLIYLPSPKTPATSSYLMTLYCIGRT  826
             V  + ST    W  LK RL   CP +       S    L   K P    +L+   C  R 
Sbjct  66    VVGRPST---RWGLLKKRLMGACPSFWLACGMSSYWAELQPSKPPDV--FLLKFCCNDRR  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVT+ LCE EL I+ VKV TTP+ +V+D+F I D  E+++ K ++E++ + L+AVL
Sbjct  121   GLLHDVTEVLCELELTIKTVKVSTTPEGKVMDLFYITDTREIMHTKRRKEDVYDHLKAVL  180

Query  645   GESCISCELKLVAPG-PLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKK  469
             G+   SCE+++  P        P F  LS ++  ++F  E+      L++     +  K+
Sbjct  181   GDDTSSCEIEIAGPDISASSQEPSF--LSDAIIEDMFNIEM------LEKHQDHSLAFKR  232

Query  468   SIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFV  289
               +T DN LS +HTLIQI C D+K  LYDI R LK  N+QI+Y RF+   K + ELD+F+
Sbjct  233   PSITFDNLLSPSHTLIQIVCQDHKGLLYDIMRTLKDYNIQISYVRFTTKGKTECELDLFI  292

Query  288   QHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFY  109
                + +KI D  KQ SL   L++EL HP+RV + +R  DTEL+VANP+E SG GRP VFY
Sbjct  293   MQADSKKIADLRKQNSLRCRLEMELSHPVRVALISRTHDTELVVANPIESSGEGRPLVFY  352

Query  108   DVTFALKTLGICIFSV  61
             D+T ALK L   IFS 
Sbjct  353   DITLALKMLNKPIFSA  368



>gb|KHG23990.1| [Protein-PII] uridylyltransferase [Gossypium arboreum]
Length=408

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 170/382 (45%), Positives = 233/382 (61%), Gaps = 39/382 (10%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + DD V+I       +P +IT+NC DK GLGC++CRI+L FGL I +GDVSTDG+WCY+V
Sbjct  4     LHDDVVIINQSKNEAEPSVITINCPDKTGLGCDLCRILLFFGLTIVRGDVSTDGKWCYIV  63

Query  990   MWVFPQSSTPIVTWAK-----LKDRLWSVCPPYSNLIYLPSPKTPATSS-----YLMTLY  841
             +WV P+   PI+ W       LK+RL   CP  S+   +    +   SS     +L+ L+
Sbjct  64    LWVIPK---PIIKWDTCRWELLKNRLIGTCPSCSSAFGISYYSSELQSSMVTDVFLIKLF  120

Query  840   CIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQ  661
             C  R GL HD+T  LC  EL I++VKV TTP   V+++F + D  ELL+ K +QEE  E 
Sbjct  121   CYDRKGLSHDITTVLCNLELDIKKVKVSTTPVGTVMNLFFVTDTRELLHTKMRQEETYEA  180

Query  660   LRAVLGESCISCELKLVAPGPLYENLPCFSA---LSPSVTNELFRCELSENETHLQELSP  490
             L  V+  + ISC ++ V P    E   C  A   LS ++TN++                 
Sbjct  181   LVDVMQAAIISCNVEKVGP----EVTACSQASPFLSSAITNDV-----------------  219

Query  489   DVMKLKKSI-VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKG  313
              V++   ++ VT+DN+ S AHTL+QI C D+K  LYDI R LK  N+QI+Y RF      
Sbjct  220   -VLRTSNNVSVTMDNSFSPAHTLVQIVCQDHKGLLYDIMRTLKDYNIQISYGRFYIKQGR  278

Query  312   QRELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSG  133
             + E+D+F+   +G+KI+DP  Q +L   L++ELL PLRVV+ +RGPDTELLVANP+ELS 
Sbjct  279   KCEIDLFITQADGKKIIDPSMQRALSSRLQMELLRPLRVVVVSRGPDTELLVANPVELSS  338

Query  132   MGRPRVFYDVTFALKTLGICIF  67
              GRP VF+D+T ALK L  CIF
Sbjct  339   KGRPLVFHDITLALKMLNTCIF  360



>ref|XP_007010015.1| ACT-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY18825.1| ACT-like superfamily protein isoform 1 [Theobroma cacao]
Length=413

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 174/380 (46%), Positives = 237/380 (62%), Gaps = 24/380 (6%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + +D +VI    K  D  +I+VNC DK GLGC++CRIIL FGL+I +GD STDG+WCYVV
Sbjct  4     LREDVIVISPAEKEEDSTVISVNCPDKTGLGCDLCRIILLFGLSIARGDFSTDGKWCYVV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNL----IYLPSPKTPA-TSSYLMTLYC-IGR  829
             +WV  +++T    W  L+ RL  VCP Y +      Y P+ + P     +L+  +C   R
Sbjct  64    LWVVGKTNT---RWDLLEKRLLEVCPSYFSTSGIDYYQPANQQPKPLDVFLLKFWCSCYR  120

Query  828   TGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAV  649
              GLL+DVT  L E EL I++VKV TTPD +V+D+F I D  ELL+ KE+Q +    L+A 
Sbjct  121   KGLLNDVTLVLFELELTIKKVKVSTTPDGKVMDLFFITDTRELLHTKERQGQTILHLKAA  180

Query  648   LGESCISCELKLVAPGPLYENLPCF---SALSPSVTNELFRCELSENETHLQELSPDVMK  478
             LG+   SCE++ V P    E   C    S L  ++T ++F  EL           P  + 
Sbjct  181   LGDILESCEIESVGP----EITACAQGTSFLPSAITEDMFSLELPAR-------YPGGLL  229

Query  477   LKKSI-VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
                 I +T+DN LS +HTLIQ+ C D+K  +YDI R LK  N+Q++Y RF A   G  E+
Sbjct  230   ASNPISITVDNTLSPSHTLIQVLCQDHKGLIYDIMRTLKDYNIQVSYGRFFAKQNGGCEM  289

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             D+F+   +G+KI+D  KQ +LC  L++EL  PLR+ + +RGPDTELLVANP+ELSG GRP
Sbjct  290   DLFIVQADGKKIVDRNKQNALCSRLRMELWRPLRLAVVSRGPDTELLVANPVELSGRGRP  349

Query  120   RVFYDVTFALKTLGICIFSV  61
              VF+D+T ALK L   IFSV
Sbjct  350   LVFHDITLALKNLNTQIFSV  369



>gb|EYU32419.1| hypothetical protein MIMGU_mgv1a007371mg [Erythranthe guttata]
Length=409

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 165/377 (44%), Positives = 237/377 (63%), Gaps = 26/377 (7%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D+V+I+   K G+  +ITVNC DK GLGC++ RIIL FGL+I +GD+STDG+WCY+V W
Sbjct  6     EDAVLIKESEKEGEHTVITVNCPDKTGLGCDLSRIILLFGLSIARGDLSTDGKWCYLVFW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCP---PYSNLIY-----LPSPKTPATSSYLMTLYC-IG  832
             V  +   P   W+ L+ RL  VCP   P ++ I+        PK P    +L+T +C   
Sbjct  66    VIGK---PTTRWSLLRKRLLEVCPTCIPSASGIFYFIPEFQQPKPPQI--FLLTFWCSYD  120

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVT+ L E EL I+RVKV T PD RV+D+F I D  ELL   ++++E  ++L+ 
Sbjct  121   RKGLLHDVTEVLYELELTIKRVKVYTAPDGRVMDLFFITDTRELLQTSKRRDETIKRLKI  180

Query  651   VLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLK  472
             VLG++ +SC+++L  P    E   C     PS    +F   +S+ ++         +   
Sbjct  181   VLGDAMLSCDIELATP----EVASCLKPYLPS--ENIFNLPISDEQSSGV------VSSD  228

Query  471   KSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVF  292
                +  DN LS +HTL+Q  C D+K  +YDI R LK  N+Q++Y RF A  +G  E+++F
Sbjct  229   SVSIVFDNTLSPSHTLVQFFCQDHKGLIYDIMRTLKDYNIQVSYGRFFANTEGNCEMELF  288

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             +   +G+KI D +K+ +L   L++EL+HPL+V + ++GPDTELLV NP+ELSG GRP VF
Sbjct  289   IMQSDGKKITDTQKRNALSSRLRMELIHPLKVDVISKGPDTELLVVNPVELSGRGRPLVF  348

Query  111   YDVTFALKTLGICIFSV  61
             YD+T AL  L I IFSV
Sbjct  349   YDITLALSILNISIFSV  365



>gb|ACR34913.1| unknown [Zea mays]
 tpg|DAA39588.1| TPA: LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_464424 
[Zea mays]
Length=428

 Score =   303 bits (776),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 170/392 (43%), Positives = 239/392 (61%), Gaps = 37/392 (9%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             DD V I++ +  G+P ++TV+C DK GLGC++CR +L FGL++ KGD+STDGRWCY+V W
Sbjct  8     DDVVQIRHADAAGEPTVVTVSCPDKTGLGCDLCRAVLLFGLSVVKGDMSTDGRWCYIVFW  67

Query  984   VFPQSSTPI-VTWAKLKDRLWSVCP---PY---SNLIYLPSPKT------PATSSYLMTL  844
             + P+   P+ V W  LKDRL  +CP   P+   S+  YL +         PA   +L+ L
Sbjct  68    LLPRGRRPVAVPWDLLKDRLLQLCPVAPPFGFGSHDAYLAAAAGLQDVPPPAPQLFLLKL  127

Query  843   YCIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCE  664
              C  R GLLHDVT+ LCE EL I RVKV TTPD  VLD+F I D   LL+ K ++EE  +
Sbjct  128   CCFDRMGLLHDVTRVLCELELTIRRVKVSTTPDGSVLDLFFITDARGLLHTKSRREETQD  187

Query  663   QLRAVLGESCISCELKLVAPGPLYENLP-------CFSALSPSVTNELFRCELSENETHL  505
             +L +VLG+S   CE+      P  E++         +++L+P+V  ++F    ++     
Sbjct  188   RLESVLGDSLTCCEID-----PAGEDMVSCCLQSWAWASLTPAVIAQMF--STADRVEEQ  240

Query  504   QELSPDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSA  325
                +          VT+DN+LS AHTLIQI C D+K  LYD+ R +K CN+QI+Y RF A
Sbjct  241   PIGTRGGGGGTIISVTMDNSLSPAHTLIQIQCGDHKGLLYDVMRIVKDCNIQISYGRFYA  300

Query  324   ANKGQRELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPL  145
             +  G+ E+D+F    +G+KILD  +Q +LC  L++EL  PL V + NRGPDTELLVANP+
Sbjct  301   SQNGRCEIDLFAVQSDGKKILDQHRQRALCCRLRMELRRPLHVALVNRGPDTELLVANPV  360

Query  144   ELSG-MGR---------PRVFYDVTFALKTLG  79
             E+SG +GR          R+F D +  L+  G
Sbjct  361   EVSGRVGRWCSTTSPLLSRIFRDESSWLRLGG  392



>ref|XP_001756159.1| predicted protein [Physcomitrella patens]
 gb|EDQ79025.1| predicted protein [Physcomitrella patens]
Length=422

 Score =   302 bits (774),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 158/372 (42%), Positives = 224/372 (60%), Gaps = 9/372 (2%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             D+ VV++ G  PGDP  IT+NC DK+GLGC++ RI+ +FGL++ KGD+STDGRWC+V +W
Sbjct  6     DEYVVVRRGRNPGDPSEITINCPDKVGLGCDLARIVFEFGLSVTKGDMSTDGRWCFVALW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLP-SPKTPATSSYLMTLYCIG-RTGLLHD  811
             V P+S    V W+ LK RL  VCP     I  P SP  P     L+   C   RTGLLHD
Sbjct  66    VTPRSRPSTVRWSLLKQRLEDVCPSALASILTPVSPPVPEAKRVLLLQVCSSDRTGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             V Q L E EL I ++KV T+PD R +D+F + D+      K++ EE+  QL+  LGE C 
Sbjct  126   VAQKLWEMELTIHKIKVSTSPDGRAVDLFFVTDNRNKQPWKKRAEEVTNQLKEFLGEPCS  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFR---CELSENETHLQEL-SPDVMKLKKSI  463
              CE+ L   G     L CF  L  ++T ++F        +  T  +++ S       + +
Sbjct  186   LCEISLA--GSECGGLTCF-PLPATITKDIFYEDPATFEKGNTKSEKINSRSEHHANEVV  242

Query  462   VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQH  283
             VT++N+ S  H+L+Q++C   KS LYD  R +K  ++++ + R      G  E+ +FV  
Sbjct  243   VTVENSTSPVHSLVQLTCKSRKSLLYDCLRTVKDFSLKVAHGRIGMLENGNSEISLFVLG  302

Query  282   KNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDV  103
              +G++I + + Q SL  C++ E+ HP+R+ +  RGPDTELLVA P+E  G GRPRV YDV
Sbjct  303   PSGQRITNVQDQKSLAQCVEEEVGHPVRIKVGTRGPDTELLVATPIEKCGRGRPRVLYDV  362

Query  102   TFALKTLGICIF  67
             T ALK L ICIF
Sbjct  363   TLALKMLDICIF  374



>ref|XP_010098797.1| hypothetical protein L484_022562 [Morus notabilis]
 gb|EXB75885.1| hypothetical protein L484_022562 [Morus notabilis]
Length=412

 Score =   299 bits (766),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 178/378 (47%), Positives = 235/378 (62%), Gaps = 25/378 (7%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + +D V+I+   K G P  IT+NC DK GLGC++CRIIL FGL+I KGDVSTDG+WCY+V
Sbjct  4     LQEDVVIIRQSEKEGAPTEITINCPDKTGLGCDLCRIILFFGLSIVKGDVSTDGKWCYLV  63

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPP---YSNLIYLPS----PKTPATSSYLMTLYCIG  832
              WV  +S T    W  LK RL   CP     S + +  S    PK P    +L+TL C  
Sbjct  64    FWVIGKSET---RWNLLKRRLVEACPSCFSASEISFFRSEVRPPKPPDV--FLLTLCCHD  118

Query  831   RTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRA  652
             R GLLHDVT+ LCE EL I++VKV TTPD R +++F I D  ELL+  E+++E  E L A
Sbjct  119   RRGLLHDVTRVLCEFELTIKKVKVSTTPDGRAINMFFITDTRELLHTNERRKETRECLNA  178

Query  651   VLGESCISCELKLVAPGPLYENLPCFSA---LSPSVTNELFRCELSENETHLQELSPDVM  481
             VLG++ ISC+++ V      E   C  A   L  ++T + F  E+        +L    +
Sbjct  179   VLGDAMISCDVEKVGS----EITACSQASSFLPSAITEDTFVLEMP------NQLPSGTL  228

Query  480   KLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
                   +  DN LS +HTL+QI C D+K  LYDI R LK  N+QI+Y RF+   + Q E+
Sbjct  229   TSSSVSIAFDNLLSPSHTLVQIICQDHKGLLYDIMRTLKEYNIQISYGRFTVKQRRQCEI  288

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             D+F+   +G+KI+DP KQ SL   L++ELL PLRV + +RGP+TEL V NP+ELSG GRP
Sbjct  289   DLFIMQVDGKKIVDPSKQKSLASRLRLELLRPLRVAVLSRGPETELFVTNPVELSGKGRP  348

Query  120   RVFYDVTFALKTLGICIF  67
              VFYD+T ALK L   IF
Sbjct  349   LVFYDITLALKMLNTGIF  366



>ref|XP_002968862.1| hypothetical protein SELMODRAFT_270752 [Selaginella moellendorffii]
 gb|EFJ29978.1| hypothetical protein SELMODRAFT_270752 [Selaginella moellendorffii]
Length=406

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 162/377 (43%), Positives = 229/377 (61%), Gaps = 24/377 (6%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             +P + +V+ +   P DP +ITVNC DK GLGC++ RII +FGL++ +GDV TDGRWC +V
Sbjct  4     LPSEELVVIH---PADPTVITVNCPDKRGLGCDLTRIIFEFGLSLVRGDVQTDGRWCLLV  60

Query  990   MWVFPQSSTPI-VTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS---YLMTLYCIGRTG  823
              W  P+ +T   + W  L+ R+ + CPP  N +++P      TS    +L+ +Y   R G
Sbjct  61    FWAVPRITTAKPIQWGLLRKRMIAACPP-ENQVFVPVDPDFVTSPLKLFLLQVYSADRAG  119

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHD+++ L E EL + +VK  T PD +V+D FII D+  LL  +E+  E+CE+++ ++G
Sbjct  120   LLHDMSRILWELELTVHKVKASTCPDGKVIDFFIISDNKLLLPSRERTLEVCERIKNLMG  179

Query  642   ESCISCELKLVAPGPLYENLPCFSALS-PSVTNELFRCELSENETHLQELSPDVMKLKKS  466
                  CELK    GP Y  L C  AL+ P   +EL    ++  +                
Sbjct  180   GLQSKCELK--EAGPEYGGLMCTPALNLPPSVSELLSSGVNSQQNG-----------DTP  226

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAA--NKGQRELDVF  292
              VTID+ LS AHTL+QISC D K  LYD  R LK  N Q+ Y R S +  +KG+ E+D+F
Sbjct  227   RVTIDDLLSPAHTLLQISCRDRKGLLYDCLRVLKDFNYQVAYGRLSMSTIDKGRGEIDLF  286

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             +   +G K++DPEKQ +LC  +  ++ +PL V +  RGPD+EL VA P+ELSG GRPRV 
Sbjct  287   ITQADGRKLVDPEKQKALCERVVRDVANPLWVTVLPRGPDSELFVATPIELSGKGRPRVL  346

Query  111   YDVTFALKTLGICIFSV  61
             YDVT ALK L +CIF  
Sbjct  347   YDVTLALKMLDVCIFQA  363



>ref|XP_002974109.1| hypothetical protein SELMODRAFT_173843 [Selaginella moellendorffii]
 gb|EFJ25064.1| hypothetical protein SELMODRAFT_173843 [Selaginella moellendorffii]
Length=406

 Score =   297 bits (761),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 162/377 (43%), Positives = 229/377 (61%), Gaps = 24/377 (6%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             +P + +V+ +   P DP +ITVNC DK GLGC++ RII +FGL++ +GDV TDGRWC +V
Sbjct  4     LPSEELVVIH---PADPTVITVNCPDKRGLGCDLTRIIFEFGLSLVRGDVQTDGRWCLLV  60

Query  990   MWVFPQSSTPI-VTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS---YLMTLYCIGRTG  823
              W  P+ +T   + W  L+ R+ + CPP  N +++P      TS    +L+ +Y   R G
Sbjct  61    FWAVPRITTAKPIQWGLLRKRMIAACPP-ENQVFVPVDPDFVTSPLKLFLLQVYSADRAG  119

Query  822   LLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLG  643
             LLHD+++ L E EL + +VK  T PD +V+D FII D+  LL  +E+  E+CE+++ ++G
Sbjct  120   LLHDMSRILWELELTVHKVKASTCPDGKVIDFFIISDNKLLLPSRERTLEVCERIKNLMG  179

Query  642   ESCISCELKLVAPGPLYENLPCFSALS-PSVTNELFRCELSENETHLQELSPDVMKLKKS  466
                  CELK    GP Y  L C  AL+ P   +EL    ++  +                
Sbjct  180   GLHSKCELK--EAGPEYGGLMCTPALNLPPSVSELLSSGVNSQQNG-----------DTP  226

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAA--NKGQRELDVF  292
              VTID+ LS AHTL+QISC D K  LYD  R LK  N Q+ Y R S +  +KG+ E+D+F
Sbjct  227   RVTIDDLLSPAHTLLQISCRDRKGLLYDCLRVLKDFNYQVAYGRLSMSTIDKGRGEIDLF  286

Query  291   VQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVF  112
             +   +G K++DPEKQ +LC  +  ++ +PL V +  RGPD+EL VA P+ELSG GRPRV 
Sbjct  287   ITQADGRKLVDPEKQKALCERVVRDVANPLWVTVLPRGPDSELFVATPIELSGKGRPRVL  346

Query  111   YDVTFALKTLGICIFSV  61
             YDVT ALK L +CIF  
Sbjct  347   YDVTLALKMLDVCIFQA  363



>ref|XP_001780363.1| predicted protein [Physcomitrella patens]
 gb|EDQ54817.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 155/375 (41%), Positives = 227/375 (61%), Gaps = 8/375 (2%)
 Frame = -2

Query  1179  FNSMPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWC  1000
               +  D+ VV++ G KP D   IT+NC DK+GLGC++ RI+ +FGL+++KGD+S DGRWC
Sbjct  1     MGAYSDEYVVVRRGKKPEDLSEITINCPDKVGLGCDLARIVFEFGLSVEKGDMSIDGRWC  60

Query  999   YVVMWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLP-SPKTPATSSYLMTLYCIG-RT  826
             +VV+WV P++S   + W+ LK RL  VCP     +  P SP  P     L+   C   RT
Sbjct  61    FVVLWVKPRTSPSTLRWSLLKQRLEDVCPSTLASMLPPVSPPVPECERVLLLQACSSDRT  120

Query  825   GLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVL  646
             GLLHDVTQ L E EL I+++KV T+PD R +D+F + D+   ++ K++ EE+ +QL+  L
Sbjct  121   GLLHDVTQKLWEMELTIKKIKVSTSPDGRAIDLFFVTDNRNQMSCKKRAEEVTKQLKEFL  180

Query  645   GESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKKS  466
             GESC  CE+   +P     +L C S L  S+T ++F     +  T  ++L+         
Sbjct  181   GESCSHCEIGRASPE--CGDLTC-SVLPDSLTRDIF---YDDPSTFEKDLNKGGNHANGV  234

Query  465   IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQ  286
             +V  DN  S  H+L+QI C   K  LYD  RA+K  N+++ Y R    + G+ EL++F+ 
Sbjct  235   VVAFDNNTSPVHSLLQIICKSRKGLLYDCLRAVKDLNLKVAYGRIDILDNGKSELNLFLL  294

Query  285   HKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYD  106
             +    K+ D ++Q  L   +K E+ HP+R+ +  RGP+TELL+A P+E  G GRPRV +D
Sbjct  295   NSKHRKVTDTQEQKVLAQYVKEEVEHPVRIKVETRGPETELLIATPIEKCGRGRPRVLHD  354

Query  105   VTFALKTLGICIFSV  61
              T ALK L ICIF  
Sbjct  355   ATLALKMLDICIFKA  369



>ref|XP_007010016.1| ACT-like superfamily protein isoform 2, partial [Theobroma cacao]
 gb|EOY18826.1| ACT-like superfamily protein isoform 2, partial [Theobroma cacao]
Length=441

 Score =   296 bits (758),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 170/379 (45%), Positives = 233/379 (61%), Gaps = 28/379 (7%)
 Frame = -2

Query  1170  MPDDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVV  991
             + +D +VI    K  D  +I+VNC DK GLGC++CRIIL FGL+I +GD    G+WCYVV
Sbjct  80    LREDVIVISPAEKEEDSTVISVNCPDKTGLGCDLCRIILLFGLSIARGD----GKWCYVV  135

Query  990   MWVFPQSSTPIVTWAKLKDRLWSVCPPYSNL----IYLPSPKTPA-TSSYLMTLYC-IGR  829
             +WV  +++T    W  L+ RL  VCP Y +      Y P+ + P     +L+  +C   R
Sbjct  136   LWVVGKTNT---RWDLLEKRLLEVCPSYFSTSGIDYYQPANQQPKPLDVFLLKFWCSCYR  192

Query  828   TGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAV  649
              GLL+DVT  L E EL I++VKV TTPD +V+D+F I D  ELL+ KE+Q +    L+A 
Sbjct  193   KGLLNDVTLVLFELELTIKKVKVSTTPDGKVMDLFFITDTRELLHTKERQGQTILHLKAA  252

Query  648   LGESCISCELKLVAPGPLYENLPCF---SALSPSVTNELFRCELSENETHLQELSPDVMK  478
             LG+   SCE++ V P    E   C    S L  ++T ++F  EL           P  + 
Sbjct  253   LGDILESCEIESVGP----EITACAQGTSFLPSAITEDMFSLELPAR-------YPGGLL  301

Query  477   LKKSI-VTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
                 I +T+DN LS +HTLIQ+ C D+K  +YDI R LK  N+Q++Y RF A   G  E+
Sbjct  302   ASNPISITVDNTLSPSHTLIQVLCQDHKGLIYDIMRTLKDYNIQVSYGRFFAKQNGGCEM  361

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             D+F+   +G+KI+D  KQ +LC  L++EL  PLR+ + +RGPDTELLVANP+ELSG GRP
Sbjct  362   DLFIVQADGKKIVDRNKQNALCSRLRMELWRPLRLAVVSRGPDTELLVANPVELSGRGRP  421

Query  120   RVFYDVTFALKTLGICIFS  64
              VF+D+T ALK L   IFS
Sbjct  422   LVFHDITLALKNLNTQIFS  440



>gb|AFW74932.1| hypothetical protein ZEAMMB73_542989 [Zea mays]
Length=792

 Score =   304 bits (778),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 169/366 (46%), Positives = 222/366 (61%), Gaps = 49/366 (13%)
 Frame = -2

Query  1029  GDVSTDGRWCYVVMWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YL  853
              DVSTDG WC+VV WV P+SS+  + WA LK+RL S+CP   ++ + P    P  S  YL
Sbjct  8     ADVSTDGHWCFVVFWVVPRSSSIRIRWASLKNRLMSMCPSSYSIPFYPDMSQPGPSQFYL  67

Query  852   MTLYCIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEE  673
             + L    R GLLHDVT  L + EL I RVKV TTPD RV+D+F I D +ELL+ KE+QEE
Sbjct  68    LKLLSPDRKGLLHDVTHILSDLELIIHRVKVSTTPDGRVVDLFFITDGMELLHKKERQEE  127

Query  672   LCEQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQE--  499
              C  L A LG S ISCE+ L A G  ++    FS+L+P +  ELFR EL+ +        
Sbjct  128   TCSTLIAALGPS-ISCEV-LSAEG--FQQ--GFSSLAPKIAEELFRVELAGDGEMCSSSL  181

Query  498   LSPDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQIT--------  343
             +S ++ K++ + +  DN+LS AHTL+QI C D K  +YDI R +K CN+Q+         
Sbjct  182   ISAELKKVQTATINFDNSLSPAHTLVQIICADQKGLIYDILRTMKDCNIQVAAVVVYTYS  241

Query  342   -------------------------YARFSA-------ANKGQRELDVFVQHKNGEKILD  259
                                      Y RF +        +KG RE+D+FV+  +G+K+ D
Sbjct  242   SQNGRNSACLSAATSYTRCTALQIFYGRFRSDKKGGRPGSKGCREVDLFVKQVDGKKVTD  301

Query  258   PEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALKTLG  79
             PEKQ +L   L+ E+LHPLRV++ +RGPDTELLVANP+EL G GRPRVFYD T ALK LG
Sbjct  302   PEKQDALRARLRSEMLHPLRVMVVSRGPDTELLVANPVELCGKGRPRVFYDATLALKALG  361

Query  78    ICIFSV  61
             +CIFS 
Sbjct  362   VCIFSA  367



>gb|EMS57585.1| hypothetical protein TRIUR3_30023 [Triticum urartu]
Length=366

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/289 (52%), Positives = 200/289 (69%), Gaps = 7/289 (2%)
 Frame = -2

Query  924  SVCPPYSNLIYLPSPKTPATSS-YLMTLYCIGRTGLLHDVTQFLCECELYIERVKVITTP  748
            ++CP    + + P    P     YL+ L+   R GLLHDVT  L E E  I+RVKV TTP
Sbjct  2    AMCPSSYAIPFYPEITEPGPPQFYLLKLFSTDRRGLLHDVTHILSELEFIIQRVKVSTTP  61

Query  747  DDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCISCELKLVAPGPLYENLPCFSA  568
            D RV+++F I D +ELL+ KE+QEE+C  L A LG S ++CE+ L A G  ++    FS+
Sbjct  62   DGRVVNLFFITDGMELLHTKERQEEICSMLIATLGPS-LTCEI-LSAEG--FQQ--GFSS  115

Query  567  LSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFL  388
            L P+++ ELFR EL E E+    L  ++ K++K+ +  DN LS AHTL+QI CVD K  L
Sbjct  116  LPPTISEELFRLELDECESSSGPLCAEMKKVQKATINFDNTLSPAHTLLQILCVDQKGLL  175

Query  387  YDITRALKGCNVQITYARFSAANKGQRELDVFVQHKNGEKILDPEKQASLCYCLKVELLH  208
            YD+ R LK CN+++TY RF +  KG RE+D+F++  +G+K++DPEKQ +L   ++ E+LH
Sbjct  176  YDMLRTLKDCNIKVTYGRFWSDKKGFREVDLFIKQADGKKVIDPEKQDALRSRMRSEMLH  235

Query  207  PLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALKTLGICIFSV  61
            PLRV+I NRGPDTELLVANP+EL+G GRPRVFYD T ALK LGICIFS 
Sbjct  236  PLRVMIVNRGPDTELLVANPVELAGKGRPRVFYDATLALKALGICIFSA  284



>ref|XP_008779027.1| PREDICTED: uncharacterized protein LOC103698750 isoform X2 [Phoenix 
dactylifera]
Length=364

 Score =   290 bits (742),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 160/328 (49%), Positives = 205/328 (63%), Gaps = 19/328 (6%)
 Frame = -2

Query  1023  VSTDGRWCYVVMWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPS------PKTPATS  862
             +STDG+WCY++ WV  +       W  LK RL   CP  S+L+ + S           + 
Sbjct  1     MSTDGKWCYILFWVVERGKKA-TRWGLLKKRLLGACPVASSLLGMDSYYHGQLETEHQSQ  59

Query  861   SYLMTLYCIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEK  682
              +L+   C  R GLLHDVTQ LCE EL I RVKV TTPD +V+D+F I D  ELL+ K +
Sbjct  60    VFLLKFSCYDRLGLLHDVTQVLCELELTIRRVKVSTTPDGKVMDLFFITDTRELLHTKSR  119

Query  681   QEELCEQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQ  502
             ++E C QL+AVLG+   SC+++ VA   +   L   S+L  SV  E+F  EL +      
Sbjct  120   RDETCAQLKAVLGDFMTSCDIE-VASSEVAACLLASSSLPYSVMEEMFNLELPDE-----  173

Query  501   ELSPDVMKLKKS---IVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARF  331
                P    L  S    V +DN LS AHTLIQ+ C D+KS LYDI RALK  N+QI+Y RF
Sbjct  174   ---PSTGSLPTSNNPSVIMDNTLSPAHTLIQLYCHDHKSLLYDIMRALKDYNIQISYGRF  230

Query  330   SAANKGQRELDVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVAN  151
              A++    E+D+FV   +G+KI+DP KQ +LC  L +EL  PLRV++ NRGPDTELLVAN
Sbjct  231   YASHNENCEIDLFVTQIDGKKIVDPNKQKALCDRLTMELSRPLRVMVVNRGPDTELLVAN  290

Query  150   PLELSGMGRPRVFYDVTFALKTLGICIF  67
             P+ELSG GRP VFYD+T ALK LG CIF
Sbjct  291   PVELSGKGRPLVFYDITLALKMLGTCIF  318



>gb|AFW74933.1| hypothetical protein ZEAMMB73_542989 [Zea mays]
Length=972

 Score =   304 bits (779),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 169/366 (46%), Positives = 222/366 (61%), Gaps = 49/366 (13%)
 Frame = -2

Query  1029  GDVSTDGRWCYVVMWVFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSS-YL  853
              DVSTDG WC+VV WV P+SS+  + WA LK+RL S+CP   ++ + P    P  S  YL
Sbjct  8     ADVSTDGHWCFVVFWVVPRSSSIRIRWASLKNRLMSMCPSSYSIPFYPDMSQPGPSQFYL  67

Query  852   MTLYCIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEE  673
             + L    R GLLHDVT  L + EL I RVKV TTPD RV+D+F I D +ELL+ KE+QEE
Sbjct  68    LKLLSPDRKGLLHDVTHILSDLELIIHRVKVSTTPDGRVVDLFFITDGMELLHKKERQEE  127

Query  672   LCEQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQE--  499
              C  L A LG S ISCE+ L A G  ++    FS+L+P +  ELFR EL+ +        
Sbjct  128   TCSTLIAALGPS-ISCEV-LSAEG--FQQ--GFSSLAPKIAEELFRVELAGDGEMCSSSL  181

Query  498   LSPDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQIT--------  343
             +S ++ K++ + +  DN+LS AHTL+QI C D K  +YDI R +K CN+Q+         
Sbjct  182   ISAELKKVQTATINFDNSLSPAHTLVQIICADQKGLIYDILRTMKDCNIQVAAVVVYTYS  241

Query  342   -------------------------YARFSA-------ANKGQRELDVFVQHKNGEKILD  259
                                      Y RF +        +KG RE+D+FV+  +G+K+ D
Sbjct  242   SQNGRNSACLSAATSYTRCTALQIFYGRFRSDKKGGRPGSKGCREVDLFVKQVDGKKVTD  301

Query  258   PEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTFALKTLG  79
             PEKQ +L   L+ E+LHPLRV++ +RGPDTELLVANP+EL G GRPRVFYD T ALK LG
Sbjct  302   PEKQDALRARLRSEMLHPLRVMVVSRGPDTELLVANPVELCGKGRPRVFYDATLALKALG  361

Query  78    ICIFSV  61
             +CIFS 
Sbjct  362   VCIFSA  367



>ref|XP_001780567.1| predicted protein [Physcomitrella patens]
 gb|EDQ54661.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 153/380 (40%), Positives = 224/380 (59%), Gaps = 15/380 (4%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             D+ VV++ G   GDP  +T+NC DK+GLGC++ R++ +FGL++ KGD+STDGRWC+V +W
Sbjct  6     DEYVVVRKGKNLGDPSEVTINCPDKVGLGCDLARVVFEFGLSVTKGDISTDGRWCFVALW  65

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPY--SNLIYLPSPKTPATSSYLMTLYCIGRTGLLHD  811
             V P+S+  +V W+ LK RL  VCP    S L  +  P+  +    L+ +    RTGLLHD
Sbjct  66    VIPRSNPSVVRWSLLKQRLEDVCPSALGSMLPTVAPPRLESKKILLLQVRSSDRTGLLHD  125

Query  810   VTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCI  631
             V Q L E EL I ++KV T+PD R +D+F + D+      K++ EE+ ++L+  LGE C 
Sbjct  126   VAQKLWEMELTIHKIKVSTSPDGRAIDLFFVTDNRNKDPWKKRAEEVTKELKEFLGEPCS  185

Query  630   SCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETHLQELSPDVMKLKK------  469
              CE+ L   GP    L C S L  S+T ++F  + +  E        D    +K      
Sbjct  186   HCEISLA--GPECGGLTC-SPLPASLTKDIFYDDPANFEKDYITSEKDHTNSEKDHIRSE  242

Query  468   ----SIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQREL  301
                 ++  ++N  S  H+L+Q++C   K  LYD  R +K  N+Q+ + R +    G  E+
Sbjct  243   CHDNNVFIVENNTSPIHSLLQLNCKSRKGLLYDCLRTVKDFNLQVAHGRIAMMENGNSEI  302

Query  300   DVFVQHKNGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRP  121
             +V+V   NG++I D ++Q  L   L+ E+ HP+R+ +  RGPDTELLVA  +E  G GRP
Sbjct  303   NVYVLGPNGQRITDLQEQKVLVQSLEEEVGHPVRIKVGTRGPDTELLVATSIEKCGRGRP  362

Query  120   RVFYDVTFALKTLGICIFSV  61
             RV YDVT ALK L ICIF  
Sbjct  363   RVLYDVTLALKMLDICIFKA  382



>emb|CAN66473.1| hypothetical protein VITISV_029959 [Vitis vinifera]
Length=462

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 166/372 (45%), Positives = 220/372 (59%), Gaps = 52/372 (14%)
 Frame = -2

Query  1164  DDSVVIQNGNKPGDPYMITVNCLDKLGLGCEICRIILDFGLNIKKGDVSTDGRWCYVVMW  985
             +D V+I+   KPGDP  ITVNC DK GLGC++CRIIL FGL+I +G +S           
Sbjct  8     EDVVLIRQAEKPGDPAEITVNCPDKTGLGCDLCRIILQFGLSITRGGIS-----------  56

Query  984   VFPQSSTPIVTWAKLKDRLWSVCPPYSNLIYLPSPKTPATSSYLMTLYCI-GRTGLLHDV  808
                                      Y    +   PK P    +L+  +C   R GLLHDV
Sbjct  57    -------------------------YYKPEFQQQPKPPDV--FLLKFWCYHDRKGLLHDV  89

Query  807   TQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIKEKQEELCEQLRAVLGESCIS  628
             T+ LCE EL I+RVKV T PD RV+D+F + D    L+ K++QE+   +L+AVLG++ +S
Sbjct  90    TEVLCELELTIKRVKVSTAPDGRVMDLFFVTDTRNELHTKKRQEDTIHRLKAVLGDAMMS  149

Query  627   CELKLVAPGPLYENLPCF---SALSPSVTNELFRCELSENETHLQELSPDVMKLKKSIVT  457
              E++L  P    E   C    S L P++T E+F  EL    ++    S  +       VT
Sbjct  150   VEIELAGP----EVTACSQGSSFLPPAITEEIFSLELPNERSNGSAASNSLS------VT  199

Query  456   IDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFSAANKGQRELDVFVQHKN  277
             +DN+LS +HTLIQI C D+K  +YDI R LK  N+Q +Y RFSA  KG  E D+ V+  +
Sbjct  200   MDNSLSPSHTLIQIICQDHKGLIYDIMRTLKDYNIQTSYGRFSANAKGMCEADLLVRQVD  259

Query  276   GEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVANPLELSGMGRPRVFYDVTF  97
             G+KI+DP K+ +L   L++EL  PLRV + +RGPDTELLVANP+ELSG GRP VFYD+T 
Sbjct  260   GKKIVDPNKRNALSSRLRMELFRPLRVAVRSRGPDTELLVANPVELSGRGRPLVFYDITL  319

Query  96    ALKTLGICIFSV  61
             ALK L I IFSV
Sbjct  320   ALKLLNIQIFSV  331



>gb|AFK39862.1| unknown [Medicago truncatula]
Length=339

 Score =   287 bits (734),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/270 (53%), Positives = 192/270 (71%), Gaps = 4/270 (1%)
 Frame = -2

Query  867  TSSYLMTLYCIGRTGLLHDVTQFLCECELYIERVKVITTPDDRVLDVFIIKDHLELLNIK  688
              S L+ ++ I + GLLHD+ + LC  +L I+RVKV+ TPD R LD+F I D +EL + K
Sbjct  26   AESSLLKVWIIDQKGLLHDINEILCNLQLTIQRVKVMPTPDGRALDLFFITDEMELFHTK  85

Query  687  EKQEELCEQLRAVLGESCISCELKLVAPGPLYENLPCFSALSPSVTNELFRCELSENETH  508
            E+++++C+ L   LGE CIS EL+L   GP Y +L  FS+L P+ + ELF  EL  ++  
Sbjct  86   ERRDDVCQYLSEALGERCISSELQLA--GPEYGHLQGFSSLPPAYSEELFGPELV-DKVS  142

Query  507  LQELSPDVMKLKKSIVTIDNALSSAHTLIQISCVDYKSFLYDITRALKGCNVQITYARFS  328
            L  LS D+  LK   VT+DN+LSS HTL+QI CVD KS  YD+ R  K  ++++ Y RF+
Sbjct  143  LHPLSQDMTTLKTPTVTVDNSLSSVHTLLQIQCVDQKSLCYDLMRISKDSDIKVAYGRFN  202

Query  327  AANKGQRELDVFVQHK-NGEKILDPEKQASLCYCLKVELLHPLRVVISNRGPDTELLVAN  151
            ++ KG + +D+FVQ K +G+KI+DPE+  +LC CLK E+LHPLRV+I NRGPD ELLVAN
Sbjct  203  SSAKGFQNIDLFVQQKEDGQKIIDPERLKTLCTCLKEEMLHPLRVIIVNRGPDIELLVAN  262

Query  150  PLELSGMGRPRVFYDVTFALKTLGICIFSV  61
            P+ELSG GRPRVFYDVT ALK LG+ IFS 
Sbjct  263  PVELSGKGRPRVFYDVTLALKALGVFIFSA  292



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2953106737764