BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14613_g1_i2 len=2594 path=[1:0-352 354:353-1680 1682:1681-2593]

Length=2594
                                                                      Score     E

ref|XP_009587776.1|  PREDICTED: protease Do-like 2, chloroplastic...   1028   0.0      
ref|XP_009768575.1|  PREDICTED: protease Do-like 2, chloroplastic...   1022   0.0      
ref|XP_009768576.1|  PREDICTED: protease Do-like 2, chloroplastic...   1011   0.0      
ref|XP_009587778.1|  PREDICTED: protease Do-like 2, chloroplastic...    991   0.0      
ref|XP_009768577.1|  PREDICTED: protease Do-like 2, chloroplastic...    984   0.0      
ref|XP_009631856.1|  PREDICTED: protease Do-like 2, chloroplastic...    983   0.0      
ref|XP_011082504.1|  PREDICTED: protease Do-like 2, chloroplastic       981   0.0      
ref|XP_009631857.1|  PREDICTED: protease Do-like 2, chloroplastic...    976   0.0      
ref|XP_009773293.1|  PREDICTED: protease Do-like 2, chloroplastic       976   0.0      
ref|XP_006366368.1|  PREDICTED: protease Do-like 2, chloroplastic...    974   0.0      
ref|XP_004247469.1|  PREDICTED: protease Do-like 2, chloroplastic       972   0.0      
ref|XP_006352801.1|  PREDICTED: protease Do-like 2, chloroplastic...    969   0.0      
ref|XP_011079745.1|  PREDICTED: protease Do-like 2, chloroplastic       964   0.0      
ref|XP_010323029.1|  PREDICTED: protease Do-like 2, chloroplastic       949   0.0      
ref|XP_006444216.1|  hypothetical protein CICLE_v10019366mg             938   0.0      
ref|XP_006479864.1|  PREDICTED: protease Do-like 2, chloroplastic...    936   0.0      
ref|XP_007200306.1|  hypothetical protein PRUPE_ppa002853mg             936   0.0      
ref|XP_002520690.1|  serine endopeptidase degp2, putative               934   0.0      Ricinus communis
ref|XP_007050776.1|  DEGP protease 2 isoform 1                          931   0.0      
ref|XP_011033618.1|  PREDICTED: protease Do-like 2, chloroplastic       929   0.0      
ref|XP_007050777.1|  DEGP protease 2 isoform 2                          927   0.0      
ref|XP_002270247.1|  PREDICTED: protease Do-like 2, chloroplastic       925   0.0      Vitis vinifera
ref|XP_010545055.1|  PREDICTED: protease Do-like 2, chloroplastic       923   0.0      
ref|XP_008451432.1|  PREDICTED: protease Do-like 2, chloroplastic       922   0.0      
ref|XP_010941774.1|  PREDICTED: protease Do-like 2, chloroplastic       920   0.0      
ref|XP_004290719.1|  PREDICTED: protease Do-like 2, chloroplastic...    920   0.0      
emb|CBI32271.3|  unnamed protein product                                919   0.0      
ref|XP_004148888.1|  PREDICTED: protease Do-like 2, chloroplastic...    917   0.0      
ref|XP_008386612.1|  PREDICTED: protease Do-like 2, chloroplastic       914   0.0      
ref|XP_008368916.1|  PREDICTED: protease Do-like 2, chloroplastic       913   0.0      
ref|XP_010070002.1|  PREDICTED: protease Do-like 2, chloroplastic       910   0.0      
ref|XP_010684757.1|  PREDICTED: protease Do-like 2, chloroplastic...    909   0.0      
ref|XP_010041338.1|  PREDICTED: protease Do-like 2, chloroplastic       907   0.0      
ref|XP_011011013.1|  PREDICTED: LOW QUALITY PROTEIN: protease Do-...    905   0.0      
ref|XP_010247118.1|  PREDICTED: protease Do-like 2, chloroplastic       905   0.0      
ref|XP_008800525.1|  PREDICTED: protease Do-like 2, chloroplastic       904   0.0      
ref|XP_006397989.1|  hypothetical protein EUTSA_v10001363mg             904   0.0      
gb|KDP28079.1|  hypothetical protein JCGZ_13850                         902   0.0      
gb|KFK37547.1|  hypothetical protein AALP_AA4G271000                    896   0.0      
ref|XP_006295823.1|  hypothetical protein CARUB_v10024950mg             895   0.0      
ref|XP_008235077.1|  PREDICTED: protease Do-like 2, chloroplastic       894   0.0      
ref|NP_001118544.1|  DegP2 protease                                     894   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_566115.1|  DegP2 protease                                        893   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118165.1|  PREDICTED: protease Do-like 2, chloroplastic       892   0.0      
ref|XP_010518514.1|  PREDICTED: protease Do-like 2, chloroplastic...    892   0.0      
pdb|4FLN|A  Chain A, Crystal Structure Of Plant Protease Deg2           892   0.0      
ref|XP_010518515.1|  PREDICTED: protease Do-like 2, chloroplastic...    891   0.0      
gb|KFK37548.1|  hypothetical protein AALP_AA4G271000                    891   0.0      
ref|XP_010507830.1|  PREDICTED: protease Do-like 2, chloroplastic       890   0.0      
ref|XP_010506841.1|  PREDICTED: protease Do-like 2, chloroplastic       887   0.0      
ref|XP_002882138.1|  hypothetical protein ARALYDRAFT_483986             884   0.0      
ref|XP_009384166.1|  PREDICTED: protease Do-like 2, chloroplastic       883   0.0      
ref|XP_003536894.1|  PREDICTED: protease Do-like 2, chloroplastic...    883   0.0      
ref|XP_004495997.1|  PREDICTED: protease Do-like 2, chloroplastic...    881   0.0      
ref|XP_003520225.1|  PREDICTED: protease Do-like 2, chloroplastic...    880   0.0      
ref|XP_006855396.1|  hypothetical protein AMTR_s00057p00143260          875   0.0      
emb|CDY55521.1|  BnaA04g29470D                                          868   0.0      
ref|XP_010684759.1|  PREDICTED: protease Do-like 2, chloroplastic...    868   0.0      
gb|KEH43264.1|  DegP protease                                           868   0.0      
emb|CDY27464.1|  BnaC04g51050D                                          867   0.0      
ref|XP_002321037.1|  putative DegP2 protease family protein             858   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006588605.1|  PREDICTED: protease Do-like 2, chloroplastic...    855   0.0      
ref|XP_006389663.1|  hypothetical protein POPTR_0020s00220g             837   0.0      
gb|KHN03752.1|  Protease Do-like 2, chloroplastic                       834   0.0      
gb|AIA26574.1|  serine protease                                         832   0.0      
ref|XP_002863059.1|  hypothetical protein ARALYDRAFT_497185             823   0.0      
gb|KHN46596.1|  Protease Do-like 2, chloroplastic                       822   0.0      
emb|CDP03552.1|  unnamed protein product                                815   0.0      
ref|XP_006352803.1|  PREDICTED: protease Do-like 2, chloroplastic...    807   0.0      
ref|NP_001146551.1|  hypothetical protein                               808   0.0      Zea mays [maize]
ref|XP_006352802.1|  PREDICTED: protease Do-like 2, chloroplastic...    804   0.0      
ref|XP_004960292.1|  PREDICTED: protease Do-like 2, chloroplastic...    807   0.0      
ref|XP_002439270.1|  hypothetical protein SORBIDRAFT_09g003540          805   0.0      Sorghum bicolor [broomcorn]
ref|XP_006654043.1|  PREDICTED: protease Do-like 2, chloroplastic...    801   0.0      
gb|AAT93972.1|  putative DegP2 protease                                 798   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ90870.1|  predicted protein                                      797   0.0      
ref|XP_006352804.1|  PREDICTED: protease Do-like 2, chloroplastic...    792   0.0      
ref|XP_007050778.1|  DEGP protease 2 isoform 3                          782   0.0      
ref|XP_010233342.1|  PREDICTED: protease Do-like 2, chloroplastic       765   0.0      
gb|EPS74298.1|  hypothetical protein M569_00454                         728   0.0      
gb|EMS54752.1|  Protease Do-like 2, chloroplastic                       731   0.0      
gb|EMT00922.1|  Protease Do-like 2, chloroplastic                       721   0.0      
gb|AFW57620.1|  hypothetical protein ZEAMMB73_444319                    690   0.0      
ref|XP_007144565.1|  hypothetical protein PHAVU_007G1665001g            586   0.0      
ref|XP_007144564.1|  hypothetical protein PHAVU_007G1665001g            580   0.0      
ref|XP_002985706.1|  hypothetical protein SELMODRAFT_122577             570   0.0      
ref|XP_002974405.1|  hypothetical protein SELMODRAFT_100929             559   0.0      
ref|XP_009587779.1|  PREDICTED: protease Do-like 2, chloroplastic...    560   0.0      
ref|XP_001753311.1|  predicted protein                                  560   0.0      
ref|XP_006470390.1|  PREDICTED: protease Do-like 9-like                 541   3e-179   
ref|XP_002948745.1|  hypothetical protein VOLCADRAFT_58517              536   1e-178   
ref|XP_006446449.1|  hypothetical protein CICLE_v10014711mg             538   6e-178   
ref|XP_002968921.1|  hypothetical protein SELMODRAFT_90340              536   2e-177   
ref|XP_002989968.1|  hypothetical protein SELMODRAFT_130891             535   3e-177   
gb|KDP31134.1|  hypothetical protein JCGZ_11510                         533   3e-176   
ref|XP_010111735.1|  Protease Do-like 9                                 533   5e-176   
ref|XP_006376843.1|  hypothetical protein POPTR_0012s07930g             528   2e-174   
ref|XP_006339987.1|  PREDICTED: protease Do-like 9-like                 529   2e-174   
ref|XP_011071819.1|  PREDICTED: protease Do-like 9 isoform X2           525   4e-174   
ref|XP_011015595.1|  PREDICTED: protease Do-like 9                      527   6e-174   
ref|XP_002321577.2|  hypothetical protein POPTR_0015s08440g             525   3e-173   Populus trichocarpa [western balsam poplar]
ref|XP_002982828.1|  hypothetical protein SELMODRAFT_116969             522   5e-173   
emb|CDP16995.1|  unnamed protein product                                525   7e-173   
ref|XP_010678720.1|  PREDICTED: protease Do-like 9                      525   7e-173   
ref|XP_004252189.1|  PREDICTED: protease Do-like 9                      524   2e-172   
ref|XP_011044336.1|  PREDICTED: protease Do-like 9                      523   2e-172   
ref|XP_009794183.1|  PREDICTED: protease Do-like 9                      522   9e-172   
ref|XP_009379979.1|  PREDICTED: protease Do-like 9                      522   9e-172   
ref|XP_002981859.1|  hypothetical protein SELMODRAFT_154815             517   2e-171   
ref|XP_009609751.1|  PREDICTED: protease Do-like 9                      521   2e-171   
ref|XP_003608950.1|  hypothetical protein MTR_4g106730                  521   5e-171   
ref|XP_009348028.1|  PREDICTED: protease Do-like 9                      519   8e-171   
ref|XP_007140930.1|  hypothetical protein PHAVU_008G153200g             518   2e-170   
ref|XP_010254385.1|  PREDICTED: protease Do-like 9                      518   4e-170   
ref|XP_008341479.1|  PREDICTED: protease Do-like 9                      517   4e-170   
ref|XP_009349861.1|  PREDICTED: protease Do-like 9                      517   7e-170   
gb|KCW49312.1|  hypothetical protein EUGRSUZ_K02868                     513   7e-170   
ref|XP_002511438.1|  serine endopeptidase degp2, putative               517   7e-170   Ricinus communis
ref|XP_009349862.1|  PREDICTED: protease Do-like 9                      516   8e-170   
ref|XP_007031392.1|  Protease Do-like 9 isoform 1                       517   1e-169   
ref|XP_002517376.1|  serine endopeptidase degp2, putative               517   1e-169   Ricinus communis
ref|XP_003057446.1|  predicted protein                                  511   3e-169   
ref|XP_010037587.1|  PREDICTED: protease Do-like 9                      515   6e-169   
gb|KFM26933.1|  Protease Do-like 9                                      509   2e-168   
ref|XP_007217173.1|  hypothetical protein PRUPE_ppa003383mg             513   3e-168   
ref|XP_008230647.1|  PREDICTED: protease Do-like 9                      512   3e-168   
gb|KHN18478.1|  Protease Do-like 9                                      508   4e-168   
ref|XP_005649879.1|  trypsin-like serine protease                       509   4e-168   
ref|XP_007216372.1|  hypothetical protein PRUPE_ppa021785mg             511   4e-168   
ref|XP_010450719.1|  PREDICTED: protease Do-like 9                      513   6e-168   
ref|XP_002511437.1|  serine endopeptidase degp2, putative               510   6e-168   Ricinus communis
ref|XP_005850048.1|  hypothetical protein CHLNCDRAFT_34342              513   7e-168   
ref|XP_003525265.1|  PREDICTED: protease Do-like 9-like                 512   7e-168   
ref|XP_006283387.1|  hypothetical protein CARUB_v10004432mg             512   1e-167   
ref|XP_002868670.1|  hypothetical protein ARALYDRAFT_493972             512   1e-167   
ref|XP_006655949.1|  PREDICTED: protease Do-like 9-like                 508   2e-167   
ref|XP_007031393.1|  Protease Do-like 9 isoform 2                       511   2e-167   
ref|XP_010678716.1|  PREDICTED: protease Do-like 9 isoform X1           507   3e-167   
ref|XP_010029214.1|  PREDICTED: protease Do-like 9                      511   3e-167   
ref|XP_011087156.1|  PREDICTED: protease Do-like 9                      510   3e-167   
ref|XP_010928580.1|  PREDICTED: protease Do-like 9                      510   3e-167   
ref|NP_001057235.1|  Os06g0234100                                       511   6e-167   Oryza sativa Japonica Group [Japonica rice]
gb|KFK33145.1|  hypothetical protein AALP_AA6G336800                    509   8e-167   
ref|XP_003550747.1|  PREDICTED: protease Do-like 9-like                 509   9e-167   
ref|XP_008230646.1|  PREDICTED: protease Do-like 9                      509   9e-167   
emb|CBI34956.3|  unnamed protein product                                505   9e-167   
ref|XP_006476739.1|  PREDICTED: protease Do-like 9-like isoform X1      509   1e-166   
ref|NP_568577.1|  DegP protease 9                                       509   1e-166   Arabidopsis thaliana [mouse-ear cress]
gb|KDP45394.1|  hypothetical protein JCGZ_09643                         509   1e-166   
ref|XP_004298924.1|  PREDICTED: protease Do-like 9-like                 508   1e-166   
emb|CBI15070.3|  unnamed protein product                                504   1e-166   
ref|XP_007155398.1|  hypothetical protein PHAVU_003G198000g             509   2e-166   
ref|XP_004508846.1|  PREDICTED: protease Do-like 9-like                 508   2e-166   
ref|XP_008341480.1|  PREDICTED: protease Do-like 9                      508   4e-166   
emb|CDY53116.1|  BnaCnng24440D                                          508   4e-166   
ref|XP_007036141.1|  Protease Do-like 9 isoform 1                       508   6e-166   
ref|XP_006836679.1|  hypothetical protein AMTR_s00088p00077590          508   6e-166   
emb|CDY44585.1|  BnaA04g10050D                                          507   6e-166   
ref|XP_009139975.1|  PREDICTED: protease Do-like 9                      507   7e-166   
ref|XP_010678718.1|  PREDICTED: protease Do-like 9 isoform X2           503   8e-166   
ref|XP_006405537.1|  hypothetical protein EUTSA_v10027697mg             507   9e-166   
ref|XP_011028602.1|  PREDICTED: protease Do-like 9                      506   1e-165   
ref|XP_002275131.1|  PREDICTED: protease Do-like 9                      506   1e-165   Vitis vinifera
ref|XP_008239730.1|  PREDICTED: protease Do-like 9                      506   1e-165   
ref|XP_002280249.1|  PREDICTED: protease Do-like 9                      506   1e-165   Vitis vinifera
emb|CAN74170.1|  hypothetical protein VITISV_013882                     506   1e-165   Vitis vinifera
ref|XP_004306333.1|  PREDICTED: protease Do-like 9-like                 504   2e-165   
ref|XP_003516811.1|  PREDICTED: protease Do-like 9-like                 504   2e-165   
ref|XP_006363999.1|  PREDICTED: protease Do-like 9-like                 506   2e-165   
ref|XP_007514393.1|  predicted protein                                  504   6e-165   
ref|XP_010528270.1|  PREDICTED: protease Do-like 9                      505   7e-165   
ref|XP_008438126.1|  PREDICTED: protease Do-like 9                      504   8e-165   
ref|XP_004152460.1|  PREDICTED: protease Do-like 9-like                 504   8e-165   
ref|XP_004252664.1|  PREDICTED: protease Do-like 9                      504   9e-165   
ref|XP_004306334.1|  PREDICTED: protease Do-like 9-like                 502   1e-164   
ref|XP_009140230.1|  PREDICTED: protease Do-like 9                      504   1e-164   
ref|XP_010254399.1|  PREDICTED: protease Do-like 9 isoform X1           504   1e-164   
ref|XP_004965071.1|  PREDICTED: protease Do-like 9-like                 503   4e-164   
emb|CDY15934.1|  BnaA04g11770D                                          503   4e-164   
ref|XP_010272002.1|  PREDICTED: protease Do-like 9                      499   4e-163   
ref|XP_010913539.1|  PREDICTED: protease Do-like 9 isoform X1           500   5e-163   
ref|XP_009344540.1|  PREDICTED: protease Do-like 9 isoform X2           498   5e-163   
gb|AFW76813.1|  hypothetical protein ZEAMMB73_778886                    500   7e-163   
ref|XP_009344539.1|  PREDICTED: protease Do-like 9 isoform X1           498   9e-163   
ref|XP_008780936.1|  PREDICTED: protease Do-like 9                      499   9e-163   
ref|XP_010111534.1|  Protease Do-like 9                                 499   1e-162   
ref|XP_008647464.1|  PREDICTED: uncharacterized protein LOC100217...    500   1e-162   
ref|XP_003564034.1|  PREDICTED: protease Do-like 9                      499   2e-162   
ref|XP_005644766.1|  trypsin-like serine protease                       494   2e-162   
ref|XP_006439771.1|  hypothetical protein CICLE_v10019344mg             499   2e-162   
ref|XP_001774430.1|  predicted protein                                  493   3e-162   
ref|XP_006649039.1|  PREDICTED: protease Do-like 9-like                 493   5e-162   
gb|EYU46653.1|  hypothetical protein MIMGU_mgv1a0034321mg               486   6e-162   
ref|XP_009609244.1|  PREDICTED: protease Do-like 9                      496   7e-162   
gb|KDD74963.1|  hypothetical protein H632_c960p1                        495   7e-162   
ref|XP_008643959.1|  PREDICTED: uncharacterized protein LOC100381...    496   1e-161   
ref|XP_008348037.1|  PREDICTED: protease Do-like 9                      495   2e-161   
dbj|BAD15737.1|  putative DegP2 protease                                495   2e-161   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87490.1|  hypothetical protein OsI_08898                          495   2e-161   Oryza sativa Indica Group [Indian rice]
gb|KDO66274.1|  hypothetical protein CISIN_1g036586mg                   495   2e-161   
ref|XP_009348035.1|  PREDICTED: protease Do-like 9                      490   3e-161   
ref|XP_004953885.1|  PREDICTED: protease Do-like 9-like                 494   3e-161   
ref|XP_010554015.1|  PREDICTED: protease Do-like 9                      494   9e-161   
ref|XP_008793849.1|  PREDICTED: protease Do-like 9                      493   2e-160   
dbj|BAK07966.1|  predicted protein                                      492   2e-160   
dbj|BAJ90442.1|  predicted protein                                      493   2e-160   
ref|XP_010227815.1|  PREDICTED: protease Do-like 9                      488   5e-160   
ref|XP_011071818.1|  PREDICTED: protease Do-like 9 isoform X1           505   5e-160   
ref|XP_010272003.1|  PREDICTED: protease Do-like 9                      492   5e-160   
ref|XP_002502087.1|  predicted protein                                  484   1e-158   Micromonas commoda
ref|XP_010236126.1|  PREDICTED: protease Do-like 9 isoform X1           488   1e-158   
ref|XP_002452567.1|  hypothetical protein SORBIDRAFT_04g028270          488   1e-158   Sorghum bicolor [broomcorn]
ref|XP_010254417.1|  PREDICTED: protease Do-like 9 isoform X2           487   2e-158   
gb|AFW73360.1|  hypothetical protein ZEAMMB73_819902                    488   2e-158   
gb|KDO69730.1|  hypothetical protein CISIN_1g007213mg                   487   1e-157   
ref|XP_006439769.1|  hypothetical protein CICLE_v10019344mg             483   9e-157   
gb|EPS65237.1|  hypothetical protein M569_09541                         476   3e-156   
gb|KFM29273.1|  Protease Do-like 9                                      478   4e-155   
emb|CEF97941.1|  Serine endopeptidase DegP2                             478   4e-155   
ref|XP_001417982.1|  predicted protein                                  475   6e-154   Ostreococcus lucimarinus CCE9901
ref|XP_003079294.1|  putative DegP2 protease (ISS)                      480   2e-153   
ref|XP_005704064.1|  serine-type endopeptidase isoform 1                474   2e-153   
gb|EMT08042.1|  Protease Do-like protein 9                              472   8e-153   
gb|EMS45662.1|  Protease Do-like 9                                      469   2e-152   
ref|XP_007031394.1|  Protease Do-like 9 isoform 3                       468   1e-151   
ref|XP_002958880.1|  serine protease                                    467   2e-151   
gb|KDO69729.1|  hypothetical protein CISIN_1g007213mg                   469   2e-151   
ref|XP_010678715.1|  PREDICTED: protease Do-like 9                      463   4e-150   
gb|EMT18472.1|  Protease Do-like protein 9                              463   4e-150   
ref|XP_005704063.1|  serine-type endopeptidase isoform 2                464   2e-149   
emb|CBJ48373.1|  conserved unknown protein                              466   2e-149   
gb|KCW56073.1|  hypothetical protein EUGRSUZ_I01831                     463   3e-149   
emb|CAN62736.1|  hypothetical protein VITISV_027750                     459   1e-147   Vitis vinifera
emb|CDX99642.1|  BnaC04g33990D                                          456   2e-146   
ref|XP_008647465.1|  PREDICTED: uncharacterized protein LOC100217...    454   6e-146   
ref|XP_006439767.1|  hypothetical protein CICLE_v10019344mg             451   8e-145   
dbj|BAK01822.1|  predicted protein                                      448   3e-144   
ref|XP_007209088.1|  hypothetical protein PRUPE_ppa003679mg             446   2e-142   
gb|KDO69731.1|  hypothetical protein CISIN_1g007213mg                   442   1e-141   
ref|XP_005537155.1|  DegP protease                                      435   6e-138   
ref|XP_006858733.1|  hypothetical protein AMTR_s00066p00121670          426   1e-134   
gb|KEH24728.1|  DegP protease                                           424   3e-134   
ref|XP_004962074.1|  PREDICTED: protease Do-like 10, mitochondria...    423   1e-133   
gb|EYU42545.1|  hypothetical protein MIMGU_mgv1a0052332mg               415   3e-133   
ref|XP_004489189.1|  PREDICTED: protease Do-like 10, mitochondria...    420   8e-133   
ref|XP_008353481.1|  PREDICTED: protease Do-like 9                      414   1e-132   
gb|EYU39504.1|  hypothetical protein MIMGU_mgv1a003194mg                420   5e-132   
ref|XP_007028414.1|  DegP protease 10 isoform 1                         416   2e-130   
ref|XP_002441105.1|  hypothetical protein SORBIDRAFT_09g020480          415   2e-130   Sorghum bicolor [broomcorn]
gb|KDP32493.1|  hypothetical protein JCGZ_13418                         414   3e-130   
ref|XP_006858734.1|  hypothetical protein AMTR_s00066p00122890          412   4e-130   
ref|XP_007150859.1|  hypothetical protein PHAVU_004G000300g             413   4e-130   
ref|XP_008776774.1|  PREDICTED: protease Do-like 10, mitochondria...    413   6e-130   
gb|EWM29653.1|  protease do-like 9                                      412   7e-130   
ref|XP_010927886.1|  PREDICTED: protease Do-like 10, mitochondrial      412   1e-129   
ref|XP_007211387.1|  hypothetical protein PRUPE_ppa003181mg             413   2e-129   
ref|XP_008647597.1|  PREDICTED: hypothetical protein isoform X1         412   2e-129   
ref|XP_004293434.1|  PREDICTED: protease Do-like 10, mitochondria...    411   2e-129   
ref|XP_010528621.1|  PREDICTED: protease Do-like 10, mitochondrial      412   3e-129   
ref|XP_010277816.1|  PREDICTED: protease Do-like 10, mitochondrial      412   3e-129   
ref|XP_009803816.1|  PREDICTED: protease Do-like 10, mitochondrial      412   4e-129   
ref|XP_009611385.1|  PREDICTED: protease Do-like 10, mitochondrial      412   6e-129   
gb|EEE63742.1|  hypothetical protein OsJ_18561                          410   6e-129   Oryza sativa Japonica Group [Japonica rice]
gb|EWM29652.1|  protease do-like 9                                      413   6e-129   
ref|XP_002463281.1|  hypothetical protein SORBIDRAFT_02g041140          411   6e-129   Sorghum bicolor [broomcorn]
gb|EAY98063.1|  hypothetical protein OsI_19981                          412   1e-128   Oryza sativa Indica Group [Indian rice]
ref|NP_001055560.1|  Os05g0417100                                       411   1e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002265825.2|  PREDICTED: protease Do-like 10, mitochondrial      409   1e-128   Vitis vinifera
ref|XP_008224670.1|  PREDICTED: protease Do-like 10, mitochondrial      410   2e-128   
gb|EMS52153.1|  Protease Do-like 10, mitochondrial                      410   2e-128   
ref|XP_003534464.1|  PREDICTED: protease Do-like 10, mitochondria...    408   2e-128   
ref|XP_011011698.1|  PREDICTED: protease Do-like 10, mitochondrial      409   2e-128   
ref|XP_006353238.1|  PREDICTED: protease Do-like 10, mitochondria...    410   3e-128   
gb|EPR63244.1|  trypsin domain-containing protein                       414   3e-128   
ref|XP_004250091.1|  PREDICTED: protease Do-like 10, mitochondrial      409   7e-128   
ref|XP_011077091.1|  PREDICTED: protease Do-like 10, mitochondrial      409   8e-128   
ref|XP_002370490.1|  trypsin, putative                                  413   1e-127   Toxoplasma gondii ME49
gb|ESS28089.1|  trypsin domain-containing protein                       413   1e-127   
gb|KFH09397.1|  trypsin domain-containing protein                       413   1e-127   
gb|EPT25374.1|  trypsin domain-containing protein                       413   1e-127   
ref|XP_009420477.1|  PREDICTED: protease Do-like 10, mitochondrial      407   2e-127   
ref|XP_003568444.1|  PREDICTED: protease Do-like 10, mitochondrial      407   2e-127   
ref|XP_006655329.1|  PREDICTED: protease Do-like 10, mitochondria...    404   2e-127   
ref|XP_008887060.1|  trypsin domain-containing protein                  412   2e-127   
ref|XP_006448510.1|  hypothetical protein CICLE_v10014700mg             406   5e-127   
ref|XP_010673840.1|  PREDICTED: protease Do-like 10, mitochondrial      406   6e-127   
gb|KHN48612.1|  Protease Do-like 9                                      397   2e-126   
emb|CDJ40717.1|  trypsin, putative                                      404   2e-126   
gb|AET50594.1|  hypothetical protein                                    404   3e-126   
ref|XP_008377055.1|  PREDICTED: protease Do-like 10, mitochondrial      402   1e-125   
ref|XP_002311275.1|  hypothetical protein POPTR_0008s07940g             402   2e-125   
ref|XP_002971553.1|  hypothetical protein SELMODRAFT_62447              397   4e-125   
emb|CDP04134.1|  unnamed protein product                                401   5e-125   
ref|XP_010027457.1|  PREDICTED: protease Do-like 10, mitochondrial      400   5e-125   
gb|KHG11681.1|  hypothetical protein F383_13103                         400   6e-125   
ref|XP_006476740.1|  PREDICTED: protease Do-like 9-like isoform X2      395   6e-125   
ref|XP_002963416.1|  hypothetical protein SELMODRAFT_62730              397   6e-125   
ref|XP_003886416.1|  hypothetical protein NCLIV_068150                  405   7e-125   
ref|XP_004152886.1|  PREDICTED: protease Do-like 10, mitochondria...    401   7e-125   
ref|XP_010440803.1|  PREDICTED: protease Do-like 10, mitochondria...    400   1e-124   
ref|XP_006468667.1|  PREDICTED: protease Do-like 10, mitochondria...    400   1e-124   
ref|XP_002951860.1|  trypsin family                                     399   3e-124   
gb|EMS48865.1|  Protease Do-like 9                                      393   3e-124   
ref|XP_004155122.1|  PREDICTED: protease Do-like 10, mitochondria...    399   4e-124   
ref|XP_010913540.1|  PREDICTED: protease Do-like 9 isoform X2           392   7e-124   
ref|XP_006283411.1|  hypothetical protein CARUB_v10004459mg             397   1e-123   
ref|NP_568543.1|  protease Do-like 10                                   396   4e-123   
ref|XP_002868484.1|  DEGP10                                             395   7e-123   
emb|CDJ68975.1|  trypsin, putative                                      395   8e-123   
ref|XP_010450457.1|  PREDICTED: protease Do-like 10, mitochondrial      395   2e-122   
ref|XP_010435521.1|  PREDICTED: protease Do-like 10, mitochondrial      393   9e-122   
gb|KEH24729.1|  DegP protease                                           387   2e-121   
ref|XP_004344572.1|  DegPtype protease                                  389   9e-121   
emb|CDY53528.1|  BnaCnng25320D                                          389   2e-120   
gb|EEE57793.1|  hypothetical protein OsJ_08344                          382   7e-120   
ref|XP_006405960.1|  hypothetical protein EUTSA_v10027701mg             387   7e-120   
ref|XP_009139697.1|  PREDICTED: protease Do-like 10, mitochondrial      387   8e-120   
gb|ACF84354.1|  unknown                                                 382   1e-119   
ref|XP_010110145.1|  Protease Do-like 10                                385   1e-119   
emb|CDX74606.1|  BnaA04g07830D                                          386   2e-119   
gb|KHN40897.1|  Protease Do-like 10, mitochondrial                      378   3e-118   
ref|XP_002886957.1|  hypothetical protein ARALYDRAFT_894151             379   6e-118   
ref|XP_008348203.1|  PREDICTED: protease Do-like 9                      380   1e-117   
ref|XP_010027524.1|  PREDICTED: protease Do-like 10, mitochondrial      380   1e-117   
dbj|GAM25013.1|  hypothetical protein SAMD00019534_081880               378   3e-117   
ref|XP_010513422.1|  PREDICTED: putative protease Do-like 3, mito...    377   4e-117   
ref|NP_001142088.1|  hypothetical protein                               378   1e-116   
emb|CDR95924.1|  DegP protease, putative                                378   2e-116   
emb|CDP02144.1|  unnamed protein product                                370   6e-116   
ref|XP_006439770.1|  hypothetical protein CICLE_v10019344mg             370   2e-115   
ref|XP_002886956.1|  hypothetical protein ARALYDRAFT_315601             374   3e-115   
ref|XP_006301507.1|  hypothetical protein CARUB_v10021933mg             374   3e-115   
ref|XP_006439772.1|  hypothetical protein CICLE_v10019344mg             367   5e-115   
ref|XP_010511113.1|  PREDICTED: putative protease Do-like 3, mito...    374   6e-115   
ref|XP_010440805.1|  PREDICTED: protease Do-like 10, mitochondria...    373   1e-114   
ref|XP_006391531.1|  hypothetical protein EUTSA_v10019570mg             369   7e-114   
ref|XP_002888435.1|  predicted protein                                  369   1e-113   
gb|KFM27991.1|  Protease Do-like 9                                      373   2e-113   
ref|XP_007028415.1|  DegP protease 10 isoform 2                         369   2e-113   
ref|XP_001610362.1|  DegP protease                                      367   1e-112   
ref|XP_009791860.1|  PREDICTED: protease Do-like 9                      359   7e-112   
ref|XP_004357429.1|  hypothetical protein DFA_02707                     368   9e-112   
gb|EFA82977.1|  hypothetical protein PPL_03755                          365   9e-112   
ref|XP_002499997.1|  predicted protein                                  361   4e-111   
ref|XP_954412.1|  serine protease (zymogen-like)                        363   9e-111   
gb|ABR25659.1|  protease do-2 like                                      349   3e-110   
ref|XP_008441958.1|  PREDICTED: protease Do-like 10, mitochondrial      361   6e-110   
ref|XP_003288812.1|  hypothetical protein DICPUDRAFT_153086             362   6e-110   
ref|XP_010418975.1|  PREDICTED: putative protease Do-like 3, mito...    360   1e-109   
ref|NP_564856.1|  putativeDegP protease 3                               358   3e-109   
ref|XP_004829939.1|  serine protease, putative                          357   3e-109   
ref|XP_010027525.1|  PREDICTED: protease Do-like 10, mitochondria...    357   9e-109   
ref|XP_002286231.1|  trypsin-like serine protease                       355   1e-108   
ref|XP_640805.1|  hypothetical protein DDB_G0281081                     360   1e-108   
sp|Q9SHZ0.1|DEGP4_ARATH  RecName: Full=Protease Do-like 4, mitoch...    353   9e-108   
ref|XP_007028416.1|  DegP protease 10 isoform 3                         353   9e-108   
ref|XP_008776775.1|  PREDICTED: protease Do-like 10, mitochondria...    352   1e-107   
ref|XP_008680676.1|  PREDICTED: protease Do-like 9                      355   2e-107   
ref|XP_010027526.1|  PREDICTED: protease Do-like 10, mitochondria...    352   6e-107   
ref|XP_002154609.2|  PREDICTED: protease Do-like 10, mitochondria...    353   7e-107   
ref|XP_005650005.1|  trypsin-like serine protease                       352   8e-107   
gb|AFW64508.1|  hypothetical protein ZEAMMB73_586209                    352   2e-106   
gb|AFW64507.1|  hypothetical protein ZEAMMB73_586209                    352   3e-106   
ref|XP_009689126.1|  serine protease                                    351   5e-106   
ref|XP_001633828.1|  predicted protein                                  350   6e-106   
emb|CDY07457.1|  BnaA07g25360D                                          347   1e-105   
ref|XP_009105158.1|  PREDICTED: putative protease Do-like 3, mito...    347   1e-105   
ref|NP_001174217.1|  Os05g0147500                                       337   4e-105   
emb|CDI84541.1|  trypsin, putative                                      346   2e-104   
ref|XP_005831529.1|  hypothetical protein GUITHDRAFT_72154              340   3e-104   
ref|XP_009140719.1|  PREDICTED: putative protease Do-like 3, mito...    347   7e-104   
ref|XP_005827715.1|  hypothetical protein GUITHDRAFT_164606             344   1e-103   
ref|XP_006439768.1|  hypothetical protein CICLE_v10019344mg             337   1e-103   
gb|ETO06735.1|  hypothetical protein RFI_30658                          341   1e-103   
emb|CCF73353.1|  unnamed protein product                                342   2e-103   
ref|XP_002946355.1|  trypsin family                                     342   3e-103   
ref|XP_010027559.1|  PREDICTED: protease Do-like 10, mitochondrial      342   4e-103   
emb|CDY35320.1|  BnaA04g15270D                                          338   6e-102   
gb|KDO77071.1|  hypothetical protein CISIN_1g007765mg                   337   6e-102   
gb|KCW54067.1|  hypothetical protein EUGRSUZ_I00047                     334   3e-101   
ref|XP_005779861.1|  hypothetical protein EMIHUDRAFT_430070             336   1e-100   
gb|EJK64737.1|  hypothetical protein THAOC_14498                        340   1e-100   
gb|KDO69732.1|  hypothetical protein CISIN_1g007213mg                   328   2e-100   
ref|XP_002888434.1|  predicted protein                                  332   4e-99    
gb|KCW54069.1|  hypothetical protein EUGRSUZ_I00050                     330   6e-99    
ref|XP_002368468.1|  trypsin, putative                                  340   3e-98    
gb|KFG31101.1|  serine protease                                         338   1e-97    
gb|ESS33926.1|  serine protease                                         338   1e-97    
gb|KFG42321.1|  serine protease                                         338   1e-97    
gb|EPR59808.1|  serine protease                                         338   1e-97    
ref|XP_001689823.1|  DegP-type protease                                 327   2e-96    
ref|XP_003881237.1|  peptidase S1, chymotrypsin:PDZ/DHR/GLGF doma...    335   2e-96    
ref|XP_002866059.1|  predicted protein                                  322   7e-96    
emb|CBX27101.1|  Protease Do-like 10, mitochondrial                     320   2e-95    
ref|XP_008889209.1|  serine protease                                    327   3e-95    
ref|XP_006391532.1|  hypothetical protein EUTSA_v10019834mg             322   5e-95    
ref|XP_001701981.1|  DegP-type protease                                 322   7e-95    
ref|XP_002514764.1|  serine endopeptidase degp2, putative               319   8e-95    
ref|XP_001748733.1|  hypothetical protein                               322   2e-94    
sp|Q9FM41.1|DGP13_ARATH  RecName: Full=Putative protease Do-like 13     316   4e-94    
gb|EYU29924.1|  hypothetical protein MIMGU_mgv1a005009mg                316   6e-94    
emb|CAX68967.1|  periplasmic serine endoprotease of the DegP/Htr ...    315   1e-93    
ref|NP_564857.2|  DegP protease 4                                       312   2e-93    
ref|XP_003055699.1|  predicted protein                                  312   1e-92    
ref|XP_007028418.1|  DegP protease 10 isoform 5                         313   2e-92    
gb|ABE65743.1|  DegP protease                                           309   3e-92    
gb|EYU46652.1|  hypothetical protein MIMGU_mgv1a0034322mg               304   3e-92    
ref|XP_005764176.1|  hypothetical protein EMIHUDRAFT_247734             313   3e-92    
ref|WP_012166589.1|  trypsin                                            311   4e-92    
ref|WP_012168296.1|  trypsin                                            311   8e-92    
gb|AAB60913.1|  F5I14.17 gene product                                   308   2e-91    
ref|WP_011980004.1|  serine protease                                    308   3e-91    
ref|XP_002788904.1|  serine protease, putative                          305   4e-91    
ref|XP_010112729.1|  hypothetical protein L484_020456                   304   8e-91    
ref|XP_010436835.1|  PREDICTED: LOW QUALITY PROTEIN: putative pro...    308   1e-90    
ref|XP_002866058.1|  hypothetical protein ARALYDRAFT_357728             307   2e-90    
ref|WP_038960950.1|  hypothetical protein                               306   4e-90    
dbj|GAK48960.1|  protease, putative                                     305   6e-90    
ref|WP_027353863.1|  hypothetical protein                               305   8e-90    
ref|WP_018060760.1|  hypothetical protein                               304   9e-90    
gb|KCW54014.1|  hypothetical protein EUGRSUZ_I00006                     302   9e-90    
gb|KFG99954.1|  serine protease                                         313   2e-89    
ref|WP_013942997.1|  protease Do-like 10                                303   4e-89    
ref|XP_004989115.1|  hypothetical protein PTSG_09760                    308   4e-89    
gb|KFH12639.1|  trypsin domain-containing protein                       298   3e-88    
ref|XP_005774372.1|  hypothetical protein EMIHUDRAFT_74740              301   2e-87    
ref|WP_008245561.1|  serine protease                                    298   2e-87    
ref|WP_025566621.1|  hypothetical protein                               297   4e-87    
ref|XP_010446115.1|  PREDICTED: putative protease Do-like 3, mito...    297   1e-86    
gb|AFW80833.1|  hypothetical protein ZEAMMB73_088014                    290   1e-86    
ref|WP_008337611.1|  serine protease                                    291   5e-85    
ref|XP_002885149.1|  DEGP12                                             291   1e-84    
ref|NP_568583.1|  DegP protease 13                                      287   3e-84    
ref|WP_033230185.1|  protease                                           288   7e-84    
ref|WP_012861033.1|  serine protease                                    287   2e-83    
ref|XP_010424503.1|  PREDICTED: putative protease Do-like 11, mit...    290   3e-83    
ref|WP_026231170.1|  serine protease                                    286   3e-83    
ref|XP_005714405.1|  unnamed protein product                            287   4e-83    
ref|XP_765845.1|  serine protease                                       284   9e-83    
gb|KFK41004.1|  hypothetical protein AALP_AA2G073000                    284   1e-82    
ref|WP_020414134.1|  hypothetical protein                               285   1e-82    
ref|XP_009038933.1|  hypothetical protein AURANDRAFT_29427              283   3e-82    
gb|AHH80643.1|  protease Do-like 2                                      284   3e-82    
ref|WP_026746190.1|  serine protease                                    281   5e-81    
ref|WP_026749297.1|  serine protease                                    279   2e-80    
ref|XP_007028417.1|  DegP protease 10 isoform 4                         276   2e-80    
ref|WP_021745262.1|  trypsin                                            279   2e-80    
ref|WP_036070981.1|  serine protease                                    279   2e-80    
gb|ERL27330.1|  hypothetical protein HMPREF9108_00073                   279   2e-80    
ref|WP_026239051.1|  serine protease                                    278   4e-80    
ref|XP_005845738.1|  hypothetical protein CHLNCDRAFT_58432              289   5e-80    
ref|WP_036059818.1|  serine protease                                    278   5e-80    
gb|ERK53062.1|  trypsin                                                 278   7e-80    
sp|Q9LK71.2|DGP11_ARATH  RecName: Full=Putative protease Do-like ...    280   9e-80    
ref|WP_014958260.1|  serine protease, related to trypsin                277   2e-79    
ref|WP_006806439.1|  serine protease                                    276   2e-79    
gb|KDO77072.1|  hypothetical protein CISIN_1g007765mg                   273   3e-79    
ref|XP_010456846.1|  PREDICTED: putative protease Do-like 11, mit...    278   7e-79    
ref|WP_013553975.1|  serine protease                                    275   9e-79    
ref|NP_566551.1|  DegP protease 11                                      276   1e-78    
ref|WP_026737895.1|  serine protease                                    274   1e-78    
dbj|BAB01153.1|  unnamed protein product                                276   2e-78    
gb|KFG58626.1|  trypsin domain-containing protein                       275   2e-78    
gb|KFG62805.1|  serine protease                                         280   4e-78    
emb|CDJ59597.1|  trypsin, putative                                      267   5e-78    
ref|XP_008655947.1|  PREDICTED: protease Do-like 9 isoform X1           266   6e-78    
ref|NP_566552.1|  DEGP protease 12                                      272   8e-78    
sp|Q9LK70.1|DGP12_ARATH  RecName: Full=Putative protease Do-like ...    271   2e-77    
ref|WP_020558112.1|  hypothetical protein                               272   4e-77    
gb|ABK21948.1|  unknown                                                 260   5e-77    
gb|KHF97808.1|  Protease Do-like 9                                      265   5e-77    
emb|CDY39277.1|  BnaC06g27140D                                          268   8e-77    
ref|XP_006281902.1|  hypothetical protein CARUB_v10028106mg             268   2e-76    
gb|KCW54111.1|  hypothetical protein EUGRSUZ_I000921                    265   3e-76    
emb|CDY66494.1|  BnaCnng51100D                                          268   4e-76    
ref|XP_010042932.1|  PREDICTED: protease Do-like 10, mitochondria...    262   4e-76    
ref|WP_020558866.1|  hypothetical protein                               267   6e-76    
ref|WP_002709445.1|  peptidase S1 and S6 chymotrypsin/Hap               272   6e-76    
ref|XP_010437094.1|  PREDICTED: putative protease Do-like 11, mit...    269   8e-76    
ref|XP_010424502.1|  PREDICTED: putative protease Do-like 12, mit...    267   1e-75    
ref|WP_012831747.1|  peptidase S1 and S6 chymotrypsin/Hap               264   6e-75    
ref|WP_038142065.1|  peptidase S1 and S6 chymotrypsin/Hap               262   4e-74    
ref|WP_022397724.1|  2-alkenal reductase                                263   5e-74    
ref|WP_012419721.1|  MULTISPECIES: 2-alkenal reductase                  262   1e-73    
ref|WP_031930418.1|  2-alkenal reductase                                262   1e-73    
ref|WP_035698046.1|  hypothetical protein                               257   2e-73    
ref|XP_009107927.1|  PREDICTED: putative protease Do-like 12, mit...    259   9e-73    
ref|WP_018971175.1|  hypothetical protein                               258   1e-72    
ref|WP_020580824.1|  hypothetical protein                               258   2e-72    
gb|KFH05116.1|  serine protease                                         264   2e-72    
ref|WP_002709499.1|  peptidase S1 and S6 chymotrypsin/Hap               256   7e-72    
ref|XP_006282154.1|  hypothetical protein CARUB_v10028411mg             256   9e-72    
ref|XP_008655948.1|  PREDICTED: protease Do-like 9 isoform X2           249   9e-72    
emb|CDY46469.1|  BnaA08g06390D                                          256   1e-71    
gb|ERK66396.1|  trypsin                                                 253   3e-71    
gb|EWM23097.1|  protease do-like 2                                      258   3e-71    
ref|WP_038160265.1|  serine protease                                    254   4e-71    
ref|WP_036100072.1|  serine protease                                    253   5e-71    
ref|WP_010409673.1|  serine protease                                    253   1e-70    
ref|WP_015250627.1|  peptidase S1                                       253   2e-70    



>ref|XP_009587776.1| PREDICTED: protease Do-like 2, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=624

 Score =  1028 bits (2658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/610 (83%), Positives = 544/610 (89%), Gaps = 8/610 (1%)
 Frame = +3

Query  165   RCSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSK  344
             RCSLSS  LF+TS  PS FF+PK++TQ+QN   N  KK       +E+EA  QK  RRSK
Sbjct  22    RCSLSSDRLFSTSLRPSSFFLPKASTQNQNHNKNVLKK------SSEKEAGKQKFPRRSK  75

Query  345   GERFFSNVDDRN-TNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAV  521
              E  F+N DDR+ TN+ GRSQ TS KSFG+QRKGKGV  DSKE QVET + QDA FLNAV
Sbjct  76    NEGAFANADDRSSTNEAGRSQPTSIKSFGLQRKGKGVLLDSKEQQVETSSFQDAAFLNAV  135

Query  522   VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKY  701
             VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVK+RGDDTKY
Sbjct  136   VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKKRGDDTKY  195

Query  702   VAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGV  881
             VAKVLARGVECDIALLSVES++FW+GAEPL+FG LPRLQDAVTVVGYPLGGDTISVTKGV
Sbjct  196   VAKVLARGVECDIALLSVESKDFWEGAEPLRFGRLPRLQDAVTVVGYPLGGDTISVTKGV  255

Query  882   VSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYV  1061
             VSRIEVTSYAHGSSELLGIQIDAA+NPGNSGGPAFNDDG+CIGVAFQVYRSD+ ENIGYV
Sbjct  256   VSRIEVTSYAHGSSELLGIQIDAAINPGNSGGPAFNDDGDCIGVAFQVYRSDDAENIGYV  315

Query  1062  IPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDA  1241
             IPTTVVSHFL+DYERNGKY GFP LGVLLQKLENPALRACLKVPSNEGVL+RKVEPTSD 
Sbjct  316   IPTTVVSHFLEDYERNGKYCGFPCLGVLLQKLENPALRACLKVPSNEGVLVRKVEPTSDV  375

Query  1242  HNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKV  1421
              N LKEGDVIVSFD VRVG EGTVPFRS+ERIAFRYLIS+KFSGD+ ELGIIR GEFMKV
Sbjct  376   SNVLKEGDVIVSFDGVRVGSEGTVPFRSSERIAFRYLISQKFSGDSVELGIIRGGEFMKV  435

Query  1422  QIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFAN  1601
             Q VL PRV LVPYHIEGGQPSYLIVAGLVFTPLSEPLI+EE EDSIGLKLLTKARYS A 
Sbjct  436   QAVLKPRVHLVPYHIEGGQPSYLIVAGLVFTPLSEPLIEEE-EDSIGLKLLTKARYSLAK  494

Query  1602  FKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFA  1781
             F+G+QIVVLSQVLANEVNIGYED+SN+Q+LKLNG RI+NIHHLAHL+DSCK KYLVFEF 
Sbjct  495   FEGQQIVVLSQVLANEVNIGYEDMSNDQVLKLNGTRIKNIHHLAHLVDSCKGKYLVFEFE  554

Query  1782  DNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNS  1961
             DNFLVVLEREAAL  S+SILKDYGIP+ERSSDLMG YVDSI  ++A +QQ FGDS  SN 
Sbjct  555   DNFLVVLEREAALDASSSILKDYGIPAERSSDLMGAYVDSIEHSEATNQQNFGDSPVSNL  614

Query  1962  EFGFDGLLWA  1991
             EFG +GLLWA
Sbjct  615   EFGSEGLLWA  624



>ref|XP_009768575.1| PREDICTED: protease Do-like 2, chloroplastic isoform X1 [Nicotiana 
sylvestris]
Length=624

 Score =  1022 bits (2642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/610 (82%), Positives = 542/610 (89%), Gaps = 8/610 (1%)
 Frame = +3

Query  165   RCSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSK  344
             RCSLSS  LF+TS  PS FF+PK++TQ+QN   N  KK       +E+EA  QK  +RSK
Sbjct  22    RCSLSSHRLFSTSLRPSSFFLPKASTQNQNHNKNVLKKS------SEKEADKQKFPQRSK  75

Query  345   GERFFSNVDDRN-TNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAV  521
              E  F+N D R+ TN+ GRSQ  S KSFG+QRKGKGV  DSKE QVET ++QDA FLNAV
Sbjct  76    NEGPFANADGRSSTNEAGRSQLASIKSFGLQRKGKGVLLDSKEQQVETSSIQDAAFLNAV  135

Query  522   VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKY  701
             VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVK+RGDDTKY
Sbjct  136   VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKKRGDDTKY  195

Query  702   VAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGV  881
             VAKVLARGVECDIALLSVES++FW+GAEPL+FG LPRLQDAVTVVGYPLGGDTISVTKGV
Sbjct  196   VAKVLARGVECDIALLSVESKDFWEGAEPLRFGRLPRLQDAVTVVGYPLGGDTISVTKGV  255

Query  882   VSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYV  1061
             VSRIEVTSYAHGSSELLGIQIDAA+NPGNSGGPAFNDDG+CIGVAFQVYRSD+ ENIGYV
Sbjct  256   VSRIEVTSYAHGSSELLGIQIDAAINPGNSGGPAFNDDGDCIGVAFQVYRSDDAENIGYV  315

Query  1062  IPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDA  1241
             IPTTVVSHFL+DYERNGKY GFP LGVLLQKLENPALRACLKVPSNEGVL+RK EPTSD 
Sbjct  316   IPTTVVSHFLEDYERNGKYCGFPCLGVLLQKLENPALRACLKVPSNEGVLVRKFEPTSDV  375

Query  1242  HNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKV  1421
              N LKEGDVIVSFD V VG EGTVPFRS+ERIAFRYLIS+KFSGD+ ELGIIRAGEFMKV
Sbjct  376   SNVLKEGDVIVSFDGVHVGSEGTVPFRSSERIAFRYLISQKFSGDSVELGIIRAGEFMKV  435

Query  1422  QIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFAN  1601
             Q VL PRV LVPYHIEGGQPSY+IVAGLVFTPLSEPLI+EE EDSIGLKLLTKARYS A 
Sbjct  436   QAVLKPRVHLVPYHIEGGQPSYIIVAGLVFTPLSEPLIEEE-EDSIGLKLLTKARYSLAK  494

Query  1602  FKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFA  1781
             F+G+QIVVLSQVLANEVNIGYED+SNEQ+LKLNG RI+NIHHLAHL+DSCK KYLVFEF 
Sbjct  495   FEGQQIVVLSQVLANEVNIGYEDMSNEQVLKLNGTRIKNIHHLAHLVDSCKGKYLVFEFE  554

Query  1782  DNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNS  1961
             DNFLVVLEREAAL  S SILKDYGIP+ERSSDLMG YVDSI Q++A +QQ FGDS  SN 
Sbjct  555   DNFLVVLEREAALDASASILKDYGIPAERSSDLMGAYVDSIEQSEATNQQNFGDSPVSNM  614

Query  1962  EFGFDGLLWA  1991
             EFG +GLLWA
Sbjct  615   EFGSEGLLWA  624



>ref|XP_009768576.1| PREDICTED: protease Do-like 2, chloroplastic isoform X2 [Nicotiana 
sylvestris]
Length=614

 Score =  1011 bits (2613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/610 (81%), Positives = 536/610 (88%), Gaps = 18/610 (3%)
 Frame = +3

Query  165   RCSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSK  344
             RCSLSS  LF+TS  PS FF+PK++TQ+QN   N                V +K + RSK
Sbjct  22    RCSLSSHRLFSTSLRPSSFFLPKASTQNQNHNKN----------------VLKKSSERSK  65

Query  345   GERFFSNVDDRN-TNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAV  521
              E  F+N D R+ TN+ GRSQ  S KSFG+QRKGKGV  DSKE QVET ++QDA FLNAV
Sbjct  66    NEGPFANADGRSSTNEAGRSQLASIKSFGLQRKGKGVLLDSKEQQVETSSIQDAAFLNAV  125

Query  522   VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKY  701
             VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVK+RGDDTKY
Sbjct  126   VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKKRGDDTKY  185

Query  702   VAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGV  881
             VAKVLARGVECDIALLSVES++FW+GAEPL+FG LPRLQDAVTVVGYPLGGDTISVTKGV
Sbjct  186   VAKVLARGVECDIALLSVESKDFWEGAEPLRFGRLPRLQDAVTVVGYPLGGDTISVTKGV  245

Query  882   VSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYV  1061
             VSRIEVTSYAHGSSELLGIQIDAA+NPGNSGGPAFNDDG+CIGVAFQVYRSD+ ENIGYV
Sbjct  246   VSRIEVTSYAHGSSELLGIQIDAAINPGNSGGPAFNDDGDCIGVAFQVYRSDDAENIGYV  305

Query  1062  IPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDA  1241
             IPTTVVSHFL+DYERNGKY GFP LGVLLQKLENPALRACLKVPSNEGVL+RK EPTSD 
Sbjct  306   IPTTVVSHFLEDYERNGKYCGFPCLGVLLQKLENPALRACLKVPSNEGVLVRKFEPTSDV  365

Query  1242  HNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKV  1421
              N LKEGDVIVSFD V VG EGTVPFRS+ERIAFRYLIS+KFSGD+ ELGIIRAGEFMKV
Sbjct  366   SNVLKEGDVIVSFDGVHVGSEGTVPFRSSERIAFRYLISQKFSGDSVELGIIRAGEFMKV  425

Query  1422  QIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFAN  1601
             Q VL PRV LVPYHIEGGQPSY+IVAGLVFTPLSEPLI+EE EDSIGLKLLTKARYS A 
Sbjct  426   QAVLKPRVHLVPYHIEGGQPSYIIVAGLVFTPLSEPLIEEE-EDSIGLKLLTKARYSLAK  484

Query  1602  FKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFA  1781
             F+G+QIVVLSQVLANEVNIGYED+SNEQ+LKLNG RI+NIHHLAHL+DSCK KYLVFEF 
Sbjct  485   FEGQQIVVLSQVLANEVNIGYEDMSNEQVLKLNGTRIKNIHHLAHLVDSCKGKYLVFEFE  544

Query  1782  DNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNS  1961
             DNFLVVLEREAAL  S SILKDYGIP+ERSSDLMG YVDSI Q++A +QQ FGDS  SN 
Sbjct  545   DNFLVVLEREAALDASASILKDYGIPAERSSDLMGAYVDSIEQSEATNQQNFGDSPVSNM  604

Query  1962  EFGFDGLLWA  1991
             EFG +GLLWA
Sbjct  605   EFGSEGLLWA  614



>ref|XP_009587778.1| PREDICTED: protease Do-like 2, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
Length=607

 Score =   991 bits (2563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/610 (81%), Positives = 530/610 (87%), Gaps = 25/610 (4%)
 Frame = +3

Query  165   RCSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSK  344
             RCSLSS  LF+TS  PS FF+PK++TQ+QN   N  KK       +E+EA  QK  RRSK
Sbjct  22    RCSLSSDRLFSTSLRPSSFFLPKASTQNQNHNKNVLKK------SSEKEAGKQKFPRRSK  75

Query  345   GERFFSNVDDRN-TNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAV  521
              E  F+N DDR+ TN+ GRSQ TS KSFG+QRKGKGV  DSKE QV              
Sbjct  76    NEGAFANADDRSSTNEAGRSQPTSIKSFGLQRKGKGVLLDSKEQQV--------------  121

Query  522   VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKY  701
                YCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVK+RGDDTKY
Sbjct  122   ---YCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKKRGDDTKY  178

Query  702   VAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGV  881
             VAKVLARGVECDIALLSVES++FW+GAEPL+FG LPRLQDAVTVVGYPLGGDTISVTKGV
Sbjct  179   VAKVLARGVECDIALLSVESKDFWEGAEPLRFGRLPRLQDAVTVVGYPLGGDTISVTKGV  238

Query  882   VSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYV  1061
             VSRIEVTSYAHGSSELLGIQIDAA+NPGNSGGPAFNDDG+CIGVAFQVYRSD+ ENIGYV
Sbjct  239   VSRIEVTSYAHGSSELLGIQIDAAINPGNSGGPAFNDDGDCIGVAFQVYRSDDAENIGYV  298

Query  1062  IPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDA  1241
             IPTTVVSHFL+DYERNGKY GFP LGVLLQKLENPALRACLKVPSNEGVL+RKVEPTSD 
Sbjct  299   IPTTVVSHFLEDYERNGKYCGFPCLGVLLQKLENPALRACLKVPSNEGVLVRKVEPTSDV  358

Query  1242  HNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKV  1421
              N LKEGDVIVSFD VRVG EGTVPFRS+ERIAFRYLIS+KFSGD+ ELGIIR GEFMKV
Sbjct  359   SNVLKEGDVIVSFDGVRVGSEGTVPFRSSERIAFRYLISQKFSGDSVELGIIRGGEFMKV  418

Query  1422  QIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFAN  1601
             Q VL PRV LVPYHIEGGQPSYLIVAGLVFTPLSEPLI+EE EDSIGLKLLTKARYS A 
Sbjct  419   QAVLKPRVHLVPYHIEGGQPSYLIVAGLVFTPLSEPLIEEE-EDSIGLKLLTKARYSLAK  477

Query  1602  FKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFA  1781
             F+G+QIVVLSQVLANEVNIGYED+SN+Q+LKLNG RI+NIHHLAHL+DSCK KYLVFEF 
Sbjct  478   FEGQQIVVLSQVLANEVNIGYEDMSNDQVLKLNGTRIKNIHHLAHLVDSCKGKYLVFEFE  537

Query  1782  DNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNS  1961
             DNFLVVLEREAAL  S+SILKDYGIP+ERSSDLMG YVDSI  ++A +QQ FGDS  SN 
Sbjct  538   DNFLVVLEREAALDASSSILKDYGIPAERSSDLMGAYVDSIEHSEATNQQNFGDSPVSNL  597

Query  1962  EFGFDGLLWA  1991
             EFG +GLLWA
Sbjct  598   EFGSEGLLWA  607



>ref|XP_009768577.1| PREDICTED: protease Do-like 2, chloroplastic isoform X3 [Nicotiana 
sylvestris]
Length=607

 Score =   984 bits (2545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/610 (80%), Positives = 527/610 (86%), Gaps = 25/610 (4%)
 Frame = +3

Query  165   RCSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSK  344
             RCSLSS  LF+TS  PS FF+PK++TQ+QN   N  KK       +E+EA  QK  +RSK
Sbjct  22    RCSLSSHRLFSTSLRPSSFFLPKASTQNQNHNKNVLKKS------SEKEADKQKFPQRSK  75

Query  345   GERFFSNVDDRN-TNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAV  521
              E  F+N D R+ TN+ GRSQ  S KSFG+QRKGKGV  DSKE QV              
Sbjct  76    NEGPFANADGRSSTNEAGRSQLASIKSFGLQRKGKGVLLDSKEQQV--------------  121

Query  522   VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKY  701
                YCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVK+RGDDTKY
Sbjct  122   ---YCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKKRGDDTKY  178

Query  702   VAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGV  881
             VAKVLARGVECDIALLSVES++FW+GAEPL+FG LPRLQDAVTVVGYPLGGDTISVTKGV
Sbjct  179   VAKVLARGVECDIALLSVESKDFWEGAEPLRFGRLPRLQDAVTVVGYPLGGDTISVTKGV  238

Query  882   VSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYV  1061
             VSRIEVTSYAHGSSELLGIQIDAA+NPGNSGGPAFNDDG+CIGVAFQVYRSD+ ENIGYV
Sbjct  239   VSRIEVTSYAHGSSELLGIQIDAAINPGNSGGPAFNDDGDCIGVAFQVYRSDDAENIGYV  298

Query  1062  IPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDA  1241
             IPTTVVSHFL+DYERNGKY GFP LGVLLQKLENPALRACLKVPSNEGVL+RK EPTSD 
Sbjct  299   IPTTVVSHFLEDYERNGKYCGFPCLGVLLQKLENPALRACLKVPSNEGVLVRKFEPTSDV  358

Query  1242  HNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKV  1421
              N LKEGDVIVSFD V VG EGTVPFRS+ERIAFRYLIS+KFSGD+ ELGIIRAGEFMKV
Sbjct  359   SNVLKEGDVIVSFDGVHVGSEGTVPFRSSERIAFRYLISQKFSGDSVELGIIRAGEFMKV  418

Query  1422  QIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFAN  1601
             Q VL PRV LVPYHIEGGQPSY+IVAGLVFTPLSEPLI+EE EDSIGLKLLTKARYS A 
Sbjct  419   QAVLKPRVHLVPYHIEGGQPSYIIVAGLVFTPLSEPLIEEE-EDSIGLKLLTKARYSLAK  477

Query  1602  FKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFA  1781
             F+G+QIVVLSQVLANEVNIGYED+SNEQ+LKLNG RI+NIHHLAHL+DSCK KYLVFEF 
Sbjct  478   FEGQQIVVLSQVLANEVNIGYEDMSNEQVLKLNGTRIKNIHHLAHLVDSCKGKYLVFEFE  537

Query  1782  DNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNS  1961
             DNFLVVLEREAAL  S SILKDYGIP+ERSSDLMG YVDSI Q++A +QQ FGDS  SN 
Sbjct  538   DNFLVVLEREAALDASASILKDYGIPAERSSDLMGAYVDSIEQSEATNQQNFGDSPVSNM  597

Query  1962  EFGFDGLLWA  1991
             EFG +GLLWA
Sbjct  598   EFGSEGLLWA  607



>ref|XP_009631856.1| PREDICTED: protease Do-like 2, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=629

 Score =   983 bits (2542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/594 (81%), Positives = 521/594 (88%), Gaps = 9/594 (2%)
 Frame = +3

Query  219   FFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSKGERFFSNVDDRNT-NKNG  395
              F+PK+  Q      NQ  K   + S +E+    Q    RSK ER  +N D R++ N+ G
Sbjct  42    LFIPKAVHQ------NQDPKKGLKNSTSEKAVGKQNFPWRSKDERHLANKDGRSSKNEAG  95

Query  396   RSQSTSFKSFGVQRKG--KGVQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPW  569
             RSQST+FKS G QRKG  KG  F+SKE QVETG ++DA FLNAVVKVYCTHTAPDYSLPW
Sbjct  96    RSQSTAFKSSGQQRKGAGKGAVFESKEQQVETGIIEDATFLNAVVKVYCTHTAPDYSLPW  155

Query  570   QKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALL  749
             QKQRQ+ STGSAFMIGDGKLLTNAHCVEH TQVKVKRRGDDTKYVAKVLARGVECDIALL
Sbjct  156   QKQRQFASTGSAFMIGDGKLLTNAHCVEHHTQVKVKRRGDDTKYVAKVLARGVECDIALL  215

Query  750   SVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSEL  929
             SVES++FW+GAEPL+FGHLP LQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSEL
Sbjct  216   SVESKDFWEGAEPLRFGHLPHLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSEL  275

Query  930   LGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERN  1109
             LGIQIDAA+NPGNSGGPAFNDDGECIGVAFQVYRSDE ENIGYVIPTTVVSHFL+DYERN
Sbjct  276   LGIQIDAAINPGNSGGPAFNDDGECIGVAFQVYRSDETENIGYVIPTTVVSHFLEDYERN  335

Query  1110  GKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDV  1289
             GKY+GFP LGVLLQKLE+PALRACLKVPSNEGVL+RKVEPTSD  N LKEGDVIVSFD V
Sbjct  336   GKYSGFPCLGVLLQKLESPALRACLKVPSNEGVLVRKVEPTSDVSNVLKEGDVIVSFDGV  395

Query  1290  RVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIE  1469
              +GCEGTVPFRS+ RIAFRYLIS+KF+GD AELGIIR GEFMKVQ VL PRV LVPYHIE
Sbjct  396   HIGCEGTVPFRSSARIAFRYLISQKFTGDVAELGIIRDGEFMKVQAVLKPRVHLVPYHIE  455

Query  1470  GGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANE  1649
              GQPSYLIVAGLVFTPLSEPLI EECEDSIGLKLLTKARYS A F GEQIVVLSQVLANE
Sbjct  456   CGQPSYLIVAGLVFTPLSEPLIGEECEDSIGLKLLTKARYSLAKFDGEQIVVLSQVLANE  515

Query  1650  VNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTS  1829
             VNIGYEDISNEQILKLNG RIRNIHHLAHL+DSCKDKYLV EF DNFLVVLEREAA++ S
Sbjct  516   VNIGYEDISNEQILKLNGTRIRNIHHLAHLVDSCKDKYLVLEFEDNFLVVLEREAAVSAS  575

Query  1830  TSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
              SILKDYGIP+ERSSDL+ PY+DSI  ++A DQ EFGDS  SNSEFG++GLLWA
Sbjct  576   ASILKDYGIPAERSSDLLEPYIDSIRPDEATDQHEFGDSPVSNSEFGYEGLLWA  629



>ref|XP_011082504.1| PREDICTED: protease Do-like 2, chloroplastic [Sesamum indicum]
Length=632

 Score =   981 bits (2535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/611 (80%), Positives = 531/611 (87%), Gaps = 6/611 (1%)
 Frame = +3

Query  171   SLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHT-EREAVTQKCTRRSKG  347
             SLSS  LF  SR P  + +  S +     ++  + KP   +S + E+EAV QK    S+ 
Sbjct  24    SLSSNRLFCASRRP--YLLSASKSSKDVNQNPVKGKPKKSLSKSAEKEAVLQKFPSISRD  81

Query  348   ERFFSNVDDRNT-NKNGRSQSTSFKSFGVQRKG-KGVQFDSKELQVETGNLQDANFLNAV  521
                 SN D R+T NK GRSQ TS+KS G+QRK  KG+  DS + QVETGNLQDA FLNAV
Sbjct  82    GSSLSNADGRSTWNKTGRSQLTSYKSSGLQRKANKGLLVDSTKQQVETGNLQDAAFLNAV  141

Query  522   VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKY  701
             VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIG GKLLTNAHCVEHDT VKVKRRGDDTKY
Sbjct  142   VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGQGKLLTNAHCVEHDTHVKVKRRGDDTKY  201

Query  702   VAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGV  881
             VAKVLARGVECDIALLSVES+EFW+GAEPLQ GHLP LQDAVTVVGYPLGG+TISV+KGV
Sbjct  202   VAKVLARGVECDIALLSVESKEFWEGAEPLQLGHLPNLQDAVTVVGYPLGGETISVSKGV  261

Query  882   VSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYV  1061
             VSRIEVTSYAHGSSELLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRSD+VENIGYV
Sbjct  262   VSRIEVTSYAHGSSELLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSDDVENIGYV  321

Query  1062  IPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDA  1241
             IPTTVVSHFL+DYERNGKYTGFP LGVLLQKLENPALR CLKVP+NEGVL+RKVEPTS A
Sbjct  322   IPTTVVSHFLEDYERNGKYTGFPCLGVLLQKLENPALRTCLKVPTNEGVLVRKVEPTSHA  381

Query  1242  HNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKV  1421
              + LKEGDVIVSFD+VRVGCEG VPFRSTERIAFRYLIS+KF+G  A +GIIR G+FM+V
Sbjct  382   TSALKEGDVIVSFDNVRVGCEGMVPFRSTERIAFRYLISQKFTGGVANIGIIRGGQFMEV  441

Query  1422  QIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFAN  1601
             Q+VL+PRV LVPYHIEGGQPSYLIVAGLVFTPLSEPLI+EECEDSIGLKLL KARYS A 
Sbjct  442   QVVLNPRVHLVPYHIEGGQPSYLIVAGLVFTPLSEPLIEEECEDSIGLKLLAKARYSMAK  501

Query  1602  FKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFA  1781
             FKGEQIV+LSQVLANE NIGYED+SNEQ+LKLNG  IRNIHHLAHL+DSCKDKYLVFEF 
Sbjct  502   FKGEQIVILSQVLANEENIGYEDMSNEQVLKLNGTWIRNIHHLAHLVDSCKDKYLVFEFD  561

Query  1782  DNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQND-AVDQQEFGDSAESN  1958
             DNFLVVLERE+AL  STSILK YGI SERSSDL+ PYV+SI QN+ A+DQ +FGDS  SN
Sbjct  562   DNFLVVLERESALAASTSILKGYGIRSERSSDLLEPYVNSILQNEGAMDQHQFGDSPVSN  621

Query  1959  SEFGFDGLLWA  1991
             SEFG+DGLLWA
Sbjct  622   SEFGYDGLLWA  632



>ref|XP_009631857.1| PREDICTED: protease Do-like 2, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
Length=623

 Score =   976 bits (2524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/594 (81%), Positives = 520/594 (88%), Gaps = 15/594 (3%)
 Frame = +3

Query  219   FFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSKGERFFSNVDDRNT-NKNG  395
              F+PK+  Q+Q+ +   +             + ++    RSK ER  +N D R++ N+ G
Sbjct  42    LFIPKAVHQNQDPKKGLKN------------STSENFPWRSKDERHLANKDGRSSKNEAG  89

Query  396   RSQSTSFKSFGVQRKG--KGVQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPW  569
             RSQST+FKS G QRKG  KG  F+SKE QVETG ++DA FLNAVVKVYCTHTAPDYSLPW
Sbjct  90    RSQSTAFKSSGQQRKGAGKGAVFESKEQQVETGIIEDATFLNAVVKVYCTHTAPDYSLPW  149

Query  570   QKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALL  749
             QKQRQ+ STGSAFMIGDGKLLTNAHCVEH TQVKVKRRGDDTKYVAKVLARGVECDIALL
Sbjct  150   QKQRQFASTGSAFMIGDGKLLTNAHCVEHHTQVKVKRRGDDTKYVAKVLARGVECDIALL  209

Query  750   SVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSEL  929
             SVES++FW+GAEPL+FGHLP LQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSEL
Sbjct  210   SVESKDFWEGAEPLRFGHLPHLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSEL  269

Query  930   LGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERN  1109
             LGIQIDAA+NPGNSGGPAFNDDGECIGVAFQVYRSDE ENIGYVIPTTVVSHFL+DYERN
Sbjct  270   LGIQIDAAINPGNSGGPAFNDDGECIGVAFQVYRSDETENIGYVIPTTVVSHFLEDYERN  329

Query  1110  GKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDV  1289
             GKY+GFP LGVLLQKLE+PALRACLKVPSNEGVL+RKVEPTSD  N LKEGDVIVSFD V
Sbjct  330   GKYSGFPCLGVLLQKLESPALRACLKVPSNEGVLVRKVEPTSDVSNVLKEGDVIVSFDGV  389

Query  1290  RVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIE  1469
              +GCEGTVPFRS+ RIAFRYLIS+KF+GD AELGIIR GEFMKVQ VL PRV LVPYHIE
Sbjct  390   HIGCEGTVPFRSSARIAFRYLISQKFTGDVAELGIIRDGEFMKVQAVLKPRVHLVPYHIE  449

Query  1470  GGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANE  1649
              GQPSYLIVAGLVFTPLSEPLI EECEDSIGLKLLTKARYS A F GEQIVVLSQVLANE
Sbjct  450   CGQPSYLIVAGLVFTPLSEPLIGEECEDSIGLKLLTKARYSLAKFDGEQIVVLSQVLANE  509

Query  1650  VNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTS  1829
             VNIGYEDISNEQILKLNG RIRNIHHLAHL+DSCKDKYLV EF DNFLVVLEREAA++ S
Sbjct  510   VNIGYEDISNEQILKLNGTRIRNIHHLAHLVDSCKDKYLVLEFEDNFLVVLEREAAVSAS  569

Query  1830  TSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
              SILKDYGIP+ERSSDL+ PY+DSI  ++A DQ EFGDS  SNSEFG++GLLWA
Sbjct  570   ASILKDYGIPAERSSDLLEPYIDSIRPDEATDQHEFGDSPVSNSEFGYEGLLWA  623



>ref|XP_009773293.1| PREDICTED: protease Do-like 2, chloroplastic [Nicotiana sylvestris]
Length=623

 Score =   976 bits (2522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/580 (82%), Positives = 516/580 (89%), Gaps = 3/580 (1%)
 Frame = +3

Query  261   HNQRKKPPARVSHTEREAVTQKCTRRSKGERFFSNVDDRNT-NKNGRSQSTSFKSFGVQR  437
              NQ +K   + S +E+    Q    RSK ER  +N D R++ N+ GRSQST+FK  G QR
Sbjct  44    QNQYQKKGLKNSTSEKAVGKQNFPWRSKDERLLANKDGRSSKNEAGRSQSTAFKLSGQQR  103

Query  438   KG--KGVQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFM  611
             KG  KG  F+SKE QVE G ++DA FLNAVVKVYCTHTAPDYSLPWQKQRQ+ STGSAFM
Sbjct  104   KGAGKGAVFESKEQQVEIGIIEDATFLNAVVKVYCTHTAPDYSLPWQKQRQFASTGSAFM  163

Query  612   IGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPL  791
             IGDGKLLTNAHCVEH TQVKVKRRGDDTKY+AKVLARGVECDIALLSVES++FW+GAEPL
Sbjct  164   IGDGKLLTNAHCVEHHTQVKVKRRGDDTKYIAKVLARGVECDIALLSVESKDFWEGAEPL  223

Query  792   QFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNS  971
              FGHLP LQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAA+NPGNS
Sbjct  224   CFGHLPHLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAINPGNS  283

Query  972   GGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQ  1151
             GGPAFNDDGECIGVAFQVYRSDE ENIGYVIPTTVVSHFL+DYERNGKY+GFP LGVLLQ
Sbjct  284   GGPAFNDDGECIGVAFQVYRSDETENIGYVIPTTVVSHFLEDYERNGKYSGFPCLGVLLQ  343

Query  1152  KLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTE  1331
             KLE+PALRACLKVPSNEGVL+RKVEPTSD  N LKEGDVIVSFD VR+GCEGTVPFRS+ 
Sbjct  344   KLESPALRACLKVPSNEGVLVRKVEPTSDVSNVLKEGDVIVSFDGVRIGCEGTVPFRSSA  403

Query  1332  RIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVF  1511
             RIAFRYLIS+KF+GD AELGIIRAGEFMKVQ +L PRV LVPYHIE GQPSYLIVAGLVF
Sbjct  404   RIAFRYLISQKFTGDVAELGIIRAGEFMKVQALLKPRVHLVPYHIECGQPSYLIVAGLVF  463

Query  1512  TPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQIL  1691
             TPLSEPLI EECEDSIGLKLLTKARYS A F+GEQIVVLSQVLANEVNIGYEDISNEQIL
Sbjct  464   TPLSEPLIGEECEDSIGLKLLTKARYSLAKFEGEQIVVLSQVLANEVNIGYEDISNEQIL  523

Query  1692  KLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERS  1871
             KLNG RI+NIHHLAHL+DSCKDKYLV EF DNFLVVLEREAA++ S SILKDYGIP+ERS
Sbjct  524   KLNGTRIKNIHHLAHLVDSCKDKYLVLEFEDNFLVVLEREAAVSASPSILKDYGIPAERS  583

Query  1872  SDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             SDL+ PY+DS+  ++A DQ EFGDS  SNSEFG++GLLW+
Sbjct  584   SDLLEPYIDSVRPDEATDQHEFGDSPVSNSEFGYEGLLWS  623



>ref|XP_006366368.1| PREDICTED: protease Do-like 2, chloroplastic-like [Solanum tuberosum]
Length=621

 Score =   974 bits (2518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/609 (78%), Positives = 532/609 (87%), Gaps = 11/609 (2%)
 Frame = +3

Query  174   LSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSKGER  353
             L+S     + RPP   F+PK+         +Q+         +++    Q    RSK ER
Sbjct  21    LTSHRPSTSLRPPPSLFIPKAV--------HQKSSSSPHHPPSQKAVGKQNFIWRSKDER  72

Query  354   FFSNVDDRNT-NKNGRSQSTSFKSFGVQRKG--KGVQFDSKELQVETGNLQDANFLNAVV  524
               +N D R++ N+  RS+ST+FK  G+QRKG  KGV F+SKE QVETG ++DA FLNAVV
Sbjct  73    HLANKDGRSSKNETERSKSTAFKFSGLQRKGSGKGVPFESKEPQVETGIIEDATFLNAVV  132

Query  525   KVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYV  704
             KV+CTHTAPDYSLPWQKQRQ+ STGSAFMIGDGKLLTNAHCVEH TQVKVKRRGDDTKYV
Sbjct  133   KVFCTHTAPDYSLPWQKQRQFASTGSAFMIGDGKLLTNAHCVEHGTQVKVKRRGDDTKYV  192

Query  705   AKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVV  884
             AKVLARGVECDIALLSVES++FWKGAEPL+FGHLP LQDAVTVVGYPLGGDTISVTKGVV
Sbjct  193   AKVLARGVECDIALLSVESKDFWKGAEPLRFGHLPHLQDAVTVVGYPLGGDTISVTKGVV  252

Query  885   SRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVI  1064
             SR+EVTSYAHGSSELLGIQIDAA+NPGNSGGPAFNDDGECIGVAFQVYRSD+VENIGYVI
Sbjct  253   SRVEVTSYAHGSSELLGIQIDAAINPGNSGGPAFNDDGECIGVAFQVYRSDDVENIGYVI  312

Query  1065  PTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAH  1244
             PTTVVSHFL+DYERNGKY+GFP LGV+LQKLENPALRACL+VPSNEG+L+RK+EPTSD  
Sbjct  313   PTTVVSHFLEDYERNGKYSGFPCLGVMLQKLENPALRACLRVPSNEGILVRKIEPTSDVS  372

Query  1245  NTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQ  1424
             N +KEGDVIVSFD VRVGCEGTVPFRS+ERIAFRYLIS+KF+GD AELGIIRAGE +KVQ
Sbjct  373   NVVKEGDVIVSFDGVRVGCEGTVPFRSSERIAFRYLISQKFTGDVAELGIIRAGELLKVQ  432

Query  1425  IVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANF  1604
              VL PRV LVPYHIEGGQPSYLIVAGLVFTPLSEPLI+EECED+IGLKLL KARYSFA F
Sbjct  433   AVLKPRVHLVPYHIEGGQPSYLIVAGLVFTPLSEPLIEEECEDTIGLKLLIKARYSFAKF  492

Query  1605  KGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFAD  1784
             +GEQIV+LSQVLANEVNIGYED+SNEQ+LKLNG RI+NIHHLAHL+DSCKDKYLVFEF D
Sbjct  493   EGEQIVILSQVLANEVNIGYEDLSNEQVLKLNGTRIKNIHHLAHLVDSCKDKYLVFEFED  552

Query  1785  NFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSE  1964
             NFLVVLEREAA + S+SIL DYGIP+ERSSDL+ PYVDSIG ++A DQ EFGDS  SNSE
Sbjct  553   NFLVVLEREAASSASSSILIDYGIPAERSSDLLEPYVDSIGPDEATDQHEFGDSPVSNSE  612

Query  1965  FGFDGLLWA  1991
             FG+DGLLWA
Sbjct  613   FGYDGLLWA  621



>ref|XP_004247469.1| PREDICTED: protease Do-like 2, chloroplastic [Solanum lycopersicum]
 ref|XP_010326611.1| PREDICTED: protease Do-like 2, chloroplastic [Solanum lycopersicum]
Length=621

 Score =   972 bits (2512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/609 (79%), Positives = 530/609 (87%), Gaps = 11/609 (2%)
 Frame = +3

Query  174   LSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSKGER  353
             L+S     + RPPS  F+PK+         +Q+   P     +++    Q    RSK ER
Sbjct  21    LTSHRPSTSLRPPSSLFIPKAV--------HQKSSSPPPHPPSQKAGGKQNFIWRSKDER  72

Query  354   FFSNVDDRNT-NKNGRSQSTSFKSFGVQRKG--KGVQFDSKELQVETGNLQDANFLNAVV  524
               +N D R++ N+ GRS+ST+FK  G+QRKG  KG  F+SKE QVETG ++DA FLNAVV
Sbjct  73    HLANNDGRSSKNETGRSKSTAFKFSGLQRKGSGKGAPFESKEPQVETGFIEDAPFLNAVV  132

Query  525   KVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYV  704
             KV+CTHTAPDYSLPWQKQRQ+ STGSAFMIGDGKLLTNAHCVEH TQVKVKRRGDDTKYV
Sbjct  133   KVFCTHTAPDYSLPWQKQRQFASTGSAFMIGDGKLLTNAHCVEHGTQVKVKRRGDDTKYV  192

Query  705   AKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVV  884
             AKVLARGVECDIALLSVES++FWKGAEPL FGHLP LQDAVTVVGYPLGGDTISVTKGVV
Sbjct  193   AKVLARGVECDIALLSVESKDFWKGAEPLCFGHLPHLQDAVTVVGYPLGGDTISVTKGVV  252

Query  885   SRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVI  1064
             SR+EVTSYAHGSSELLGIQIDAA+NPGNSGGPAFNDDGECIGVAFQVYRSD+VENIGYVI
Sbjct  253   SRVEVTSYAHGSSELLGIQIDAAINPGNSGGPAFNDDGECIGVAFQVYRSDDVENIGYVI  312

Query  1065  PTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAH  1244
             P  VVSHFL+DYERNGKY+GFP LGVLLQKLENPALRACL+VPSNEGVL+RK+EPTSD  
Sbjct  313   PAMVVSHFLEDYERNGKYSGFPCLGVLLQKLENPALRACLRVPSNEGVLVRKIEPTSDVS  372

Query  1245  NTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQ  1424
             N +KEGDVIVSFD VRVGCEGTVPFRS+ERIAFRYLIS+KF+GD AELGIIRAGEF+KVQ
Sbjct  373   NVVKEGDVIVSFDGVRVGCEGTVPFRSSERIAFRYLISQKFTGDVAELGIIRAGEFLKVQ  432

Query  1425  IVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANF  1604
              VL PRV LVPYHIEGGQPSYLIVAGLVFTPLSEPLI+EECED+IGLKLL KARYSFA F
Sbjct  433   AVLKPRVHLVPYHIEGGQPSYLIVAGLVFTPLSEPLIEEECEDTIGLKLLIKARYSFAKF  492

Query  1605  KGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFAD  1784
             +GEQIV+LSQVLANEVNIGYED+SNEQ+LKLNG RI+NIHHLAHL+DSCKDKYLVFEF D
Sbjct  493   EGEQIVILSQVLANEVNIGYEDLSNEQVLKLNGTRIKNIHHLAHLVDSCKDKYLVFEFED  552

Query  1785  NFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSE  1964
             NFLV LEREAA + S+SIL DYGIP+ERSSDL+ PYVDSIG  +A DQ EFGDS  SNSE
Sbjct  553   NFLVALEREAASSASSSILIDYGIPAERSSDLLEPYVDSIGPYEATDQHEFGDSPVSNSE  612

Query  1965  FGFDGLLWA  1991
             FG+DGLLWA
Sbjct  613   FGYDGLLWA  621



>ref|XP_006352801.1| PREDICTED: protease Do-like 2, chloroplastic-like isoform X1 
[Solanum tuberosum]
Length=611

 Score =   969 bits (2506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/608 (78%), Positives = 530/608 (87%), Gaps = 13/608 (2%)
 Frame = +3

Query  171   SLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSKGE  350
             SL+S  LF+TS  PS FF+PK+   SQNQ H ++    +  S  E+ A   K +RRSK E
Sbjct  16    SLTSHRLFSTSLRPSSFFIPKA--DSQNQNHKRKVLNKSSSSPPEKVAGKPKFSRRSKNE  73

Query  351   RFFSNVDDRN-TNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVK  527
               F+N D R+ T++ GRSQS + KSFG+Q+KGKG+  DSK+ QVETG++QDA FLNAVVK
Sbjct  74    GPFANADGRSSTSETGRSQSAAIKSFGLQKKGKGILLDSKDQQVETGSIQDAAFLNAVVK  133

Query  528   VYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVA  707
             VYCTHTAPDYSLPWQKQRQ+TSTGSAFMIGDGKLLTNAHCVEHDTQVKVK+RGDDTKYVA
Sbjct  134   VYCTHTAPDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKKRGDDTKYVA  193

Query  708   KVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVS  887
             KVLARGV CDIALLSVES+EFW+GAEPL FG LPRLQDAVTVVGYPLGGDTISVTKGVVS
Sbjct  194   KVLARGVACDIALLSVESKEFWEGAEPLSFGRLPRLQDAVTVVGYPLGGDTISVTKGVVS  253

Query  888   RIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIP  1067
             RIEVTSYAHGSSELLGIQIDAA+NPGNSGGPAFND G+CIGVAFQVYRSD+ ENIGYVIP
Sbjct  254   RIEVTSYAHGSSELLGIQIDAAINPGNSGGPAFNDVGDCIGVAFQVYRSDDAENIGYVIP  313

Query  1068  TTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHN  1247
             TTVVSHFL+DYE+NGKY GFP LGVLLQKLENPALRACLKVPSNEGVL+RKVEPTSD  N
Sbjct  314   TTVVSHFLEDYEKNGKYCGFPCLGVLLQKLENPALRACLKVPSNEGVLVRKVEPTSDISN  373

Query  1248  TLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQI  1427
              +KEGDVIVSFD V VGCEGTVPFRS+ERIAFRYLIS+KF+GD+ ELGIIRAGEFMKVQ 
Sbjct  374   VVKEGDVIVSFDGVHVGCEGTVPFRSSERIAFRYLISQKFTGDSVELGIIRAGEFMKVQA  433

Query  1428  VLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFK  1607
             VL PRV LVPYHIEGGQPSYLIVAGLVFTPLSEPLI+EE EDSIGLKLLTKARYS A F+
Sbjct  434   VLKPRVHLVPYHIEGGQPSYLIVAGLVFTPLSEPLIEEE-EDSIGLKLLTKARYSLAKFE  492

Query  1608  GEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADN  1787
             GEQIVVLSQVLANEVNIGYED+SNEQ+LK+NG RI+NIHHLAHL+DS K KYLVFEF DN
Sbjct  493   GEQIVVLSQVLANEVNIGYEDMSNEQVLKMNGTRIKNIHHLAHLVDSSKGKYLVFEFEDN  552

Query  1788  FLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEF  1967
              LVVLERE A++ S SILKDYGIP+ERSSDL+G YVDS      ++Q E    A ++ EF
Sbjct  553   ILVVLEREEAMSASASILKDYGIPAERSSDLLGQYVDS-----TIEQSE----ATNHGEF  603

Query  1968  GFDGLLWA  1991
             G++G LW+
Sbjct  604   GYEGFLWS  611



>ref|XP_011079745.1| PREDICTED: protease Do-like 2, chloroplastic [Sesamum indicum]
Length=626

 Score =   964 bits (2491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/604 (79%), Positives = 523/604 (87%), Gaps = 3/604 (0%)
 Frame = +3

Query  189   LFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSH-TEREAVTQKCTRRSKGERFFSN  365
             LF+TSR P+     +  +  QNQ   Q K   +      + E  T K   +S+ ER F N
Sbjct  20    LFSTSRRPTYLSSVRKPSDDQNQAPIQGKPKKSLCKFGIQNEVSTLKFKLKSRDERSFPN  79

Query  366   VDDR-NTNKNGRSQSTSFKSFGVQRK-GKGVQFDSKELQVETGNLQDANFLNAVVKVYCT  539
              + R + NK GRSQST FKS GVQ+K  +G+  D KE QVE GNLQ+A+FLNAVVKVYCT
Sbjct  80    SEGRSDWNKAGRSQSTVFKSLGVQKKESQGILVDLKEQQVEAGNLQNASFLNAVVKVYCT  139

Query  540   HTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLA  719
             HTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEH+TQVKVKRRGDDTKYVAKVLA
Sbjct  140   HTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHNTQVKVKRRGDDTKYVAKVLA  199

Query  720   RGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEV  899
             RGVECDIALLSVES+EFW+GAEPL FG LP LQDAVTVVGYPLGG+TISV+KGVVSRIEV
Sbjct  200   RGVECDIALLSVESKEFWQGAEPLHFGCLPNLQDAVTVVGYPLGGETISVSKGVVSRIEV  259

Query  900   TSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVV  1079
             TSYAHGSSELLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRSD+VENIGYVIPTTVV
Sbjct  260   TSYAHGSSELLGIQIDAAINPGNSGGPAFNDKGECIGVAFQVYRSDDVENIGYVIPTTVV  319

Query  1080  SHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKE  1259
             SHFL+DYE+NGKYTGFPSLGVLLQKLENPALRACL VP+NEGVL+RKVEPTS A+  LKE
Sbjct  320   SHFLEDYEKNGKYTGFPSLGVLLQKLENPALRACLNVPTNEGVLVRKVEPTSHANAVLKE  379

Query  1260  GDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSP  1439
             GDVIVSFD+VRVGCEGTVPFRS+ERIAFRYLIS+KF+GD AELGIIR G+F+KVQ++L  
Sbjct  380   GDVIVSFDNVRVGCEGTVPFRSSERIAFRYLISQKFTGDEAELGIIRGGQFLKVQVILDT  439

Query  1440  RVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQI  1619
             RV LVPYHIEG QPSYLIVAGLVFTPLSEPLI EECE+SIGLKLLTKARYS   FKGEQI
Sbjct  440   RVHLVPYHIEGDQPSYLIVAGLVFTPLSEPLIGEECEESIGLKLLTKARYSMPRFKGEQI  499

Query  1620  VVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVV  1799
             V+LSQVLANEVNIGYED+SNEQ+LKLNG  IRNIHHLAHL+DSCK+KYLVFEF DNFLVV
Sbjct  500   VILSQVLANEVNIGYEDMSNEQVLKLNGTWIRNIHHLAHLVDSCKEKYLVFEFEDNFLVV  559

Query  1800  LEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDG  1979
             LERE+AL  S SILK YGIPSERS+DL+ PYVD + QN+ +DQ+EFGDS  SNSE   DG
Sbjct  560   LERESALAASESILKGYGIPSERSADLLDPYVDPVSQNEPIDQREFGDSPASNSEIVHDG  619

Query  1980  LLWA  1991
             LLWA
Sbjct  620   LLWA  623



>ref|XP_010323029.1| PREDICTED: protease Do-like 2, chloroplastic [Solanum lycopersicum]
Length=608

 Score =   949 bits (2452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/582 (80%), Positives = 514/582 (88%), Gaps = 11/582 (2%)
 Frame = +3

Query  249   QNQEHNQRKKPPARVSHTEREAVTQKCTRRSKGERFFSNVDDRN-TNKNGRSQSTSFKSF  425
             QNQ + ++    +  S  E+ A  QK +RRSK E  F+N D R+ T++NGRSQST+ KSF
Sbjct  37    QNQNYKRQVLNKSSSSPPEKVAGKQKFSRRSKNEGPFANADGRSSTSENGRSQSTAIKSF  96

Query  426   GVQRKGKGVQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSA  605
             G+Q+KGKGV  DSK+ QVETG++QDA FLNAVVKVYCTHTAPDYSLPWQKQRQ+TSTGSA
Sbjct  97    GLQKKGKGVLLDSKDQQVETGSIQDAAFLNAVVKVYCTHTAPDYSLPWQKQRQFTSTGSA  156

Query  606   FMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAE  785
             FMIGDGKLLTNAHCVEHDTQVKVK+RGDDTKYVAKVLARGV CD+ALLSVES+EFW+ AE
Sbjct  157   FMIGDGKLLTNAHCVEHDTQVKVKKRGDDTKYVAKVLARGVACDLALLSVESKEFWEAAE  216

Query  786   PLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPG  965
             PL FG LPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYA+GSSELLGIQIDAA+NPG
Sbjct  217   PLSFGRLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYANGSSELLGIQIDAAINPG  276

Query  966   NSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVL  1145
             NSGGPAFNDDG+CIGVAFQVYRSD+ ENIGYVIPTTVVSHFL+DYERNGKY GFP LGVL
Sbjct  277   NSGGPAFNDDGDCIGVAFQVYRSDDAENIGYVIPTTVVSHFLEDYERNGKYCGFPCLGVL  336

Query  1146  LQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRS  1325
             LQKLENPALRACLKVPSNEGVL+RKVEPTSD  N +KEGDVIVSFD V VGCEGTVPFRS
Sbjct  337   LQKLENPALRACLKVPSNEGVLVRKVEPTSDISNVVKEGDVIVSFDGVHVGCEGTVPFRS  396

Query  1326  TERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGL  1505
             +ERIAFRYLIS+KF+GD+ ELGIIRAGEFMKVQ +L PRV LVPYHIE GQPSYLIVAGL
Sbjct  397   SERIAFRYLISQKFTGDSVELGIIRAGEFMKVQAILKPRVHLVPYHIEDGQPSYLIVAGL  456

Query  1506  VFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQ  1685
             VFTPLSEPLI+EE EDSIGLKLLTKARYS A F+GEQIVVLSQVLANEVNIGYED+SNEQ
Sbjct  457   VFTPLSEPLIEEE-EDSIGLKLLTKARYSLAKFEGEQIVVLSQVLANEVNIGYEDMSNEQ  515

Query  1686  ILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSE  1865
             +LKLNG RI+NIHHLAHL+DS K KYLVFEF DN LVVLER+ A++ S SILKDYGIP+E
Sbjct  516   VLKLNGTRIKNIHHLAHLVDSSKGKYLVFEFEDNILVVLERKEAMSASASILKDYGIPAE  575

Query  1866  RSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             RSSDL+G YVDS  Q     Q E    A ++ EFG++GLLWA
Sbjct  576   RSSDLLGQYVDSTTQ-----QSE----ATNHGEFGYEGLLWA  608



>ref|XP_006444216.1| hypothetical protein CICLE_v10019366mg [Citrus clementina]
 gb|ESR57456.1| hypothetical protein CICLE_v10019366mg [Citrus clementina]
 gb|KDO87409.1| hypothetical protein CISIN_1g007357mg [Citrus sinensis]
Length=606

 Score =   938 bits (2425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/533 (85%), Positives = 487/533 (91%), Gaps = 2/533 (0%)
 Frame = +3

Query  396   RSQSTSFKSFGVQRKGKG-VQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQ  572
             RSQST+FKSFG QRK K   QFDSKE   E+GNLQDA FLNAVVKVYCTHTAPDYSLPWQ
Sbjct  75    RSQSTAFKSFGAQRKDKKEFQFDSKEQLSESGNLQDAAFLNAVVKVYCTHTAPDYSLPWQ  134

Query  573   KQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLS  752
             KQRQYTSTGSAFMIGDGKLLTNAHCVEH TQVKVKRRGDDTKYVAKVLARGV+CDIALLS
Sbjct  135   KQRQYTSTGSAFMIGDGKLLTNAHCVEHYTQVKVKRRGDDTKYVAKVLARGVDCDIALLS  194

Query  753   VESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELL  932
             VESEEFWK AEPL  GHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELL
Sbjct  195   VESEEFWKDAEPLCLGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELL  254

Query  933   GIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNG  1112
             GIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+EVENIGYVIPTTVVSHFL DYERNG
Sbjct  255   GIQIDAAINPGNSGGPAFNDKGECIGVAFQVYRSEEVENIGYVIPTTVVSHFLSDYERNG  314

Query  1113  KYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVR  1292
             KYTGFP LGVLLQKLENPALR CLKVPSNEGVL+R+VEPTSDA+N LKEGDVIVSFDDV 
Sbjct  315   KYTGFPCLGVLLQKLENPALRTCLKVPSNEGVLVRRVEPTSDANNILKEGDVIVSFDDVC  374

Query  1293  VGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEG  1472
             VG EGTVPFRS ERIAFRYLIS+KF+GD AELGIIRAG FMKV++VL+PRV LVPYHI+G
Sbjct  375   VGSEGTVPFRSNERIAFRYLISQKFAGDVAELGIIRAGTFMKVKVVLNPRVHLVPYHIDG  434

Query  1473  GQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEV  1652
             GQPSYLI+AGLVFTPLSEPLI+EEC+DSIGLKLL KARYS A F+GEQ+V+LSQVLANEV
Sbjct  435   GQPSYLIIAGLVFTPLSEPLIEEECDDSIGLKLLAKARYSLARFEGEQMVILSQVLANEV  494

Query  1653  NIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTST  1832
             +IGYED+SN+Q+LK NG RI+NIHHLAHL+DSCKDKYLVFEF DN+L VLEREAA+  S+
Sbjct  495   SIGYEDMSNQQVLKFNGTRIKNIHHLAHLVDSCKDKYLVFEFEDNYLAVLEREAAVAASS  554

Query  1833  SILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
              ILKDYGIPSERSSDL+ PYVD +G N A++Q   GDS  S+ E GFDGL WA
Sbjct  555   CILKDYGIPSERSSDLLEPYVDPLGGNQAINQDS-GDSPVSDLEIGFDGLKWA  606



>ref|XP_006479864.1| PREDICTED: protease Do-like 2, chloroplastic-like [Citrus sinensis]
Length=606

 Score =   936 bits (2420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/533 (85%), Positives = 487/533 (91%), Gaps = 2/533 (0%)
 Frame = +3

Query  396   RSQSTSFKSFGVQRKGKG-VQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQ  572
             RSQST+FKSFG QRK K   QFDSKE   E+GNLQDA FLNAVVKVYCTHTAPDYSLPWQ
Sbjct  75    RSQSTAFKSFGAQRKDKKEFQFDSKEQLSESGNLQDAAFLNAVVKVYCTHTAPDYSLPWQ  134

Query  573   KQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLS  752
             KQRQYTSTGSAFMIGDGKLLTNAHCVEH TQVKVKRRGDDTKYVAKVLARGV+CDIALLS
Sbjct  135   KQRQYTSTGSAFMIGDGKLLTNAHCVEHYTQVKVKRRGDDTKYVAKVLARGVDCDIALLS  194

Query  753   VESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELL  932
             VESEEFWK AEPL  GHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELL
Sbjct  195   VESEEFWKDAEPLCLGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELL  254

Query  933   GIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNG  1112
             GIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+EVENIGYVIPTTVVSHFL DYERNG
Sbjct  255   GIQIDAAINPGNSGGPAFNDKGECIGVAFQVYRSEEVENIGYVIPTTVVSHFLSDYERNG  314

Query  1113  KYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVR  1292
             KYTGFP LGVLLQKLENPALR CLKVPSNEGVL+R+VEPTSDA+N LKEGDVIVSFDDV 
Sbjct  315   KYTGFPCLGVLLQKLENPALRTCLKVPSNEGVLVRRVEPTSDANNILKEGDVIVSFDDVC  374

Query  1293  VGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEG  1472
             VG EGTVPFRS ERIAFRYLIS+KF+GD AELGIIRAG FMKV++VL+PRV LVPYHI+G
Sbjct  375   VGSEGTVPFRSNERIAFRYLISQKFAGDVAELGIIRAGTFMKVKVVLNPRVHLVPYHIDG  434

Query  1473  GQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEV  1652
             GQPSYLI+AGLVFTPLSEPLI+EEC+DSIGLKLL KARYS A F+GEQ+V+LSQVLANEV
Sbjct  435   GQPSYLIIAGLVFTPLSEPLIEEECDDSIGLKLLAKARYSLARFEGEQMVILSQVLANEV  494

Query  1653  NIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTST  1832
             +IGYED+SN+Q+LK NG RI+NIHHLAHL+DSCKDKYLVFEF DN+L VLEREAA+  S+
Sbjct  495   SIGYEDMSNQQVLKFNGTRIKNIHHLAHLVDSCKDKYLVFEFEDNYLAVLEREAAVAASS  554

Query  1833  SILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
              ILKDYGIPSERSSDL+ P+VD +G N A++Q   GDS  S+ E GFDGL WA
Sbjct  555   CILKDYGIPSERSSDLLEPFVDPLGGNQAINQDS-GDSPVSDLEIGFDGLKWA  606



>ref|XP_007200306.1| hypothetical protein PRUPE_ppa002853mg [Prunus persica]
 gb|EMJ01505.1| hypothetical protein PRUPE_ppa002853mg [Prunus persica]
Length=628

 Score =   936 bits (2418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/616 (76%), Positives = 522/616 (85%), Gaps = 14/616 (2%)
 Frame = +3

Query  165   RCSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVS------HTEREAVTQK  326
             R S+S QP FATS   S     K  +QS+ +  +  +K  +  S        E+EAV  K
Sbjct  20    RSSVSIQPCFATSLWSSNGHALKPVSQSKRERASSSRKGSSSSSSSSAKSQPEKEAVPNK  79

Query  327   CTRRSKGERFFSNVDDRNTNKNGRSQSTSFKSFGVQRKGKG-VQFDSKELQVETGNLQDA  503
              +    G+R+  +V  R   K G+SQ T+++SFG QRK K     D KE QVE  +LQDA
Sbjct  80    LS--GNGDRW--SVTGRG--KKGQSQPTAYRSFGTQRKEKKEFAVDQKEQQVEPRSLQDA  133

Query  504   NFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRR  683
             +FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEH TQVKVKRR
Sbjct  134   DFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHYTQVKVKRR  193

Query  684   GDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTI  863
             GDDTKYVAKVLARGV+CDIALLSVESEEFWKGAEPLQ G LP LQ+AVTVVGYPLGGDTI
Sbjct  194   GDDTKYVAKVLARGVDCDIALLSVESEEFWKGAEPLQLGSLPHLQEAVTVVGYPLGGDTI  253

Query  864   SVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEV  1043
             SVTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+E 
Sbjct  254   SVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEEA  313

Query  1044  ENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKV  1223
             ENIGYVIPTTVVSHFL DYERNG+YTGFP LGVLLQKLENPALRACLKV S EGVL+R+V
Sbjct  314   ENIGYVIPTTVVSHFLDDYERNGRYTGFPCLGVLLQKLENPALRACLKVESIEGVLVRRV  373

Query  1224  EPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRA  1403
             EPTSDAHN LKEGDVIVSFDDV VGCEGTVPFRS ERIAFRYLIS+KF+GD ++LGIIRA
Sbjct  374   EPTSDAHNVLKEGDVIVSFDDVHVGCEGTVPFRSNERIAFRYLISQKFAGDVSDLGIIRA  433

Query  1404  GEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKA  1583
             GEF KV+ VL+PRV LVP+HI+GGQPSYLI+AGLVFTPLSEPLI EECEDSIGLKLL KA
Sbjct  434   GEFKKVKAVLNPRVHLVPFHIDGGQPSYLIIAGLVFTPLSEPLIDEECEDSIGLKLLAKA  493

Query  1584  RYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKY  1763
             RYS A FKGEQIV+LSQVLANEVNIGYED+SN+Q+LKLNG +IRNIHHLA+L+DSCKDKY
Sbjct  494   RYSLARFKGEQIVILSQVLANEVNIGYEDMSNQQVLKLNGTQIRNIHHLAYLVDSCKDKY  553

Query  1764  LVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGD  1943
             LVFEF DN++ VLEREAA   S+ ILKDYGIPSERSSDL+ PYVDS+G N AV+ Q+ GD
Sbjct  554   LVFEFEDNYITVLEREAATAASSCILKDYGIPSERSSDLLEPYVDSLGDNQAVN-QDIGD  612

Query  1944  SAESNSEFGFDGLLWA  1991
             S  SN E GFDG++WA
Sbjct  613   SPVSNLEIGFDGIIWA  628



>ref|XP_002520690.1| serine endopeptidase degp2, putative [Ricinus communis]
 gb|EEF41652.1| serine endopeptidase degp2, putative [Ricinus communis]
Length=621

 Score =   934 bits (2415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/613 (75%), Positives = 513/613 (84%), Gaps = 15/613 (2%)
 Frame = +3

Query  165   RCSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSK  344
             RC ++SQ  FATS         +S T S+   H+ R     R S +  +    +   + K
Sbjct  20    RCYVTSQRHFATSHH-------RSLTSSKAINHSGRNSK--RGSSSSIDKSNNRNNAKLK  70

Query  345   GERFFSNV-DDRNTNK--NGRSQSTSFKSFGVQRKGKG-VQFDSKELQVETGNLQDANFL  512
             G+R  SN+  D N  K   G++QS ++KSFG +RK K   QFDS ELQ+E+G LQD  FL
Sbjct  71    GKR--SNLYSDENGGKAERGKAQSVAYKSFGTERKDKKEFQFDSNELQIESGKLQDMAFL  128

Query  513   NAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDD  692
             NAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEH TQVKVKRRGDD
Sbjct  129   NAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHYTQVKVKRRGDD  188

Query  693   TKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVT  872
             TKYVAKVLARGV+CDIALLSV+ +EFW+GAEPLQ GHLPRLQDAVTVVGYPLGGDTISVT
Sbjct  189   TKYVAKVLARGVDCDIALLSVKDKEFWEGAEPLQLGHLPRLQDAVTVVGYPLGGDTISVT  248

Query  873   KGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENI  1052
             KGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFN+ GECIGVAFQVYRS+E ENI
Sbjct  249   KGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNEQGECIGVAFQVYRSEEAENI  308

Query  1053  GYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPT  1232
             GYVIPTTVVSHFL DYERNGKYTGFP LGVLLQKLENPALRACLKV SNEGVL+R++EPT
Sbjct  309   GYVIPTTVVSHFLNDYERNGKYTGFPCLGVLLQKLENPALRACLKVESNEGVLVRRIEPT  368

Query  1233  SDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEF  1412
             SDA+N LKEGDVIVSFDDV VGCEGTVPFRS ERIAFRYLIS+KF+GD AELGIIRAG F
Sbjct  369   SDANNVLKEGDVIVSFDDVNVGCEGTVPFRSNERIAFRYLISQKFAGDVAELGIIRAGSF  428

Query  1413  MKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYS  1592
             MKV++VL+PRV LVPYH++GGQPSYLI+AGLVFTPLSEPLI EECE SIGLKLL KARYS
Sbjct  429   MKVKVVLNPRVHLVPYHVDGGQPSYLIIAGLVFTPLSEPLIDEECEGSIGLKLLAKARYS  488

Query  1593  FANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVF  1772
              A FKGEQIV+LSQVLANEVNIGYED+SN+Q+LK NG RI+NIHHLA+L+DSCKDKYLVF
Sbjct  489   LARFKGEQIVILSQVLANEVNIGYEDMSNQQVLKFNGTRIKNIHHLAYLVDSCKDKYLVF  548

Query  1773  EFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAE  1952
             EF DN+L VLER+ A   S+ IL DYGIPSERS DL+ PYVDS   N   +Q   GDS  
Sbjct  549   EFEDNYLAVLERQPATAASSCILTDYGIPSERSPDLLKPYVDSQVDNQLAEQDALGDSPV  608

Query  1953  SNSEFGFDGLLWA  1991
             SN E G DG+LWA
Sbjct  609   SNLEIGNDGILWA  621



>ref|XP_007050776.1| DEGP protease 2 isoform 1 [Theobroma cacao]
 gb|EOX94933.1| DEGP protease 2 isoform 1 [Theobroma cacao]
Length=633

 Score =   931 bits (2407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/615 (75%), Positives = 518/615 (84%), Gaps = 7/615 (1%)
 Frame = +3

Query  165   RCSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPA---RVSHTEREAVTQK-CT  332
             R S+S     ATS   S+  +   + ++ N +    K   +   R  + +++ V+QK   
Sbjct  20    RYSVSYHRRLATSTSTSQASLDALSPKATNDKKRALKSCSSTSPRKFNVKKDPVSQKKLP  79

Query  333   RRSKGERFFSNVDDRNTNKN-GRSQSTSFKSFGVQRKGKG-VQFDSKELQVETGNLQDAN  506
              RSK E+     D  +   + GR QST FKSFG QRK +   Q D +E QVE GNLQDA 
Sbjct  80    GRSKDEKSSLYADGISGRGDMGRPQSTGFKSFGTQRKDREEFQLDLREQQVEPGNLQDAT  139

Query  507   FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRG  686
             FLNAVVKVYCTHTAPDYSLPWQKQRQ+TSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRG
Sbjct  140   FLNAVVKVYCTHTAPDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRG  199

Query  687   DDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTIS  866
             DDTKYVAKVLARGV+CDIALLSVES+EFW+GAEPL+ GHLP LQDAVTVVGYPLGGDTIS
Sbjct  200   DDTKYVAKVLARGVDCDIALLSVESKEFWRGAEPLRLGHLPGLQDAVTVVGYPLGGDTIS  259

Query  867   VTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVE  1046
             VTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFN+ GECIGVAFQVYRS+E E
Sbjct  260   VTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNEQGECIGVAFQVYRSEEAE  319

Query  1047  NIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVE  1226
             NIGYVIPTTVVSHFL DYERNGKYTGFP LGVLLQKLENPALRACL V SNEGVL+R+VE
Sbjct  320   NIGYVIPTTVVSHFLSDYERNGKYTGFPCLGVLLQKLENPALRACLHVQSNEGVLVRRVE  379

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PTSDA+N LKEGDVIVSFDDV VG EGTVPFRS ERIAFRYLIS+KF+GD AELGI+RAG
Sbjct  380   PTSDANNVLKEGDVIVSFDDVHVGSEGTVPFRSNERIAFRYLISQKFAGDVAELGIVRAG  439

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKAR  1586
              FMKVQ+VL+ RV LVPYHI+GGQPSYLI+AGLVFTPLSEPLI+EECEDSIGLKLL KAR
Sbjct  440   RFMKVQVVLNRRVHLVPYHIDGGQPSYLIIAGLVFTPLSEPLIEEECEDSIGLKLLAKAR  499

Query  1587  YSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYL  1766
             YS A FKGEQIV+LSQVLANEVNIGYED+ N+Q+LK NG RI+NIHHLAHL+  CKDKYL
Sbjct  500   YSLARFKGEQIVILSQVLANEVNIGYEDMGNQQVLKFNGIRIKNIHHLAHLVACCKDKYL  559

Query  1767  VFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDS  1946
             VFEF DN+L VLEREAA+  S+ ILKDYGIPSE+S DL+ PYVDS+G N A+ +Q++GDS
Sbjct  560   VFEFEDNYLAVLEREAAMAASSRILKDYGIPSEKSDDLLEPYVDSLGDNQAI-EQDYGDS  618

Query  1947  AESNSEFGFDGLLWA  1991
               SN E GF+GLLWA
Sbjct  619   PVSNLEIGFEGLLWA  633



>ref|XP_011033618.1| PREDICTED: protease Do-like 2, chloroplastic [Populus euphratica]
Length=621

 Score =   929 bits (2402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/614 (76%), Positives = 518/614 (84%), Gaps = 19/614 (3%)
 Frame = +3

Query  165   RCSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTR-RS  341
             RC + SQP  ATS+        K+         N+R++P        +E V+QK +  +S
Sbjct  20    RCCVPSQPYLATSQHSIASVTCKAVV-------NRRRRPGKY-----KEGVSQKKSPGKS  67

Query  342   KGER--FFSNVDDRNTNKN--GRSQSTSFKSFGVQRKGKG-VQFDSKELQVETGNLQDAN  506
             K +R       DD  T K   G+SQS +FKSFG QRK K   +FD KE Q E  NL+DA 
Sbjct  68    KDKRSSLHDEDDDGITGKRNAGKSQSMAFKSFGAQRKDKKEFKFDMKEQQFEPQNLKDAA  127

Query  507   FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRG  686
             FL+AVVKVYCTHT PDYSLPWQKQRQYTSTGSAFMIG+GKLLTNAHCVE+ TQVKVKRRG
Sbjct  128   FLDAVVKVYCTHTEPDYSLPWQKQRQYTSTGSAFMIGNGKLLTNAHCVEYYTQVKVKRRG  187

Query  687   DDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTIS  866
             DDTKYVAKVLARGV+CDIALLSVESEEFW+GAEPL+FGHLPRLQDAVTVVGYPLGGDTIS
Sbjct  188   DDTKYVAKVLARGVDCDIALLSVESEEFWEGAEPLKFGHLPRLQDAVTVVGYPLGGDTIS  247

Query  867   VTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVE  1046
             VTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+EVE
Sbjct  248   VTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEEVE  307

Query  1047  NIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVE  1226
             NIGYVIPT VVSHFL+D+ERN KYTGFPSLGV+LQKLENPALRACLKV SNEGVL+R+VE
Sbjct  308   NIGYVIPTAVVSHFLKDFERNEKYTGFPSLGVMLQKLENPALRACLKVQSNEGVLVRRVE  367

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+DA+  LKEGDVIVSFDDV VGCEGTVPFRS ERIAFRYLIS+KF+GD AELGIIRAG
Sbjct  368   PTADANRVLKEGDVIVSFDDVHVGCEGTVPFRSNERIAFRYLISQKFAGDEAELGIIRAG  427

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKAR  1586
              FMKV++VL+PRV LVPYH++GGQPSYLI+AGLVFTPLSEPLI+EECE SIGLKLL K+R
Sbjct  428   SFMKVKVVLNPRVHLVPYHVDGGQPSYLIIAGLVFTPLSEPLIEEECEGSIGLKLLAKSR  487

Query  1587  YSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYL  1766
             YS A FKGEQIV+LSQVLANEVN GYED+SN+Q+LK NG +I+NIHHLAHL+DSCK++YL
Sbjct  488   YSLARFKGEQIVILSQVLANEVNFGYEDMSNQQVLKFNGTQIKNIHHLAHLVDSCKNRYL  547

Query  1767  VFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDS  1946
             VFEF DN+LVVLEREA    S  ILKDYGIPSERSSDL  PYVDS+  N AVD Q+FG+S
Sbjct  548   VFEFEDNYLVVLEREATSACSPHILKDYGIPSERSSDLSEPYVDSLEDNQAVD-QDFGNS  606

Query  1947  AESNSEFGFDGLLW  1988
               SN E GFDGLLW
Sbjct  607   TVSNLEIGFDGLLW  620



>ref|XP_007050777.1| DEGP protease 2 isoform 2 [Theobroma cacao]
 gb|EOX94934.1| DEGP protease 2 isoform 2 [Theobroma cacao]
Length=634

 Score =   927 bits (2396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/616 (75%), Positives = 518/616 (84%), Gaps = 8/616 (1%)
 Frame = +3

Query  165   RCSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPA---RVSHTEREAVTQK-CT  332
             R S+S     ATS   S+  +   + ++ N +    K   +   R  + +++ V+QK   
Sbjct  20    RYSVSYHRRLATSTSTSQASLDALSPKATNDKKRALKSCSSTSPRKFNVKKDPVSQKKLP  79

Query  333   RRSKGERFFSNVDDRNTNKN-GRSQSTSFKSFGVQRKGKG-VQFDSKELQVETGNLQDAN  506
              RSK E+     D  +   + GR QST FKSFG QRK +   Q D +E QVE GNLQDA 
Sbjct  80    GRSKDEKSSLYADGISGRGDMGRPQSTGFKSFGTQRKDREEFQLDLREQQVEPGNLQDAT  139

Query  507   FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRG  686
             FLNAVVKVYCTHTAPDYSLPWQKQRQ+TSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRG
Sbjct  140   FLNAVVKVYCTHTAPDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRG  199

Query  687   DDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTIS  866
             DDTKYVAKVLARGV+CDIALLSVES+EFW+GAEPL+ GHLP LQDAVTVVGYPLGGDTIS
Sbjct  200   DDTKYVAKVLARGVDCDIALLSVESKEFWRGAEPLRLGHLPGLQDAVTVVGYPLGGDTIS  259

Query  867   VTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVE  1046
             VTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFN+ GECIGVAFQVYRS+E E
Sbjct  260   VTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNEQGECIGVAFQVYRSEEAE  319

Query  1047  NIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVE  1226
             NIGYVIPTTVVSHFL DYERNGKYTGFP LGVLLQKLENPALRACL V SNEGVL+R+VE
Sbjct  320   NIGYVIPTTVVSHFLSDYERNGKYTGFPCLGVLLQKLENPALRACLHVQSNEGVLVRRVE  379

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PTSDA+N LKEGDVIVSFDDV VG EGTVPFRS ERIAFRYLIS+KF+GD AELGI+RAG
Sbjct  380   PTSDANNVLKEGDVIVSFDDVHVGSEGTVPFRSNERIAFRYLISQKFAGDVAELGIVRAG  439

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKAR  1586
              FMKVQ+VL+ RV LVPYHI+GGQPSYLI+AGLVFTPLSEPLI+EECEDSIGLKLL KAR
Sbjct  440   RFMKVQVVLNRRVHLVPYHIDGGQPSYLIIAGLVFTPLSEPLIEEECEDSIGLKLLAKAR  499

Query  1587  YSFANFKGEQIVVLSQVLANEVNIGYEDISN-EQILKLNGKRIRNIHHLAHLLDSCKDKY  1763
             YS A FKGEQIV+LSQVLANEVNIGYED+ N +Q+LK NG RI+NIHHLAHL+  CKDKY
Sbjct  500   YSLARFKGEQIVILSQVLANEVNIGYEDMGNQQQVLKFNGIRIKNIHHLAHLVACCKDKY  559

Query  1764  LVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGD  1943
             LVFEF DN+L VLEREAA+  S+ ILKDYGIPSE+S DL+ PYVDS+G N A+ +Q++GD
Sbjct  560   LVFEFEDNYLAVLEREAAMAASSRILKDYGIPSEKSDDLLEPYVDSLGDNQAI-EQDYGD  618

Query  1944  SAESNSEFGFDGLLWA  1991
             S  SN E GF+GLLWA
Sbjct  619   SPVSNLEIGFEGLLWA  634



>ref|XP_002270247.1| PREDICTED: protease Do-like 2, chloroplastic [Vitis vinifera]
Length=606

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/536 (83%), Positives = 484/536 (90%), Gaps = 5/536 (1%)
 Frame = +3

Query  396   RSQSTSFKSFGVQ---RKGKGVQFDSKELQ-VETGNLQDANFLNAVVKVYCTHTAPDYSL  563
             R+QS+ FKSFG Q   +  KGV  D KE Q VETGNLQD  FLNAVVKVYCTHTAPDYSL
Sbjct  72    RTQSSPFKSFGAQSQRKDKKGVSSDLKEQQQVETGNLQDGAFLNAVVKVYCTHTAPDYSL  131

Query  564   PWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIA  743
             PWQKQRQYTSTGSAF+IGDGKLLTNAHCVEH TQVKVKRRGDDTKYVAKVLARG+ECDIA
Sbjct  132   PWQKQRQYTSTGSAFIIGDGKLLTNAHCVEHATQVKVKRRGDDTKYVAKVLARGIECDIA  191

Query  744   LLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS  923
             LLSVESEEFWKG EPL FG LPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS
Sbjct  192   LLSVESEEFWKGTEPLNFGRLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS  251

Query  924   ELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYE  1103
             +LLGIQIDAA+NPGNSGGPAFND GECIGVAFQV+RS++VENIGYVIPTTVVSHFL DYE
Sbjct  252   DLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVFRSEDVENIGYVIPTTVVSHFLDDYE  311

Query  1104  RNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFD  1283
             RNGKYTGFP LGVLLQKLENPALR+CLKV SNEGVL+R+VEPTSDA+N LKEGDVIVSFD
Sbjct  312   RNGKYTGFPCLGVLLQKLENPALRSCLKVQSNEGVLVRRVEPTSDANNVLKEGDVIVSFD  371

Query  1284  DVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYH  1463
              V VGCEGTVPFRSTERIAFRYLIS+KF+GD  E+GIIRAG FMKVQ+VL PRV LVPYH
Sbjct  372   GVHVGCEGTVPFRSTERIAFRYLISQKFTGDVVEVGIIRAGAFMKVQVVLDPRVHLVPYH  431

Query  1464  IEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLA  1643
             IEGGQPSYLI++GLVFTPLSEPLI+EECED+IGLKLLTKARYS A FKGEQIV+LSQVLA
Sbjct  432   IEGGQPSYLIISGLVFTPLSEPLIEEECEDTIGLKLLTKARYSLARFKGEQIVILSQVLA  491

Query  1644  NEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALT  1823
             NEVNIGYE++SN+Q+LK NG  I+NIHHLAHL+DSCKDKYLVFEF DN+L VLEREAA  
Sbjct  492   NEVNIGYENMSNQQVLKFNGTWIKNIHHLAHLIDSCKDKYLVFEFEDNYLAVLEREAAAA  551

Query  1824  TSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
              S  ILKDYGIPSERSSDL+ PY+DS+G N +++ Q+FGD   SN E G DGLLWA
Sbjct  552   ASPCILKDYGIPSERSSDLLKPYMDSLGDNRSIN-QDFGDIPVSNLEIGSDGLLWA  606



>ref|XP_010545055.1| PREDICTED: protease Do-like 2, chloroplastic [Tarenaya hassleriana]
Length=627

 Score =   923 bits (2385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/608 (75%), Positives = 510/608 (84%), Gaps = 4/608 (1%)
 Frame = +3

Query  171   SLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSKGE  350
             S S +   A S+       P+++ Q +    +     PA+ +        +K   R+K E
Sbjct  23    SASPRCFVAASQRSLTSVTPRASYQKRRALGSDSSPSPAKFNPQNDLTSQKKFQGRTKNE  82

Query  351   RFFSNVDDRNTNKNGRSQSTSFKSFGVQRKGKG-VQFDSKELQVETGNLQDANFLNAVVK  527
                  +  R     GRSQST+FK+FG QRK K   Q D +E QV++G +QDA+FL+AVVK
Sbjct  83    ISTDGISGRR--DGGRSQSTAFKAFGTQRKEKKEFQPDLREQQVDSGKIQDASFLDAVVK  140

Query  528   VYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVA  707
             VYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDD KYVA
Sbjct  141   VYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDRKYVA  200

Query  708   KVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVS  887
             KVLARGV+CDIALLSVE+EEFWKGAEPL+ GHLPRLQDAVTVVGYPLGGDTISVTKGVVS
Sbjct  201   KVLARGVDCDIALLSVENEEFWKGAEPLRLGHLPRLQDAVTVVGYPLGGDTISVTKGVVS  260

Query  888   RIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIP  1067
             RIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+E ENIGYVIP
Sbjct  261   RIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEEAENIGYVIP  320

Query  1068  TTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHN  1247
             TTVVSHFL DYE+NGKYTGFP LGVLLQKLENP LR CLKVPSNEGVL+R+VEPTSDA+N
Sbjct  321   TTVVSHFLTDYEKNGKYTGFPCLGVLLQKLENPVLRECLKVPSNEGVLVRRVEPTSDANN  380

Query  1248  TLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQI  1427
              LKEGDVIVSFDDV VGCEGTVPFR+ ERIAFRYLIS+KF+GD  ELG+IRAGE MK ++
Sbjct  381   LLKEGDVIVSFDDVHVGCEGTVPFRTNERIAFRYLISQKFAGDVIELGVIRAGERMKAKV  440

Query  1428  VLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFK  1607
             VL+PRV LVPYHI+GGQPSY+I+AGLVFTPLSEPLI+EECEDSIGLKLLTKARYS A F+
Sbjct  441   VLNPRVHLVPYHIDGGQPSYIIIAGLVFTPLSEPLIEEECEDSIGLKLLTKARYSLAKFR  500

Query  1608  GEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADN  1787
             GEQIV+LSQVLANEVNIGYED++N+Q+LK NG  IRNIHHLAHL+D+CKDKYLVFEF DN
Sbjct  501   GEQIVILSQVLANEVNIGYEDMNNQQVLKFNGIPIRNIHHLAHLVDTCKDKYLVFEFEDN  560

Query  1788  FLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEF  1967
             ++ VLEREAA   S+ IL+DYGIPSERSSDL  PYVD +  + A D Q+ GDS  SN E 
Sbjct  561   YIAVLEREAANAASSCILRDYGIPSERSSDLSEPYVDFVDGSQARD-QDSGDSPVSNLEI  619

Query  1968  GFDGLLWA  1991
             GFDGLLWA
Sbjct  620   GFDGLLWA  627



>ref|XP_008451432.1| PREDICTED: protease Do-like 2, chloroplastic [Cucumis melo]
Length=636

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/533 (81%), Positives = 487/533 (91%), Gaps = 0/533 (0%)
 Frame = +3

Query  393   GRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQ  572
             GR Q+ ++KSFG+QRK K    ++ E QVE+GNLQ A FLNAVVKVYCTHTAPDYSLPWQ
Sbjct  104   GRLQTEAYKSFGMQRKDKKELVNAIEEQVESGNLQGAAFLNAVVKVYCTHTAPDYSLPWQ  163

Query  573   KQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLS  752
             KQRQ+TSTGSAFMIGDGKLLTNAHCVEHDTQVKVK+RGDDTKYVAKVLARGV+CDIALLS
Sbjct  164   KQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKKRGDDTKYVAKVLARGVDCDIALLS  223

Query  753   VESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELL  932
             VE+EEFWKGAEPL+FG+LP LQDAVTVVGYPLGGDTISVT+GVVSRIEVTSYAHGSS+LL
Sbjct  224   VENEEFWKGAEPLKFGNLPSLQDAVTVVGYPLGGDTISVTRGVVSRIEVTSYAHGSSDLL  283

Query  933   GIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNG  1112
             GIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+EVENIGYVIPTTVVSHFL DYERNG
Sbjct  284   GIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEEVENIGYVIPTTVVSHFLNDYERNG  343

Query  1113  KYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVR  1292
             KYTGFPSLGVLLQKLENPALRACL+V SNEGVL+R+VEPTSDA+N LKEGDVIVSFDD++
Sbjct  344   KYTGFPSLGVLLQKLENPALRACLRVKSNEGVLVRRVEPTSDANNVLKEGDVIVSFDDIK  403

Query  1293  VGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEG  1472
             VGCEGTVPFR+ ERIAFRYLIS+KF+GD AELGIIR+GE +K +++L+PRV LVP+H++G
Sbjct  404   VGCEGTVPFRTNERIAFRYLISQKFAGDVAELGIIRSGELIKAKVILNPRVHLVPFHVDG  463

Query  1473  GQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEV  1652
             GQPSYLI+AGLVFTPLSEPLI EECEDSIGLKLL KARYS A+FKGEQIV+LSQVLANEV
Sbjct  464   GQPSYLIIAGLVFTPLSEPLIDEECEDSIGLKLLAKARYSLASFKGEQIVILSQVLANEV  523

Query  1653  NIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTST  1832
             NIGYED+ N+Q+LKLNG RIRNIHHL HL+D+CKDK+LVFEF +N++ VLEREAA+  S+
Sbjct  524   NIGYEDMGNQQVLKLNGTRIRNIHHLTHLIDTCKDKFLVFEFEENYIAVLEREAAIAASS  583

Query  1833  SILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
              IL+DYGIPSERSSDL+ PYVD  G    +  Q +GDS  SN E GF+GLLWA
Sbjct  584   CILRDYGIPSERSSDLLEPYVDISGDEKGMVDQNYGDSPVSNVEIGFEGLLWA  636



>ref|XP_010941774.1| PREDICTED: protease Do-like 2, chloroplastic [Elaeis guineensis]
Length=617

 Score =   920 bits (2379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/603 (76%), Positives = 506/603 (84%), Gaps = 15/603 (2%)
 Frame = +3

Query  189   LFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQK-CTRRSKGERFFSN  365
             +FA S  P R           +++ + RK PPAR +  E + ++QK    R K ER +  
Sbjct  28    IFACSHRPPR-----------SRKKSLRKGPPARENGGEFKGISQKRFPGRGKDERAYLP  76

Query  366   VDDRNTNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVE-TGNLQDANFLNAVVKVYCTH  542
              D  +  ++G SQS  FKS G+Q+K KG+ +D +E Q++ TGNLQD  FLNAVVKVYCTH
Sbjct  77    PDG-SRGESGWSQSAVFKSAGLQKKDKGLVYDLREQQLDDTGNLQDVTFLNAVVKVYCTH  135

Query  543   TAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLAR  722
             TAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTK+VAKVLAR
Sbjct  136   TAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKFVAKVLAR  195

Query  723   GVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVT  902
             GVECDIALLSVESEEFW+GAEPL FG LP LQD+VTVVGYPLGGDTISVTKGVVSRIEVT
Sbjct  196   GVECDIALLSVESEEFWRGAEPLHFGRLPCLQDSVTVVGYPLGGDTISVTKGVVSRIEVT  255

Query  903   SYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVS  1082
             SYAHG+S+LLGIQIDAAVNPGNSGGPAFND GECIGVAFQ +RS+E ENIGYVIPTTVVS
Sbjct  256   SYAHGASDLLGIQIDAAVNPGNSGGPAFNDQGECIGVAFQAFRSEEAENIGYVIPTTVVS  315

Query  1083  HFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEG  1262
             HFL DYERNGKYTGFP LGVLLQKLENPALRACLKVPSNEGVL+R+VEPTS A N LKEG
Sbjct  316   HFLNDYERNGKYTGFPCLGVLLQKLENPALRACLKVPSNEGVLVRRVEPTSAASNVLKEG  375

Query  1263  DVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPR  1442
             DVIVSFD V VGCEGTVPFRSTERIAFRYLIS+KFSGD AELGIIR G FMKV+ VL PR
Sbjct  376   DVIVSFDGVPVGCEGTVPFRSTERIAFRYLISQKFSGDVAELGIIREGSFMKVKTVLQPR  435

Query  1443  VDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIV  1622
             V LVPYHIEGGQPSYLI+AGLVFTPLSEPLI EECEDSIGLKLL KARYS A FKGE+IV
Sbjct  436   VHLVPYHIEGGQPSYLIIAGLVFTPLSEPLIDEECEDSIGLKLLAKARYSLARFKGEEIV  495

Query  1623  VLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVL  1802
             +LSQVLANEVNIGYED+ N+Q+LK NG  I+NI HLAHL+DSCKD+YLVFEF DNFL VL
Sbjct  496   ILSQVLANEVNIGYEDMGNQQVLKFNGMPIKNIRHLAHLVDSCKDRYLVFEFEDNFLAVL  555

Query  1803  EREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGL  1982
             EREAA   S  ILKDYGIP ERS+DL  PY+D   +++ V  Q+ GDS  SN E GFDGL
Sbjct  556   EREAAAAVSPCILKDYGIPFERSADLREPYID-FSEDNRVPSQDIGDSPVSNLEIGFDGL  614

Query  1983  LWA  1991
             LWA
Sbjct  615   LWA  617



>ref|XP_004290719.1| PREDICTED: protease Do-like 2, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=622

 Score =   920 bits (2378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/611 (75%), Positives = 505/611 (83%), Gaps = 19/611 (3%)
 Frame = +3

Query  177   SSQPLFATS-RPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSKGER  353
             ++QP FA S    S     K   QS     N RK   +R   +E+E V +K         
Sbjct  25    AAQPSFAASLWSGSSCHTIKPVCQSNGAASNSRKGDKSR---SEKEGVKKK---------  72

Query  354   FFSNVD---DRNTNKNGRSQSTSFKSFGVQRKGK--GVQFDSKELQVETGNLQDANFLNA  518
                N D        K GRSQ  ++K FG QRK K   V    ++ Q E  NLQDA+FLNA
Sbjct  73    LIGNGDVLSGGGGGKKGRSQQAAYKPFGTQRKEKKESVADQKEKKQAEVRNLQDADFLNA  132

Query  519   VVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTK  698
             VVKVYCTHTAPDYSLPWQKQRQ+TSTGSAFMIGDGKLLTNAHCVEH TQVKVKRRGDDTK
Sbjct  133   VVKVYCTHTAPDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHYTQVKVKRRGDDTK  192

Query  699   YVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKG  878
             YVAKVLA+GV+CDIALL+VESEEFWKGAEPL FG LP LQ+AVTVVGYPLGGDTISVTKG
Sbjct  193   YVAKVLAKGVDCDIALLTVESEEFWKGAEPLHFGSLPHLQEAVTVVGYPLGGDTISVTKG  252

Query  879   VVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGY  1058
             VVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+E ENIGY
Sbjct  253   VVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEEAENIGY  312

Query  1059  VIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSD  1238
             VIPTTVVSHFL DYERNGKYTGFP LGV+LQKLENPALRACLKV S EGVL+R+VEPT D
Sbjct  313   VIPTTVVSHFLNDYERNGKYTGFPCLGVMLQKLENPALRACLKVESVEGVLVRRVEPTCD  372

Query  1239  AHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMK  1418
             AHN LKEGDVIVSFDDV VGCEGTVPFRS ERIAFRYLIS+KF+GD AELGIIRAGEFMK
Sbjct  373   AHNVLKEGDVIVSFDDVHVGCEGTVPFRSNERIAFRYLISQKFAGDVAELGIIRAGEFMK  432

Query  1419  VQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFA  1598
             V+  L+PRV LVPYHI+GGQPSYLI+AGLVFTPLSEPLI EEC+DSIGLKLL KARYS A
Sbjct  433   VKAELNPRVHLVPYHIDGGQPSYLIIAGLVFTPLSEPLIDEECDDSIGLKLLAKARYSLA  492

Query  1599  NFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEF  1778
              FKGEQIV+LSQVLANEVNIGYED+SN+Q+LKLNG  I+NIHHLAHL+DSCK KYLVFEF
Sbjct  493   RFKGEQIVILSQVLANEVNIGYEDMSNQQVLKLNGTPIKNIHHLAHLVDSCKHKYLVFEF  552

Query  1779  ADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESN  1958
              DN++ VLERE AL +STSILKDYGIP+ERSSDL+ PYVDS+    A DQ++ GDS  SN
Sbjct  553   EDNYITVLEREGALASSTSILKDYGIPAERSSDLLEPYVDSVVDGQA-DQEDLGDSPVSN  611

Query  1959  SEFGFDGLLWA  1991
              E GFDGL+WA
Sbjct  612   LEIGFDGLIWA  622



>emb|CBI32271.3| unnamed protein product [Vitis vinifera]
Length=612

 Score =   919 bits (2374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/542 (82%), Positives = 484/542 (89%), Gaps = 11/542 (2%)
 Frame = +3

Query  396   RSQSTSFKSFGVQ---RKGKGVQFDSKELQ-VETGNLQDANFLNAVVKVYCTHTAPDYSL  563
             R+QS+ FKSFG Q   +  KGV  D KE Q VETGNLQD  FLNAVVKVYCTHTAPDYSL
Sbjct  72    RTQSSPFKSFGAQSQRKDKKGVSSDLKEQQQVETGNLQDGAFLNAVVKVYCTHTAPDYSL  131

Query  564   PWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIA  743
             PWQKQRQYTSTGSAF+IGDGKLLTNAHCVEH TQVKVKRRGDDTKYVAKVLARG+ECDIA
Sbjct  132   PWQKQRQYTSTGSAFIIGDGKLLTNAHCVEHATQVKVKRRGDDTKYVAKVLARGIECDIA  191

Query  744   LLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS  923
             LLSVESEEFWKG EPL FG LPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS
Sbjct  192   LLSVESEEFWKGTEPLNFGRLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS  251

Query  924   ELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYE  1103
             +LLGIQIDAA+NPGNSGGPAFND GECIGVAFQV+RS++VENIGYVIPTTVVSHFL DYE
Sbjct  252   DLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVFRSEDVENIGYVIPTTVVSHFLDDYE  311

Query  1104  RNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFD  1283
             RNGKYTGFP LGVLLQKLENPALR+CLKV SNEGVL+R+VEPTSDA+N LKEGDVIVSFD
Sbjct  312   RNGKYTGFPCLGVLLQKLENPALRSCLKVQSNEGVLVRRVEPTSDANNVLKEGDVIVSFD  371

Query  1284  DVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYH  1463
              V VGCEGTVPFRSTERIAFRYLIS+KF+GD  E+GIIRAG FMKVQ+VL PRV LVPYH
Sbjct  372   GVHVGCEGTVPFRSTERIAFRYLISQKFTGDVVEVGIIRAGAFMKVQVVLDPRVHLVPYH  431

Query  1464  IEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLA  1643
             IEGGQPSYLI++GLVFTPLSEPLI+EECED+IGLKLLTKARYS A FKGEQIV+LSQVLA
Sbjct  432   IEGGQPSYLIISGLVFTPLSEPLIEEECEDTIGLKLLTKARYSLARFKGEQIVILSQVLA  491

Query  1644  NEVNIGYEDISNEQ------ILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLE  1805
             NEVNIGYE++SN+Q      +LK NG  I+NIHHLAHL+DSCKDKYLVFEF DN+L VLE
Sbjct  492   NEVNIGYENMSNQQASNNLNVLKFNGTWIKNIHHLAHLIDSCKDKYLVFEFEDNYLAVLE  551

Query  1806  REAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLL  1985
             REAA   S  ILKDYGIPSERSSDL+ PY+DS+G N +++ Q+FGD   SN E G DGLL
Sbjct  552   REAAAAASPCILKDYGIPSERSSDLLKPYMDSLGDNRSIN-QDFGDIPVSNLEIGSDGLL  610

Query  1986  WA  1991
             WA
Sbjct  611   WA  612



>ref|XP_004148888.1| PREDICTED: protease Do-like 2, chloroplastic-like [Cucumis sativus]
 ref|XP_004158921.1| PREDICTED: protease Do-like 2, chloroplastic-like [Cucumis sativus]
 gb|KGN44832.1| hypothetical protein Csa_7G390110 [Cucumis sativus]
Length=623

 Score =   917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/541 (80%), Positives = 488/541 (90%), Gaps = 0/541 (0%)
 Frame = +3

Query  369   DDRNTNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVKVYCTHTA  548
             D+     +GR Q+ ++KSFG+QRK K    ++ E QVE+GNLQ A FLNAVVKVYCTHTA
Sbjct  83    DNSAQRNSGRVQTEAYKSFGMQRKDKKELVNAIEDQVESGNLQGAAFLNAVVKVYCTHTA  142

Query  549   PDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGV  728
             PDYSLPWQKQRQ+TSTGSAFMIGDGKLLTNAHCVEHDTQVKVK+RGDDTKYVAKVLARGV
Sbjct  143   PDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKKRGDDTKYVAKVLARGV  202

Query  729   ECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSY  908
             +CDIALLSVE+EEFWKGAEPL+FG+LP LQDAVTVVGYPLGGDTISVT+GVVSRIEVTSY
Sbjct  203   DCDIALLSVENEEFWKGAEPLKFGNLPCLQDAVTVVGYPLGGDTISVTRGVVSRIEVTSY  262

Query  909   AHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHF  1088
             AHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+EVENIGYVIPTTVVSHF
Sbjct  263   AHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEEVENIGYVIPTTVVSHF  322

Query  1089  LQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDV  1268
             L DYERN KYTGFPSLGVLLQKLENPALRACL+V SNEGVL+R+VEPTSDA+  LKEGDV
Sbjct  323   LNDYERNRKYTGFPSLGVLLQKLENPALRACLRVKSNEGVLVRRVEPTSDANKVLKEGDV  382

Query  1269  IVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVD  1448
             IVSFDD++VGCEGTVPFR+ ERIAFRYLIS+KF+GD AELGIIR+GE +K +++L+PRV 
Sbjct  383   IVSFDDIKVGCEGTVPFRTNERIAFRYLISQKFAGDVAELGIIRSGELIKAKVILNPRVH  442

Query  1449  LVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVL  1628
             LVP+HI+GGQPSYLI+AGLVFTPLSEPLI EECEDSIGLKLL KARYS A+FKGEQIV+L
Sbjct  443   LVPFHIDGGQPSYLIIAGLVFTPLSEPLIDEECEDSIGLKLLAKARYSLASFKGEQIVIL  502

Query  1629  SQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLER  1808
             SQVLANEVNIGYED+ N+Q+LKLNG RIRNIHHL HL+D+CKDKYLVFEF +N++ VLER
Sbjct  503   SQVLANEVNIGYEDMGNQQVLKLNGTRIRNIHHLTHLVDTCKDKYLVFEFEENYIAVLER  562

Query  1809  EAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLW  1988
             EAA+  S+ IL+DYGIPSERSSDL+ PYVD       +  Q +GDS  SN+E GF+GLLW
Sbjct  563   EAAIAASSCILRDYGIPSERSSDLLEPYVDISEDEKGMVVQNYGDSPVSNAEIGFEGLLW  622

Query  1989  A  1991
             A
Sbjct  623   A  623



>ref|XP_008386612.1| PREDICTED: protease Do-like 2, chloroplastic [Malus domestica]
Length=621

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/551 (81%), Positives = 487/551 (88%), Gaps = 5/551 (1%)
 Frame = +3

Query  342   KGERFFSNVDDRNTNKNGRSQSTSFKSFGVQRKG-KGVQFDSKELQVETGNLQDANFLNA  518
             +GE   +        K G+SQS +++ FG QRK  K    + KE QVE  +LQDA+FLNA
Sbjct  75    EGEGVPNKFSGNGRGKKGQSQSVAYRGFGAQRKERKESVVNQKEQQVEPKSLQDADFLNA  134

Query  519   VVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTK  698
             VVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEH TQVKVKRRGDDTK
Sbjct  135   VVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHYTQVKVKRRGDDTK  194

Query  699   YVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKG  878
             YVAKVLARGV+CDIALLSVESEEFWKGAEPLQ G LP LQ++VTVVGYPLGGDTISVTKG
Sbjct  195   YVAKVLARGVDCDIALLSVESEEFWKGAEPLQLGSLPHLQESVTVVGYPLGGDTISVTKG  254

Query  879   VVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGY  1058
             VVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+E ENIGY
Sbjct  255   VVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDKGECIGVAFQVYRSEEAENIGY  314

Query  1059  VIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSD  1238
             VIPTTVVSHFL DYERNGKYTGFP LGVLLQKLENPAL+ACLK   + GVL+R+VEPTSD
Sbjct  315   VIPTTVVSHFLDDYERNGKYTGFPCLGVLLQKLENPALKACLK---SRGVLVRRVEPTSD  371

Query  1239  AHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMK  1418
             AHN LKEGDVIVSFDDV VGCEGTVPFRS ERIAFRYLIS+KF+GD A++GIIRAGE+MK
Sbjct  372   AHNVLKEGDVIVSFDDVHVGCEGTVPFRSNERIAFRYLISQKFAGDVADIGIIRAGEYMK  431

Query  1419  VQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFA  1598
             V+ VL PRV LVP+HI+GGQPSYLI+AGLVFTPLSEPLI EECEDSIGLKLL KARYS A
Sbjct  432   VKAVLHPRVHLVPFHIDGGQPSYLIIAGLVFTPLSEPLIDEECEDSIGLKLLXKARYSLA  491

Query  1599  NFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEF  1778
              FKGEQIV+LSQVLANEVNIGYED+SN+Q+LKLNG +IRNIHHLA+L+DSCKDKYLVFEF
Sbjct  492   RFKGEQIVILSQVLANEVNIGYEDMSNQQVLKLNGTQIRNIHHLAYLVDSCKDKYLVFEF  551

Query  1779  ADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESN  1958
              DN++ VLEREAAL  S+ ILKDYGIPSERSSDL  PYVDS+G N AVD Q+ GDS  SN
Sbjct  552   EDNYITVLEREAALAASSCILKDYGIPSERSSDLSEPYVDSLGDNQAVD-QDIGDSPVSN  610

Query  1959  SEFGFDGLLWA  1991
              E GFDG++WA
Sbjct  611   LEIGFDGIIWA  621



>ref|XP_008368916.1| PREDICTED: protease Do-like 2, chloroplastic [Malus domestica]
Length=624

 Score =   913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/619 (74%), Positives = 507/619 (82%), Gaps = 24/619 (4%)
 Frame = +3

Query  165   RCSLSSQPLFAT--SRPPSRFFVPKSATQSQNQE-------HNQRKKPPARVSHTEREAV  317
             R S+S QP FAT       ++   K   QS  +              P A     ERE V
Sbjct  20    RSSVSVQPFFATWLCSGSYQYHALKPVGQSNRERASSSRKGSQSSSPPSADKYQPEREGV  79

Query  318   TQKCTRRSKGERFFSNVDDRNTNKNGRSQSTSFKSFGVQRKG-KGVQFDSKELQVETGNL  494
               K +   +G             K G+SQS ++++FG QRK  K    D KE QVE  +L
Sbjct  80    PSKFSGNERG-------------KKGKSQSVAYRAFGTQRKERKESVVDQKEQQVEPKSL  126

Query  495   QDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKV  674
             QDA+FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEH TQVKV
Sbjct  127   QDADFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHYTQVKV  186

Query  675   KRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGG  854
             KRRGDDTK+VAKVL RGV+CDIALLSVESEEFWKGAEPLQ G LP LQ+AVTVVGYPLGG
Sbjct  187   KRRGDDTKFVAKVLXRGVDCDIALLSVESEEFWKGAEPLQLGSLPHLQEAVTVVGYPLGG  246

Query  855   DTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRS  1034
             DTISVTKGVVSRIEVT YAHGS +LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS
Sbjct  247   DTISVTKGVVSRIEVTPYAHGSXDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRS  306

Query  1035  DEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLI  1214
             +E ENIGYVIPTTVVSHFL DYERNGKYTGFP LGVLLQKLENPAL+ACLKV S EGVL+
Sbjct  307   EEAENIGYVIPTTVVSHFLDDYERNGKYTGFPCLGVLLQKLENPALKACLKVESIEGVLV  366

Query  1215  RKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGI  1394
             R+VEPTSDAHN LKEGDVIVSFDDV VGCEGT PFRS ERIAFRYLIS+KF+GD A++GI
Sbjct  367   RRVEPTSDAHNVLKEGDVIVSFDDVHVGCEGTXPFRSNERIAFRYLISQKFAGDVADIGI  426

Query  1395  IRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLL  1574
             IRAGE+MKV+ VL PRV LVP+HI+GGQPSYLI+AGLVFTPLSEPLI+EEC+DSIGLKLL
Sbjct  427   IRAGEYMKVKAVLHPRVHLVPFHIDGGQPSYLIIAGLVFTPLSEPLIEEECDDSIGLKLL  486

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              KARYS A FKGEQIV+LSQVLANEVNIGYED+SN+Q+LKLNG +IRNIHHLA+L+DSCK
Sbjct  487   AKARYSLARFKGEQIVILSQVLANEVNIGYEDMSNQQVLKLNGIQIRNIHHLAYLVDSCK  546

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQE  1934
             DKYLVFEF DN++ VLEREAA   S+ ILKDYGIPSERSSDL+ PY DS+G N AVD Q+
Sbjct  547   DKYLVFEFEDNYITVLEREAAAAASSCILKDYGIPSERSSDLLEPYADSLGDNQAVD-QD  605

Query  1935  FGDSAESNSEFGFDGLLWA  1991
              GDS  SN E GFDG++WA
Sbjct  606   IGDSPVSNLEIGFDGIIWA  624



>ref|XP_010070002.1| PREDICTED: protease Do-like 2, chloroplastic [Eucalyptus grandis]
 gb|KCW58553.1| hypothetical protein EUGRSUZ_H01212 [Eucalyptus grandis]
Length=638

 Score =   910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/572 (78%), Positives = 494/572 (86%), Gaps = 4/572 (1%)
 Frame = +3

Query  285   ARVSHTEREAVTQK-CTRRSKGERFFSNVD-DRNTNKNGRSQSTSFKSFGVQRKGK-GVQ  455
             A+ S  + + ++QK    RSK ER +  VD DRN    GRS+ST F S G+QRK K G  
Sbjct  68    AKTSWDKGKPISQKKYPGRSKDERPYPFVDGDRNRGSAGRSESTGFGSSGLQRKEKRGFN  127

Query  456   FDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLT  635
             F  +  Q E G  QDA  LNAVVKVYCTHT PDYSLPWQKQRQYTSTGSAFMIGDGKLLT
Sbjct  128   FTEQRSQTEPGKFQDAASLNAVVKVYCTHTEPDYSLPWQKQRQYTSTGSAFMIGDGKLLT  187

Query  636   NAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRL  815
             NAHCVEH TQVKVKRRGDDTKYVAKVLA+G++CDIALLSVESE FWKGAEPLQ GHLP+L
Sbjct  188   NAHCVEHYTQVKVKRRGDDTKYVAKVLAKGIDCDIALLSVESEGFWKGAEPLQLGHLPQL  247

Query  816   QDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDD  995
             QDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND 
Sbjct  248   QDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQ  307

Query  996   GECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALR  1175
             GECIGVAFQVYRS+E ENIGYVIPTTVVSHFL DY+RNGKYTGFP LGVLLQKLENPALR
Sbjct  308   GECIGVAFQVYRSEEAENIGYVIPTTVVSHFLNDYDRNGKYTGFPCLGVLLQKLENPALR  367

Query  1176  ACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLI  1355
              CLKV SNEGVL+R+VEPTSDA+N LKEGDVI SFDDV VGCEGTVPFRS+ERIAFRYLI
Sbjct  368   ECLKVQSNEGVLVRRVEPTSDANNVLKEGDVITSFDDVHVGCEGTVPFRSSERIAFRYLI  427

Query  1356  SRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLI  1535
             S+KF+GD  +LGIIRAG F+KV ++L+PRV LVPYHIEGGQPSYLI+AGLVFTPLSEPLI
Sbjct  428   SQKFAGDVVQLGIIRAGTFVKVPVILNPRVHLVPYHIEGGQPSYLIIAGLVFTPLSEPLI  487

Query  1536  QEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIR  1715
              EECEDSIGLKLL KARYS A FKGEQIV+LSQVLANEVNIGYED+ N+Q+LK NG +I+
Sbjct  488   DEECEDSIGLKLLAKARYSLARFKGEQIVILSQVLANEVNIGYEDMGNQQVLKFNGTQIK  547

Query  1716  NIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYV  1895
             NI HLAHL+DSCKDKYLVFEF DN+L VLEREAA+  S+ ILKDYGIP+ERSSDL+ PYV
Sbjct  548   NIRHLAHLVDSCKDKYLVFEFEDNYLAVLEREAAMAASSCILKDYGIPAERSSDLLEPYV  607

Query  1896  DSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             D    N+ V +Q+FG+S  S+ E G DG+LWA
Sbjct  608   DLPTDNEKV-EQDFGNSPVSSLEIGNDGILWA  638



>ref|XP_010684757.1| PREDICTED: protease Do-like 2, chloroplastic isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=632

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/615 (75%), Positives = 513/615 (83%), Gaps = 9/615 (1%)
 Frame = +3

Query  165   RCSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREA--VTQK-CTR  335
             R SLSS   F T  P SR  +  +A   +N +    ++  +   ++ REA  ++QK    
Sbjct  21    RSSLSSHNFFPTPHPTSRALISMAA-NCKNGDSAAPRRNASNSGNSAREADIISQKKFFG  79

Query  336   RSKGERF--FSNVDDRNTNKNGRSQSTSFKSFGVQRKGK-GVQFDSKELQVETGNLQDAN  506
             + K ER   F + D R  +  GRSQS+ F+S  +QRK K G  ++SKE Q E  NLQD  
Sbjct  80    KPKDERHSSFRHYDGRKEDM-GRSQSSGFQSLVMQRKDKKGFAYESKEQQAEAANLQDTT  138

Query  507   FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRG  686
             FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEH TQVK+KRRG
Sbjct  139   FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHYTQVKLKRRG  198

Query  687   DDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTIS  866
             DDTKYVAKVLARG++CDIALLSVE+EEFWKGAEPL+ G LP LQD+VTVVGYPLGGDTIS
Sbjct  199   DDTKYVAKVLARGIDCDIALLSVENEEFWKGAEPLRLGRLPHLQDSVTVVGYPLGGDTIS  258

Query  867   VTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVE  1046
             VTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQV RS++ E
Sbjct  259   VTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVLRSEDTE  318

Query  1047  NIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVE  1226
             NIGYVIPTTVVSHFL DYERNGKYTGFP LGVLLQKLENPALR+CLKV SNEGVL+R+VE
Sbjct  319   NIGYVIPTTVVSHFLTDYERNGKYTGFPCLGVLLQKLENPALRSCLKVASNEGVLVRRVE  378

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PTSDAHN LKEGDVIV FD V VGCEGTVPFRSTERIAFRYLIS+KFSGD  ELGIIR G
Sbjct  379   PTSDAHNALKEGDVIVRFDGVHVGCEGTVPFRSTERIAFRYLISQKFSGDVVELGIIRNG  438

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKAR  1586
               +KVQ VL+PRV LVPY+IEGGQPSYLIVAGLVFTPLSEPLI+EECE+ +GLKLLTKAR
Sbjct  439   AHLKVQTVLNPRVHLVPYNIEGGQPSYLIVAGLVFTPLSEPLIEEECEEVMGLKLLTKAR  498

Query  1587  YSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYL  1766
             YS A F+GEQIV+LSQVLANEVNIGYED+SN+Q+LKLNG  IRNIHHLAHL DSC DKYL
Sbjct  499   YSLARFRGEQIVILSQVLANEVNIGYEDMSNQQVLKLNGTHIRNIHHLAHLTDSCNDKYL  558

Query  1767  VFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDS  1946
             VFEF DN+LVVLERE A   S+ ILKDYGIPSERSSDLM PY+D+    +AV +++ GDS
Sbjct  559   VFEFEDNYLVVLERETAAAASSCILKDYGIPSERSSDLMEPYLDTFRDINAV-EKDIGDS  617

Query  1947  AESNSEFGFDGLLWA  1991
               +N E GFDGLLWA
Sbjct  618   PVTNLEIGFDGLLWA  632



>ref|XP_010041338.1| PREDICTED: protease Do-like 2, chloroplastic [Eucalyptus grandis]
 gb|KCW44430.1| hypothetical protein EUGRSUZ_L02072 [Eucalyptus grandis]
Length=635

 Score =   907 bits (2345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/559 (79%), Positives = 487/559 (87%), Gaps = 3/559 (1%)
 Frame = +3

Query  321   QKCTRRSKGERFFSNVD-DRNTNKNGRSQSTSFKSFGVQRKGK-GVQFDSKELQVETGNL  494
             +K   RSK ER +  VD DRN    GRS+ST F S G+QRK K G  F  ++ Q E G  
Sbjct  78    KKYPGRSKDERPYPFVDGDRNRGSAGRSESTGFGSSGLQRKEKRGFNFTEQQSQTEPGKF  137

Query  495   QDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKV  674
             QDA  LNAVVKVYCTHT PDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEH TQVKV
Sbjct  138   QDAASLNAVVKVYCTHTEPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHYTQVKV  197

Query  675   KRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGG  854
             KRRGDDTKYVAKVLA+G++CDIALLSVESE FWKGAEPLQ G LP+LQDAVTVVGYPLGG
Sbjct  198   KRRGDDTKYVAKVLAKGIDCDIALLSVESEGFWKGAEPLQLGRLPQLQDAVTVVGYPLGG  257

Query  855   DTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRS  1034
             DTISVTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS
Sbjct  258   DTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRS  317

Query  1035  DEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLI  1214
             +E ENIGYVIPTTVVSHFL DY+RNGKYTGFP LGVLLQKLENPALR CLKV SNEGVL+
Sbjct  318   EEAENIGYVIPTTVVSHFLNDYDRNGKYTGFPCLGVLLQKLENPALRECLKVQSNEGVLV  377

Query  1215  RKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGI  1394
             R+VEPTSDA+N LKEGDVI SFDDV VGCEGTVPFRS+ERIAFRYLIS+KF+GD  +LGI
Sbjct  378   RRVEPTSDANNVLKEGDVITSFDDVHVGCEGTVPFRSSERIAFRYLISQKFAGDVVQLGI  437

Query  1395  IRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLL  1574
             IRAG F+KV ++L+PRV LVPYHIEGGQPSYLI+AGLVFTPLSEPLI EECEDSIGLKLL
Sbjct  438   IRAGTFVKVSVILNPRVHLVPYHIEGGQPSYLIIAGLVFTPLSEPLIDEECEDSIGLKLL  497

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              KARYS A FKGEQIV+LSQVLANEVNIGYED+ N+Q+LK NG +I+NI HLAHL+DSCK
Sbjct  498   AKARYSLARFKGEQIVILSQVLANEVNIGYEDMGNQQVLKFNGTQIKNIRHLAHLVDSCK  557

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQE  1934
             DKYLVFEF DN+L VLEREAA+  S+ ILKDYGIP+ERSSDL+ PYVD    N+ V +Q+
Sbjct  558   DKYLVFEFEDNYLAVLEREAAMAASSCILKDYGIPAERSSDLLEPYVDLPTDNEKV-EQD  616

Query  1935  FGDSAESNSEFGFDGLLWA  1991
             FG+S  S+ E G DG+LWA
Sbjct  617   FGNSPVSSLEIGNDGILWA  635



>ref|XP_011011013.1| PREDICTED: LOW QUALITY PROTEIN: protease Do-like 2, chloroplastic 
[Populus euphratica]
Length=628

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/614 (74%), Positives = 512/614 (83%), Gaps = 10/614 (2%)
 Frame = +3

Query  165   RCSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQK-CTRRS  341
             RC +SSQ   ATS   +     K+    +   +    K   R     +  V+QK  +R+ 
Sbjct  20    RCCVSSQQYLATSHHSNASVTCKAVVNHKRTXYFFLSKKEER----SKLCVSQKKSSRKL  75

Query  342   KGERFFSNVDDRNTN---KNGRSQSTSFKSFGVQRKGKG-VQFDSKELQVETGNLQDANF  509
             K ER + + DD   N   K GRSQS +FKSFG QRK K   +FD KE QVE  NL+DA F
Sbjct  76    KDERSYIHDDDDGINGKMKAGRSQSAAFKSFGGQRKDKKESKFDMKEQQVEPQNLKDAAF  135

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             L+AVVKVYCTHT PDYSLPWQKQRQ TSTGSAFMIG+GKLLTNAHCVEH TQVKVKRRGD
Sbjct  136   LDAVVKVYCTHTYPDYSLPWQKQRQCTSTGSAFMIGNGKLLTNAHCVEHYTQVKVKRRGD  195

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+AKVLARGV+CDIALLSVESEEFW+GAEPL+FG LPRLQDAVTVVGYPLGGDTIS+
Sbjct  196   DTKYLAKVLARGVDCDIALLSVESEEFWEGAEPLEFGCLPRLQDAVTVVGYPLGGDTISL  255

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             TKGVVS  EVTSYAHGSS+LLGIQIDAA+NPGNSGGPAF+D GECIGVAFQVYRS+EVEN
Sbjct  256   TKGVVSHNEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFSDQGECIGVAFQVYRSEEVEN  315

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEP  1229
             IGYVIPTTVVSHFL DYERNG+YTGFPSLGVLLQKLENPALRACLKV SN GVL+R+VEP
Sbjct  316   IGYVIPTTVVSHFLNDYERNGRYTGFPSLGVLLQKLENPALRACLKVNSNGGVLVRRVEP  375

Query  1230  TSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGE  1409
              SDA+  LKEGDVIVSFDDV VGCEGTVPFRS E IAFRYLIS+KF+GD AELGIIRAG 
Sbjct  376   ISDANRVLKEGDVIVSFDDVHVGCEGTVPFRSNEHIAFRYLISQKFAGDVAELGIIRAGS  435

Query  1410  FMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARY  1589
             FMKV++VL+PRV+LVPYH++GGQPS+LI+AGLVFTPLSEPL++EECEDSIGLKLL K+RY
Sbjct  436   FMKVKVVLNPRVNLVPYHVDGGQPSHLIIAGLVFTPLSEPLMEEECEDSIGLKLLAKSRY  495

Query  1590  SFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLV  1769
             S A FKGEQIV+LSQVLANEVN GYE++SN+Q+LK NG +I++IHHLAHL+DSCK+KY+V
Sbjct  496   SLARFKGEQIVILSQVLANEVNFGYEEMSNQQVLKFNGIQIKSIHHLAHLVDSCKNKYIV  555

Query  1770  FEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSA  1949
             FEF   +LVVLEREAA  +S   LKDYGI SERSSDL GPYVDS+  N A   Q+FG+S 
Sbjct  556   FEFEGIYLVVLEREAASASSFHNLKDYGISSERSSDLSGPYVDSLEDNQA-GVQDFGNSP  614

Query  1950  ESNSEFGFDGLLWA  1991
              SN E GFDGLLWA
Sbjct  615   ISNLEIGFDGLLWA  628



>ref|XP_010247118.1| PREDICTED: protease Do-like 2, chloroplastic [Nelumbo nucifera]
Length=628

 Score =   905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/628 (73%), Positives = 506/628 (81%), Gaps = 27/628 (4%)
 Frame = +3

Query  168   CSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKC------  329
             CS S   +  T   PS  F  + AT  +    +  K       H +R A+ + C      
Sbjct  8     CSFSMFRITETCPTPSYIFNCRFATLRRTISLDMNKD-----VHLKRRALKKDCFPTGKA  62

Query  330   ------------TRRSKGERFFSNVDDRNTNKNGRSQSTSFKSFGVQRKGK-GVQFDSKE  470
                           RSK E  +   +D   NK+ RSQ T FKS G QRK K G  +D KE
Sbjct  63    REKMEGISRKRFPARSKNEMSYLPPNDSGGNKS-RSQPTVFKSIGTQRKDKKGSAYDLKE  121

Query  471   LQV-ETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHC  647
              QV +TG+LQDA FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHC
Sbjct  122   QQVKDTGDLQDAAFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHC  181

Query  648   VEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAV  827
             VEHDTQVKVKRRGDDTKY AKVLARG+ECDIALL+VESEEFW+G+EPL+FG LP LQD+V
Sbjct  182   VEHDTQVKVKRRGDDTKYAAKVLARGIECDIALLTVESEEFWRGSEPLRFGRLPLLQDSV  241

Query  828   TVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECI  1007
             TVVGYPLGGDTISVTKGVVSRIEVTSYAHG+S+LLGIQIDAA+NPGNSGGPAFND GECI
Sbjct  242   TVVGYPLGGDTISVTKGVVSRIEVTSYAHGTSDLLGIQIDAAINPGNSGGPAFNDQGECI  301

Query  1008  GVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLK  1187
             GVAFQV+RSDE ENIGYVIPTTVVSHFL DY+RNGKYTGFP LGVLLQKLENPALR+CLK
Sbjct  302   GVAFQVFRSDEAENIGYVIPTTVVSHFLDDYDRNGKYTGFPCLGVLLQKLENPALRSCLK  361

Query  1188  VPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKF  1367
             V  NEGVL+R+VEPTSDA+N LK+GDVIVSFD V VGCEGTVPFRSTERIAFRYLIS+KF
Sbjct  362   VQYNEGVLVRRVEPTSDANNVLKKGDVIVSFDGVPVGCEGTVPFRSTERIAFRYLISQKF  421

Query  1368  SGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEEC  1547
             SGD AELGIIR G FMKV+ VL PRV LVPYHIEGGQPSYLI+AGLVFTPLSEPLI EEC
Sbjct  422   SGDVAELGIIRQGTFMKVKTVLKPRVHLVPYHIEGGQPSYLIIAGLVFTPLSEPLIDEEC  481

Query  1548  EDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHH  1727
             ED+IGLKLL KARYS A FKGE+IV+LSQVLANEVNIGYED+ N+Q+LK NG  I+NI H
Sbjct  482   EDTIGLKLLAKARYSLAKFKGEEIVILSQVLANEVNIGYEDMGNQQVLKFNGTPIKNIRH  541

Query  1728  LAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIG  1907
             LAHL+DSC DKYL+FEF DNFLVVLEREAA   S+ ILKDYGIPSERSSDL+ PYVD   
Sbjct  542   LAHLIDSCNDKYLIFEFEDNFLVVLEREAAAAASSCILKDYGIPSERSSDLLEPYVDPSE  601

Query  1908  QNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
              ++A    + GDS  SN E GFDGLLWA
Sbjct  602   DSEAT-SHDLGDSPVSNLEIGFDGLLWA  628



>ref|XP_008800525.1| PREDICTED: protease Do-like 2, chloroplastic [Phoenix dactylifera]
Length=619

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/603 (75%), Positives = 502/603 (83%), Gaps = 15/603 (2%)
 Frame = +3

Query  189   LFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQK-CTRRSKGERFFSN  365
             +FA S  P     P+S  QS       RK PPAR +  E + V+QK    R K ER +  
Sbjct  30    IFACSHRP-----PRSRKQSL------RKGPPARKNGDEFKGVSQKRFPGRGKDERAYLP  78

Query  366   VDDRNTNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVE-TGNLQDANFLNAVVKVYCTH  542
              D  +  + G SQS  F S G+Q+K K +  D +E Q + TGNLQDA FLNAVVKVYCTH
Sbjct  79    PDG-SRGEAGWSQSMVFGSAGLQKKDKDLVSDLREQQFDDTGNLQDAAFLNAVVKVYCTH  137

Query  543   TAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLAR  722
             TAPDYSLPWQKQRQYTST SAFMIGDGKLLTNAHCVEHDTQVK+KRRGD+TK+VAKVLAR
Sbjct  138   TAPDYSLPWQKQRQYTSTASAFMIGDGKLLTNAHCVEHDTQVKLKRRGDNTKFVAKVLAR  197

Query  723   GVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVT  902
             G+ECDIALLSVESEEFW+GAEPL FG LP LQD+VTVVGYPLGGDTISVTKGVVSRIEVT
Sbjct  198   GIECDIALLSVESEEFWRGAEPLCFGRLPCLQDSVTVVGYPLGGDTISVTKGVVSRIEVT  257

Query  903   SYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVS  1082
             SYAHG+S+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQV+RS+E ENIGYVIPTTVVS
Sbjct  258   SYAHGASDLLGIQIDAAINPGNSGGPAFNDRGECIGVAFQVFRSEEAENIGYVIPTTVVS  317

Query  1083  HFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEG  1262
             HFL DYERNGKYTGFP LGVLLQKLENPALRACL+VPSNEGVL+R+VEPTS A N LKEG
Sbjct  318   HFLNDYERNGKYTGFPCLGVLLQKLENPALRACLRVPSNEGVLVRRVEPTSAAGNVLKEG  377

Query  1263  DVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPR  1442
             DVIVSFD V VGCEGT+PFRSTERIAFRYLIS+KFSGD +ELGIIR G  MKV+ VL PR
Sbjct  378   DVIVSFDGVSVGCEGTIPFRSTERIAFRYLISQKFSGDVSELGIIREGSSMKVKTVLRPR  437

Query  1443  VDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIV  1622
             V LVPYHIEGGQPSYLI+AGLVFTPLSEPLI EECEDSIGLKLL KARYS A FKGE+IV
Sbjct  438   VHLVPYHIEGGQPSYLIIAGLVFTPLSEPLIDEECEDSIGLKLLAKARYSLARFKGEEIV  497

Query  1623  VLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVL  1802
             +LSQVLANEVNIGYED+ N+Q+LK NG  I+NI HLAHL+DSC+DKYLVFEF DNFL VL
Sbjct  498   ILSQVLANEVNIGYEDMGNQQVLKFNGTPIKNIRHLAHLVDSCRDKYLVFEFEDNFLAVL  557

Query  1803  EREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGL  1982
             EREAA   S  ILKDYGIP ERS+DL+ PY+D   +++ V  Q+ GDS  SN E GFDGL
Sbjct  558   EREAAAAASPCILKDYGIPCERSADLLEPYID-FSEDNQVPIQDIGDSPVSNLEIGFDGL  616

Query  1983  LWA  1991
             LWA
Sbjct  617   LWA  619



>ref|XP_006397989.1| hypothetical protein EUTSA_v10001363mg [Eutrema salsugineum]
 gb|ESQ39442.1| hypothetical protein EUTSA_v10001363mg [Eutrema salsugineum]
Length=612

 Score =   904 bits (2335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/574 (76%), Positives = 493/574 (86%), Gaps = 7/574 (1%)
 Frame = +3

Query  288   RVSHTEREAVTQKCTRRSKGERFFSNVDDRNTNKNGRS-----QSTSFKSFGVQRKGKG-  449
             R S+ +R+A     + +   E++     D + N +G+      Q+ +FK+FG  +K K  
Sbjct  40    RASNQKRKASRSDSSPKLNPEKYPVRSIDESCNSHGKGDGAGPQTMAFKAFGSPKKDKKE  99

Query  450   VQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKL  629
              Q D ++ Q + G + DA+FLNAVVKVYCTHTAPDYSLPWQKQRQ+TSTGSAFMIGDGKL
Sbjct  100   AQSDFRDQQTDPGKIHDASFLNAVVKVYCTHTAPDYSLPWQKQRQFTSTGSAFMIGDGKL  159

Query  630   LTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLP  809
             LTNAHCVEHDTQVKVKRRGDD KYVAKVL RGV+CDIALLSVESE+FWKGAEPL+ GHLP
Sbjct  160   LTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRGVDCDIALLSVESEDFWKGAEPLRLGHLP  219

Query  810   RLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFN  989
             RLQD+VTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFN
Sbjct  220   RLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFN  279

Query  990   DDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPA  1169
             D GECIGVAFQVYRS+E ENIGYVIPTTVVSHFL DYERNGKYTG+P LGVLLQKLENPA
Sbjct  280   DQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLTDYERNGKYTGYPCLGVLLQKLENPA  339

Query  1170  LRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRY  1349
             LR CLKVP+NEGVL+R+VEPTSDA   LKEGDVIVSFDD+ VGCEGTVPFRS+ERIAFRY
Sbjct  340   LRECLKVPTNEGVLVRRVEPTSDASKVLKEGDVIVSFDDLHVGCEGTVPFRSSERIAFRY  399

Query  1350  LISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEP  1529
             LIS+KFSGD AELGIIRAGE  KVQ+VL PRV LVP+HI+GGQPSY+I+AGLVFTPLSEP
Sbjct  400   LISQKFSGDIAELGIIRAGEHKKVQVVLRPRVHLVPFHIDGGQPSYIIIAGLVFTPLSEP  459

Query  1530  LIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKR  1709
             LI+EECED+IGLKLLTKARYS A F+GEQIV+LSQVLANEVNIGYED++N+Q+LK NG  
Sbjct  460   LIEEECEDTIGLKLLTKARYSVARFRGEQIVILSQVLANEVNIGYEDMNNQQVLKFNGTP  519

Query  1710  IRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGP  1889
             IRNIHHLAHL+D CKDKYLVFEF DN++ VLEREA+ + S  ILKDYGIPSERS+DL  P
Sbjct  520   IRNIHHLAHLIDMCKDKYLVFEFEDNYVAVLEREASDSASLCILKDYGIPSERSADLREP  579

Query  1890  YVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             Y+D I    A+DQ  FGDS  SN E GFDGL+WA
Sbjct  580   YIDPIDDTRALDQG-FGDSPVSNLEIGFDGLVWA  612



>gb|KDP28079.1| hypothetical protein JCGZ_13850 [Jatropha curcas]
Length=632

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/622 (72%), Positives = 508/622 (82%), Gaps = 22/622 (4%)
 Frame = +3

Query  165   RCSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHT-------EREAVTQ  323
             RC  S Q   A S      FV   A        N RK+   R S +       ++E   +
Sbjct  20    RCYASPQLYLAVSH--RSIFVTSKAI-------NHRKRHSKRASSSSFDKVSRDKEGAQK  70

Query  324   KCTRRSKGERFF-SNVDDRNTNKNGRSQSTSFKSFGVQRKGK-----GVQFDSKELQVET  485
                 +SK +R++ S+  D    + G+SQS ++KSFG+QR+ +        F+ KE + ET
Sbjct  71    NSLGKSKDDRYYLSDNGDSGAREAGKSQSMAYKSFGMQRQRQRKDKMKFGFNLKEHEQET  130

Query  486   GNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQ  665
             GN+QD +FL+AVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQ
Sbjct  131   GNIQDESFLDAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQ  190

Query  666   VKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYP  845
             VKVKRRGDDTKYVAKVLARGV+CDIALLSVESEEFW+GAEPLQFG LPRLQDAVTVVGYP
Sbjct  191   VKVKRRGDDTKYVAKVLARGVDCDIALLSVESEEFWEGAEPLQFGRLPRLQDAVTVVGYP  250

Query  846   LGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQV  1025
             LGGDTISVT+GVVSRIEVTSYAHG S+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQV
Sbjct  251   LGGDTISVTQGVVSRIEVTSYAHGPSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQV  310

Query  1026  YRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEG  1205
             YRS++ ENIGYVIPTTVVSHFL DYERNGKYTGFPSLGVL+QKLENPALRACLKV SNEG
Sbjct  311   YRSEDAENIGYVIPTTVVSHFLIDYERNGKYTGFPSLGVLMQKLENPALRACLKVQSNEG  370

Query  1206  VLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAE  1385
             VL+R++EPTSDA+N LKEGDVIVSFDDV VGCEGTVPFRS ERIAFRYLIS+KF+GD AE
Sbjct  371   VLVRRIEPTSDANNVLKEGDVIVSFDDVHVGCEGTVPFRSNERIAFRYLISQKFAGDVAE  430

Query  1386  LGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGL  1565
             LGIIR G  MKV++VL+PR  LVPY+ +GGQPSYLI+AGLVFTPLSEPLI  E EDS+GL
Sbjct  431   LGIIRGGSPMKVKVVLNPRAHLVPYYADGGQPSYLIIAGLVFTPLSEPLIDAEGEDSMGL  490

Query  1566  KLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLD  1745
             KLL KARYS + FKGEQIV+LSQVL+NEVNIGYED+SN+Q+LK NG R++NIHHLA+L+D
Sbjct  491   KLLAKARYSLSRFKGEQIVILSQVLSNEVNIGYEDMSNQQVLKYNGTRVKNIHHLAYLVD  550

Query  1746  SCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVD  1925
             SCK++YLVFEF DN++ VLER+AA    +SIL+DYGI  ERS DL+ PYVDS G N   +
Sbjct  551   SCKERYLVFEFDDNYVAVLERQAANAALSSILRDYGIRCERSPDLLEPYVDSPGDNQVKE  610

Query  1926  QQEFGDSAESNSEFGFDGLLWA  1991
             +   GD   SN E GFDGLLWA
Sbjct  611   RDPLGDGPVSNLEIGFDGLLWA  632



>gb|KFK37547.1| hypothetical protein AALP_AA4G271000 [Arabis alpina]
Length=614

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/577 (75%), Positives = 484/577 (84%), Gaps = 20/577 (3%)
 Frame = +3

Query  264   NQRKKPPARVSHTEREAVTQKCTRRSKGERFFSNVDDRNTNKNGRSQSTSFKSFGVQRKG  443
             N  KK P RV    R+ ++ K                      G  Q  +FK+FG  +K 
Sbjct  57    NPEKKYPGRVRDVHRDGISGK------------------GGDVGGHQKMAFKAFGSPKKE  98

Query  444   KG-VQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGD  620
             K   Q + +E Q +   + DA+FLNAVVKVYCTHTAPDYSLPWQKQRQ+TSTGSAFMIGD
Sbjct  99    KKESQSEFREQQTDPAKIHDASFLNAVVKVYCTHTAPDYSLPWQKQRQFTSTGSAFMIGD  158

Query  621   GKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFG  800
             GKLLTNAHCVEHDTQVKVKRRGDD KYVAKVL RGV+CDIALLSVESEEFWKGAEPL+ G
Sbjct  159   GKLLTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRGVDCDIALLSVESEEFWKGAEPLRLG  218

Query  801   HLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGP  980
             HLPRLQD+VTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGP
Sbjct  219   HLPRLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGP  278

Query  981   AFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLE  1160
             AFND GECIGVAFQVYRS+E ENIGYVIPTTVVSHFL DYERNGKYTG+P LGVLLQKLE
Sbjct  279   AFNDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLTDYERNGKYTGYPCLGVLLQKLE  338

Query  1161  NPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIA  1340
             NPALR CLKVP+NEGVL+R+VEPTSDA   LKEGDVIVSFD + VGCEGTVPFRS+ERIA
Sbjct  339   NPALRECLKVPTNEGVLVRRVEPTSDASKVLKEGDVIVSFDGLHVGCEGTVPFRSSERIA  398

Query  1341  FRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPL  1520
             FRYLI++KF+GD AELGIIRAGE  K+Q+VL PRV LVPYHI+GGQPSY+I+AGLVFTPL
Sbjct  399   FRYLITQKFAGDVAELGIIRAGEHKKIQVVLRPRVHLVPYHIDGGQPSYIIIAGLVFTPL  458

Query  1521  SEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLN  1700
             SEPLI+EECED+IGLKLLTKARYS A F+GEQIV+LSQVLANEVNIGYED++N+Q+LK N
Sbjct  459   SEPLIEEECEDTIGLKLLTKARYSVARFRGEQIVILSQVLANEVNIGYEDMNNQQVLKFN  518

Query  1701  GKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             G  IRNIHHLAHL+D CKDKYLVFEF DN++ VLEREA+ + S  ILKDYGIPSERS+DL
Sbjct  519   GNHIRNIHHLAHLIDMCKDKYLVFEFEDNYVAVLEREASNSASVCILKDYGIPSERSADL  578

Query  1881  MGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             + PYVD I    A+ Q  FGDS  SN E GFDGL+WA
Sbjct  579   LEPYVDPIDDTQALGQG-FGDSPVSNLEMGFDGLVWA  614



>ref|XP_006295823.1| hypothetical protein CARUB_v10024950mg [Capsella rubella]
 gb|EOA28721.1| hypothetical protein CARUB_v10024950mg [Capsella rubella]
Length=604

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/530 (81%), Positives = 473/530 (89%), Gaps = 1/530 (0%)
 Frame = +3

Query  402   QSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQR  581
             Q+ +FK+FG  +K K     S++ Q +   + DA+FLNAVVKVYCTHTAPDYSLPWQKQR
Sbjct  76    QTMAFKAFGSPKKDKKDAPLSRDQQTDPAKIHDASFLNAVVKVYCTHTAPDYSLPWQKQR  135

Query  582   QYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVES  761
             Q+TSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDD KYVAKVL RGV+CDIALLSVES
Sbjct  136   QFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRGVDCDIALLSVES  195

Query  762   EEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQ  941
             E+FWKGAEPL+ GHLPRLQD+VTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS+LLGIQ
Sbjct  196   EDFWKGAEPLRLGHLPRLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQ  255

Query  942   IDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYT  1121
             IDAA+NPGNSGGPAFND GECIGVAFQVYRS+E ENIGYVIPTTVVSHFL DYERNGKYT
Sbjct  256   IDAAINPGNSGGPAFNDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLTDYERNGKYT  315

Query  1122  GFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGC  1301
             G+P LGVLLQKLENPALR CLKVP+NEGVL+R+VEPTSDA   LKEGDVIVSFDD+ VGC
Sbjct  316   GYPCLGVLLQKLENPALRECLKVPTNEGVLVRRVEPTSDASKVLKEGDVIVSFDDLHVGC  375

Query  1302  EGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQP  1481
             EGTVPFRS+ERIAFRYLIS+KF+GD AELGIIRAGE  KVQ+ L PRV LVPYHI+GGQP
Sbjct  376   EGTVPFRSSERIAFRYLISQKFAGDIAELGIIRAGEHKKVQVALRPRVHLVPYHIDGGQP  435

Query  1482  SYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIG  1661
             SY+IVAGLVFTPLSEPLI+EECED+IGLKLLTKARYS A F+GEQIV+LSQVLANEVNIG
Sbjct  436   SYIIVAGLVFTPLSEPLIEEECEDTIGLKLLTKARYSVARFRGEQIVILSQVLANEVNIG  495

Query  1662  YEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSIL  1841
             YED++N+Q+LK NG  IRNIHHLAHL+D CKDKYLVFEF DN++ VLEREA+ + S  IL
Sbjct  496   YEDMNNQQVLKFNGIPIRNIHHLAHLIDMCKDKYLVFEFEDNYVAVLEREASNSASLCIL  555

Query  1842  KDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             KDYGIPSERS+DL+ PYVD I  N A+DQ   GDS  SN E GFDGL+WA
Sbjct  556   KDYGIPSERSADLLEPYVDPIDDNQALDQG-IGDSPVSNLEIGFDGLVWA  604



>ref|XP_008235077.1| PREDICTED: protease Do-like 2, chloroplastic [Prunus mume]
Length=604

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/613 (74%), Positives = 502/613 (82%), Gaps = 32/613 (5%)
 Frame = +3

Query  165   RCSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVS---HTEREAVTQKCTR  335
             R S+S QP FATS   S     K  +QS+ +  +  +K  +  S     E+EAV  K + 
Sbjct  20    RSSVSIQPCFATSLWSSNGHALKPVSQSKRERASSSRKGSSSSSAKSQPEKEAVPNKLS-  78

Query  336   RSKGERFFSNVDDRNTNKNGRSQSTSFKSFGVQRKGKG-VQFDSKELQVETGNLQDANFL  512
                G     +V  R   K G+SQ T+++SFG QRK K     D KE QVE  +LQDA+FL
Sbjct  79    ---GNGDIWSVTGRG--KKGKSQPTAYRSFGTQRKEKKEFTVDQKEQQVEPRSLQDADFL  133

Query  513   NAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDD  692
             NAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEH TQVKVKRRGDD
Sbjct  134   NAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHYTQVKVKRRGDD  193

Query  693   TKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVT  872
             TKYVAKVLARGV+CDIALLSVESEEFWKGAEPLQ G LP LQ+AVTVVGYPLGGDTISVT
Sbjct  194   TKYVAKVLARGVDCDIALLSVESEEFWKGAEPLQLGSLPHLQEAVTVVGYPLGGDTISVT  253

Query  873   KGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENI  1052
             KGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+E ENI
Sbjct  254   KGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEEAENI  313

Query  1053  GYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPT  1232
             GYVIPTTVVSHFL DYERNGKYTGFP LGVLLQKLENPALRACLKV S EGVL+R+VEPT
Sbjct  314   GYVIPTTVVSHFLDDYERNGKYTGFPCLGVLLQKLENPALRACLKVESIEGVLVRRVEPT  373

Query  1233  SDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEF  1412
             SDAHN LKEGDVIVSFDDV VGCEGTVPFRS ERIAFRYLIS+KF+GD ++LGIIRAGEF
Sbjct  374   SDAHNVLKEGDVIVSFDDVHVGCEGTVPFRSNERIAFRYLISQKFAGDVSDLGIIRAGEF  433

Query  1413  MKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYS  1592
              KV+ VL+PRV LVP+HI+GGQPSYLI+AGLVFTPLSEPLI EECEDSIGLKLL KARYS
Sbjct  434   KKVKAVLNPRVHLVPFHIDGGQPSYLIIAGLVFTPLSEPLIDEECEDSIGLKLLAKARYS  493

Query  1593  FANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVF  1772
              A FKGEQIV+LSQVLANEVNIGYED+SN+Q+LKLNG +IRNIHHLA+L+DSCKDKYLVF
Sbjct  494   LARFKGEQIVILSQVLANEVNIGYEDMSNQQVLKLNGTQIRNIHHLAYLVDSCKDKYLVF  553

Query  1773  EFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAE  1952
             EF DN++ VLERE                     DL+ PYVDS+G N AVD Q+ GDS  
Sbjct  554   EFEDNYITVLERE---------------------DLLEPYVDSLGDNQAVD-QDIGDSPV  591

Query  1953  SNSEFGFDGLLWA  1991
             SN E GFDG++WA
Sbjct  592   SNLEIGFDGIIWA  604



>ref|NP_001118544.1| DegP2 protease [Arabidopsis thaliana]
 gb|AEC10915.1| DegP2 protease [Arabidopsis thaliana]
Length=606

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/550 (78%), Positives = 479/550 (87%), Gaps = 6/550 (1%)
 Frame = +3

Query  348   ERFFSNVDDRNTNKNGRSQSTSFKSFGVQRKGKGVQFD--SKELQVETGNLQDANFLNAV  521
             E +   V D ++N     Q  +FK+FG  +K K       S++ Q +   + DA+FLNAV
Sbjct  61    ENYPGRVRDESSNP---PQKMAFKAFGSPKKEKKESLSDFSRDQQTDPAKIHDASFLNAV  117

Query  522   VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKY  701
             VKVYCTHTAPDYSLPWQKQRQ+TSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDD KY
Sbjct  118   VKVYCTHTAPDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDRKY  177

Query  702   VAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGV  881
             VAKVL RGV+CDIALLSVESE+FWKGAEPL+ GHLPRLQD+VTVVGYPLGGDTISVTKGV
Sbjct  178   VAKVLVRGVDCDIALLSVESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGGDTISVTKGV  237

Query  882   VSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYV  1061
             VSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+E ENIGYV
Sbjct  238   VSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEETENIGYV  297

Query  1062  IPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDA  1241
             IPTTVVSHFL DYERNGKYTG+P LGVLLQKLENPALR CLKVP+NEGVL+R+VEPTSDA
Sbjct  298   IPTTVVSHFLTDYERNGKYTGYPCLGVLLQKLENPALRECLKVPTNEGVLVRRVEPTSDA  357

Query  1242  HNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKV  1421
                LKEGDVIVSFDD+ VGCEGTVPFRS+ERIAFRYLIS+KF+GD AE+GIIRAGE  KV
Sbjct  358   SKVLKEGDVIVSFDDLHVGCEGTVPFRSSERIAFRYLISQKFAGDIAEIGIIRAGEHKKV  417

Query  1422  QIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFAN  1601
             Q+VL PRV LVPYHI+GGQPSY+IVAGLVFTPLSEPLI+EECED+IGLKLLTKARYS A 
Sbjct  418   QVVLRPRVHLVPYHIDGGQPSYIIVAGLVFTPLSEPLIEEECEDTIGLKLLTKARYSVAR  477

Query  1602  FKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFA  1781
             F+GEQIV+LSQVLANEVNIGYED++N+Q+LK NG  IRNIHHLAHL+D CKDKYLVFEF 
Sbjct  478   FRGEQIVILSQVLANEVNIGYEDMNNQQVLKFNGIPIRNIHHLAHLIDMCKDKYLVFEFE  537

Query  1782  DNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNS  1961
             DN++ VLEREA+ + S  ILKDYGIPSERS+DL+ PYVD I    A+DQ   GDS  SN 
Sbjct  538   DNYVAVLEREASNSASLCILKDYGIPSERSADLLEPYVDPIDDTQALDQG-IGDSPVSNL  596

Query  1962  EFGFDGLLWA  1991
             E GFDGL+WA
Sbjct  597   EIGFDGLVWA  606



>ref|NP_566115.1| DegP2 protease [Arabidopsis thaliana]
 sp|O82261.2|DEGP2_ARATH RecName: Full=Protease Do-like 2, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG41447.1|AF326865_1 putative DegP2 protease [Arabidopsis thaliana]
 gb|AAK14061.1|AF245171_1 DegP2 protease [Arabidopsis thaliana]
 gb|AAK15563.1|AF349516_1 putative DegP2 protease [Arabidopsis thaliana]
 gb|AAL77706.1| At2g47940/F17A22.33 [Arabidopsis thaliana]
 gb|AAC63648.2| DegP2 protease [Arabidopsis thaliana]
 gb|AAM15122.1| DegP2 protease [Arabidopsis thaliana]
 gb|AAM26706.1| At2g47940/F17A22.33 [Arabidopsis thaliana]
 gb|AEC10914.1| DegP2 protease [Arabidopsis thaliana]
Length=607

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/532 (80%), Positives = 472/532 (89%), Gaps = 3/532 (1%)
 Frame = +3

Query  402   QSTSFKSFGVQRKGKGVQFD--SKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQK  575
             Q  +FK+FG  +K K       S++ Q +   + DA+FLNAVVKVYCTHTAPDYSLPWQK
Sbjct  77    QKMAFKAFGSPKKEKKESLSDFSRDQQTDPAKIHDASFLNAVVKVYCTHTAPDYSLPWQK  136

Query  576   QRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSV  755
             QRQ+TSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDD KYVAKVL RGV+CDIALLSV
Sbjct  137   QRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRGVDCDIALLSV  196

Query  756   ESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLG  935
             ESE+FWKGAEPL+ GHLPRLQD+VTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS+LLG
Sbjct  197   ESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLG  256

Query  936   IQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGK  1115
             IQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+E ENIGYVIPTTVVSHFL DYERNGK
Sbjct  257   IQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLTDYERNGK  316

Query  1116  YTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRV  1295
             YTG+P LGVLLQKLENPALR CLKVP+NEGVL+R+VEPTSDA   LKEGDVIVSFDD+ V
Sbjct  317   YTGYPCLGVLLQKLENPALRECLKVPTNEGVLVRRVEPTSDASKVLKEGDVIVSFDDLHV  376

Query  1296  GCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGG  1475
             GCEGTVPFRS+ERIAFRYLIS+KF+GD AE+GIIRAGE  KVQ+VL PRV LVPYHI+GG
Sbjct  377   GCEGTVPFRSSERIAFRYLISQKFAGDIAEIGIIRAGEHKKVQVVLRPRVHLVPYHIDGG  436

Query  1476  QPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVN  1655
             QPSY+IVAGLVFTPLSEPLI+EECED+IGLKLLTKARYS A F+GEQIV+LSQVLANEVN
Sbjct  437   QPSYIIVAGLVFTPLSEPLIEEECEDTIGLKLLTKARYSVARFRGEQIVILSQVLANEVN  496

Query  1656  IGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTS  1835
             IGYED++N+Q+LK NG  IRNIHHLAHL+D CKDKYLVFEF DN++ VLEREA+ + S  
Sbjct  497   IGYEDMNNQQVLKFNGIPIRNIHHLAHLIDMCKDKYLVFEFEDNYVAVLEREASNSASLC  556

Query  1836  ILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             ILKDYGIPSERS+DL+ PYVD I    A+DQ   GDS  SN E GFDGL+WA
Sbjct  557   ILKDYGIPSERSADLLEPYVDPIDDTQALDQG-IGDSPVSNLEIGFDGLVWA  607



>ref|XP_009118165.1| PREDICTED: protease Do-like 2, chloroplastic [Brassica rapa]
Length=600

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/567 (77%), Positives = 491/567 (87%), Gaps = 5/567 (1%)
 Frame = +3

Query  300   TEREAVTQKCTRRSKGERFFSNVDDRNTNKNGRSQSTSFKS-FGV--QRKGKGVQFDSKE  470
             T R + + K     K +++   V D +++ +G  Q+ +FKS FG   Q+K K     + +
Sbjct  36    TPRASSSSKLNPEKKKKKYTLRVRDEHSSNDG-PQTMAFKSPFGSSQQKKDKKESQPTTD  94

Query  471   LQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCV  650
             L+ +   + DA+FL+AVVKVYCTHTAPDYSLPWQKQRQ+TSTGSAFMIGDGKLLTNAHCV
Sbjct  95    LRTDPAKIHDASFLDAVVKVYCTHTAPDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCV  154

Query  651   EHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVT  830
             EHDTQVKVKRRGDD KYVAKVL RGV+CDIALLSVESE+FWKGAEPL+ GHLPRLQD+VT
Sbjct  155   EHDTQVKVKRRGDDRKYVAKVLVRGVDCDIALLSVESEDFWKGAEPLRLGHLPRLQDSVT  214

Query  831   VVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIG  1010
             VVGYPLGGDTISVTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIG
Sbjct  215   VVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIG  274

Query  1011  VAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV  1190
             VAFQVYRS+E ENIGYVIPTTVVSHFL DYERN KYTG+P LGVLLQKLENPALR CLKV
Sbjct  275   VAFQVYRSEETENIGYVIPTTVVSHFLTDYERNAKYTGYPCLGVLLQKLENPALRECLKV  334

Query  1191  PSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFS  1370
             P+NEGVL+R+VEPTSDA   LKEGDVIVSFDD+RVGCEGTVPFRS+ERIAFRYLIS+KF+
Sbjct  335   PTNEGVLVRRVEPTSDASKVLKEGDVIVSFDDLRVGCEGTVPFRSSERIAFRYLISQKFA  394

Query  1371  GDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECE  1550
             GD  ELGIIRAGE  KVQ+VL PRV LVPYHI+GGQPSY+I+AGLVFTPLSEPLI+EECE
Sbjct  395   GDIVELGIIRAGEPKKVQVVLRPRVHLVPYHIDGGQPSYIIIAGLVFTPLSEPLIEEECE  454

Query  1551  DSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHL  1730
             D+IGLKLLTKARYS A F+GEQIV+LSQVLANEVNIGYED++N+Q+LK NG  IRNIHHL
Sbjct  455   DTIGLKLLTKARYSVARFRGEQIVILSQVLANEVNIGYEDMNNQQVLKFNGTHIRNIHHL  514

Query  1731  AHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQ  1910
             AHL+D CKDKYLVFEF DN++ VLEREA+ + S  ILKDYGIPSERS+DL  PYVD +  
Sbjct  515   AHLIDMCKDKYLVFEFEDNYVAVLEREASNSASLCILKDYGIPSERSADLREPYVDPVHD  574

Query  1911  NDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             N+A+DQ  FGDS  SN E GFDGL+WA
Sbjct  575   NEALDQG-FGDSPVSNLEIGFDGLVWA  600



>ref|XP_010518514.1| PREDICTED: protease Do-like 2, chloroplastic isoform X1 [Camelina 
sativa]
Length=618

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/539 (79%), Positives = 474/539 (88%), Gaps = 1/539 (0%)
 Frame = +3

Query  375   RNTNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPD  554
             R+ + N   Q+ +FK+FG  +K K     S +   +   + DA+FLNAVVKVYCTHTAPD
Sbjct  81    RDESCNNAHQTMAFKAFGSPKKDKKDAALSHQRTDDPAKIHDASFLNAVVKVYCTHTAPD  140

Query  555   YSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVEC  734
             YSLPWQKQRQ+TSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDD KYVAKVL RGV+C
Sbjct  141   YSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRGVDC  200

Query  735   DIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAH  914
             DIALLSVESE+FWKGAEPL+ GHLPRLQD+VTVVGYPLGGDTISVTKGVVSRIEVTSYAH
Sbjct  201   DIALLSVESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAH  260

Query  915   GSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQ  1094
             GSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+E ENIGYVIPTTVVSHFL 
Sbjct  261   GSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLT  320

Query  1095  DYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIV  1274
             DYERNGKYTG+P LGVLLQKLENPALR CLKVP+NEGVL+R+VEPTSDA   LKEGDVIV
Sbjct  321   DYERNGKYTGYPCLGVLLQKLENPALRECLKVPTNEGVLVRRVEPTSDASKVLKEGDVIV  380

Query  1275  SFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLV  1454
             SFDD+ VGCEGTVPFRS+ERIAFRYLIS+KF+GD AELGIIRAGE  KVQ+VL PRV LV
Sbjct  381   SFDDLHVGCEGTVPFRSSERIAFRYLISQKFAGDIAELGIIRAGEHKKVQVVLRPRVHLV  440

Query  1455  PYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQ  1634
             PYHI+GGQPSY+IVAGLVFTPLSEPLI+EECED+IGLKLLTKARYS A F+GEQIV+LSQ
Sbjct  441   PYHIDGGQPSYIIVAGLVFTPLSEPLIEEECEDTIGLKLLTKARYSVARFRGEQIVILSQ  500

Query  1635  VLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREA  1814
             VLANEVNIGYED++N+Q+LK NG  IRNIHHLAHL+D CKDKYLVFEF DN++ VLEREA
Sbjct  501   VLANEVNIGYEDMNNQQVLKFNGSPIRNIHHLAHLIDMCKDKYLVFEFEDNYVAVLEREA  560

Query  1815  ALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             + + S  ILKDYGIPSERS+DL+ PYVD      A+DQ   GDS  SN E GFDGL+WA
Sbjct  561   SNSASLCILKDYGIPSERSADLLEPYVDPRDDTQALDQG-IGDSPVSNLEIGFDGLVWA  618



>pdb|4FLN|A Chain A, Crystal Structure Of Plant Protease Deg2
 pdb|4FLN|B Chain B, Crystal Structure Of Plant Protease Deg2
 pdb|4FLN|C Chain C, Crystal Structure Of Plant Protease Deg2
Length=539

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/540 (79%), Positives = 474/540 (88%), Gaps = 3/540 (1%)
 Frame = +3

Query  378   NTNKNGRSQSTSFKSFGVQRKGKGVQFD--SKELQVETGNLQDANFLNAVVKVYCTHTAP  551
             N   +   Q  +FK+FG  +K K       S++ Q +   + DA+FLNAVVKVYCTHTAP
Sbjct  1     NAESSNPPQKMAFKAFGSPKKEKKESLSDFSRDQQTDPAKIHDASFLNAVVKVYCTHTAP  60

Query  552   DYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVE  731
             DYSLPWQKQRQ+TSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDD KYVAKVL RGV+
Sbjct  61    DYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRGVD  120

Query  732   CDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYA  911
             CDIALLSVESE+FWKGAEPL+ GHLPRLQD+VTVVGYPLGGDTISVTKGVVSRIEVTSYA
Sbjct  121   CDIALLSVESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYA  180

Query  912   HGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFL  1091
             HGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+E ENIGYVIPTTVVSHFL
Sbjct  181   HGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFL  240

Query  1092  QDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVI  1271
              DYERNGKYTG+P LGVLLQKLENPALR CLKVP+NEGVL+R+VEPTSDA   LKEGDVI
Sbjct  241   TDYERNGKYTGYPCLGVLLQKLENPALRECLKVPTNEGVLVRRVEPTSDASKVLKEGDVI  300

Query  1272  VSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDL  1451
             VSFDD+ VGCEGTVPFRS+ERIAFRYLIS+KF+GD AE+GIIRAGE  KVQ+VL PRV L
Sbjct  301   VSFDDLHVGCEGTVPFRSSERIAFRYLISQKFAGDIAEIGIIRAGEHKKVQVVLRPRVHL  360

Query  1452  VPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLS  1631
             VPYHI+GGQPSY+IVAGLVFTPLSEPLI+EECED+IGLKLLTKARYS A F+GEQIV+LS
Sbjct  361   VPYHIDGGQPSYIIVAGLVFTPLSEPLIEEECEDTIGLKLLTKARYSVARFRGEQIVILS  420

Query  1632  QVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLERE  1811
             QVLANEVNIGYED++N+Q+LK NG  IRNIHHLAHL+D CKDKYLVFEF DN++ VLERE
Sbjct  421   QVLANEVNIGYEDMNNQQVLKFNGIPIRNIHHLAHLIDMCKDKYLVFEFEDNYVAVLERE  480

Query  1812  AALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             A+ + S  ILKDYGIPSERS+DL+ PYVD I    A+DQ   GDS  SN E GFDGL+WA
Sbjct  481   ASNSASLCILKDYGIPSERSADLLEPYVDPIDDTQALDQG-IGDSPVSNLEIGFDGLVWA  539



>ref|XP_010518515.1| PREDICTED: protease Do-like 2, chloroplastic isoform X2 [Camelina 
sativa]
Length=615

 Score =   891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/539 (79%), Positives = 474/539 (88%), Gaps = 1/539 (0%)
 Frame = +3

Query  375   RNTNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPD  554
             R+ + N   Q+ +FK+FG  +K K     S +   +   + DA+FLNAVVKVYCTHTAPD
Sbjct  78    RDESCNNAHQTMAFKAFGSPKKDKKDAALSHQRTDDPAKIHDASFLNAVVKVYCTHTAPD  137

Query  555   YSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVEC  734
             YSLPWQKQRQ+TSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDD KYVAKVL RGV+C
Sbjct  138   YSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRGVDC  197

Query  735   DIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAH  914
             DIALLSVESE+FWKGAEPL+ GHLPRLQD+VTVVGYPLGGDTISVTKGVVSRIEVTSYAH
Sbjct  198   DIALLSVESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAH  257

Query  915   GSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQ  1094
             GSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+E ENIGYVIPTTVVSHFL 
Sbjct  258   GSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLT  317

Query  1095  DYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIV  1274
             DYERNGKYTG+P LGVLLQKLENPALR CLKVP+NEGVL+R+VEPTSDA   LKEGDVIV
Sbjct  318   DYERNGKYTGYPCLGVLLQKLENPALRECLKVPTNEGVLVRRVEPTSDASKVLKEGDVIV  377

Query  1275  SFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLV  1454
             SFDD+ VGCEGTVPFRS+ERIAFRYLIS+KF+GD AELGIIRAGE  KVQ+VL PRV LV
Sbjct  378   SFDDLHVGCEGTVPFRSSERIAFRYLISQKFAGDIAELGIIRAGEHKKVQVVLRPRVHLV  437

Query  1455  PYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQ  1634
             PYHI+GGQPSY+IVAGLVFTPLSEPLI+EECED+IGLKLLTKARYS A F+GEQIV+LSQ
Sbjct  438   PYHIDGGQPSYIIVAGLVFTPLSEPLIEEECEDTIGLKLLTKARYSVARFRGEQIVILSQ  497

Query  1635  VLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREA  1814
             VLANEVNIGYED++N+Q+LK NG  IRNIHHLAHL+D CKDKYLVFEF DN++ VLEREA
Sbjct  498   VLANEVNIGYEDMNNQQVLKFNGSPIRNIHHLAHLIDMCKDKYLVFEFEDNYVAVLEREA  557

Query  1815  ALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             + + S  ILKDYGIPSERS+DL+ PYVD      A+DQ   GDS  SN E GFDGL+WA
Sbjct  558   SNSASLCILKDYGIPSERSADLLEPYVDPRDDTQALDQG-IGDSPVSNLEIGFDGLVWA  615



>gb|KFK37548.1| hypothetical protein AALP_AA4G271000 [Arabis alpina]
Length=615

 Score =   891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/579 (75%), Positives = 484/579 (84%), Gaps = 23/579 (4%)
 Frame = +3

Query  264   NQRKKPPARVSHTEREAVTQKCTRRSKGERFFSNVDDRNTNKNGRSQSTSFKSFGVQRKG  443
             N  KK P RV    R+ ++ K                      G  Q  +FK+FG  +K 
Sbjct  57    NPEKKYPGRVRDVHRDGISGK------------------GGDVGGHQKMAFKAFGSPKKE  98

Query  444   KG---VQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMI  614
             K     +F  ++ Q +   + DA+FLNAVVKVYCTHTAPDYSLPWQKQRQ+TSTGSAFMI
Sbjct  99    KKESQSEFREQQ-QTDPAKIHDASFLNAVVKVYCTHTAPDYSLPWQKQRQFTSTGSAFMI  157

Query  615   GDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQ  794
             GDGKLLTNAHCVEHDTQVKVKRRGDD KYVAKVL RGV+CDIALLSVESEEFWKGAEPL+
Sbjct  158   GDGKLLTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRGVDCDIALLSVESEEFWKGAEPLR  217

Query  795   FGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSG  974
              GHLPRLQD+VTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSG
Sbjct  218   LGHLPRLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSG  277

Query  975   GPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQK  1154
             GPAFND GECIGVAFQVYRS+E ENIGYVIPTTVVSHFL DYERNGKYTG+P LGVLLQK
Sbjct  278   GPAFNDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLTDYERNGKYTGYPCLGVLLQK  337

Query  1155  LENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTER  1334
             LENPALR CLKVP+NEGVL+R+VEPTSDA   LKEGDVIVSFD + VGCEGTVPFRS+ER
Sbjct  338   LENPALRECLKVPTNEGVLVRRVEPTSDASKVLKEGDVIVSFDGLHVGCEGTVPFRSSER  397

Query  1335  IAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFT  1514
             IAFRYLI++KF+GD AELGIIRAGE  K+Q+VL PRV LVPYHI+GGQPSY+I+AGLVFT
Sbjct  398   IAFRYLITQKFAGDVAELGIIRAGEHKKIQVVLRPRVHLVPYHIDGGQPSYIIIAGLVFT  457

Query  1515  PLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILK  1694
             PLSEPLI+EECED+IGLKLLTKARYS A F+GEQIV+LSQVLANEVNIGYED++N+Q+LK
Sbjct  458   PLSEPLIEEECEDTIGLKLLTKARYSVARFRGEQIVILSQVLANEVNIGYEDMNNQQVLK  517

Query  1695  LNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSS  1874
              NG  IRNIHHLAHL+D CKDKYLVFEF DN++ VLEREA+ + S  ILKDYGIPSERS+
Sbjct  518   FNGNHIRNIHHLAHLIDMCKDKYLVFEFEDNYVAVLEREASNSASVCILKDYGIPSERSA  577

Query  1875  DLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             DL+ PYVD I    A+ Q  FGDS  SN E GFDGL+WA
Sbjct  578   DLLEPYVDPIDDTQALGQG-FGDSPVSNLEMGFDGLVWA  615



>ref|XP_010507830.1| PREDICTED: protease Do-like 2, chloroplastic [Camelina sativa]
Length=617

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/542 (79%), Positives = 474/542 (87%), Gaps = 2/542 (0%)
 Frame = +3

Query  369   DDRNTNKNGRSQSTSFKSFGVQRKGK-GVQFDSKELQVETGNLQDANFLNAVVKVYCTHT  545
             D+   + N   Q+ +FK+FG  +K K      S +   +   + DA+FLNAVVKVYCTHT
Sbjct  77    DESCNSSNNAHQTMAFKAFGSPKKDKKDAAALSHQQTTDPAKIHDASFLNAVVKVYCTHT  136

Query  546   APDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARG  725
             APDYSLPWQKQRQ+TSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDD KYVAKVL RG
Sbjct  137   APDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRG  196

Query  726   VECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTS  905
             V+CDIALLSVESE+FWKGAEPL+ GHLPRLQD+VTVVGYPLGGDTISVTKGVVSRIEVTS
Sbjct  197   VDCDIALLSVESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGGDTISVTKGVVSRIEVTS  256

Query  906   YAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSH  1085
             YAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+E ENIGYVIPTTVVSH
Sbjct  257   YAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEETENIGYVIPTTVVSH  316

Query  1086  FLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGD  1265
             FL DYERNGKYTG+P LGVLLQKLENPALR CLKVP+NEGVL+R+VEPTSDA   LKEGD
Sbjct  317   FLTDYERNGKYTGYPCLGVLLQKLENPALRECLKVPTNEGVLVRRVEPTSDASKVLKEGD  376

Query  1266  VIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRV  1445
             VIVSFDD+ VGCEGTVPFRS+ERIAFRYLIS+KF+GD AELGIIRAGE  KVQ+VL PRV
Sbjct  377   VIVSFDDLHVGCEGTVPFRSSERIAFRYLISQKFAGDVAELGIIRAGEHKKVQVVLRPRV  436

Query  1446  DLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVV  1625
              LVPYHI+GGQPSY+IVAGLVFTPLSEPLI+EECED+IGLKLLTKARYS A F+GEQIV+
Sbjct  437   HLVPYHIDGGQPSYIIVAGLVFTPLSEPLIEEECEDTIGLKLLTKARYSVARFRGEQIVI  496

Query  1626  LSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLE  1805
             LSQVLANEVNIGYED++N+Q+LK NG  IRNIHHLAHL+D CKDKYLVFEF DN++ VLE
Sbjct  497   LSQVLANEVNIGYEDMNNQQVLKFNGIPIRNIHHLAHLIDMCKDKYLVFEFEDNYVAVLE  556

Query  1806  REAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLL  1985
             REA+ + S  ILKDYGIPSERS+DL+ PYVD      A+DQ   GDS  SN E GFDGL+
Sbjct  557   REASNSASLCILKDYGIPSERSADLLEPYVDPRDDTQALDQG-IGDSPVSNLEIGFDGLV  615

Query  1986  WA  1991
             WA
Sbjct  616   WA  617



>ref|XP_010506841.1| PREDICTED: protease Do-like 2, chloroplastic [Camelina sativa]
Length=613

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/539 (79%), Positives = 473/539 (88%), Gaps = 1/539 (0%)
 Frame = +3

Query  375   RNTNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPD  554
             R+ + N   Q+ +FK+FG  +K K     S +   +   + DA+FLNAVVKVYCTHTAPD
Sbjct  76    RDESCNNAHQTMAFKAFGSPKKDKKDAALSHQRTDDPAKIHDASFLNAVVKVYCTHTAPD  135

Query  555   YSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVEC  734
             YSLPWQKQRQ+TSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDD KYVAKVL RGV+C
Sbjct  136   YSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRGVDC  195

Query  735   DIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAH  914
             DIALLSVESE+FWKGAEPL+ GHLPRLQD+VTVVGYPLGGDTISVTKGVVSRIEVTSYAH
Sbjct  196   DIALLSVESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAH  255

Query  915   GSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQ  1094
             GSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+E ENIGYVIPTTVVSHFL 
Sbjct  256   GSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLT  315

Query  1095  DYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIV  1274
             DYERNGKYTG+P LGVLLQKLENPALR CLKVP+NEGVL+R+VEPTS A   LKEGDVIV
Sbjct  316   DYERNGKYTGYPCLGVLLQKLENPALRECLKVPTNEGVLVRRVEPTSYASKVLKEGDVIV  375

Query  1275  SFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLV  1454
             SFDD+ VGCEGTVPFRS+ERIAFRYLIS+KF+GD AELGIIRAGE  KVQ+VL PRV LV
Sbjct  376   SFDDLHVGCEGTVPFRSSERIAFRYLISQKFAGDIAELGIIRAGEHKKVQVVLRPRVHLV  435

Query  1455  PYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQ  1634
             PYHI+GGQPSY+IVAGLVFTPLSEPLI+EECED+IGLKLLTKARYS A F+GEQIV+LSQ
Sbjct  436   PYHIDGGQPSYIIVAGLVFTPLSEPLIEEECEDTIGLKLLTKARYSVARFRGEQIVILSQ  495

Query  1635  VLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREA  1814
             VLANEVNIGYED++N+Q+LK NG  IRNIHHLAHL+D CKDKYLVFEF DN++ VLEREA
Sbjct  496   VLANEVNIGYEDMNNQQVLKFNGIPIRNIHHLAHLIDMCKDKYLVFEFEDNYVAVLEREA  555

Query  1815  ALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             + + S  ILKDYGIPSERS+DL+ PYVD      A+DQ   GDS  SN E GFDGL+WA
Sbjct  556   SNSASLCILKDYGIPSERSADLLEPYVDPRDDTQALDQG-IGDSPVSNLEIGFDGLVWA  613



>ref|XP_002882138.1| hypothetical protein ARALYDRAFT_483986 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58397.1| hypothetical protein ARALYDRAFT_483986 [Arabidopsis lyrata subsp. 
lyrata]
Length=613

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/539 (79%), Positives = 472/539 (88%), Gaps = 10/539 (2%)
 Frame = +3

Query  402   QSTSFKSFGVQRKGKGVQFD--SKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQK  575
             Q  +FK+FG  +K K       S++ Q + G + DA+FLNAVVKVYCTHTAPDYSLPWQK
Sbjct  76    QKMAFKAFGSPKKEKKEPLSDFSRDQQTDPGKIHDASFLNAVVKVYCTHTAPDYSLPWQK  135

Query  576   QRQYTSTGS-------AFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVEC  734
             QRQ+TSTG        AFMIGDGKLLTNAHCVEHDTQVKVKRRGDD KYVAKVL RGV+C
Sbjct  136   QRQFTSTGRHVFFIHIAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRGVDC  195

Query  735   DIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAH  914
             DIALLSVESE+FWKGAEPL+ GHLPRLQD+VTVVGYPLGGDTISVTKGVVSRIEVTSYAH
Sbjct  196   DIALLSVESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAH  255

Query  915   GSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQ  1094
             GSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+E ENIGYVIPTTVVSHFL 
Sbjct  256   GSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLT  315

Query  1095  DYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIV  1274
             DYERNGKYTG+P LGVLLQKLENPALR CLKVP+NEGVL+R+VEPTSDA   LKEGDVIV
Sbjct  316   DYERNGKYTGYPCLGVLLQKLENPALRECLKVPTNEGVLVRRVEPTSDASKVLKEGDVIV  375

Query  1275  SFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLV  1454
             SFDD+ VGCEGTVPFRS+ERIAFRYLIS+KF+GD AELGIIRAGE  KVQ+VL PRV LV
Sbjct  376   SFDDLHVGCEGTVPFRSSERIAFRYLISQKFAGDIAELGIIRAGEHKKVQVVLRPRVHLV  435

Query  1455  PYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQ  1634
             PYHI+GGQPSY+IVAGLVFTPLSEPLI+EECED+IGLKLLTKARYS A F+GEQIV+LSQ
Sbjct  436   PYHIDGGQPSYIIVAGLVFTPLSEPLIEEECEDTIGLKLLTKARYSVARFRGEQIVILSQ  495

Query  1635  VLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREA  1814
             VLANEVNIGYED++N+Q+LK NG  IRNIHHLAHL+D CKDKYLVFEF DN++ VLEREA
Sbjct  496   VLANEVNIGYEDMNNQQVLKFNGIPIRNIHHLAHLIDMCKDKYLVFEFEDNYVAVLEREA  555

Query  1815  ALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             + + S  ILKDYGIPSERS+DL+ PYVD I    A+DQ   GDS  SN E GFDGL+WA
Sbjct  556   SNSASLCILKDYGIPSERSADLLEPYVDPIDDTQALDQG-IGDSPVSNLEIGFDGLVWA  613



>ref|XP_009384166.1| PREDICTED: protease Do-like 2, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=627

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/612 (73%), Positives = 505/612 (83%), Gaps = 25/612 (4%)
 Frame = +3

Query  189   LFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQK-CTRRSKGERFFSN  365
             +FA+ RP       +S  QS + +H+ R+K      +   E V+QK    R K +R +  
Sbjct  30    IFASHRPH------RSGRQSLSNDHSNRRK------NDVVEGVSQKRFPGRGKDDRTYLP  77

Query  366   VDDRNTNKN---------GRSQSTSFKSFGVQRKGKGVQFDSKELQV-ETGNLQDANFLN  515
              D    +            +SQST FKS G Q K KG+ +D KE Q  ETG  QD+ FLN
Sbjct  78    SDGSRGDAGLSQSQSQSQSQSQSTVFKSIGTQ-KDKGMVYDLKEQQADETGKFQDSAFLN  136

Query  516   AVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDT  695
             AVVKVYCTHT+PDYSLPWQKQRQ+TSTGSAFMIGDGKLLTNAHCVEH TQVKVKRRGDDT
Sbjct  137   AVVKVYCTHTSPDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHGTQVKVKRRGDDT  196

Query  696   KYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTK  875
             K+VAKVLARG+ECDIALLSV+SE+FWKGAEPL+FGHLP LQD+VTVVGYPLGGDTISVTK
Sbjct  197   KFVAKVLARGIECDIALLSVDSEDFWKGAEPLRFGHLPCLQDSVTVVGYPLGGDTISVTK  256

Query  876   GVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIG  1055
             GVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQV+RS+E ENIG
Sbjct  257   GVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDHGECIGVAFQVFRSEEAENIG  316

Query  1056  YVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTS  1235
             YVIPTTVVSHFL DYER+GKYTGFPSLGVLLQKLENPALRACLKV SNEGVL+R+VEPTS
Sbjct  317   YVIPTTVVSHFLNDYERSGKYTGFPSLGVLLQKLENPALRACLKVSSNEGVLVRRVEPTS  376

Query  1236  DAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFM  1415
              A++ LKEGDVIVSFD V+VG EGTVPFRSTERIAFRYLIS+KFSGD AELGIIR G +M
Sbjct  377   PANDVLKEGDVIVSFDGVQVGSEGTVPFRSTERIAFRYLISQKFSGDVAELGIIRDGTYM  436

Query  1416  KVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSF  1595
             KV+ VL PRV LVP+HIEGGQPSYLI+AGLVFTPLSEPLI+EECEDSIGLKLL KARYS 
Sbjct  437   KVRTVLQPRVHLVPFHIEGGQPSYLIIAGLVFTPLSEPLIEEECEDSIGLKLLAKARYSL  496

Query  1596  ANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFE  1775
             A FKGE+IV+LSQVLANEVNIGYED+  +Q++K NG  I+NI HLAHL+D+CKDKYL+FE
Sbjct  497   ARFKGEEIVILSQVLANEVNIGYEDMGTQQVMKFNGTPIKNIRHLAHLVDTCKDKYLIFE  556

Query  1776  FADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAES  1955
             F DNFL VLEREAA   S  +LKDYGIP ERSSDL+ P++D + ++  +  Q+ GDS  S
Sbjct  557   FEDNFLAVLEREAAAAASPFVLKDYGIPCERSSDLLEPFID-LEEDKQILNQDIGDSPVS  615

Query  1956  NSEFGFDGLLWA  1991
             N E GFDGLLWA
Sbjct  616   NFEIGFDGLLWA  627



>ref|XP_003536894.1| PREDICTED: protease Do-like 2, chloroplastic-like isoform X1 
[Glycine max]
Length=612

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/564 (76%), Positives = 484/564 (86%), Gaps = 9/564 (2%)
 Frame = +3

Query  303   EREAVTQKCTRRSKGERFFSNVDDRNTNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVE  482
             ++E V QK  ++SK ER          N     Q++S K FG+QRK K + FDSK+ QVE
Sbjct  57    QKEGVGQK--KQSKDER------PARGNVLEPQQTSSSKPFGIQRKNKDLIFDSKDQQVE  108

Query  483   TGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDT  662
                LQD+ FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGD KLLTNAHCVEHDT
Sbjct  109   PSALQDSAFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDRKLLTNAHCVEHDT  168

Query  663   QVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGY  842
             QVKVK+RGDD+KYVAKVLARGV+CDIALLSVESEEFW+  EPL+ G LP LQD+VTVVGY
Sbjct  169   QVKVKKRGDDSKYVAKVLARGVDCDIALLSVESEEFWRDVEPLRLGRLPHLQDSVTVVGY  228

Query  843   PLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQ  1022
             PLGGDTISVTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQ
Sbjct  229   PLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQ  288

Query  1023  VYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE  1202
             V RSDE ENIGYVIPTTVVSHFL DYERNG+YTGFP LGVL+QKLENPALRA LKV SNE
Sbjct  289   VLRSDEAENIGYVIPTTVVSHFLTDYERNGRYTGFPCLGVLIQKLENPALRAWLKVQSNE  348

Query  1203  GVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTA  1382
             GVL+R+VEPTSDA+N LKEGDVIVSFDDVRVG EGTVPFRS ERIAF +LIS+KF+GDTA
Sbjct  349   GVLVRRVEPTSDANNVLKEGDVIVSFDDVRVGSEGTVPFRSNERIAFHFLISQKFAGDTA  408

Query  1383  ELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIG  1562
             ELGIIRAG  +K ++VL+ RV LVPYHI+ GQPSYLI+AGLVFTPLSEPLI+EECEDSIG
Sbjct  409   ELGIIRAGSLIKTKVVLNSRVHLVPYHIDEGQPSYLIIAGLVFTPLSEPLIEEECEDSIG  468

Query  1563  LKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLL  1742
             LKLL +ARYS A FKGEQIV+LSQVLANEVNIGYED+ N+Q++K NG RI+NIHHLAHL+
Sbjct  469   LKLLARARYSLAKFKGEQIVILSQVLANEVNIGYEDMGNQQVVKFNGTRIKNIHHLAHLI  528

Query  1743  DSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIG-QNDA  1919
             DSCKD+YL FEF D+++ VLE+E+    S S+L DYGIPSERSSDL+ PYVD++  + D 
Sbjct  529   DSCKDRYLRFEFEDSYVAVLEKESVTAASPSVLSDYGIPSERSSDLLKPYVDALEVEGDQ  588

Query  1920  VDQQEFGDSAESNSEFGFDGLLWA  1991
                +EFGDS  SN EFG DGLLWA
Sbjct  589   PADEEFGDSPVSNYEFGPDGLLWA  612



>ref|XP_004495997.1| PREDICTED: protease Do-like 2, chloroplastic-like [Cicer arietinum]
Length=600

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/584 (74%), Positives = 490/584 (84%), Gaps = 21/584 (4%)
 Frame = +3

Query  288   RVSHTEREAVTQKCTR----------RSKGERF------FSNVDDRNTNKNGRSQSTSFK  419
             R SH  R  ++ +CTR          R K + +       S+ D++++   G     S+K
Sbjct  22    RYSH--RPIISIRCTRTPSIPDPNINRQKKDAWQKKQLKLSSKDEKSSG--GNVVPASYK  77

Query  420   SFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTG  599
             S G+ RK +    DSK+LQVE+ NLQD+ FLNAVVKVYCTHTAPDYSLPWQKQRQ+TSTG
Sbjct  78    SSGISRKDRDFMVDSKDLQVESNNLQDSAFLNAVVKVYCTHTAPDYSLPWQKQRQFTSTG  137

Query  600   SAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKG  779
             SAFMIG  KLLTNAHCVE+DTQVKVK+RGDD+KYVAKVLAR V CD+ALLSVESEEFW+ 
Sbjct  138   SAFMIGGRKLLTNAHCVEYDTQVKVKKRGDDSKYVAKVLARAVGCDLALLSVESEEFWRD  197

Query  780   AEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVN  959
              EPL+FGHLP LQD+VTVVGYPLGGDTISVTKGVVSR+EVTSYAHG SELLGIQIDAA+N
Sbjct  198   VEPLRFGHLPHLQDSVTVVGYPLGGDTISVTKGVVSRVEVTSYAHGLSELLGIQIDAAIN  257

Query  960   PGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLG  1139
             PGNSGGPAFN  GECIGVAFQVYRS+E ENIGYVIPTTVVSHFL DYE+NGKYTGFP LG
Sbjct  258   PGNSGGPAFNGQGECIGVAFQVYRSEEAENIGYVIPTTVVSHFLTDYEKNGKYTGFPCLG  317

Query  1140  VLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPF  1319
             VL+QKLENP LRACLKV SNEGVL+R+VEPTSDA+N LKEGDVIVSFD VRVGCEGTVPF
Sbjct  318   VLIQKLENPVLRACLKVQSNEGVLVRRVEPTSDANNVLKEGDVIVSFDGVRVGCEGTVPF  377

Query  1320  RSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVA  1499
             RS ERIAF +LIS+KF+GDTAELGIIRAG  MK  +VL+PRV LVPYHI+ GQPSYLI+A
Sbjct  378   RSNERIAFHFLISQKFAGDTAELGIIRAGTLMKADVVLNPRVHLVPYHIDEGQPSYLIIA  437

Query  1500  GLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISN  1679
             GLVFTPLSEPLI+EE EDSIGLKLLTKARYSFA FKGEQIV+LSQVLANE+NIGYED+SN
Sbjct  438   GLVFTPLSEPLIEEEHEDSIGLKLLTKARYSFARFKGEQIVILSQVLANELNIGYEDMSN  497

Query  1680  EQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIP  1859
             +QI+K NG RI+NIHHLAHL+DSCKD+YL FEF D+++ VLEREA    S+S+L+DYGIP
Sbjct  498   QQIIKFNGTRIKNIHHLAHLIDSCKDRYLCFEFEDSYVAVLEREAVAAASSSLLRDYGIP  557

Query  1860  SERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             SERSSDL+ PYVDS+ + D    QEFGD   SN E G DGLL A
Sbjct  558   SERSSDLLQPYVDSL-EGDQPADQEFGDCPVSNFEVGHDGLLLA  600



>ref|XP_003520225.1| PREDICTED: protease Do-like 2, chloroplastic-like [Glycine max]
Length=612

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/532 (80%), Positives = 469/532 (88%), Gaps = 1/532 (0%)
 Frame = +3

Query  399   SQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQ  578
             SQ TS K FG+QRK K + FDSK+ QVE   LQD+ FLNAVVKVYCTHTAPDYSLPWQKQ
Sbjct  81    SQPTSSKPFGIQRKNKDLIFDSKDQQVEQSILQDSAFLNAVVKVYCTHTAPDYSLPWQKQ  140

Query  579   RQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVE  758
             RQYTSTGSAFMIGD KLLTNAHCVEHDTQVKVK+RGDD+KYVAKVLARGV+CDIALLSVE
Sbjct  141   RQYTSTGSAFMIGDRKLLTNAHCVEHDTQVKVKKRGDDSKYVAKVLARGVDCDIALLSVE  200

Query  759   SEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGI  938
             SEEFW+  EPL+ G LP LQD+VTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS+LLGI
Sbjct  201   SEEFWRDVEPLRLGRLPHLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGI  260

Query  939   QIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKY  1118
             QIDAA+NPGNSGGPAFND GECIGVAFQV RS+E ENIGYVIPTTVVSHFL DYERNG+Y
Sbjct  261   QIDAAINPGNSGGPAFNDQGECIGVAFQVLRSEEAENIGYVIPTTVVSHFLTDYERNGRY  320

Query  1119  TGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVG  1298
             TGFP LGVL+QKLENPALRA LKV SNEGVL+R+VEPTSDA+N LKEGDVIVSFDDVRVG
Sbjct  321   TGFPCLGVLIQKLENPALRAWLKVQSNEGVLVRRVEPTSDANNVLKEGDVIVSFDDVRVG  380

Query  1299  CEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQ  1478
              EGTVPFRS ERIAF +LIS+KF+GDTAELGIIRAG  MK ++VL+ RV LVPYHI+ G 
Sbjct  381   SEGTVPFRSNERIAFHFLISQKFAGDTAELGIIRAGTLMKTKVVLNSRVHLVPYHIDEGL  440

Query  1479  PSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNI  1658
             PSYLI+AGLVFTPLSEPLI+EECEDSIGLKLL +ARYS A FKGEQIV+LSQVLANEVNI
Sbjct  441   PSYLIIAGLVFTPLSEPLIEEECEDSIGLKLLARARYSLAKFKGEQIVILSQVLANEVNI  500

Query  1659  GYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSI  1838
             GYED+ N+Q++K NG RI+NIHHLAHL+DSC+D+YL FEF D+++ VLE+EA    S S+
Sbjct  501   GYEDMGNQQVVKFNGARIKNIHHLAHLIDSCEDRYLRFEFEDSYVAVLEKEAVAAASPSV  560

Query  1839  LKDYGIPSERSSDLMGPYVDSIG-QNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             L DYGIPSERSSDL  PYVD++  + D    QEFGDS  SN EFG DGLLWA
Sbjct  561   LSDYGIPSERSSDLSKPYVDTLEVEGDQPADQEFGDSPVSNYEFGPDGLLWA  612



>ref|XP_006855396.1| hypothetical protein AMTR_s00057p00143260 [Amborella trichopoda]
 gb|ERN16863.1| hypothetical protein AMTR_s00057p00143260 [Amborella trichopoda]
Length=528

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/528 (80%), Positives = 463/528 (88%), Gaps = 2/528 (0%)
 Frame = +3

Query  411   SFKSFGVQRKGKGVQFDSKELQV-ETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQY  587
             +FKS G+QRK K +  D KE Q+ E   LQD  FLNAVVKVYCTHTAPDYSLPWQKQRQ+
Sbjct  2     AFKSLGMQRKEKAIVHDLKEQQINEASTLQDGAFLNAVVKVYCTHTAPDYSLPWQKQRQF  61

Query  588   TSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEE  767
             TSTGSAFMIGDGKLLTNAHCVEH TQVKVKRRGDDTKYVAKVLARGVECDIALL VESEE
Sbjct  62    TSTGSAFMIGDGKLLTNAHCVEHYTQVKVKRRGDDTKYVAKVLARGVECDIALLYVESEE  121

Query  768   FWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQID  947
             FWKGA+PL+FG LP LQD+VTVVGYPLGGDTISVTKGVVSRIEVTSYAHG+S+LLGIQID
Sbjct  122   FWKGADPLKFGRLPCLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGASDLLGIQID  181

Query  948   AAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGF  1127
             AA+NPGNSGGPAFND GECIGVAFQV+RSDE ENIGYVIPTTVVSHFL DYERNGKYTGF
Sbjct  182   AAINPGNSGGPAFNDQGECIGVAFQVFRSDEAENIGYVIPTTVVSHFLTDYERNGKYTGF  241

Query  1128  PSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEG  1307
             PSLGVLLQKLENPALRACLKV SNEGVL+R++EPT+ AH+ LKEGDVIVSFD + VGCEG
Sbjct  242   PSLGVLLQKLENPALRACLKVNSNEGVLVRRIEPTAAAHDALKEGDVIVSFDGIPVGCEG  301

Query  1308  TVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSY  1487
             TVPFRSTERIAFRYLIS+KF+GDTAELGIIR G  MKV+ +L PRV LVPYHIEGGQPSY
Sbjct  302   TVPFRSTERIAFRYLISQKFAGDTAELGIIRGGAHMKVKTLLYPRVHLVPYHIEGGQPSY  361

Query  1488  LIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYE  1667
             LI+AGLVFTPLSEPLI EECEDS+GLKLL KARYS A FKGEQIV+LSQVLANE NIGYE
Sbjct  362   LIIAGLVFTPLSEPLIDEECEDSMGLKLLAKARYSLAKFKGEQIVLLSQVLANEANIGYE  421

Query  1668  DISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKD  1847
             D+ N+Q+LK NG +I+NI HLAHL+D+CKD+YL+FEF DNFL VL+REAA   S  ILKD
Sbjct  422   DMGNQQVLKFNGTKIKNIRHLAHLVDTCKDEYLIFEFEDNFLAVLDREAASIASPRILKD  481

Query  1848  YGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             YGIP ERSS+L   Y+DS  ++D     +  D   SN E GFDGLLWA
Sbjct  482   YGIPFERSSNLAELYLDS-SEDDLALSGDLDDIPASNLEIGFDGLLWA  528



>emb|CDY55521.1| BnaA04g29470D [Brassica napus]
Length=599

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/572 (75%), Positives = 484/572 (85%), Gaps = 16/572 (3%)
 Frame = +3

Query  300   TEREAVTQKCTRRSKGERFFSNVDDRNTNKNGRSQSTSFKS-FGV--QRKGKGVQFDSKE  470
             T R + + K     K +++   V D +++ +G  Q+ +FKS FG   Q+K K     + +
Sbjct  36    TPRASSSSKLNPEKKKKKYTLRVRDEHSSNDG-PQTMAFKSPFGSSQQKKDKKESQPTTD  94

Query  471   LQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCV  650
             L+ +   + DA+FL+AVVKVYCTHTAPDYSLPWQKQR       AFMIGDGKLLTNAHCV
Sbjct  95    LRTDPAKIHDASFLDAVVKVYCTHTAPDYSLPWQKQRH------AFMIGDGKLLTNAHCV  148

Query  651   EHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVT  830
             EHDTQVKVKRRGDD KYVAKVL RGV+CDIALLSVESE+FWKGAEPL+ GHLPRLQD+VT
Sbjct  149   EHDTQVKVKRRGDDRKYVAKVLVRGVDCDIALLSVESEDFWKGAEPLRLGHLPRLQDSVT  208

Query  831   VVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIG  1010
             VVGYPLGGDTISVTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIG
Sbjct  209   VVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIG  268

Query  1011  VAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV  1190
             VAFQVYRS+E ENIGYVIPTTVVSHFL DYERN KYTG+P LGVLLQKLENPALR CLKV
Sbjct  269   VAFQVYRSEETENIGYVIPTTVVSHFLTDYERNAKYTGYPCLGVLLQKLENPALRECLKV  328

Query  1191  PSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFS  1370
             P+NEGVL+R+VEPTSDA   LKEGDVIVSFDD+RVGCEGTVPFRS+ERIAFRYLIS+KF+
Sbjct  329   PTNEGVLVRRVEPTSDASKVLKEGDVIVSFDDLRVGCEGTVPFRSSERIAFRYLISQKFA  388

Query  1371  GDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECE  1550
             GD  ELGIIRAGE  KVQ+VL PRV LVPYHI+GGQPSY+I+AGLVFTPLSEPLI+EECE
Sbjct  389   GDIVELGIIRAGEPKKVQVVLRPRVHLVPYHIDGGQPSYIIIAGLVFTPLSEPLIEEECE  448

Query  1551  DSIGLKLLTKARYSFANFKGEQIVVLSQ-----VLANEVNIGYEDISNEQILKLNGKRIR  1715
             D+IGLKLLTKARYS A F+GEQIV+LSQ     VLANEVNIGYED++N+Q+LK NG  IR
Sbjct  449   DTIGLKLLTKARYSVARFRGEQIVILSQASHNDVLANEVNIGYEDMNNQQVLKFNGTHIR  508

Query  1716  NIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYV  1895
             NIHHLAHL+D CKDKYLVFEF DN++ VLEREA+ + S  ILKDYGIPSERS+DL  PYV
Sbjct  509   NIHHLAHLIDMCKDKYLVFEFEDNYVAVLEREASNSASLCILKDYGIPSERSADLREPYV  568

Query  1896  DSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             D +  N+A+DQ  FGDS  SN E GFDGL+WA
Sbjct  569   DPVHDNEALDQG-FGDSPVSNLEIGFDGLVWA  599



>ref|XP_010684759.1| PREDICTED: protease Do-like 2, chloroplastic isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=572

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/506 (83%), Positives = 456/506 (90%), Gaps = 1/506 (0%)
 Frame = +3

Query  474   QVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVE  653
             + E  NLQD  FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVE
Sbjct  68    EAEAANLQDTTFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVE  127

Query  654   HDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTV  833
             H TQVK+KRRGDDTKYVAKVLARG++CDIALLSVE+EEFWKGAEPL+ G LP LQD+VTV
Sbjct  128   HYTQVKLKRRGDDTKYVAKVLARGIDCDIALLSVENEEFWKGAEPLRLGRLPHLQDSVTV  187

Query  834   VGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGV  1013
             VGYPLGGDTISVTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGV
Sbjct  188   VGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGV  247

Query  1014  AFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVP  1193
             AFQV RS++ ENIGYVIPTTVVSHFL DYERNGKYTGFP LGVLLQKLENPALR+CLKV 
Sbjct  248   AFQVLRSEDTENIGYVIPTTVVSHFLTDYERNGKYTGFPCLGVLLQKLENPALRSCLKVA  307

Query  1194  SNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSG  1373
             SNEGVL+R+VEPTSDAHN LKEGDVIV FD V VGCEGTVPFRSTERIAFRYLIS+KFSG
Sbjct  308   SNEGVLVRRVEPTSDAHNALKEGDVIVRFDGVHVGCEGTVPFRSTERIAFRYLISQKFSG  367

Query  1374  DTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED  1553
             D  ELGIIR G  +KVQ VL+PRV LVPY+IEGGQPSYLIVAGLVFTPLSEPLI+EECE+
Sbjct  368   DVVELGIIRNGAHLKVQTVLNPRVHLVPYNIEGGQPSYLIVAGLVFTPLSEPLIEEECEE  427

Query  1554  SIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLA  1733
              +GLKLLTKARYS A F+GEQIV+LSQVLANEVNIGYED+SN+Q+LKLNG  IRNIHHLA
Sbjct  428   VMGLKLLTKARYSLARFRGEQIVILSQVLANEVNIGYEDMSNQQVLKLNGTHIRNIHHLA  487

Query  1734  HLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQN  1913
             HL DSC DKYLVFEF DN+LVVLERE A   S+ ILKDYGIPSERSSDLM PY+D+    
Sbjct  488   HLTDSCNDKYLVFEFEDNYLVVLERETAAAASSCILKDYGIPSERSSDLMEPYLDTFRDI  547

Query  1914  DAVDQQEFGDSAESNSEFGFDGLLWA  1991
             +AV +++ GDS  +N E GFDGLLWA
Sbjct  548   NAV-EKDIGDSPVTNLEIGFDGLLWA  572



>gb|KEH43264.1| DegP protease [Medicago truncatula]
Length=596

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/604 (72%), Positives = 493/604 (82%), Gaps = 16/604 (3%)
 Frame = +3

Query  195   ATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRR-SKGERFF---S  362
             A S   S F V  S+T      H     P      ++R  ++ +C+R  S  +  F   +
Sbjct  4     ALSSYCSMFSVLSSSTVKFRYSHRHTHTP------SQRPFISIRCSRTPSNSDPNFKGQN  57

Query  363   NVDDRNTNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVKVYCTH  542
             ++++R+T   G     SFKS    RK K    DSK+ Q E+  LQD+ FLNAVVKVYCTH
Sbjct  58    SLEERSTG--GNVVPASFKS---SRKNKDFVVDSKDQQGESSVLQDSAFLNAVVKVYCTH  112

Query  543   TAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLAR  722
             TAPDYSLPWQKQRQ+TSTGSAFMIG  KLLTNAHCVEHDTQVKVKRRGDD+KYVAKVLAR
Sbjct  113   TAPDYSLPWQKQRQFTSTGSAFMIGGKKLLTNAHCVEHDTQVKVKRRGDDSKYVAKVLAR  172

Query  723   GVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVT  902
                CD+ALLSVESEEFW+  EPL+FGHLP LQD+VTVVGYP GGDTISVTKGVVSR+EVT
Sbjct  173   AAGCDLALLSVESEEFWRDVEPLRFGHLPHLQDSVTVVGYPFGGDTISVTKGVVSRVEVT  232

Query  903   SYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVS  1082
             SYAHGSSELLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS++ ENIGYVIP+TVVS
Sbjct  233   SYAHGSSELLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEDAENIGYVIPSTVVS  292

Query  1083  HFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEG  1262
             HFL DYE+NGKYTGFP LGVL+QKLENPALRACLK+ SNEGVL+R+VEPTSDA+N LKEG
Sbjct  293   HFLTDYEKNGKYTGFPCLGVLIQKLENPALRACLKLQSNEGVLVRRVEPTSDANNVLKEG  352

Query  1263  DVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPR  1442
             DVIVSFDD+RVGCEGTVPFRS ERIAF YLIS+KF+GDTAELGI+R G  MK +++L+PR
Sbjct  353   DVIVSFDDIRVGCEGTVPFRSNERIAFHYLISQKFAGDTAELGIVRDGTSMKAKVILNPR  412

Query  1443  VDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIV  1622
             V LVP+HI+ GQPSYLI+AGLVFTPLSEPLI+EE ED IGLKLL KARYSFA FKGEQIV
Sbjct  413   VHLVPFHIDEGQPSYLIIAGLVFTPLSEPLIEEEREDCIGLKLLAKARYSFARFKGEQIV  472

Query  1623  VLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVL  1802
             +LSQVLANE+NIGYED+SN+QI+K NG RI+NIHHLAHL+DSCK+KYL FEF D +  VL
Sbjct  473   ILSQVLANELNIGYEDMSNQQIIKFNGVRIKNIHHLAHLIDSCKNKYLCFEFEDCYAAVL  532

Query  1803  EREAALTTSTSILKDYGIPSERSSDLMGPYVDSIG-QNDAVDQQEFGDSAESNSEFGFDG  1979
             EREA    S+S+L+DYGIPSERSSDL+ PYVDS   + D    QEFGDS  SN E G DG
Sbjct  533   EREAVAAASSSLLRDYGIPSERSSDLLQPYVDSQEVEGDQPPDQEFGDSPVSNFEVGHDG  592

Query  1980  LLWA  1991
             LLWA
Sbjct  593   LLWA  596



>emb|CDY27464.1| BnaC04g51050D [Brassica napus]
Length=589

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/567 (75%), Positives = 478/567 (84%), Gaps = 17/567 (3%)
 Frame = +3

Query  318   TQKCTRRSKGERFFSNVDDRNTNKNGRSQSTSFKS--FGV--QRKGKGVQFDSKELQVET  485
             +  C    + +++   V D +++ +G  Q  +FKS  FG   Q+K K     +   Q + 
Sbjct  31    SSSCKLNPEKKKYTLRVRDEHSSNDG-PQPMAFKSSPFGSSQQKKDKKESQPTDLRQTDP  89

Query  486   GNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQ  665
               + DA+FL+AVVKVYCTHTAPDYSLPWQKQR       AFMIGDGKLLTNAHCVEHDTQ
Sbjct  90    AKIHDASFLDAVVKVYCTHTAPDYSLPWQKQRH------AFMIGDGKLLTNAHCVEHDTQ  143

Query  666   VKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYP  845
             VKVKRRGDD KYVAKVL RGV+CDIALLSVESE+FWKGAEPL+FGHLPRLQD+VTVVGYP
Sbjct  144   VKVKRRGDDRKYVAKVLVRGVDCDIALLSVESEDFWKGAEPLRFGHLPRLQDSVTVVGYP  203

Query  846   LGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQV  1025
             LGGDTISVTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQV
Sbjct  204   LGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQV  263

Query  1026  YRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEG  1205
             YRS+E ENIGYVIPTTVVSHFL DYERN KYTG+P LGVLLQKLENPALR CLKVP+NEG
Sbjct  264   YRSEETENIGYVIPTTVVSHFLTDYERNAKYTGYPCLGVLLQKLENPALRECLKVPTNEG  323

Query  1206  VLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAE  1385
             VL+R+VEPTSDA   LKEGDVIVSFDD+RVGCEGTVPFRS+ERIAFRYLIS+KF+GD  E
Sbjct  324   VLVRRVEPTSDASKVLKEGDVIVSFDDLRVGCEGTVPFRSSERIAFRYLISQKFAGDIVE  383

Query  1386  LGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGL  1565
             LGIIRAGE  KVQ+VL PRV LVPYHI+GGQPSY+I+AGLVFTPLSEPLI+EECEDSIGL
Sbjct  384   LGIIRAGEPKKVQVVLRPRVHLVPYHIDGGQPSYIIIAGLVFTPLSEPLIEEECEDSIGL  443

Query  1566  KLLTKARYSFANFKGEQIVVLSQ-----VLANEVNIGYEDISNEQILKLNGKRIRNIHHL  1730
             KLLTKARYS A F+GEQIV+LSQ     VLANEVNIGYED++N+Q+LK NG  IRNIHHL
Sbjct  444   KLLTKARYSVARFRGEQIVILSQASHNDVLANEVNIGYEDMNNQQVLKFNGTHIRNIHHL  503

Query  1731  AHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQ  1910
             AHL+D C DKYLVFEF DN++ VLEREA+ + S  ILKDYGIPSERS+DL  PYVD +  
Sbjct  504   AHLIDMCNDKYLVFEFEDNYVAVLEREASNSASLCILKDYGIPSERSADLREPYVDPVHD  563

Query  1911  NDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             N+A+DQ  FGDS  SN E GFDGL+WA
Sbjct  564   NEALDQG-FGDSPVSNLEIGFDGLVWA  589



>ref|XP_002321037.1| putative DegP2 protease family protein [Populus trichocarpa]
 gb|EEE99352.1| putative DegP2 protease family protein [Populus trichocarpa]
Length=592

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/614 (71%), Positives = 491/614 (80%), Gaps = 48/614 (8%)
 Frame = +3

Query  165   RCSLSSQPLFATSRPP-----SRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKC  329
             RC + SQP  ATS+        +  V +S    +++E   +KK P + S  +R ++  + 
Sbjct  20    RCCVPSQPYLATSQHSVASVNCKAVVNRSRRPGEHKEGVSQKKSPGK-SKDKRSSLHDED  78

Query  330   TRRSKGERFFSNVDDRNTNKNGRSQSTSFKSFGVQRKGKG-VQFDSKELQVETGNLQDAN  506
                  G+R             G+SQS +FKSFG QRK K   +FD KE Q E  NL+DA 
Sbjct  79    DDGISGKR-----------NAGKSQSMAFKSFGAQRKDKKEFKFDMKEQQFEPQNLKDAA  127

Query  507   FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRG  686
             FL+AVVKVYCTHT PDYSLPWQKQRQYTSTGSAFMIG+GKLLTNAHCVE+ TQVKVKRRG
Sbjct  128   FLDAVVKVYCTHTEPDYSLPWQKQRQYTSTGSAFMIGNGKLLTNAHCVEYYTQVKVKRRG  187

Query  687   DDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTIS  866
             DDTKYVAKVLARGV+CDIALLSVESEEFW+GAEPL+FGHLPRLQDAVTVVGYPLGGDTIS
Sbjct  188   DDTKYVAKVLARGVDCDIALLSVESEEFWEGAEPLKFGHLPRLQDAVTVVGYPLGGDTIS  247

Query  867   VTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVE  1046
             VTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+EVE
Sbjct  248   VTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEEVE  307

Query  1047  NIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVE  1226
             NIGYVIPTTVVSHFL+D+ERN KYTGFPSLGV+LQKLENPALRACLKV SNEGVL+R+VE
Sbjct  308   NIGYVIPTTVVSHFLKDFERNEKYTGFPSLGVMLQKLENPALRACLKVQSNEGVLVRRVE  367

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+DA+  LKEGDVIVSFDDV VGCEGTVPFRS ERIAFRYLIS+KF+GD AELGIIRAG
Sbjct  368   PTADANRVLKEGDVIVSFDDVHVGCEGTVPFRSNERIAFRYLISQKFAGDEAELGIIRAG  427

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKAR  1586
              FMKVQ+VL+PRV LVPYH++GGQPSYLI+AGLVFTPLSEPLI+EECE SIGLKLL K+R
Sbjct  428   SFMKVQVVLNPRVHLVPYHVDGGQPSYLIIAGLVFTPLSEPLIEEECEGSIGLKLLAKSR  487

Query  1587  YSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYL  1766
             YS A FKGEQIV+LSQV                 LK NG +I+NIHHLAHL+D       
Sbjct  488   YSLARFKGEQIVILSQV-----------------LKFNGTQIKNIHHLAHLVDY------  524

Query  1767  VFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDS  1946
                   N+LVVLEREAA   S+ ILKDYGIPSERSSDL  PYVDS+  N AVD Q+FG+S
Sbjct  525   ------NYLVVLEREAASACSSHILKDYGIPSERSSDLSEPYVDSLEDNQAVD-QDFGNS  577

Query  1947  AESNSEFGFDGLLW  1988
               +N E GFDGLLW
Sbjct  578   TVTNLEVGFDGLLW  591



>ref|XP_006588605.1| PREDICTED: protease Do-like 2, chloroplastic-like isoform X2 
[Glycine max]
Length=513

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/507 (80%), Positives = 453/507 (89%), Gaps = 1/507 (0%)
 Frame = +3

Query  474   QVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVE  653
             +VE   LQD+ FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGD KLLTNAHCVE
Sbjct  7     EVEPSALQDSAFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDRKLLTNAHCVE  66

Query  654   HDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTV  833
             HDTQVKVK+RGDD+KYVAKVLARGV+CDIALLSVESEEFW+  EPL+ G LP LQD+VTV
Sbjct  67    HDTQVKVKKRGDDSKYVAKVLARGVDCDIALLSVESEEFWRDVEPLRLGRLPHLQDSVTV  126

Query  834   VGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGV  1013
             VGYPLGGDTISVTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGV
Sbjct  127   VGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGV  186

Query  1014  AFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVP  1193
             AFQV RSDE ENIGYVIPTTVVSHFL DYERNG+YTGFP LGVL+QKLENPALRA LKV 
Sbjct  187   AFQVLRSDEAENIGYVIPTTVVSHFLTDYERNGRYTGFPCLGVLIQKLENPALRAWLKVQ  246

Query  1194  SNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSG  1373
             SNEGVL+R+VEPTSDA+N LKEGDVIVSFDDVRVG EGTVPFRS ERIAF +LIS+KF+G
Sbjct  247   SNEGVLVRRVEPTSDANNVLKEGDVIVSFDDVRVGSEGTVPFRSNERIAFHFLISQKFAG  306

Query  1374  DTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED  1553
             DTAELGIIRAG  +K ++VL+ RV LVPYHI+ GQPSYLI+AGLVFTPLSEPLI+EECED
Sbjct  307   DTAELGIIRAGSLIKTKVVLNSRVHLVPYHIDEGQPSYLIIAGLVFTPLSEPLIEEECED  366

Query  1554  SIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLA  1733
             SIGLKLL +ARYS A FKGEQIV+LSQVLANEVNIGYED+ N+Q++K NG RI+NIHHLA
Sbjct  367   SIGLKLLARARYSLAKFKGEQIVILSQVLANEVNIGYEDMGNQQVVKFNGTRIKNIHHLA  426

Query  1734  HLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIG-Q  1910
             HL+DSCKD+YL FEF D+++ VLE+E+    S S+L DYGIPSERSSDL+ PYVD++  +
Sbjct  427   HLIDSCKDRYLRFEFEDSYVAVLEKESVTAASPSVLSDYGIPSERSSDLLKPYVDALEVE  486

Query  1911  NDAVDQQEFGDSAESNSEFGFDGLLWA  1991
              D    +EFGDS  SN EFG DGLLWA
Sbjct  487   GDQPADEEFGDSPVSNYEFGPDGLLWA  513



>ref|XP_006389663.1| hypothetical protein POPTR_0020s00220g [Populus trichocarpa]
 gb|ERP48577.1| hypothetical protein POPTR_0020s00220g [Populus trichocarpa]
Length=609

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/613 (71%), Positives = 489/613 (80%), Gaps = 27/613 (4%)
 Frame = +3

Query  165   RCSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSK  344
             RC +SSQ   ATS         K+         N +++P +           +K +R+SK
Sbjct  20    RCCVSSQRYLATSHHSIASVTCKAVV-------NHKRRPSSNRDRELEGVSQKKSSRKSK  72

Query  345   GERFFSNVDD---RNTNKNGRSQSTSFKSFGVQRKGKG-VQFDSKELQVETGNLQDANFL  512
              ER +   DD   R   K GRSQS +FKSFG QRK K   +FD KE QV T     A  L
Sbjct  73    DERSYILDDDDGIRGKRKAGRSQSAAFKSFGGQRKDKNESKFDMKEQQVST-----APIL  127

Query  513   NAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDD  692
             + ++        P  S    K       G AFMIG+GKLLTNAHCVEH TQVKVKRRGDD
Sbjct  128   SLIIPF------PGKS----KGNTQAQEGDAFMIGNGKLLTNAHCVEHYTQVKVKRRGDD  177

Query  693   TKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVT  872
             TKYVAKVLARGV+CDIALLSVESEEFW+GAEPL+FG LPRLQDAVTVVGYPLGGDTISVT
Sbjct  178   TKYVAKVLARGVDCDIALLSVESEEFWEGAEPLEFGCLPRLQDAVTVVGYPLGGDTISVT  237

Query  873   KGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENI  1052
             KGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAF+D GECIGVAFQVYRS+EVENI
Sbjct  238   KGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFSDQGECIGVAFQVYRSEEVENI  297

Query  1053  GYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPT  1232
             GYVIPTTVVSHFL DYER G+YTGFPSLGVLLQKLENPALRA LKV SNEGVL+R+VEP 
Sbjct  298   GYVIPTTVVSHFLNDYERTGRYTGFPSLGVLLQKLENPALRAWLKVNSNEGVLVRRVEPI  357

Query  1233  SDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEF  1412
             SDA+  LKEGDVIVSFDDV VGCEGTVPFRS ERIAFRYLIS+KF+GD AELGIIRAG F
Sbjct  358   SDANRVLKEGDVIVSFDDVNVGCEGTVPFRSNERIAFRYLISQKFTGDVAELGIIRAGSF  417

Query  1413  MKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYS  1592
             MKV++VL+PRV+LVPYH++GGQPSYLI+AGLVFTPLSEPL++EECEDSIGLKLL K+RYS
Sbjct  418   MKVKVVLNPRVNLVPYHVDGGQPSYLIIAGLVFTPLSEPLMEEECEDSIGLKLLAKSRYS  477

Query  1593  FANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVF  1772
              A FKGEQIV++SQVLANEVN GYE++SN+Q+LK NG +I+NIHHLAHL+DSCK+KYLVF
Sbjct  478   LARFKGEQIVIVSQVLANEVNFGYEEMSNQQVLKFNGTQIKNIHHLAHLVDSCKNKYLVF  537

Query  1773  EFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAE  1952
             EF DN+LVVLEREAA  +S  ILKDYGIPSERSSDL  PYVDS+  N A   Q+FG+S  
Sbjct  538   EFEDNYLVVLEREAASASSFYILKDYGIPSERSSDLSEPYVDSLKDNQAA-VQDFGNSPI  596

Query  1953  SNSEFGFDGLLWA  1991
             SN E GFDGLLWA
Sbjct  597   SNLEIGFDGLLWA  609



>gb|KHN03752.1| Protease Do-like 2, chloroplastic [Glycine soja]
Length=596

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/566 (73%), Positives = 467/566 (83%), Gaps = 28/566 (5%)
 Frame = +3

Query  303   EREAVTQKCTRRSKGERFFSNVDDRNTNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVE  482
             ++E V QK  ++SK ER          N     Q++S K FG+QRK K + FDSK+ QVE
Sbjct  56    QKEGVGQK--KQSKDER------PARGNVLEPQQTSSSKPFGIQRKNKDLIFDSKDQQVE  107

Query  483   TGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTS--TGSAFMIGDGKLLTNAHCVEH  656
                LQD+ FLNAVVKVYCTHTAPDYSLPWQKQRQYT+    SAFMIGD KLLTNAHCVEH
Sbjct  108   PSALQDSAFLNAVVKVYCTHTAPDYSLPWQKQRQYTNHILCSAFMIGDRKLLTNAHCVEH  167

Query  657   DTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVV  836
             DTQVKVK+RGDD+KYVAKVLARGV+CDIALLSVESEEFW+  EPL+ G LP LQD+VTVV
Sbjct  168   DTQVKVKKRGDDSKYVAKVLARGVDCDIALLSVESEEFWRDVEPLRLGRLPHLQDSVTVV  227

Query  837   GYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVA  1016
             GYPLGGDTISVTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVA
Sbjct  228   GYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVA  287

Query  1017  FQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPS  1196
             FQV RSDE ENIGYVIPTTVVSHFL DYERNG+YTGFP LGVL+QKLENPALRA LKV S
Sbjct  288   FQVLRSDEAENIGYVIPTTVVSHFLTDYERNGRYTGFPCLGVLIQKLENPALRAWLKVQS  347

Query  1197  NEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGD  1376
             NEGVL+R+VEPTSDA+N LKEGDVIVSFDDVRVG EGTVPFRS ERIAF +LIS+KF+GD
Sbjct  348   NEGVLVRRVEPTSDANNVLKEGDVIVSFDDVRVGSEGTVPFRSNERIAFHFLISQKFAGD  407

Query  1377  TAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDS  1556
             TAELGIIRAG  +K ++VL+ RV LVPYHI+ GQPSYLI+AGLVFTPLSEPLI+EECEDS
Sbjct  408   TAELGIIRAGSLIKTKVVLNSRVHLVPYHIDEGQPSYLIIAGLVFTPLSEPLIEEECEDS  467

Query  1557  IGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAH  1736
             IGLKLL +ARYS A FKGEQIV+LSQV                 +K NG RI+NIHHLAH
Sbjct  468   IGLKLLARARYSLAKFKGEQIVILSQV-----------------VKFNGTRIKNIHHLAH  510

Query  1737  LLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIG-QN  1913
             L+DSCKD+YL FEF D+++ VLE+E+  T S S+L DYGIPSERSSDL+ PYVD++  + 
Sbjct  511   LIDSCKDRYLRFEFEDSYVAVLEKESVTTASPSVLSDYGIPSERSSDLLKPYVDALEVEG  570

Query  1914  DAVDQQEFGDSAESNSEFGFDGLLWA  1991
             D    +EFGDS  SN EFG DGLLWA
Sbjct  571   DQPADEEFGDSPVSNYEFGPDGLLWA  596



>gb|AIA26574.1| serine protease [Cicer arietinum]
Length=581

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/584 (71%), Positives = 472/584 (81%), Gaps = 40/584 (7%)
 Frame = +3

Query  288   RVSHTEREAVTQKCTR----------RSKGERF------FSNVDDRNTNKNGRSQSTSFK  419
             R SH  R  ++ +CTR          R K + +       S+ D++++   G     S+K
Sbjct  22    RYSH--RPIISIRCTRTPSIPDPNINRQKKDAWQKKQLKLSSKDEKSSG--GNVVPASYK  77

Query  420   SFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTG  599
             S G+ RK +    DSK+LQVE+ NLQD+ FLNAVVKVYCTHTAPDYSLPWQKQRQ+TSTG
Sbjct  78    SSGISRKDRDFMVDSKDLQVESNNLQDSAFLNAVVKVYCTHTAPDYSLPWQKQRQFTSTG  137

Query  600   SAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKG  779
             SAFMIG  KLLTNAHCVE+DTQVKVK+RGDD+KYVAKVLAR V CD+ALLSVESEEFW+ 
Sbjct  138   SAFMIGGRKLLTNAHCVEYDTQVKVKKRGDDSKYVAKVLARAVGCDLALLSVESEEFWRD  197

Query  780   AEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVN  959
              EPL+FGHLP LQD+VTVVGYPLGGDTISVTKGVVSR+EVTSYAHG SELLGIQIDAA+N
Sbjct  198   VEPLRFGHLPHLQDSVTVVGYPLGGDTISVTKGVVSRVEVTSYAHGLSELLGIQIDAAIN  257

Query  960   PGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLG  1139
             PGNSGGPAFN  GECIGVAFQVYRS+E ENIGYVIPTTVVSHFL DYE+NGKYTGFP LG
Sbjct  258   PGNSGGPAFNGQGECIGVAFQVYRSEEAENIGYVIPTTVVSHFLTDYEKNGKYTGFPCLG  317

Query  1140  VLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPF  1319
             VL+QKLENP LRACLKV SNEGVL+R+VEPTSDA+N LKEGDVIVSFD VRVGCEGTVPF
Sbjct  318   VLIQKLENPVLRACLKVQSNEGVLVRRVEPTSDANNVLKEGDVIVSFDGVRVGCEGTVPF  377

Query  1320  RSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVA  1499
             RS ERIAF +LIS+KF+GDTAELGIIRAG  MK  +VL+PRV LVPYHI+ GQPSYLI+A
Sbjct  378   RSNERIAFHFLISQKFAGDTAELGIIRAGTLMKADVVLNPRVHLVPYHIDEGQPSYLIIA  437

Query  1500  GLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISN  1679
             GLVFTPLSEPLI+EE EDSIGLKLLTKARYSFA FKGEQIV+LSQVLANE+NIGYED+SN
Sbjct  438   GLVFTPLSEPLIEEEHEDSIGLKLLTKARYSFARFKGEQIVILSQVLANELNIGYEDMSN  497

Query  1680  EQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIP  1859
             +Q                    +CKD+YL FEF D+++ VLEREA    S+S+L+DYGIP
Sbjct  498   QQA-------------------TCKDRYLCFEFEDSYVAVLEREAVAAASSSLLRDYGIP  538

Query  1860  SERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             SERSSDL+ PYVDS+ + D    QEFGD   SN E G DGLL A
Sbjct  539   SERSSDLLQPYVDSL-EGDQPADQEFGDCPVSNFEVGHDGLLLA  581



>ref|XP_002863059.1| hypothetical protein ARALYDRAFT_497185 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39318.1| hypothetical protein ARALYDRAFT_497185 [Arabidopsis lyrata subsp. 
lyrata]
Length=610

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/538 (76%), Positives = 453/538 (84%), Gaps = 9/538 (2%)
 Frame = +3

Query  402   QSTSFKSFGVQRKGKGVQFD--SKELQVETGNLQDANFLNAVVK------VYCTHTAPDY  557
             Q  +FK+FG  +K K       S++ Q + G + DA+FLNAV +         T  A  +
Sbjct  74    QKMAFKAFGSPKKEKKEPLSDFSRDQQTDPGKIHDASFLNAVFRNELLSSSSITLLASSF  133

Query  558   SLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECD  737
                  K  +    G AFMIGDGKLLTNAHCVEHDTQVKVKRRGDD KYVAKVL RGV+CD
Sbjct  134   FELQAKTMELALEGIAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRGVDCD  193

Query  738   IALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHG  917
             IALLSVESE+FWKGAEPL+ GHLPRLQD+VTVVGYPLGGDTISVTKGVVSRIEVTSYAHG
Sbjct  194   IALLSVESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAHG  253

Query  918   SSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQD  1097
             SS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQVYRS+E ENIGYVIPTTVVSHFL D
Sbjct  254   SSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLTD  313

Query  1098  YERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVS  1277
             YERNGKYTG+P LGVLLQKLENPALR CLKVP+NEGVL+R+VEPTSDA   LKEGDVIVS
Sbjct  314   YERNGKYTGYPCLGVLLQKLENPALRECLKVPTNEGVLVRRVEPTSDASKVLKEGDVIVS  373

Query  1278  FDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVP  1457
             FDD+ VGCEGTVPFRS+ERIAFRYLIS+KF+GD AELGIIRAGE  KVQ+VL PRV LVP
Sbjct  374   FDDLHVGCEGTVPFRSSERIAFRYLISQKFAGDIAELGIIRAGEHKKVQVVLRPRVHLVP  433

Query  1458  YHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQV  1637
             YHI+GGQPSY+IVAGLVFTPLSEPLI+EECED+IGLKLLTKARYS A F+GEQIV+LSQV
Sbjct  434   YHIDGGQPSYIIVAGLVFTPLSEPLIEEECEDTIGLKLLTKARYSVARFRGEQIVILSQV  493

Query  1638  LANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAA  1817
             LANEVNIGYED++N+Q+LK NG  IRNIHHLAHL+D CKDKYLVFEF DN++ VLEREA+
Sbjct  494   LANEVNIGYEDMNNQQVLKFNGIPIRNIHHLAHLIDMCKDKYLVFEFEDNYVAVLEREAS  553

Query  1818  LTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
              + S  ILKDYGIPSERS+DL+ PYVD I    A+DQ   GDS  SN E GFDGL+WA
Sbjct  554   NSASLCILKDYGIPSERSADLLEPYVDPIDDTQALDQG-IGDSPVSNLEIGFDGLVWA  610



>gb|KHN46596.1| Protease Do-like 2, chloroplastic [Glycine soja]
Length=595

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/534 (76%), Positives = 449/534 (84%), Gaps = 22/534 (4%)
 Frame = +3

Query  399   SQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQ  578
             SQ TS K FG+QRK K + FDSK+ QVE   LQD+ FLNAVVKVYCTHTAPDYSLPWQKQ
Sbjct  81    SQPTSSKPFGIQRKNKDLIFDSKDQQVEQSILQDSAFLNAVVKVYCTHTAPDYSLPWQKQ  140

Query  579   RQYTS--TGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLS  752
             RQYT+    SAFMIGD KLLTNAHCVEHDTQVKVK+RGDD+KYVAKVLARGV+CDIALLS
Sbjct  141   RQYTNHILCSAFMIGDRKLLTNAHCVEHDTQVKVKKRGDDSKYVAKVLARGVDCDIALLS  200

Query  753   VESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELL  932
             VESEEFW   EPL+ G LP LQD+VTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS+LL
Sbjct  201   VESEEFWSDVEPLRLGRLPHLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLL  260

Query  933   GIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNG  1112
             GIQIDAA+NPGNSGGPAFND GECIGVAFQV RS+E ENIGYVIPTTVVSHFL DYERNG
Sbjct  261   GIQIDAAINPGNSGGPAFNDQGECIGVAFQVLRSEEAENIGYVIPTTVVSHFLTDYERNG  320

Query  1113  KYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVR  1292
             +YTGFP LGVL+QKLENPALRA LKV SNEGVL+R+VEPTSDA+N LKEGDVIVSFDDVR
Sbjct  321   RYTGFPCLGVLIQKLENPALRAWLKVQSNEGVLVRRVEPTSDANNVLKEGDVIVSFDDVR  380

Query  1293  VGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEG  1472
             VG EGTVPFRS ERIAF +LIS+KF+GDTAELGIIRAG  +K ++VL+ RV LVPYHI+G
Sbjct  381   VGSEGTVPFRSNERIAFHFLISQKFAGDTAELGIIRAGSLIKTKVVLNSRVHLVPYHIDG  440

Query  1473  GQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEV  1652
             G PSYLI+AGLVFTPLSEPLI+EECEDSIGLKLL +ARYS A FKGEQIV+LSQVLANEV
Sbjct  441   GLPSYLIIAGLVFTPLSEPLIEEECEDSIGLKLLARARYSLAKFKGEQIVILSQVLANEV  500

Query  1653  NIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTST  1832
             NIGYED+ N+Q                    +C+D+YL FEF D+++ VLE+EA    S 
Sbjct  501   NIGYEDMGNQQA-------------------TCEDRYLRFEFEDSYVAVLEKEAVAAASP  541

Query  1833  SILKDYGIPSERSSDLMGPYVDSIG-QNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             S+L DYGIPSERSSDL  PYVD++  + D    QEFGDS  SN EFG DGLLWA
Sbjct  542   SVLSDYGIPSERSSDLSKPYVDTLEVEGDQPADQEFGDSPVSNYEFGPDGLLWA  595



>emb|CDP03552.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/468 (84%), Positives = 424/468 (91%), Gaps = 8/468 (2%)
 Frame = +3

Query  609   MIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEP  788
             MIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARG+ECD+ALLSVES EFW+ AEP
Sbjct  1     MIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGIECDMALLSVESTEFWERAEP  60

Query  789   LQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGN  968
             L FG LPRLQD VTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS+LLGIQIDAA+NPGN
Sbjct  61    LHFGRLPRLQDPVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGN  120

Query  969   SGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLL  1148
             SGGPAFND GEC+GVAFQV+RSDEVENIGYVIPTTVVSHFL+DYERNGKYTGFP LGVLL
Sbjct  121   SGGPAFNDQGECVGVAFQVFRSDEVENIGYVIPTTVVSHFLEDYERNGKYTGFPCLGVLL  180

Query  1149  QKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRST  1328
             QKLENPALRACL VPSNEGVL+R+VEPTSDA N LKEGDVIVSFD +RVGCEGTVPFRST
Sbjct  181   QKLENPALRACLGVPSNEGVLVRRVEPTSDASNVLKEGDVIVSFDGIRVGCEGTVPFRST  240

Query  1329  ERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLV  1508
             ERIAFRYLIS+KF+GD AELGI+RAG F K++ VL+PRV LVPYHIEGGQPSYLIVAGLV
Sbjct  241   ERIAFRYLISQKFAGDVAELGIVRAGSFTKLKAVLNPRVHLVPYHIEGGQPSYLIVAGLV  300

Query  1509  FTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQ-  1685
             FTPLS+PLI+EECED IGLKLLTKARYS A FKGEQIV+LSQVLANEVNIGYED+SNEQ 
Sbjct  301   FTPLSDPLIEEECEDQIGLKLLTKARYSLAKFKGEQIVILSQVLANEVNIGYEDMSNEQA  360

Query  1686  -------ILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILK  1844
                    +LKLNG RI+NIHHLA+L+DSCKDKYLVFEF DN+L VLEREAA + S  ILK
Sbjct  361   SIFMMTLVLKLNGTRIKNIHHLAYLVDSCKDKYLVFEFEDNYLAVLEREAACSASARILK  420

Query  1845  DYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLW  1988
             DYGIP+ERS DL  PYVDS+G N  V+Q EFGD   SNSEFGF+GLLW
Sbjct  421   DYGIPAERSPDLSEPYVDSLGVNHPVEQHEFGDGPVSNSEFGFEGLLW  468



>ref|XP_006352803.1| PREDICTED: protease Do-like 2, chloroplastic-like isoform X3 
[Solanum tuberosum]
Length=501

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/489 (81%), Positives = 434/489 (89%), Gaps = 4/489 (1%)
 Frame = +3

Query  171   SLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSKGE  350
             SL+S  LF+TS  PS FF+PK+   SQNQ H ++    +  S  E+ A   K +RRSK E
Sbjct  16    SLTSHRLFSTSLRPSSFFIPKA--DSQNQNHKRKVLNKSSSSPPEKVAGKPKFSRRSKNE  73

Query  351   RFFSNVDDRN-TNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVK  527
               F+N D R+ T++ GRSQS + KSFG+Q+KGKG+  DSK+ QVETG++QDA FLNAVVK
Sbjct  74    GPFANADGRSSTSETGRSQSAAIKSFGLQKKGKGILLDSKDQQVETGSIQDAAFLNAVVK  133

Query  528   VYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVA  707
             VYCTHTAPDYSLPWQKQRQ+TSTGSAFMIGDGKLLTNAHCVEHDTQVKVK+RGDDTKYVA
Sbjct  134   VYCTHTAPDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKKRGDDTKYVA  193

Query  708   KVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVS  887
             KVLARGV CDIALLSVES+EFW+GAEPL FG LPRLQDAVTVVGYPLGGDTISVTKGVVS
Sbjct  194   KVLARGVACDIALLSVESKEFWEGAEPLSFGRLPRLQDAVTVVGYPLGGDTISVTKGVVS  253

Query  888   RIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIP  1067
             RIEVTSYAHGSSELLGIQIDAA+NPGNSGGPAFND G+CIGVAFQVYRSD+ ENIGYVIP
Sbjct  254   RIEVTSYAHGSSELLGIQIDAAINPGNSGGPAFNDVGDCIGVAFQVYRSDDAENIGYVIP  313

Query  1068  TTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHN  1247
             TTVVSHFL+DYE+NGKY GFP LGVLLQKLENPALRACLKVPSNEGVL+RKVEPTSD  N
Sbjct  314   TTVVSHFLEDYEKNGKYCGFPCLGVLLQKLENPALRACLKVPSNEGVLVRKVEPTSDISN  373

Query  1248  TLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQI  1427
              +KEGDVIVSFD V VGCEGTVPFRS+ERIAFRYLIS+KF+GD+ ELGIIRAGEFMKVQ 
Sbjct  374   VVKEGDVIVSFDGVHVGCEGTVPFRSSERIAFRYLISQKFTGDSVELGIIRAGEFMKVQA  433

Query  1428  VLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFK  1607
             VL PRV LVPYHIEGGQPSYLIVAGLVFTPLSEPLI+EE EDSIGLKLLTKARYS A F+
Sbjct  434   VLKPRVHLVPYHIEGGQPSYLIVAGLVFTPLSEPLIEEE-EDSIGLKLLTKARYSLAKFE  492

Query  1608  GEQIVVLSQ  1634
             GEQIVVLSQ
Sbjct  493   GEQIVVLSQ  501



>ref|NP_001146551.1| hypothetical protein [Zea mays]
 gb|ACL54269.1| unknown [Zea mays]
 gb|AFW57621.1| hypothetical protein ZEAMMB73_444319 [Zea mays]
Length=601

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/520 (74%), Positives = 444/520 (85%), Gaps = 1/520 (0%)
 Frame = +3

Query  435   RKGKGVQFDSKELQV-ETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFM  611
             R+ +G+  D KE QV E  +L++  FLNAVVKVYCTH APDY LPWQKQRQ++S+GSAFM
Sbjct  82    RRDRGLSVDFKEPQVAEFDDLEEDKFLNAVVKVYCTHIAPDYGLPWQKQRQHSSSGSAFM  141

Query  612   IGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPL  791
             IGDGKLLTNAHCVEHDTQVKVKRRGDD KY+AKVLARGVECD+ALLSVE+EEFW+G E L
Sbjct  142   IGDGKLLTNAHCVEHDTQVKVKRRGDDKKYIAKVLARGVECDLALLSVENEEFWRGTEAL  201

Query  792   QFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNS  971
              FG LP LQD+VTVVGYPLGGDTISVTKGVVSRIEVT YAHG+S+LLGIQIDAA+NPGNS
Sbjct  202   HFGRLPCLQDSVTVVGYPLGGDTISVTKGVVSRIEVTPYAHGTSDLLGIQIDAAINPGNS  261

Query  972   GGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQ  1151
             GGPAFND GECIGVAFQVYRSDE ENIGYVIPTTVVSHFL DY++NGKYTGFP LGVLLQ
Sbjct  262   GGPAFNDQGECIGVAFQVYRSDEAENIGYVIPTTVVSHFLNDYQKNGKYTGFPCLGVLLQ  321

Query  1152  KLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTE  1331
             KLENPALR  LKVPS+EGVL+R+VEPT+ A + L++GDVIVSFD + VGCE TVPFRSTE
Sbjct  322   KLENPALRESLKVPSSEGVLVRRVEPTAPASSVLRKGDVIVSFDGIAVGCEATVPFRSTE  381

Query  1332  RIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVF  1511
             RIAFRYL S+K++GD A+LGIIR G  MKVQ +L PR  LVP+H+EGGQPSYLIVAGLVF
Sbjct  382   RIAFRYLTSQKYAGDIAQLGIIRDGNSMKVQTILQPRKHLVPFHVEGGQPSYLIVAGLVF  441

Query  1512  TPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQIL  1691
             TPL+EP I+EECED++GLKLL KARYS A F+GE+IV++SQVLA+EVNIGYE + N+Q++
Sbjct  442   TPLTEPFIEEECEDTLGLKLLAKARYSLATFEGEEIVIVSQVLAHEVNIGYEHMGNQQVM  501

Query  1692  KLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERS  1871
             KLNG  I+NIHHLAHL+D+CKDK+L FEF D+FLVVL RE A   S+ ILK++ IPS RS
Sbjct  502   KLNGTTIKNIHHLAHLVDTCKDKFLTFEFEDDFLVVLHREEADAASSDILKEHAIPSIRS  561

Query  1872  SDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             SDL  PY ++         ++FG+S  +N E G D LLWA
Sbjct  562   SDLSEPYAEANNNEIQKTSEDFGESPVTNFEMGIDCLLWA  601



>ref|XP_006352802.1| PREDICTED: protease Do-like 2, chloroplastic-like isoform X2 
[Solanum tuberosum]
Length=532

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/489 (81%), Positives = 434/489 (89%), Gaps = 4/489 (1%)
 Frame = +3

Query  171   SLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSKGE  350
             SL+S  LF+TS  PS FF+PK+   SQNQ H ++    +  S  E+ A   K +RRSK E
Sbjct  16    SLTSHRLFSTSLRPSSFFIPKA--DSQNQNHKRKVLNKSSSSPPEKVAGKPKFSRRSKNE  73

Query  351   RFFSNVDDRN-TNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVK  527
               F+N D R+ T++ GRSQS + KSFG+Q+KGKG+  DSK+ QVETG++QDA FLNAVVK
Sbjct  74    GPFANADGRSSTSETGRSQSAAIKSFGLQKKGKGILLDSKDQQVETGSIQDAAFLNAVVK  133

Query  528   VYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVA  707
             VYCTHTAPDYSLPWQKQRQ+TSTGSAFMIGDGKLLTNAHCVEHDTQVKVK+RGDDTKYVA
Sbjct  134   VYCTHTAPDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKKRGDDTKYVA  193

Query  708   KVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVS  887
             KVLARGV CDIALLSVES+EFW+GAEPL FG LPRLQDAVTVVGYPLGGDTISVTKGVVS
Sbjct  194   KVLARGVACDIALLSVESKEFWEGAEPLSFGRLPRLQDAVTVVGYPLGGDTISVTKGVVS  253

Query  888   RIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIP  1067
             RIEVTSYAHGSSELLGIQIDAA+NPGNSGGPAFND G+CIGVAFQVYRSD+ ENIGYVIP
Sbjct  254   RIEVTSYAHGSSELLGIQIDAAINPGNSGGPAFNDVGDCIGVAFQVYRSDDAENIGYVIP  313

Query  1068  TTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHN  1247
             TTVVSHFL+DYE+NGKY GFP LGVLLQKLENPALRACLKVPSNEGVL+RKVEPTSD  N
Sbjct  314   TTVVSHFLEDYEKNGKYCGFPCLGVLLQKLENPALRACLKVPSNEGVLVRKVEPTSDISN  373

Query  1248  TLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQI  1427
              +KEGDVIVSFD V VGCEGTVPFRS+ERIAFRYLIS+KF+GD+ ELGIIRAGEFMKVQ 
Sbjct  374   VVKEGDVIVSFDGVHVGCEGTVPFRSSERIAFRYLISQKFTGDSVELGIIRAGEFMKVQA  433

Query  1428  VLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFK  1607
             VL PRV LVPYHIEGGQPSYLIVAGLVFTPLSEPLI+EE EDSIGLKLLTKARYS A F+
Sbjct  434   VLKPRVHLVPYHIEGGQPSYLIVAGLVFTPLSEPLIEEE-EDSIGLKLLTKARYSLAKFE  492

Query  1608  GEQIVVLSQ  1634
             GEQIVVLSQ
Sbjct  493   GEQIVVLSQ  501



>ref|XP_004960292.1| PREDICTED: protease Do-like 2, chloroplastic-like [Setaria italica]
Length=599

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/520 (73%), Positives = 446/520 (86%), Gaps = 2/520 (0%)
 Frame = +3

Query  435   RKGKGVQFDSKELQV-ETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFM  611
             R+ +G+  D KE QV E  +L++  FLNAVVKVYCTH APDY LPWQKQRQ++S+GSAFM
Sbjct  81    RRDRGLAVDFKESQVAEFDDLEEDKFLNAVVKVYCTHIAPDYGLPWQKQRQHSSSGSAFM  140

Query  612   IGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPL  791
             IGDGKLLTNAHCVEHDTQVKVKRRGDD KY+AKVLARG+ECD+ALLSVE+EEFW+G E L
Sbjct  141   IGDGKLLTNAHCVEHDTQVKVKRRGDDKKYIAKVLARGIECDLALLSVENEEFWRGTEAL  200

Query  792   QFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNS  971
              FG LP LQD+VTVVGYPLGGDTISVTKGVVSRIEVT YAHG+S+LLGIQIDAA+NPGNS
Sbjct  201   SFGRLPCLQDSVTVVGYPLGGDTISVTKGVVSRIEVTPYAHGTSDLLGIQIDAAINPGNS  260

Query  972   GGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQ  1151
             GGPAFN+ GECIGVAFQVYRSDE ENIGYVIPTTVVSHFL D+++NGKYTGFP LGVLLQ
Sbjct  261   GGPAFNEQGECIGVAFQVYRSDEAENIGYVIPTTVVSHFLNDFQKNGKYTGFPCLGVLLQ  320

Query  1152  KLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTE  1331
             KLENPALR  LKVPS+EGVL+R+VEPT+ A + L++GDVIVSFD V VGCE TVPFRSTE
Sbjct  321   KLENPALRESLKVPSSEGVLVRRVEPTAPASSVLRKGDVIVSFDGVAVGCEATVPFRSTE  380

Query  1332  RIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVF  1511
             RIAFRYL S+K++GD A+LGIIR G  MKVQ +L PR  LVP+H+EGGQPSYLIVAGLVF
Sbjct  381   RIAFRYLTSQKYAGDIAQLGIIRDGNSMKVQTILQPRKHLVPFHVEGGQPSYLIVAGLVF  440

Query  1512  TPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQIL  1691
             TPL+EP I+EECED++GLKLL KARYS A F+GEQIV++SQVLA+EVNIGYE + N+Q++
Sbjct  441   TPLTEPFIEEECEDTLGLKLLAKARYSLATFEGEQIVIVSQVLAHEVNIGYEHMGNQQLI  500

Query  1692  KLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERS  1871
             KLNG  ++NIHHLAHL+D+CKDK+L FEF D+FLVVL RE A   S+ ILK++ IPS RS
Sbjct  501   KLNGTAVKNIHHLAHLVDTCKDKFLTFEFEDDFLVVLNREEATAASSDILKEHAIPSVRS  560

Query  1872  SDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             SDL  PYV++  +      ++FG+S  +N E G D LLWA
Sbjct  561   SDLSEPYVETKTEVQKTS-EDFGESPVTNFEMGIDCLLWA  599



>ref|XP_002439270.1| hypothetical protein SORBIDRAFT_09g003540 [Sorghum bicolor]
 gb|EES17700.1| hypothetical protein SORBIDRAFT_09g003540 [Sorghum bicolor]
Length=604

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/521 (74%), Positives = 445/521 (85%), Gaps = 4/521 (1%)
 Frame = +3

Query  435   RKGKGVQFDSKELQV-ETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFM  611
             R+ +G+  D KE QV +  +L++  FLNAVVKVYCTH APDY LPWQKQRQ++S+GSAFM
Sbjct  86    RRDRGLAVDFKESQVADFDDLEEDKFLNAVVKVYCTHIAPDYGLPWQKQRQHSSSGSAFM  145

Query  612   IGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPL  791
             IGDGKLLTNAHCVEHDTQVKVKRRGDD KY+AKVLARG ECD+ALLSVE+EEFW+G E L
Sbjct  146   IGDGKLLTNAHCVEHDTQVKVKRRGDDKKYIAKVLARGTECDLALLSVENEEFWRGTEAL  205

Query  792   QFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNS  971
              FG LP LQD+VTVVGYPLGGDTISVTKGVVSRIEVT YAHG+S+LLGIQIDAA+NPGNS
Sbjct  206   NFGRLPCLQDSVTVVGYPLGGDTISVTKGVVSRIEVTPYAHGTSDLLGIQIDAAINPGNS  265

Query  972   GGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQ  1151
             GGPAFN+ GECIGVAFQVYRSDE ENIGYVIPTTVVSHFL DY++NGKYTGFP LGVLLQ
Sbjct  266   GGPAFNEQGECIGVAFQVYRSDEAENIGYVIPTTVVSHFLNDYQKNGKYTGFPCLGVLLQ  325

Query  1152  KLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTE  1331
             KLENPALR  LKVPS+EGVL+R+VEPT+ A + L++GDVIVSFD   VGCE TVPFRSTE
Sbjct  326   KLENPALRESLKVPSSEGVLVRRVEPTAPASSVLRKGDVIVSFDGTSVGCEATVPFRSTE  385

Query  1332  RIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVF  1511
             RIAFRYL S+K++GD A+LGIIR G  MKVQ +L PR  LVP+H+EGGQPSYLIVAGLVF
Sbjct  386   RIAFRYLTSQKYAGDIAQLGIIRDGNSMKVQTILQPRKHLVPFHVEGGQPSYLIVAGLVF  445

Query  1512  TPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQIL  1691
             TPL+EP I+EECED++GLKLL KARYS A F+GEQIV++SQVLA+EVNIGYE + N+Q++
Sbjct  446   TPLTEPFIEEECEDTLGLKLLAKARYSLATFEGEQIVIVSQVLAHEVNIGYEHMGNQQVM  505

Query  1692  KLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERS  1871
             KLNG  I+NIHHLAHL+D+CKDK+L FEF D+FLVVL RE A   S+ ILK++ IPS RS
Sbjct  506   KLNGTTIKNIHHLAHLVDTCKDKFLTFEFEDDFLVVLHREEAAAASSDILKEHAIPSIRS  565

Query  1872  SDLMGPYVDSIGQNDAVDQQE-FGDSAESNSEFGFDGLLWA  1991
             SDL  PYV++  +ND     E FG+S  +N E G D LLWA
Sbjct  566   SDLSEPYVET--KNDIQKTSEDFGESPVTNFEMGIDCLLWA  604



>ref|XP_006654043.1| PREDICTED: protease Do-like 2, chloroplastic-like [Oryza brachyantha]
Length=585

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/520 (75%), Positives = 447/520 (86%), Gaps = 2/520 (0%)
 Frame = +3

Query  435   RKGKGVQFDSKELQV-ETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFM  611
             RK +G+  D KE QV +  +L++  FLNAVVKVYCTH APDY LPWQKQRQ+ STGSAFM
Sbjct  67    RKDRGLAVDFKESQVADFEDLEEDKFLNAVVKVYCTHIAPDYGLPWQKQRQHASTGSAFM  126

Query  612   IGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPL  791
             IGDGKLLTNAHCVEHDTQVKVKRRGDD KY+AKVLARG+ECD+ALLSVE+EEFW+G EPL
Sbjct  127   IGDGKLLTNAHCVEHDTQVKVKRRGDDKKYIAKVLARGIECDLALLSVENEEFWRGTEPL  186

Query  792   QFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNS  971
             Q G LP LQD+VTVVGYPLGGDTISVTKGVVSRIEVT YAHG+S+LLGIQIDAA+NPGNS
Sbjct  187   QLGRLPCLQDSVTVVGYPLGGDTISVTKGVVSRIEVTPYAHGTSDLLGIQIDAAINPGNS  246

Query  972   GGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQ  1151
             GGPAFND GECIGVAFQV+RSDE ENIGYVIPTTVVSHFL DY++NGKYTGFP LGVLLQ
Sbjct  247   GGPAFNDQGECIGVAFQVFRSDEAENIGYVIPTTVVSHFLNDYQKNGKYTGFPCLGVLLQ  306

Query  1152  KLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTE  1331
             KLENPALR  LKVPS+EGVL+R+VEPT+ A   L++GDVI SFD V VGCEGTVPFRSTE
Sbjct  307   KLENPALRESLKVPSSEGVLVRRVEPTAPASKVLRKGDVITSFDGVNVGCEGTVPFRSTE  366

Query  1332  RIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVF  1511
             RIAFRYL S+K++GD A+LGIIRAG  MKVQ VL PR  LVP+H+EGGQPSYLIVAGLVF
Sbjct  367   RIAFRYLTSQKYAGDVAQLGIIRAGNIMKVQTVLQPRKHLVPFHVEGGQPSYLIVAGLVF  426

Query  1512  TPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQIL  1691
             TPL+EP I+EECE+++GLKLL KARYS A F+GEQIV++SQVLA+EVNIGYE + N+Q++
Sbjct  427   TPLTEPFIEEECEETLGLKLLAKARYSLATFEGEQIVIVSQVLAHEVNIGYEHMGNQQVI  486

Query  1692  KLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERS  1871
             KLNG  ++NIHHLAHL+D+CKDK+L FEF D+FLVVL+RE A T S+ ILK++ IP+ RS
Sbjct  487   KLNGTAVKNIHHLAHLVDNCKDKFLTFEFEDDFLVVLDREEATTASSDILKEHAIPAIRS  546

Query  1872  SDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             SDL  PYV++  Q       +FGDS  +N E G D LLWA
Sbjct  547   SDLSEPYVEA-EQEIKKPNDDFGDSPVTNYEMGVDCLLWA  585



>gb|AAT93972.1| putative DegP2 protease [Oryza sativa Japonica Group]
 gb|EEC78515.1| hypothetical protein OsI_18450 [Oryza sativa Indica Group]
 gb|EEE62322.1| hypothetical protein OsJ_17111 [Oryza sativa Japonica Group]
Length=596

 Score =   798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/519 (75%), Positives = 446/519 (86%), Gaps = 2/519 (0%)
 Frame = +3

Query  438   KGKGVQFDSKELQV-ETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMI  614
             K +G+  D KE QV +  +L++  FLNAVVKVYCTH APDY LPWQKQRQ+ STGSAFMI
Sbjct  79    KDRGLAVDFKESQVSDFEDLEEDKFLNAVVKVYCTHIAPDYGLPWQKQRQHASTGSAFMI  138

Query  615   GDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQ  794
             GDGKLLTNAHCVEHDTQVKVKRRGDD KY+AKVLARG+ECD+ALLSVE+EEFW+G EPLQ
Sbjct  139   GDGKLLTNAHCVEHDTQVKVKRRGDDKKYIAKVLARGIECDLALLSVENEEFWRGTEPLQ  198

Query  795   FGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSG  974
              G LP LQD+VTVVGYPLGGDTISVTKGVVSRIEVT YAHG+S+LLGIQIDAA+NPGNSG
Sbjct  199   LGRLPCLQDSVTVVGYPLGGDTISVTKGVVSRIEVTPYAHGTSDLLGIQIDAAINPGNSG  258

Query  975   GPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQK  1154
             GPAFND GECIGVAFQV+RSDE ENIGYVIPTTVVSHFL DY++NGKYTGFP LGVLLQK
Sbjct  259   GPAFNDHGECIGVAFQVFRSDEAENIGYVIPTTVVSHFLNDYQKNGKYTGFPCLGVLLQK  318

Query  1155  LENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTER  1334
             LENPALR  LKVPS+EGVL+R+VEPT+ A   L++GDVI SFD V VGCEGTVPFRSTER
Sbjct  319   LENPALRESLKVPSSEGVLVRRVEPTAPASKVLRKGDVITSFDGVAVGCEGTVPFRSTER  378

Query  1335  IAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFT  1514
             IAFRYL S+K++GD A+LGIIRAG  MKVQ VL PR  LVP+H+EGGQPSYLIVAGLVFT
Sbjct  379   IAFRYLTSQKYAGDVAQLGIIRAGNTMKVQTVLQPRKHLVPFHVEGGQPSYLIVAGLVFT  438

Query  1515  PLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILK  1694
             PL+EP I+EECE+++GLKLL KARYS + F+GEQIV++SQVLA+EVNIGYE + N+Q++K
Sbjct  439   PLTEPFIEEECEETLGLKLLAKARYSLSTFEGEQIVIVSQVLAHEVNIGYEHMGNQQVIK  498

Query  1695  LNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSS  1874
             LNG  ++NIHHLAHL+D+CKDK+L FEF D+FLVVL+RE A T S+ ILK++ IPS RSS
Sbjct  499   LNGTVVKNIHHLAHLVDNCKDKFLTFEFEDDFLVVLDREEATTASSDILKEHAIPSVRSS  558

Query  1875  DLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
             DL  PYVD+  Q       +FGDS  +N E G D LLWA
Sbjct  559   DLSEPYVDT-EQEIQKPNDDFGDSPVTNYEMGVDCLLWA  596



>dbj|BAJ90870.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07813.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=604

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/522 (73%), Positives = 444/522 (85%), Gaps = 6/522 (1%)
 Frame = +3

Query  435   RKGKGVQFDSKELQV-ETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFM  611
             RK KG+  D KE QV +  +L++  FLNAVVKVYCTH  PDY LPWQKQRQ++STGSAFM
Sbjct  86    RKDKGLSVDFKEPQVADFEDLEEDKFLNAVVKVYCTHIRPDYGLPWQKQRQHSSTGSAFM  145

Query  612   IGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPL  791
             IGD KLLTNAHCVEHDTQ+KVKRRGDD KYVAKVLARG ECD+A+LSVE+EEFW+G EPL
Sbjct  146   IGDNKLLTNAHCVEHDTQIKVKRRGDDKKYVAKVLARGTECDLAMLSVENEEFWRGTEPL  205

Query  792   QFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNS  971
             Q G LP LQD+VTVVGYPLGGDTISVTKGVVSRIEVT YAHG+S+LLG+QIDAA+N GNS
Sbjct  206   QLGRLPCLQDSVTVVGYPLGGDTISVTKGVVSRIEVTPYAHGTSDLLGVQIDAAINAGNS  265

Query  972   GGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQ  1151
             GGPAFN+ GECIGVAFQV+RSDE ENIGYVIPTTVVSHFL DY +NGKYTGFP LGVLLQ
Sbjct  266   GGPAFNEQGECIGVAFQVFRSDEAENIGYVIPTTVVSHFLNDYRKNGKYTGFPCLGVLLQ  325

Query  1152  KLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTE  1331
             KLENPALR  LKVPS+EGVL+R+VEPT+ A + L++GDVI SFD V VGCEGTVPFRSTE
Sbjct  326   KLENPALRESLKVPSSEGVLVRRVEPTAPASSILRKGDVITSFDGVSVGCEGTVPFRSTE  385

Query  1332  RIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVF  1511
             RIAFRYL S+K++GD A+LGIIR G+ MKVQ VL PR  LVP++++GGQPSYLIVAGLVF
Sbjct  386   RIAFRYLTSQKYAGDVAQLGIIREGKVMKVQTVLRPRKHLVPFNVDGGQPSYLIVAGLVF  445

Query  1512  TPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQIL  1691
             TPL+EP I+EECED++GLKLL KARYS + F+GEQIV++SQVLAN+VNIGYE + N+Q++
Sbjct  446   TPLTEPFIEEECEDTLGLKLLAKARYSLSTFEGEQIVIVSQVLANDVNIGYEHMGNQQVI  505

Query  1692  KLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERS  1871
             KLNG  I+NIHHLAHL+D+C+DK+L FEF D+FLVVL+RE A+  S+ I K++ IPS RS
Sbjct  506   KLNGTMIKNIHHLAHLVDTCQDKFLTFEFEDDFLVVLDREEAVAASSDIQKEHAIPSVRS  565

Query  1872  SDLMGPYVDSIGQNDAVDQQ--EFGDSAESNSEFGFDGLLWA  1991
              DL  PYVD+   N  V  Q  +FGDS  +N E G D LLWA
Sbjct  566   MDLSEPYVDT---NHEVQNQGEDFGDSPVTNFELGVDCLLWA  604



>ref|XP_006352804.1| PREDICTED: protease Do-like 2, chloroplastic-like isoform X4 
[Solanum tuberosum]
Length=496

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/481 (81%), Positives = 426/481 (89%), Gaps = 4/481 (1%)
 Frame = +3

Query  171   SLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSKGE  350
             SL+S  LF+TS  PS FF+PK+   SQNQ H ++    +  S  E+ A   K +RRSK E
Sbjct  16    SLTSHRLFSTSLRPSSFFIPKA--DSQNQNHKRKVLNKSSSSPPEKVAGKPKFSRRSKNE  73

Query  351   RFFSNVDDRN-TNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVK  527
               F+N D R+ T++ GRSQS + KSFG+Q+KGKG+  DSK+ QVETG++QDA FLNAVVK
Sbjct  74    GPFANADGRSSTSETGRSQSAAIKSFGLQKKGKGILLDSKDQQVETGSIQDAAFLNAVVK  133

Query  528   VYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVA  707
             VYCTHTAPDYSLPWQKQRQ+TSTGSAFMIGDGKLLTNAHCVEHDTQVKVK+RGDDTKYVA
Sbjct  134   VYCTHTAPDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKKRGDDTKYVA  193

Query  708   KVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVS  887
             KVLARGV CDIALLSVES+EFW+GAEPL FG LPRLQDAVTVVGYPLGGDTISVTKGVVS
Sbjct  194   KVLARGVACDIALLSVESKEFWEGAEPLSFGRLPRLQDAVTVVGYPLGGDTISVTKGVVS  253

Query  888   RIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIP  1067
             RIEVTSYAHGSSELLGIQIDAA+NPGNSGGPAFND G+CIGVAFQVYRSD+ ENIGYVIP
Sbjct  254   RIEVTSYAHGSSELLGIQIDAAINPGNSGGPAFNDVGDCIGVAFQVYRSDDAENIGYVIP  313

Query  1068  TTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHN  1247
             TTVVSHFL+DYE+NGKY GFP LGVLLQKLENPALRACLKVPSNEGVL+RKVEPTSD  N
Sbjct  314   TTVVSHFLEDYEKNGKYCGFPCLGVLLQKLENPALRACLKVPSNEGVLVRKVEPTSDISN  373

Query  1248  TLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQI  1427
              +KEGDVIVSFD V VGCEGTVPFRS+ERIAFRYLIS+KF+GD+ ELGIIRAGEFMKVQ 
Sbjct  374   VVKEGDVIVSFDGVHVGCEGTVPFRSSERIAFRYLISQKFTGDSVELGIIRAGEFMKVQA  433

Query  1428  VLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFK  1607
             VL PRV LVPYHIEGGQPSYLIVAGLVFTPLSEPLI+EE EDSIGLKLLTKARYS A F+
Sbjct  434   VLKPRVHLVPYHIEGGQPSYLIVAGLVFTPLSEPLIEEE-EDSIGLKLLTKARYSLAKFE  492

Query  1608  G  1610
             G
Sbjct  493   G  493



>ref|XP_007050778.1| DEGP protease 2 isoform 3 [Theobroma cacao]
 gb|EOX94935.1| DEGP protease 2 isoform 3 [Theobroma cacao]
Length=558

 Score =   782 bits (2019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/488 (79%), Positives = 423/488 (87%), Gaps = 12/488 (2%)
 Frame = +3

Query  231   KSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSKGERFFSNVDDRNTNKN-GRSQS  407
             KS + +  ++ N +K P ++          +K   RSK E+     D  +   + GR QS
Sbjct  56    KSCSSTSPRKFNVKKDPVSQ----------KKLPGRSKDEKSSLYADGISGRGDMGRPQS  105

Query  408   TSFKSFGVQRKGKG-VQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQ  584
             T FKSFG QRK +   Q D +E QVE GNLQDA FLNAVVKVYCTHTAPDYSLPWQKQRQ
Sbjct  106   TGFKSFGTQRKDREEFQLDLREQQVEPGNLQDATFLNAVVKVYCTHTAPDYSLPWQKQRQ  165

Query  585   YTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESE  764
             +TSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGV+CDIALLSVES+
Sbjct  166   FTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVDCDIALLSVESK  225

Query  765   EFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQI  944
             EFW+GAEPL+ GHLP LQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS+LLGIQI
Sbjct  226   EFWRGAEPLRLGHLPGLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQI  285

Query  945   DAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTG  1124
             DAA+NPGNSGGPAFN+ GECIGVAFQVYRS+E ENIGYVIPTTVVSHFL DYERNGKYTG
Sbjct  286   DAAINPGNSGGPAFNEQGECIGVAFQVYRSEEAENIGYVIPTTVVSHFLSDYERNGKYTG  345

Query  1125  FPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCE  1304
             FP LGVLLQKLENPALRACL V SNEGVL+R+VEPTSDA+N LKEGDVIVSFDDV VG E
Sbjct  346   FPCLGVLLQKLENPALRACLHVQSNEGVLVRRVEPTSDANNVLKEGDVIVSFDDVHVGSE  405

Query  1305  GTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPS  1484
             GTVPFRS ERIAFRYLIS+KF+GD AELGI+RAG FMKVQ+VL+ RV LVPYHI+GGQPS
Sbjct  406   GTVPFRSNERIAFRYLISQKFAGDVAELGIVRAGRFMKVQVVLNRRVHLVPYHIDGGQPS  465

Query  1485  YLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGY  1664
             YLI+AGLVFTPLSEPLI+EECEDSIGLKLL KARYS A FKGEQIV+LSQVLANEVNIGY
Sbjct  466   YLIIAGLVFTPLSEPLIEEECEDSIGLKLLAKARYSLARFKGEQIVILSQVLANEVNIGY  525

Query  1665  EDISNEQI  1688
             ED+ N+Q+
Sbjct  526   EDMGNQQV  533



>ref|XP_010233342.1| PREDICTED: protease Do-like 2, chloroplastic [Brachypodium distachyon]
Length=616

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/543 (68%), Positives = 438/543 (81%), Gaps = 27/543 (5%)
 Frame = +3

Query  435   RKGKGVQFDSKELQV-ETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAF-  608
             RK KG+  D KE QV +  +L++  F NAVVKVYCTH  PDY LPWQKQRQ +STG  + 
Sbjct  77    RKEKGLSVDFKESQVADFEDLEEDKFFNAVVKVYCTHIRPDYGLPWQKQRQNSSTGRQYC  136

Query  609   ---------MIGDGKLLT-----------NAHCVEHDTQVKVKRRGDDTKYVAKVLARGV  728
                      ++G G +L+            +HCVEHDTQ+KVKRRGDD KYVAKV+ARG 
Sbjct  137   LLSSHVFYVLVGKGMVLSILINYAMSASIVSHCVEHDTQIKVKRRGDDKKYVAKVVARGT  196

Query  729   ECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSY  908
             ECD+ALLSVE+EEFW+G EPLQ G LP LQD+VTVVGYPLGGDTISVTKGVVSRIEVT Y
Sbjct  197   ECDLALLSVENEEFWRGTEPLQLGRLPCLQDSVTVVGYPLGGDTISVTKGVVSRIEVTPY  256

Query  909   AHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHF  1088
             AHG+S+LLG+QIDAA+N GNSGGPAFN+ GECIGVAFQV+RSDE ENIGYVIPTTVVSHF
Sbjct  257   AHGTSDLLGVQIDAAINAGNSGGPAFNEQGECIGVAFQVFRSDEAENIGYVIPTTVVSHF  316

Query  1089  LQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDV  1268
             L DY +NGKYTGFP LGVLLQKLENPALR  LKVPS+EG+L+R+VEPT+ A   L++GDV
Sbjct  317   LNDYRKNGKYTGFPCLGVLLQKLENPALRESLKVPSSEGILVRRVEPTAPASCVLRKGDV  376

Query  1269  IVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVD  1448
             I SFD V VGCEGTVPFRSTERIAFRYL S+K++GD AELGIIR G FMKVQ  L PR  
Sbjct  377   IASFDGVPVGCEGTVPFRSTERIAFRYLTSQKYAGDVAELGIIREGNFMKVQTTLHPRKH  436

Query  1449  LVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVL  1628
             LVP+H+EGGQPSYLIVAGLVFTPL+EP I+EECED++GLKLL KARYS + F+GEQIV++
Sbjct  437   LVPFHVEGGQPSYLIVAGLVFTPLTEPFIEEECEDTLGLKLLAKARYSLSTFEGEQIVIV  496

Query  1629  SQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLER  1808
             SQVLAN+VNIGYE + N+Q++KLNG  ++NIHHLAHL+D+C+DK+L FEF D+FLVVL+R
Sbjct  497   SQVLANDVNIGYEHMGNQQVIKLNGTMVKNIHHLAHLVDTCQDKFLTFEFEDDFLVVLDR  556

Query  1809  EAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQ--QEFGDSAESNSEFGFDGL  1982
             E A+  S+ I K++ IPS RSSDL  PYVD+   N  V +  ++FGDS  +N E G D L
Sbjct  557   EEAMAASSDIQKEHAIPSVRSSDLSEPYVDT---NHEVQKTSEDFGDSPVTNFEMGVDCL  613

Query  1983  LWA  1991
             LWA
Sbjct  614   LWA  616



>gb|EPS74298.1| hypothetical protein M569_00454, partial [Genlisea aurea]
Length=404

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/404 (86%), Positives = 377/404 (93%), Gaps = 1/404 (0%)
 Frame = +3

Query  474   QVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVE  653
             Q E GN QDA+FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVE
Sbjct  1     QAEEGNFQDADFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVE  60

Query  654   HDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTV  833
             H+TQVKVKRRGDDTKY+AKVLARG+ECDIALLSVES+EFW GAEPL+FG LP LQD+VTV
Sbjct  61    HNTQVKVKRRGDDTKYLAKVLARGIECDIALLSVESKEFWVGAEPLRFGQLPNLQDSVTV  120

Query  834   VGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGV  1013
             VGYPLGG+TISV+KGVVSRIEVTSYAHGSSELLGIQIDAA+NPGNSGGPAFND GECIGV
Sbjct  121   VGYPLGGETISVSKGVVSRIEVTSYAHGSSELLGIQIDAAINPGNSGGPAFNDQGECIGV  180

Query  1014  AFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVP  1193
             AFQVYRSD+ ENIGYVIPT+VVSHFL+DY RNG+YTGFP LGVLLQKLENPALRACL VP
Sbjct  181   AFQVYRSDDAENIGYVIPTSVVSHFLEDYARNGRYTGFPCLGVLLQKLENPALRACLNVP  240

Query  1194  SNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSG  1373
             SNEGVL+RKVEPTS A   L EGDVIVSF DVRVGCEGTVPFRSTERIAFRYLIS+K++G
Sbjct  241   SNEGVLVRKVEPTSHASEVLNEGDVIVSFGDVRVGCEGTVPFRSTERIAFRYLISQKYTG  300

Query  1374  DTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED  1553
             D AE+GIIR G+FMKV +VL+P+V LVPYHIE G+PSYLIVAGLVFTPLS+PLI+EECED
Sbjct  301   DVAEVGIIRRGQFMKVHVVLNPQVHLVPYHIE-GEPSYLIVAGLVFTPLSDPLIEEECED  359

Query  1554  SIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQ  1685
             +IGLKLL KARYS   FKGEQIV+LSQVLANE NIGYE++SNEQ
Sbjct  360   NIGLKLLAKARYSMPRFKGEQIVILSQVLANEENIGYEEMSNEQ  403



>gb|EMS54752.1| Protease Do-like 2, chloroplastic [Triticum urartu]
Length=598

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/540 (67%), Positives = 428/540 (79%), Gaps = 24/540 (4%)
 Frame = +3

Query  435   RKGKGVQFDSKELQV-ETGNLQDANFLNAVVKV------YCTHTAPDYSLPWQKQRQYTS  593
             RK KG+  D KE QV +  +L++  FLNAVVKV      + +    + SL  +       
Sbjct  62    RKDKGLSIDFKESQVADFEDLEEDKFLNAVVKVGLKNMSWLSMMLDNASLVRELDMCDRC  121

Query  594   TGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFW  773
                AFMIGD KLLTNAHCVEHDTQ+KVKRRGDD KYVAKVLARG ECD+A+LSVE+EEFW
Sbjct  122   CLCAFMIGDNKLLTNAHCVEHDTQIKVKRRGDDKKYVAKVLARGTECDLAMLSVENEEFW  181

Query  774   KGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIE------------VTSYAHG  917
             +G EPLQ G LP LQD+VTVVGYPLGGDTISVTKGVVSRIE            VT YAHG
Sbjct  182   RGTEPLQLGRLPCLQDSVTVVGYPLGGDTISVTKGVVSRIESHLYYFTFGIAQVTPYAHG  241

Query  918   SSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQD  1097
             +S+LLG+QIDAA+N GNSGGPAFN+ GECIGVAFQV+RSDE ENIGYVIPTTVVSHFL D
Sbjct  242   TSDLLGVQIDAAINAGNSGGPAFNEQGECIGVAFQVFRSDEAENIGYVIPTTVVSHFLND  301

Query  1098  YERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVS  1277
             Y +NGKYTGFP LGVLLQKLENPALR  LKVPS+EGVL+R+VEPT+ A + L++GDVI S
Sbjct  302   YRKNGKYTGFPCLGVLLQKLENPALRESLKVPSSEGVLVRRVEPTAPASSVLRKGDVITS  361

Query  1278  FDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVP  1457
             FD V VGCEGTVPFRSTERIAFRYL S+K++GD A+LGIIR G+ MKVQ +L PR  LVP
Sbjct  362   FDGVSVGCEGTVPFRSTERIAFRYLTSQKYAGDVAQLGIIREGKVMKVQTILHPRKHLVP  421

Query  1458  YHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQV  1637
             ++++GGQPSYLIVAGLVFTPL+EP I+EECED++GLKLL KARYS + F+GEQIV++SQV
Sbjct  422   FNVDGGQPSYLIVAGLVFTPLTEPFIEEECEDTLGLKLLAKARYSLSTFEGEQIVIVSQV  481

Query  1638  LANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAA  1817
             LAN+VNIGYE + N+Q++KLNG  I+NIHHLAHL+D+C+DK+L FEF D+FLVVL+RE A
Sbjct  482   LANDVNIGYEHMGNQQVIKLNGTMIKNIHHLAHLVDTCQDKFLTFEFEDDFLVVLDREEA  541

Query  1818  LTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQ--EFGDSAESNSEFGFDGLLWA  1991
                S+ I K++ IPS RS DL  PYVD+   N  V  Q  +FGDS  +N E G D LLWA
Sbjct  542   AAASSDIQKEHAIPSVRSLDLSEPYVDT---NHEVQNQGEDFGDSPVTNFELGVDCLLWA  598



>gb|EMT00922.1| Protease Do-like 2, chloroplastic [Aegilops tauschii]
Length=642

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/521 (68%), Positives = 416/521 (80%), Gaps = 23/521 (4%)
 Frame = +3

Query  489   NLQDANFLNAVVKV------YCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCV  650
             +L++  FLNAVVKV      + +    + SL  +          AFMIGD KLLTNAHCV
Sbjct  125   DLEEDKFLNAVVKVGLKNMSWLSMMLDNASLVRELDMCARCCLCAFMIGDNKLLTNAHCV  184

Query  651   EHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVT  830
             EHDTQ+KVKRRGDD KYVAKVLARG ECD+A+LSVE+EEFW+G EPLQ G LP LQD+VT
Sbjct  185   EHDTQIKVKRRGDDKKYVAKVLARGTECDLAMLSVENEEFWRGTEPLQLGRLPCLQDSVT  244

Query  831   VVGYPLGGDTISVTKGVVSRIE------------VTSYAHGSSELLGIQIDAAVNPGNSG  974
             VVGYPLGGDTISVTKGVVSRIE            VT YAHG+S+LLG+QIDAA+N GNSG
Sbjct  245   VVGYPLGGDTISVTKGVVSRIELHLYYFTFGIAQVTPYAHGTSDLLGVQIDAAINAGNSG  304

Query  975   GPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQK  1154
             GPAFN+ GECIGVAFQV+RSDE ENIGYVIPTTVVSHFL DY +NGKYTGFP LGVLLQK
Sbjct  305   GPAFNEQGECIGVAFQVFRSDEAENIGYVIPTTVVSHFLNDYRKNGKYTGFPCLGVLLQK  364

Query  1155  LENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTER  1334
             LENPALR  LKVPS+EGVL+R+VEPT+ A + L++GDVI SFD V VGCEGTVPFRSTER
Sbjct  365   LENPALRESLKVPSSEGVLVRRVEPTAPASSVLRKGDVITSFDGVSVGCEGTVPFRSTER  424

Query  1335  IAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFT  1514
             IAFRYL S+K++GD A+LGIIR G  MKVQ +L PR  LVP++++GGQPSYLIVAGLVFT
Sbjct  425   IAFRYLTSQKYAGDVAQLGIIREGNVMKVQTILHPRKHLVPFNVDGGQPSYLIVAGLVFT  484

Query  1515  PLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILK  1694
             PL+EP I+EECED++GLKLL KARYS + F+GEQIV++SQVLAN+VNIGYE + N+Q++K
Sbjct  485   PLTEPFIEEECEDTLGLKLLAKARYSLSTFEGEQIVIVSQVLANDVNIGYEHMGNQQVIK  544

Query  1695  LNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSS  1874
             LNG  I+NIHHLAHL+D+C+DK+L FEF D+FLVVL+RE A   S+ I K++ IPS RS 
Sbjct  545   LNGTMIKNIHHLAHLVDTCQDKFLTFEFEDDFLVVLDREEAAAASSDIQKEHAIPSVRSL  604

Query  1875  DLMGPYVDSIGQNDAVDQQ--EFGDSAESNSEFGFDGLLWA  1991
             DL  PYVD+   N  V  Q  +FGDS  +N E G D LLWA
Sbjct  605   DLSEPYVDT---NHEVQNQGEDFGDSPVTNFELGVDCLLWA  642



>gb|AFW57620.1| hypothetical protein ZEAMMB73_444319 [Zea mays]
Length=458

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/444 (74%), Positives = 379/444 (85%), Gaps = 0/444 (0%)
 Frame = +3

Query  660   TQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVG  839
              QVKVKRRGDD KY+AKVLARGVECD+ALLSVE+EEFW+G E L FG LP LQD+VTVVG
Sbjct  15    VQVKVKRRGDDKKYIAKVLARGVECDLALLSVENEEFWRGTEALHFGRLPCLQDSVTVVG  74

Query  840   YPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAF  1019
             YPLGGDTISVTKGVVSRIEVT YAHG+S+LLGIQIDAA+NPGNSGGPAFND GECIGVAF
Sbjct  75    YPLGGDTISVTKGVVSRIEVTPYAHGTSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAF  134

Query  1020  QVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSN  1199
             QVYRSDE ENIGYVIPTTVVSHFL DY++NGKYTGFP LGVLLQKLENPALR  LKVPS+
Sbjct  135   QVYRSDEAENIGYVIPTTVVSHFLNDYQKNGKYTGFPCLGVLLQKLENPALRESLKVPSS  194

Query  1200  EGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDT  1379
             EGVL+R+VEPT+ A + L++GDVIVSFD + VGCE TVPFRSTERIAFRYL S+K++GD 
Sbjct  195   EGVLVRRVEPTAPASSVLRKGDVIVSFDGIAVGCEATVPFRSTERIAFRYLTSQKYAGDI  254

Query  1380  AELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSI  1559
             A+LGIIR G  MKVQ +L PR  LVP+H+EGGQPSYLIVAGLVFTPL+EP I+EECED++
Sbjct  255   AQLGIIRDGNSMKVQTILQPRKHLVPFHVEGGQPSYLIVAGLVFTPLTEPFIEEECEDTL  314

Query  1560  GLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHL  1739
             GLKLL KARYS A F+GE+IV++SQVLA+EVNIGYE + N+Q++KLNG  I+NIHHLAHL
Sbjct  315   GLKLLAKARYSLATFEGEEIVIVSQVLAHEVNIGYEHMGNQQVMKLNGTTIKNIHHLAHL  374

Query  1740  LDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDA  1919
             +D+CKDK+L FEF D+FLVVL RE A   S+ ILK++ IPS RSSDL  PY ++      
Sbjct  375   VDTCKDKFLTFEFEDDFLVVLHREEADAASSDILKEHAIPSIRSSDLSEPYAEANNNEIQ  434

Query  1920  VDQQEFGDSAESNSEFGFDGLLWA  1991
                ++FG+S  +N E G D LLWA
Sbjct  435   KTSEDFGESPVTNFEMGIDCLLWA  458



>ref|XP_007144565.1| hypothetical protein PHAVU_007G1665001g, partial [Phaseolus vulgaris]
 gb|ESW16559.1| hypothetical protein PHAVU_007G1665001g, partial [Phaseolus vulgaris]
Length=364

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/365 (77%), Positives = 318/365 (87%), Gaps = 1/365 (0%)
 Frame = +3

Query  897   VTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTV  1076
             VTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQV+RS+E ENIGYVIPTTV
Sbjct  1     VTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVFRSEEAENIGYVIPTTV  60

Query  1077  VSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLK  1256
             VSHFL DYE+NG+YTGFP LGVL+QKLENPALRA LKV SNEGVL+R+VEPTSDA N LK
Sbjct  61    VSHFLTDYEKNGRYTGFPCLGVLIQKLENPALRAWLKVQSNEGVLVRRVEPTSDATNVLK  120

Query  1257  EGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLS  1436
             EGDVIVSFDD+RVG EGTVPFR+ ERIAF  LIS+KFSGDTAELGIIR G FMK ++VL+
Sbjct  121   EGDVIVSFDDIRVGSEGTVPFRTNERIAFHSLISQKFSGDTAELGIIREGTFMKTKVVLN  180

Query  1437  PRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQ  1616
              RV LVPYH++ GQPSYLI+AGLVFTPLSEPLI+EECEDSIGLKLL +ARYS A FKGEQ
Sbjct  181   SRVHLVPYHMDEGQPSYLIIAGLVFTPLSEPLIEEECEDSIGLKLLARARYSLARFKGEQ  240

Query  1617  IVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLV  1796
             IV+LSQVLANEVNIGYED+ N+Q++K NG RI+NIHHLAHL+DSC+D+YL FEF D+++ 
Sbjct  241   IVILSQVLANEVNIGYEDMGNQQVVKFNGTRIKNIHHLAHLVDSCEDRYLSFEFEDSYVA  300

Query  1797  VLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFD  1976
             VL+REA    S+SIL DYGIPS RSSDL  PYVD+  + D    QEFGDS  SN E G D
Sbjct  301   VLDREAVSDASSSILSDYGIPSGRSSDLSKPYVDT-PEGDQPANQEFGDSPVSNFEIGSD  359

Query  1977  GLLWA  1991
             GLLWA
Sbjct  360   GLLWA  364



>ref|XP_007144564.1| hypothetical protein PHAVU_007G1665001g, partial [Phaseolus vulgaris]
 gb|ESW16558.1| hypothetical protein PHAVU_007G1665001g, partial [Phaseolus vulgaris]
Length=369

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/370 (76%), Positives = 318/370 (86%), Gaps = 6/370 (2%)
 Frame = +3

Query  897   VTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTV  1076
             VTSYAHGSS+LLGIQIDAA+NPGNSGGPAFND GECIGVAFQV+RS+E ENIGYVIPTTV
Sbjct  1     VTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVFRSEEAENIGYVIPTTV  60

Query  1077  VSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLK  1256
             VSHFL DYE+NG+YTGFP LGVL+QKLENPALRA LKV SNEGVL+R+VEPTSDA N LK
Sbjct  61    VSHFLTDYEKNGRYTGFPCLGVLIQKLENPALRAWLKVQSNEGVLVRRVEPTSDATNVLK  120

Query  1257  EGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLS  1436
             EGDVIVSFDD+RVG EGTVPFR+ ERIAF  LIS+KFSGDTAELGIIR G FMK ++VL+
Sbjct  121   EGDVIVSFDDIRVGSEGTVPFRTNERIAFHSLISQKFSGDTAELGIIREGTFMKTKVVLN  180

Query  1437  PRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIG-----LKLLTKARYSFAN  1601
              RV LVPYH++ GQPSYLI+AGLVFTPLSEPLI+EECEDSIG     LKLL +ARYS A 
Sbjct  181   SRVHLVPYHMDEGQPSYLIIAGLVFTPLSEPLIEEECEDSIGVTSEFLKLLARARYSLAR  240

Query  1602  FKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFA  1781
             FKGEQIV+LSQVLANEVNIGYED+ N+Q++K NG RI+NIHHLAHL+DSC+D+YL FEF 
Sbjct  241   FKGEQIVILSQVLANEVNIGYEDMGNQQVVKFNGTRIKNIHHLAHLVDSCEDRYLSFEFE  300

Query  1782  DNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNS  1961
             D+++ VL+REA    S+SIL DYGIPS RSSDL  PYVD+  + D    QEFGDS  SN 
Sbjct  301   DSYVAVLDREAVSDASSSILSDYGIPSGRSSDLSKPYVDT-PEGDQPANQEFGDSPVSNF  359

Query  1962  EFGFDGLLWA  1991
             E G DGLLWA
Sbjct  360   EIGSDGLLWA  369



>ref|XP_002985706.1| hypothetical protein SELMODRAFT_122577, partial [Selaginella 
moellendorffii]
 gb|EFJ13284.1| hypothetical protein SELMODRAFT_122577, partial [Selaginella 
moellendorffii]
Length=490

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/462 (59%), Positives = 358/462 (77%), Gaps = 11/462 (2%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             L+ VVKVYCTH+ PDYSLPWQKQRQ+ STGS F+I   +LLTNAHCVEH TQV+VK+RGD
Sbjct  9     LDGVVKVYCTHSEPDYSLPWQKQRQFMSTGSGFVISGRRLLTNAHCVEHHTQVQVKKRGD  68

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTK+VA+VLA G +CD+ALL+V+SEEFW+  EPL+FG LPRLQD V VVGYP+GG+TISV
Sbjct  69    DTKFVARVLAEGPDCDLALLTVDSEEFWEAVEPLKFGSLPRLQDPVIVVGYPMGGETISV  128

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSD-EVE  1046
             T GVVSRIEVTSY HG+SELLG+QIDAA+N GNSGGPAFN++GEC+G+AFQV  SD +VE
Sbjct  129   TSGVVSRIEVTSYVHGASELLGVQIDAAINAGNSGGPAFNEEGECVGIAFQVSLSDMDVE  188

Query  1047  NIGYVIPTTVVSHFLQDYERNGKYTG--FPSLGVLLQKLENPALRACLKVPSNE-GVLIR  1217
             NIG+VIPT V+ HFL+D+E+NG+YTG  FPSL V  QKLEN A+RA LK+ S + GVLIR
Sbjct  189   NIGFVIPTAVIFHFLKDFEQNGRYTGKCFPSLAVWWQKLENSAMRASLKMKSGQKGVLIR  248

Query  1218  KVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGII  1397
             +VEP +   + +K GDV++SFD V +  EGTV FR+ ERI F +L+++K+  +TAEL ++
Sbjct  249   RVEPLAPVASVVKAGDVLLSFDGVPIANEGTVSFRTGERIDFEFLVTQKYVCETAELELL  308

Query  1398  RAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGLKLLT  1577
             R G+ +KVQ V  P V LVP H+    PSY IVAGLVF PL  P ++ EC+       L 
Sbjct  309   RDGKELKVQTVFKPPVRLVPVHLASKMPSYFIVAGLVFVPLCFPYLESECD-------LG  361

Query  1578  KARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKD  1757
             +A  S +NF+ +Q++V+SQVLA+ VN GYE++ N ++L  NG++IRN+   + L+DSC +
Sbjct  362   EAEVSVSNFEDQQVIVMSQVLAHPVNAGYENLQNVEVLTFNGEKIRNLRQFSRLVDSCTE  421

Query  1758  KYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLM  1883
             +++ FE   + LVVLE ++A   +  IL+D+ +PSERS DL+
Sbjct  422   EFMRFELERHILVVLETKSARLANEQILRDFHVPSERSLDLV  463



>ref|XP_002974405.1| hypothetical protein SELMODRAFT_100929, partial [Selaginella 
moellendorffii]
 gb|EFJ24627.1| hypothetical protein SELMODRAFT_100929, partial [Selaginella 
moellendorffii]
Length=498

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/471 (57%), Positives = 352/471 (75%), Gaps = 16/471 (3%)
 Frame = +3

Query  519   VVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTK  698
             + +VYCTH+ PDYSLPWQKQRQ+ STGS F+I   +LLTNAHCVEH TQV+VK+RGDDTK
Sbjct  1     LTQVYCTHSEPDYSLPWQKQRQFMSTGSGFVISGRRLLTNAHCVEHHTQVQVKKRGDDTK  60

Query  699   YVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKG  878
             +VA+VLA G +CD+ALL+V+SEEFW+  EPL+FG LPRLQD V VVGYP+GG+TISVT G
Sbjct  61    FVARVLAEGPDCDLALLTVDSEEFWEAVEPLKFGSLPRLQDPVIVVGYPMGGETISVTSG  120

Query  879   VVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGY  1058
             VVSRIEVTSY HG+SELLG+QIDAA+N GNSGGPAFN++GEC+G+AFQ  +  +VENIG+
Sbjct  121   VVSRIEVTSYVHGASELLGVQIDAAINAGNSGGPAFNEEGECVGIAFQSLKDMDVENIGF  180

Query  1059  VIPTTVVSHFLQDYERNGKYT------------GFPSLGVLLQKLENPALRACLKVPSNE  1202
             VIPT V+ HFL+D+E+NG+YT            GFPSL V  QKLEN A+RA LK+ S +
Sbjct  181   VIPTAVIFHFLKDFEQNGRYTGNIFLNFLSVQSGFPSLAVWWQKLENSAMRASLKMKSGQ  240

Query  1203  -GVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDT  1379
              GVLIR+VEP +   + +K GDV++SFD V +  EGTV FR+ ERI F +L+++K+  +T
Sbjct  241   KGVLIRRVEPLAPVASAVKAGDVLLSFDGVPIANEGTVSFRTGERIDFEFLVTQKYVCET  300

Query  1380  AELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEEC---E  1550
             AEL ++R G+ +KVQ V  P V LVP H+    PSY IVAGLVF PL  P ++ EC   E
Sbjct  301   AELELLRDGKELKVQTVFKPPVRLVPVHLASKMPSYFIVAGLVFVPLCFPYLESECDLGE  360

Query  1551  DSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHL  1730
               +  KL   AR     F+ +Q++V+SQVLA+ VN GYE++ N ++L  NG++IRN+   
Sbjct  361   AEVSGKLREIARNGMVEFEDQQVIVMSQVLAHPVNAGYENLQNVEVLTFNGEKIRNLRQF  420

Query  1731  AHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLM  1883
             + L+DSC ++++ FE   + LVVLE ++A   +  IL+D+ +PSERS DL+
Sbjct  421   SRLVDSCTEEFMRFELERHILVVLETKSARLANEQILRDFHVPSERSLDLV  471



>ref|XP_009587779.1| PREDICTED: protease Do-like 2, chloroplastic isoform X3 [Nicotiana 
tomentosiformis]
Length=537

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/322 (84%), Positives = 292/322 (91%), Gaps = 1/322 (0%)
 Frame = +3

Query  1026  YRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNEG  1205
             +RSD+ ENIGYVIPTTVVSHFL+DYERNGKY GFP LGVLLQKLENPALRACLKVPSNEG
Sbjct  217   FRSDDAENIGYVIPTTVVSHFLEDYERNGKYCGFPCLGVLLQKLENPALRACLKVPSNEG  276

Query  1206  VLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAE  1385
             VL+RKVEPTSD  N LKEGDVIVSFD VRVG EGTVPFRS+ERIAFRYLIS+KFSGD+ E
Sbjct  277   VLVRKVEPTSDVSNVLKEGDVIVSFDGVRVGSEGTVPFRSSERIAFRYLISQKFSGDSVE  336

Query  1386  LGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGL  1565
             LGIIR GEFMKVQ VL PRV LVPYHIEGGQPSYLIVAGLVFTPLSEPLI+EE EDSIGL
Sbjct  337   LGIIRGGEFMKVQAVLKPRVHLVPYHIEGGQPSYLIVAGLVFTPLSEPLIEEE-EDSIGL  395

Query  1566  KLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLD  1745
             KLLTKARYS A F+G+QIVVLSQVLANEVNIGYED+SN+Q+LKLNG RI+NIHHLAHL+D
Sbjct  396   KLLTKARYSLAKFEGQQIVVLSQVLANEVNIGYEDMSNDQVLKLNGTRIKNIHHLAHLVD  455

Query  1746  SCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVD  1925
             SCK KYLVFEF DNFLVVLEREAAL  S+SILKDYGIP+ERSSDLMG YVDSI  ++A +
Sbjct  456   SCKGKYLVFEFEDNFLVVLEREAALDASSSILKDYGIPAERSSDLMGAYVDSIEHSEATN  515

Query  1926  QQEFGDSAESNSEFGFDGLLWA  1991
             QQ FGDS  SN EFG +GLLWA
Sbjct  516   QQNFGDSPVSNLEFGSEGLLWA  537


 Score =   270 bits (690),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 150/185 (81%), Gaps = 7/185 (4%)
 Frame = +3

Query  165  RCSLSSQPLFATSRPPSRFFVPKSATQSQNQEHNQRKKPPARVSHTEREAVTQKCTRRSK  344
            RCSLSS  LF+TS  PS FF+PK++TQ+QN   N  KK       +E+EA  QK  RRSK
Sbjct  22   RCSLSSDRLFSTSLRPSSFFLPKASTQNQNHNKNVLKKS------SEKEAGKQKFPRRSK  75

Query  345  GERFFSNVDDRN-TNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAV  521
             E  F+N DDR+ TN+ GRSQ TS KSFG+QRKGKGV  DSKE QVET + QDA FLNAV
Sbjct  76   NEGAFANADDRSSTNEAGRSQPTSIKSFGLQRKGKGVLLDSKEQQVETSSFQDAAFLNAV  135

Query  522  VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKY  701
            VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVK+RGDDTKY
Sbjct  136  VKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKKRGDDTKY  195

Query  702  VAKVL  716
            VAKV+
Sbjct  196  VAKVI  200



>ref|XP_001753311.1| predicted protein [Physcomitrella patens]
 gb|EDQ81940.1| predicted protein [Physcomitrella patens]
Length=851

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/474 (59%), Positives = 357/474 (75%), Gaps = 13/474 (3%)
 Frame = +3

Query  498   DANFLNAVVKV------YCTHTAPDYSLPWQKQR-QYTSTGSAFMIGDGKLLTNAHCVEH  656
             DA FL+AVVK       +C +   D+ L  ++   +     S FMI   +LLTNAHCVEH
Sbjct  359   DAPFLDAVVKAGKLSSSFC-YFGVDFCLRVRESNSEILDLISGFMIQGRRLLTNAHCVEH  417

Query  657   DTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVV  836
              TQVKVKRRGDDTK+VA VLA G ECDIALL+V+ EEFWKG EPL+FG LPRLQDAVTVV
Sbjct  418   HTQVKVKRRGDDTKFVATVLAIGPECDIALLAVDDEEFWKGVEPLKFGSLPRLQDAVTVV  477

Query  837   GYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVA  1016
             GYP+GG++ISVT GVVSRIEVTSY HG+SELLG+QIDAA+N GNSGGP F+++GEC+G+A
Sbjct  478   GYPIGGESISVTSGVVSRIEVTSYVHGASELLGVQIDAAINAGNSGGPVFHENGECVGIA  537

Query  1017  FQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-P  1193
             FQ  +  + ENIGYVIPTTV+ HFL DY+ NGKYTGFPS+GVL QKLENPALRA LK+ P
Sbjct  538   FQSLKGADAENIGYVIPTTVIHHFLSDYDTNGKYTGFPSMGVLWQKLENPALRAFLKMKP  597

Query  1194  SNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSG  1373
               +GVL+R+VEPTS A   +KEGDV++SFD++ V  EGTVPFR+ ERI+F +LIS+KFSG
Sbjct  598   DQKGVLVRRVEPTSPAFQAIKEGDVLLSFDNIPVANEGTVPFRAGERISFGFLISQKFSG  657

Query  1374  DTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE---  1544
             DTA+  ++R GE ++++  L   V LVP HIEG  PSYLIVAGLVFTP+  P ++ E   
Sbjct  658   DTAKCKMLRDGEVIEIETTLKAPVHLVPVHIEGKLPSYLIVAGLVFTPVCNPYLESEYGQ  717

Query  1545  -CEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNI  1721
               E    +K+L K+R+  A F  EQ+VV+SQVLAN+VNIGYE+I+N  +   NG +IRN+
Sbjct  718   DFEYDAPVKILEKSRHGMAEFDDEQLVVVSQVLANDVNIGYEEIANTLVKTFNGVKIRNL  777

Query  1722  HHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLM  1883
              HLA L+D+C D ++ FE     LVVLE + A + +  IL+D  +P++RS DL+
Sbjct  778   RHLADLIDTCTDDFMRFELDYCSLVVLETKVARSVTPKILEDNCVPTDRSQDLI  831



>ref|XP_006470390.1| PREDICTED: protease Do-like 9-like [Citrus sinensis]
Length=587

 Score =   541 bits (1395),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 276/573 (48%), Positives = 381/573 (66%), Gaps = 22/573 (4%)
 Frame = +3

Query  228   PKSATQSQNQEHNQRKKP-------------PARVSHTEREAVTQKCTR-RSKGERFF--  359
             PK+ TQ++ +  ++   P             PA  ++  R     +  R R K  R    
Sbjct  13    PKTQTQTETESESETIMPGTTKNGTVASHSLPATTTNDSRSTSPARRGRGRPKKMRKHAD  72

Query  360   -SNVDDRNTNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVKVYC  536
              S+ D+ N+  N  S      S    R G+G        + E+  ++    ++AVVKV+C
Sbjct  73    NSSNDNHNSANNTNSNVGHVASPERSRHGEGNDITILPPRWESVAVKAVPSMDAVVKVFC  132

Query  537   THTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVL  716
              HT P++SLPWQ++RQY+S+ S F++G  ++LTNAH VEH TQVKVK+RG DTKY+A VL
Sbjct  133   VHTEPNFSLPWQRKRQYSSSSSGFIVGGRRVLTNAHSVEHHTQVKVKKRGSDTKYLATVL  192

Query  717   ARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIE  896
             + G ECDIALL+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISVT GVVSR+E
Sbjct  193   SIGTECDIALLTVKDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISVTSGVVSRME  252

Query  897   VTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTV  1076
             + SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  ++D+VENIGYVIPT V
Sbjct  253   ILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKNDDVENIGYVIPTPV  312

Query  1077  VSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVEPTSDAHNTL  1253
             + HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR++EPT+   + L
Sbjct  313   IIHFIQDYEKNGAYTGFPILGVEWQKMENPDLRISMGMRPGQKGVRIRRIEPTAPESHVL  372

Query  1254  KEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVL  1433
             K  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++GD+A + ++R  E  +  I L
Sbjct  373   KPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNSEVHEFNIKL  432

Query  1434  SPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLLTKARYSFAN  1601
             S    L+P HI G  PSY I+AG VFT ++ P ++ E     E    +KLL K  ++ A 
Sbjct  433   STHKRLIPAHINGRPPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDAPVKLLDKLLHAMAQ  492

Query  1602  FKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFA  1781
                EQIVV+SQVL  ++NIGYE+I N Q+L LNGK +RN+  LA +++S +D++L F+  
Sbjct  493   SVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVRNLKSLADMVESSEDEFLKFDLE  552

Query  1782  DNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
                +VVL+ + A   ++ IL  + IPS  S DL
Sbjct  553   YQQIVVLKSKTAKEATSDILATHCIPSAMSGDL  585



>ref|XP_002948745.1| hypothetical protein VOLCADRAFT_58517 [Volvox carteri f. nagariensis]
 gb|EFJ50125.1| hypothetical protein VOLCADRAFT_58517 [Volvox carteri f. nagariensis]
Length=494

 Score =   536 bits (1382),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 263/471 (56%), Positives = 337/471 (72%), Gaps = 5/471 (1%)
 Frame = +3

Query  492   LQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVK  671
             L D        +V+C HT P+YSLPWQ++RQY+S+ S F++   ++LTNAHCV+H TQVK
Sbjct  2     LSDVACPARCCQVFCVHTEPNYSLPWQRKRQYSSSSSGFLLPGRRILTNAHCVDHYTQVK  61

Query  672   VKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLG  851
             VKRRG D K+VA VL+ G ECDIALL+VE + FW+G EP+ FG LP+LQDAVTVVGYP+G
Sbjct  62    VKRRGSDVKHVASVLSVGTECDIALLTVEDDSFWEGVEPVVFGQLPQLQDAVTVVGYPIG  121

Query  852   GDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYR  1031
             GDT+SVT GVVSRIEVT+Y HGSSELLGIQIDAA+N GNSGGPAFN+ GEC+G+AFQ  +
Sbjct  122   GDTMSVTSGVVSRIEVTAYMHGSSELLGIQIDAAINSGNSGGPAFNEAGECVGIAFQSLK  181

Query  1032  SDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGV  1208
              ++ ENIGY+IPT V+ HFL DY R+G YTGFP LGV  QKLENP LRA LK+ P  +GV
Sbjct  182   HEDAENIGYIIPTPVIEHFLTDYARHGHYTGFPCLGVEWQKLENPDLRAALKMQPGQKGV  241

Query  1209  LIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAEL  1388
             LIR+VEPTS     L + DV++SFD V +  +GTVPFRS ERI+F YL+S K++ + AEL
Sbjct  242   LIRRVEPTSAVSEVLHQNDVLMSFDGVSIANDGTVPFRSGERISFSYLVSNKYTDEEAEL  301

Query  1389  GIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDS  1556
              ++  G+   V++ L   V LVP+H  G  PSY IVAGLVFT ++ P ++    +E +  
Sbjct  302   VVLHDGQQRTVRVNLRAPVRLVPFHTRGAPPSYFIVAGLVFTTVTVPYLRSEYGKEYDFD  361

Query  1557  IGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAH  1736
               +KLL K  +  A+   EQ+VVLSQVLA+E+N GY+DI+N Q+L LN KRI+N+  L  
Sbjct  362   APVKLLDKMMHGMASHMDEQVVVLSQVLASEINTGYDDITNTQVLALNNKRIKNLADLVA  421

Query  1737  LLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGP  1889
              +D C + YL  +   N  VVLE   A   +  IL  + I  +RS DLM P
Sbjct  422   RVDECTEPYLCLDLEYNQKVVLEMAKAKAATPEILSVHCISQDRSPDLMKP  472



>ref|XP_006446449.1| hypothetical protein CICLE_v10014711mg [Citrus clementina]
 gb|ESR59689.1| hypothetical protein CICLE_v10014711mg [Citrus clementina]
Length=586

 Score =   538 bits (1387),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 263/512 (51%), Positives = 360/512 (70%), Gaps = 5/512 (1%)
 Frame = +3

Query  360   SNVDDRNTNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVKVYCT  539
             S+ D+ N+  N  S      S    R G+G        + E+  ++    ++AVVKV+C 
Sbjct  73    SSNDNHNSANNTNSNVGHVASPERSRHGEGNDITILPPRWESVAVKAVPSMDAVVKVFCV  132

Query  540   HTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLA  719
             HT P++SLPWQ++RQY+S+ S F++G  ++LTNAH VEH TQVKVK+RG DTKY+A VL+
Sbjct  133   HTEPNFSLPWQRKRQYSSSSSGFIVGGRRVLTNAHSVEHHTQVKVKKRGSDTKYLATVLS  192

Query  720   RGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEV  899
              G ECDIALL+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISVT GVVSR+E+
Sbjct  193   IGTECDIALLTVKDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISVTSGVVSRMEI  252

Query  900   TSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVV  1079
              SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  ++D+VENIGYVIPT V+
Sbjct  253   LSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKNDDVENIGYVIPTPVI  312

Query  1080  SHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVEPTSDAHNTLK  1256
              HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR++EPT+   + LK
Sbjct  313   IHFIQDYEKNGAYTGFPILGVEWQKMENPDLRISMGMRPGQKGVRIRRIEPTAPESHVLK  372

Query  1257  EGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLS  1436
               D+I+SFD + +  +GTVPFR  ERI F YL+S+K++GD+A + ++R  E  +  I LS
Sbjct  373   PSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNSEVHEFNIKLS  432

Query  1437  PRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLLTKARYSFANF  1604
                 L+P HI G  PSY I+AG VFT ++ P ++ E     E    +KLL K  ++ A  
Sbjct  433   THKRLIPAHINGRPPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDAPVKLLDKLLHAMAQS  492

Query  1605  KGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFAD  1784
               EQIVV+SQVL  ++NIGYE+I N Q+L LNGK ++N+  LA +++S +D++L F+   
Sbjct  493   VDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVQNLKSLADMVESSEDEFLKFDLEY  552

Query  1785  NFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
               +VVL+ + A   ++ IL  + IPS  S DL
Sbjct  553   QQIVVLKTKTAKEATSDILATHCIPSAMSGDL  584



>ref|XP_002968921.1| hypothetical protein SELMODRAFT_90340 [Selaginella moellendorffii]
 gb|EFJ30037.1| hypothetical protein SELMODRAFT_90340 [Selaginella moellendorffii]
Length=558

 Score =   536 bits (1381),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 254/483 (53%), Positives = 348/483 (72%), Gaps = 7/483 (1%)
 Frame = +3

Query  447   GVQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGK  626
              V  D  E   E   + D  FL+AVVKV+C HT P++SLPWQ++RQ+++  S F+IG  +
Sbjct  76    AVVLDDAEFGAE--EVDDLPFLDAVVKVFCIHTEPNFSLPWQRKRQFSTNSSGFIIGGNR  133

Query  627   LLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHL  806
             +LTNAH VEH TQVKVKRRG D K+VA VLA G ECDIA+L++  + FW+G  P++FG L
Sbjct  134   VLTNAHSVEHHTQVKVKRRGSDIKFVAAVLAIGTECDIAMLTINDDSFWRGVTPVEFGAL  193

Query  807   PRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAF  986
             PRLQD +TVVGYP+GGDTISVT GVVSRIE+TSY HG+SELLG+QIDAA+N GNSGGP+F
Sbjct  194   PRLQDPITVVGYPIGGDTISVTSGVVSRIEITSYVHGASELLGVQIDAAINAGNSGGPSF  253

Query  987   NDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENP  1166
             ND G+CIG+AFQ  + ++ ENIGYVIPT V+SHF+ DYER+G YTGFP LG+  Q++ENP
Sbjct  254   NDRGQCIGIAFQSLKHEDCENIGYVIPTPVISHFIMDYERHGHYTGFPVLGIEWQRMENP  313

Query  1167  ALRACLKVPSNE-GVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAF  1343
              LR  + + +N+ GV IR+VEPT+ A   L+  D+++SFD V +  +GTVPFRS ERI F
Sbjct  314   DLRRAVGMKANQKGVRIRRVEPTAPAARHLRSSDILLSFDGVDIANDGTVPFRSGERIGF  373

Query  1344  RYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLS  1523
              YL+S+K++G  A + ++R+G+ ++  + ++    LVP H +G  PSY IVAG+VF  +S
Sbjct  374   TYLVSQKYTGQRARVRVLRSGQIIENAVEVTIPKRLVPAHNKGRPPSYYIVAGIVFAAVS  433

Query  1524  EPLIQEE----CEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQIL  1691
              P ++ E     +    +KLL K  ++FA  + EQ+VV+SQVLA + NIGYEDI N QI+
Sbjct  434   VPYLRSEYGKDYDYDAPVKLLDKLMHNFAQTEDEQLVVISQVLAADANIGYEDIVNTQII  493

Query  1692  KLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERS  1871
               NG  +RN+ HLAH++D+C D ++ F+     ++VL+ + A + +  IL  + IPS  S
Sbjct  494   AFNGTAVRNLKHLAHMVDNCNDGFMRFDLEYQQMIVLDAQVAKSATPEILSMHCIPSAMS  553

Query  1872  SDL  1880
              DL
Sbjct  554   DDL  556



>ref|XP_002989968.1| hypothetical protein SELMODRAFT_130891 [Selaginella moellendorffii]
 gb|EFJ08981.1| hypothetical protein SELMODRAFT_130891 [Selaginella moellendorffii]
Length=558

 Score =   535 bits (1379),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 254/482 (53%), Positives = 348/482 (72%), Gaps = 7/482 (1%)
 Frame = +3

Query  450   VQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKL  629
             V  D  E   E   + D  FL+AVVKV+C HT P++SLPWQ++RQ+++  S F+IG  ++
Sbjct  77    VVLDDAEFGAE--EVDDLPFLDAVVKVFCIHTEPNFSLPWQRKRQFSTNSSGFIIGGNRV  134

Query  630   LTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLP  809
             LTNAH VEH TQVKVKRRG D K+VA VLA G ECDIA+L++  + FW+G  P++FG LP
Sbjct  135   LTNAHSVEHHTQVKVKRRGSDIKFVAAVLAIGTECDIAMLTINDDSFWRGVTPVEFGALP  194

Query  810   RLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFN  989
             RLQD +TVVGYP+GGDTISVT GVVSRIE+TSY HG+SELLG+QIDAA+N GNSGGP+FN
Sbjct  195   RLQDPITVVGYPIGGDTISVTSGVVSRIEITSYVHGASELLGVQIDAAINAGNSGGPSFN  254

Query  990   DDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPA  1169
             D G+CIG+AFQ  + ++ ENIGYVIPT V+SHF+ DYER+G YTGFP LG+  Q++ENP 
Sbjct  255   DRGQCIGIAFQSLKHEDCENIGYVIPTPVISHFIMDYERHGHYTGFPVLGIEWQRMENPD  314

Query  1170  LRACLKVPSNE-GVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFR  1346
             LR  + + +N+ GV IR+VEPT+ A   L+  D+++SFD V +  +GTVPFRS ERI F 
Sbjct  315   LRRAVGMKANQKGVRIRRVEPTAPAARHLRSSDILLSFDGVDIANDGTVPFRSGERIGFT  374

Query  1347  YLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSE  1526
             YL+S+K++G  A + ++R+G+ ++  + ++    LVP H +G  PSY IVAG+VF  +S 
Sbjct  375   YLVSQKYTGQRARVRVLRSGQIIENAVEVTIPKRLVPAHNKGRPPSYYIVAGIVFAAVSV  434

Query  1527  PLIQEE----CEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILK  1694
             P ++ E     +    +KLL K  ++FA  + EQ+VV+SQVLA + NIGYEDI N QI+ 
Sbjct  435   PYLRSEYGKDYDYDAPVKLLDKLMHNFAQTEDEQLVVISQVLAADANIGYEDIVNTQIIA  494

Query  1695  LNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSS  1874
              NG  +RN+ HLAH++D+C D ++ F+     ++VL+ + A + +  IL  + IPS  S 
Sbjct  495   FNGTAVRNLKHLAHMVDNCNDGFMRFDLEYQQMIVLDAQVAKSATPEILSMHCIPSGMSD  554

Query  1875  DL  1880
             DL
Sbjct  555   DL  556



>gb|KDP31134.1| hypothetical protein JCGZ_11510 [Jatropha curcas]
Length=572

 Score =   533 bits (1374),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 253/462 (55%), Positives = 336/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  109   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGY  168

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  169   DTKYLATVLAIGTECDIALLTVNDDEFWEGVSPVEFGELPALQDAVTVVGYPIGGDTISV  228

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  229   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGQCVGIAFQSLKHEDVEN  288

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V++HF+QDYE+NG YTGFP LG+  QK+ENP LR  +++ P  +GV IR+++
Sbjct  289   IGYVIPTPVITHFIQDYEKNGAYTGFPFLGIEWQKMENPDLRMAMRMKPDQKGVRIRRID  348

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD A + ++R  
Sbjct  349   PTAPESKVLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAAISVLRNS  408

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E +   I LS    LVP H++G  PSY I+AG VF+ +S P ++ E     E    +KLL
Sbjct  409   ETLNFDIKLSTHRRLVPPHVKGRPPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEAPVKLL  468

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S      EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+  L  +++SC 
Sbjct  469   DKLLHSMPQSPDEQLVVISQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLVTMVESCT  528

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L FE     +VVL  + A   +  +L  + IPS  S DL
Sbjct  529   DEFLKFELEYEQIVVLRTKTAKAATVDVLTTHCIPSAMSDDL  570



>ref|XP_010111735.1| Protease Do-like 9 [Morus notabilis]
 gb|EXC31597.1| Protease Do-like 9 [Morus notabilis]
Length=590

 Score =   533 bits (1374),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 255/462 (55%), Positives = 341/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  127   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  186

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  187   DTKYLATVLAIGTECDIAMLTVSDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  246

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  247   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVEN  306

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF++DYE+NG YTGFP LGV  QK+ENP LR+ + + P  +GV IR++E
Sbjct  307   IGYVIPTPVIMHFIKDYEKNGAYTGFPILGVEWQKMENPDLRSSIGMSPDQKGVRIRRIE  366

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   N L+  DVI+SFD + +  +GTVPFR  ERI F YL+S+K++GDTA + ++R  
Sbjct  367   PTAPESNVLRPSDVILSFDGINIANDGTVPFRHGERIGFSYLVSQKYTGDTALVKVLRNS  426

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             E ++  I LS    L+P HI+G  PSY I+AG VF+ +S P ++    +E E    +KLL
Sbjct  427   EILEYNIKLSTHKRLIPAHIKGRPPSYYIIAGFVFSAVSVPYLRSEYGKEYEFDAPVKLL  486

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ VV+SQVL  ++NIGYEDI N Q+L  NGK +RN+  LA +++SC 
Sbjct  487   DKHLHAMAQSVDEQAVVVSQVLVADINIGYEDIVNTQVLAFNGKPVRNLKTLASMVESCN  546

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL F    + +VVL+ + A   +  IL  + IPS  S DL
Sbjct  547   DEYLKFNLEYDQIVVLQTKTAREATLDILATHCIPSAMSDDL  588



>ref|XP_006376843.1| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
 ref|XP_002318029.2| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
 gb|ERP54640.1| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
 gb|EEE96249.2| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
Length=559

 Score =   528 bits (1360),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 339/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P+ SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  96    MDAVVKVFCVHTEPNLSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGS  155

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  156   DTKYLATVLAIGTECDIALLTVNDDEFWEGVSPVEFGELPSLQDAVTVVGYPIGGDTISV  215

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SYAHGS+ELLG+QIDAA+N GNSGGPAFND GEC+G+AFQ  + ++ EN
Sbjct  216   TSGVVSRIEILSYAHGSTELLGLQIDAAINSGNSGGPAFNDKGECVGIAFQSLKHEDAEN  275

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LG+  QK+ENP +R  + + S++ GV IR+++
Sbjct  276   IGYVIPTPVIKHFIQDYEKNGAYTGFPFLGIEWQKMENPDMRVAMGMKSDQKGVRIRRID  335

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD A + ++R  
Sbjct  336   PTAPESEVLQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAVIKVLRNS  395

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             + ++  I LS    L+P H++G  PSY I+AG VFT +S P ++    +E E    +KLL
Sbjct  396   KTLEFDIKLSTHRRLIPPHVKGKPPSYYIIAGFVFTTVSVPYLRSEYGKEYEFEAPVKLL  455

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S      EQIVV+SQVL  ++NIGYEDI N Q++  NGK ++N+  LA+++++  
Sbjct  456   DKLLHSMPQSPDEQIVVVSQVLVADINIGYEDIVNTQVVAFNGKPVKNLKSLANMVENFD  515

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+   + +VVL  + A   +  IL  +GIPS  S DL
Sbjct  516   DEFLKFDLEYDQIVVLRTKTAKEATVDILTTHGIPSAISDDL  557



>ref|XP_006339987.1| PREDICTED: protease Do-like 9-like [Solanum tuberosum]
Length=581

 Score =   529 bits (1362),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 272/572 (48%), Positives = 374/572 (65%), Gaps = 19/572 (3%)
 Frame = +3

Query  201   SRPPSRFFVPKSATQSQNQ-----EHNQRKKPPARVSHTEREAVTQKCTRRSKGERFFSN  365
             S PPS   +P S +   +       + +   PP   SH  R    +K     +  +    
Sbjct  15    SDPPSTPDIPTSTSPHIDDIVFSVSNVELIDPPPSTSHRPRRGRPRKTPLLPENSKL---  71

Query  366   VDDRNTNKNGRSQSTSFKSFGVQRKGKGV-QFDSKELQVETGNLQDANFLNAVVKVYCTH  542
                    KNG++   +  +  +  K  GV    S E  +     +    ++AVVKV+C H
Sbjct  72    ----TNPKNGKTLKVTSPTRRLIDKPNGVPSLISSESTITNAAARVVPAMDAVVKVFCVH  127

Query  543   TAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLAR  722
             T P+YSLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG DTK+VA VLA 
Sbjct  128   TEPNYSLPWQRKRQYSSSSSGFVIKGRRVLTNAHSVEHYTQVKLKKRGSDTKFVATVLAI  187

Query  723   GVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVT  902
             G ECDIALL+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISVT GVVSRIE+ 
Sbjct  188   GTECDIALLTVDDDEFWEGVSPVEFGDLPTLQDAVTVVGYPIGGDTISVTSGVVSRIEIL  247

Query  903   SYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVS  1082
             SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++VENIGYVIPT V++
Sbjct  248   SYVHGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDVENIGYVIPTPVIT  307

Query  1083  HFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVEPTSDAHNTLKE  1259
             HF++DYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR+++PT+     L  
Sbjct  308   HFIKDYEKNGAYTGFPILGVEWQKMENPDLRLSMGMKPYQKGVRIRRIDPTAPESMMLMP  367

Query  1260  GDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRA-GEFMKVQIVLS  1436
              DVI+SFD V +  +GTVPFR  ERI F YL+S+K+SGD+A + ++R   E +   I L+
Sbjct  368   SDVILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYSGDSAAVKVLRRNSEILNFIIKLA  427

Query  1437  PRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLLTKARYSFANF  1604
              ++ L+P H +G  PSY I+AG VFT +S P ++ E     E    +KLL K  + F   
Sbjct  428   TQMRLIPAHNKGRPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLLDKLLHEFRQS  487

Query  1605  KGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFAD  1784
               EQIVV+SQVL  ++NIGYE+I N Q+L  NG+R++N+  LA +++ C D++L F+   
Sbjct  488   PDEQIVVVSQVLVADINIGYEEIVNTQVLAFNGERVKNLKSLASMVEKCSDEFLKFDLEY  547

Query  1785  NFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
               +VVL+ + A + ++ IL  + IPS  S DL
Sbjct  548   QQVVVLQTKTAKSATSDILTTHCIPSAMSEDL  579



>ref|XP_011071819.1| PREDICTED: protease Do-like 9 isoform X2 [Sesamum indicum]
Length=492

 Score =   525 bits (1352),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 253/462 (55%), Positives = 332/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  29    MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIKGRRVLTNAHSVEHYTQVKLKKRGS  88

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKYVA VLA G ECDIALL+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  89    DTKYVATVLAIGTECDIALLTVDDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  148

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++VEN
Sbjct  149   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDVEN  208

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++G YTGFP LGV  QK+ENP LR  + + P  +GV IR+++
Sbjct  209   IGYVIPTPVIMHFIQDYEKHGTYTGFPILGVEWQKMENPDLRLSMGMKPDQKGVRIRRID  268

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++GD A + ++R  
Sbjct  269   PTAPEFKVLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDNAAIEVLRNS  328

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E +K  + L     L+P H +G  PSY IVAG VFT +S P ++ E     E    +KLL
Sbjct  329   ETLKFNVKLGTHRRLIPAHNKGRPPSYYIVAGFVFTTVSVPYLRSEYGKDYEYEAPVKLL  388

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +       EQIVV+SQVL  ++NIGYEDI N Q+   NGK ++N+  LAH++++C 
Sbjct  389   DKLLHEMPQSPEEQIVVVSQVLVADINIGYEDIVNTQVHAFNGKPVKNLKSLAHMVENCD  448

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL F+     +VVL  + A   +  IL  + IPS  S DL
Sbjct  449   DEYLKFDLEYQQIVVLRTKNAKAATLDILSTHCIPSAMSDDL  490



>ref|XP_011015595.1| PREDICTED: protease Do-like 9 [Populus euphratica]
 ref|XP_011015596.1| PREDICTED: protease Do-like 9 [Populus euphratica]
 ref|XP_011015597.1| PREDICTED: protease Do-like 9 [Populus euphratica]
Length=559

 Score =   527 bits (1357),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 250/462 (54%), Positives = 339/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P+ SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  96    MDAVVKVFCVHTEPNLSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGS  155

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  ++FW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  156   DTKYLATVLAIGTECDIALLTVNDDDFWEGVSPVEFGELPSLQDAVTVVGYPIGGDTISV  215

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SYAHGS+ELLG+QIDAA+N GNSGGPAFND GEC+G+AFQ  + ++ EN
Sbjct  216   TSGVVSRIEILSYAHGSTELLGLQIDAAINSGNSGGPAFNDKGECVGIAFQSLKHEDAEN  275

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LG+  QK+ENP +R  + + S++ GV IR+++
Sbjct  276   IGYVIPTPVIKHFIQDYEKNGAYTGFPFLGIEWQKMENPDMRVAMGMKSDQKGVRIRRID  335

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD A + ++R  
Sbjct  336   PTAPESEALQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAVIKVLRNS  395

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             + ++  I LS    L+P H++G  PSY I+AG VFT +S P ++    +E E    +KLL
Sbjct  396   KTLEFDIKLSTHRRLIPPHVKGKPPSYYIIAGFVFTTVSVPYLRSEYGKEYEFEAPVKLL  455

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S      EQIVV+SQVL  ++NIGYEDI N Q++  NGK ++N+  LA+++++  
Sbjct  456   DKLLHSMPQSPDEQIVVVSQVLVADINIGYEDIVNTQVVAFNGKPVKNLKSLANMVENFD  515

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+   + +VVL  + A   +  IL  +GIPS  S DL
Sbjct  516   DEFLKFDLEYDQIVVLRTKTAKEATVDILTTHGIPSAISDDL  557



>ref|XP_002321577.2| hypothetical protein POPTR_0015s08440g [Populus trichocarpa]
 gb|EEF05704.2| hypothetical protein POPTR_0015s08440g [Populus trichocarpa]
Length=556

 Score =   525 bits (1352),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 337/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  93    MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIRGRRVLTNAHSVEHYTQVKLKKRGS  152

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  153   DTKYLATVLAIGTECDIALLTVNDDEFWEGVSPVEFGELPALQDAVTVVGYPIGGDTISV  212

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND GEC+G+AFQ  + ++ EN
Sbjct  213   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGECVGIAFQSLKHEDAEN  272

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LG+  QK+ENP LR  + + P  +GV IR+V+
Sbjct  273   IGYVIPTPVIKHFIQDYEKNGAYTGFPFLGIEWQKMENPDLRMAMGMKPDQKGVRIRRVD  332

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD A + ++R  
Sbjct  333   PTALESEVLQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIKVLRNS  392

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             + ++  I LS    L+P H++G  PSY I+AG VFT +S P ++    +E E    +KLL
Sbjct  393   KTLEFVIKLSTHRRLIPPHVKGKPPSYYIIAGFVFTTVSVPYLRSEYGKEYEFEAPVKLL  452

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S      EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+  LA+++++C 
Sbjct  453   DKLLHSMPQSPDEQMVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLANMVENCD  512

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+   + +VVL  + A   +  IL  + IPS  S DL
Sbjct  513   DEFLKFDLEYDQIVVLRMKTAKEATVDILTTHCIPSAISDDL  554



>ref|XP_002982828.1| hypothetical protein SELMODRAFT_116969 [Selaginella moellendorffii]
 gb|EFJ16073.1| hypothetical protein SELMODRAFT_116969 [Selaginella moellendorffii]
Length=494

 Score =   522 bits (1345),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 258/467 (55%), Positives = 347/467 (74%), Gaps = 5/467 (1%)
 Frame = +3

Query  495   QDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKV  674
             +DA F++ VVKV+C HT P++SLPWQ++RQ++++ S F+I   +LLTNAH VEH TQVK+
Sbjct  23    KDAPFMDNVVKVFCVHTEPNFSLPWQRKRQFSTSSSGFVIEGKRLLTNAHSVEHHTQVKI  82

Query  675   KRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGG  854
             K+RG DTKY+A VLA G ECDIA+LSV  +EFW+G  P+ FG LPRLQDAVTVVGYP+GG
Sbjct  83    KKRGSDTKYLANVLAIGTECDIAMLSVNDDEFWEGITPVTFGSLPRLQDAVTVVGYPIGG  142

Query  855   DTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRS  1034
             DTISVT GVVSRIEVTSY HG++EL+G+QIDAA+N GNSGGPAFN  GEC+G+AFQ  R 
Sbjct  143   DTISVTSGVVSRIEVTSYVHGATELIGVQIDAAINSGNSGGPAFNHRGECVGIAFQSLRH  202

Query  1035  DEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVL  1211
             ++VENIGYVIPT V+ HF+ DY+R+G YTGFP LGV  QK+ENP LR  + + P+ +GV 
Sbjct  203   EDVENIGYVIPTPVIEHFINDYKRSGDYTGFPILGVEWQKMENPDLRKAVGMAPNQKGVR  262

Query  1212  IRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELG  1391
             IR+VEPT+ A   L+  D+++SFDDV +  +GTVPFR  ERI+F YL+S+K++G++A++ 
Sbjct  263   IRRVEPTAPAAQYLRHSDILLSFDDVAIANDGTVPFRLGERISFSYLVSQKYTGESAKVK  322

Query  1392  IIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSI  1559
             I+R G   +  + L     LVP HI+G  PSY IVAG+VF  ++ P ++ E     +   
Sbjct  323   ILRDGSVNEYNLELRYHKRLVPAHIKGIPPSYYIVAGVVFAAITVPYLRSEYGKDYDYDA  382

Query  1560  GLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHL  1739
              +KLL K  +S A  + EQ+VV+SQVL  +VNIGYEDI N Q+L  NG  + N+ HLA++
Sbjct  383   PVKLLNKLLHSMAKTEDEQLVVVSQVLVADVNIGYEDIVNTQVLAFNGTSVTNLKHLANM  442

Query  1740  LDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             ++SCKD++L F+     ++VLE + A   + +IL  + IPS  SSDL
Sbjct  443   VESCKDEFLKFDLDHQQVLVLETQRAKAATPAILATHCIPSPMSSDL  489



>emb|CDP16995.1| unnamed protein product [Coffea canephora]
Length=580

 Score =   525 bits (1352),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 252/462 (55%), Positives = 337/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  117   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVISGRRILTNAHSVEHYTQVKLKKRGS  176

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKYVA VLA G ECDIA+L+VE +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  177   DTKYVATVLAIGTECDIAMLTVEDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  236

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFN+ G C+G+AFQ  + ++VEN
Sbjct  237   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNEKGNCVGIAFQSLKHEDVEN  296

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF++DYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR+++
Sbjct  297   IGYVIPTPVILHFIKDYEKNGAYTGFPILGVEWQKMENPDLRLSMGMKPDQKGVRIRRID  356

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++GD+A + ++R  
Sbjct  357   PTAPESDLLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDSAAIKVLRNS  416

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E +K  I L+    L+P H +G  PSY I+AG VFT +S P ++ E     E    +KLL
Sbjct  417   ETIKFNIKLASHRRLIPAHNKGKPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLL  476

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +       EQIVV+SQVL  ++NIGYEDI N Q+L  NGK ++N+ +LA +++SC 
Sbjct  477   DKLLHEMPKSPDEQIVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKNLASMVESCN  536

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+     +VVL+ + A   +  IL  + IPS  S DL
Sbjct  537   DEFLQFDLEYQQIVVLQTKGAKAATLDILTTHCIPSAMSDDL  578



>ref|XP_010678720.1| PREDICTED: protease Do-like 9 [Beta vulgaris subsp. vulgaris]
Length=566

 Score =   525 bits (1351),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 255/462 (55%), Positives = 332/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  103   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHFTQVKLKKRGS  162

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G EPL+FG LP LQDAVTVVGYP+GGDTISV
Sbjct  163   DTKYLATVLAIGTECDIALLTVNDDEFWEGIEPLEFGELPALQDAVTVVGYPIGGDTISV  222

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  223   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGSCVGIAFQSLKHEDAEN  282

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYERNG YTGFP LGV  QK+ENP LR  + + S++ GV +R+V+
Sbjct  283   IGYVIPTPVILHFIQDYERNGAYTGFPILGVEWQKMENPDLRISMGMKSDQKGVRVRRVD  342

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  DVI+SFD V +  +GTVPFR  ERI F YLIS+K++GD AE+ ++R  
Sbjct  343   PTAPESKVLRPSDVILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDKAEIKVLRDS  402

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
                   I L     LVP H +G  PSY IVAG VFT +S P ++    +E E    +KLL
Sbjct  403   VIQTFSIKLGTHRRLVPAHSKGRPPSYYIVAGFVFTTVSVPYLRSEYGKEYEYDAPVKLL  462

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S    K E++VV+SQVL  ++NIGYE+I N Q++  NG  + N+  LA +++SC 
Sbjct  463   DKLLHSMPQSKDEELVVISQVLVADINIGYEEIVNTQVIAFNGNPVTNLKTLASMVESCN  522

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+++ F    + +VVL  E A   +  IL  + IPS  S DL
Sbjct  523   DEFMKFNLDYDQIVVLRTETAKAATIDILATHCIPSAMSDDL  564



>ref|XP_004252189.1| PREDICTED: protease Do-like 9 [Solanum lycopersicum]
Length=584

 Score =   524 bits (1349),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 252/463 (54%), Positives = 338/463 (73%), Gaps = 6/463 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P+YSLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  120   MDAVVKVFCVHTEPNYSLPWQRKRQYSSSSSGFVIKGRRVLTNAHSVEHYTQVKLKKRGS  179

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTK+VA VLA G ECDIALL+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  180   DTKFVATVLAIGTECDIALLNVDDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  239

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++VEN
Sbjct  240   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDVEN  299

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V++HF++DYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR+++
Sbjct  300   IGYVIPTPVITHFIKDYEKNGAYTGFPILGVEWQKMENPDLRLSMGMKPDQKGVRIRRID  359

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGII-RA  1403
             PT+     L   DVI+SFD V +  +GTVPFR  ERI F YL+S+K+SGD A + ++ R 
Sbjct  360   PTTPESMMLMPSDVILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYSGDYAAVKVLRRN  419

Query  1404  GEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKL  1571
              E +   I L+ ++ L+P H +G  PSY I+AG VFT +S P ++ E     E    +KL
Sbjct  420   SEILNFIIKLATQMRLIPAHNKGRPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEASVKL  479

Query  1572  LTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSC  1751
             L K  + F     EQIVV+SQVL  ++NIGYE+I N Q+L  NG+ ++N+  LA +++ C
Sbjct  480   LDKLLHEFRQSPDEQIVVVSQVLVADINIGYEEIVNTQVLSFNGEPVKNLKSLASMVEKC  539

Query  1752  KDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             KD++L F+     +VVL+ + A + ++ IL  + IPS  S DL
Sbjct  540   KDEFLKFDLEYQQVVVLQTKTAKSATSDILTTHCIPSAMSEDL  582



>ref|XP_011044336.1| PREDICTED: protease Do-like 9 [Populus euphratica]
Length=559

 Score =   523 bits (1346),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 249/462 (54%), Positives = 337/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P+ SLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  96    MDAVVKVFCVHTEPNLSLPWQRKRQYSSSSSGFVIRGRRVLTNAHSVEHYTQVKLKKRGS  155

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  ++FW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  156   DTKYLATVLAIGTECDIALLTVNDDDFWEGVSPVEFGELPSLQDAVTVVGYPIGGDTISV  215

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SYAHGS+ELLG+QIDAA+N GNSGGPAFND GEC+G+AFQ  + ++ EN
Sbjct  216   TSGVVSRIEILSYAHGSTELLGLQIDAAINSGNSGGPAFNDKGECVGIAFQSLKHEDAEN  275

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LG+  QK+ENP +R  + + S++ GV IR+++
Sbjct  276   IGYVIPTPVIKHFIQDYEKNGAYTGFPFLGIEWQKMENPDMRVAMGMKSDQKGVRIRRID  335

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD A + ++R  
Sbjct  336   PTAPESEALQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAVIKVLRNS  395

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             + ++  I LS    L+P H++G  PSY I+AG VFT +S P ++    +E E    +KLL
Sbjct  396   KTLEFDIKLSTHRRLIPPHVKGKPPSYYIIAGFVFTTVSVPYLRSEYGKEYEFEAPVKLL  455

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S      EQIVV+SQVL  ++NIGYEDI N Q++  NGK ++N+  LA+++++  
Sbjct  456   DKLLHSMPQSPDEQIVVVSQVLVADINIGYEDIVNTQVVAFNGKPVKNLKSLANMVENFD  515

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+     +VVL  + A   +  IL  +GIPS  S DL
Sbjct  516   DEFLKFDLEYEQIVVLRTKTAKEATVDILTTHGIPSAISDDL  557



>ref|XP_009794183.1| PREDICTED: protease Do-like 9 [Nicotiana sylvestris]
Length=575

 Score =   522 bits (1344),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 252/463 (54%), Positives = 337/463 (73%), Gaps = 6/463 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P+YSLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  111   MDAVVKVFCVHTEPNYSLPWQRKRQYSSSSSGFVIKGRRVLTNAHSVEHYTQVKLKKRGS  170

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKYVA VLA G ECDIALL+V+ +EFW+G   ++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  171   DTKYVATVLAIGTECDIALLTVDDDEFWEGVSAVEFGDLPALQDAVTVVGYPIGGDTISV  230

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++VEN
Sbjct  231   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDVEN  290

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LG+  QK+ENP LR  + + P  +GV IR+++
Sbjct  291   IGYVIPTPVIMHFIQDYEKNGAYTGFPILGIEWQKMENPDLRLSMGMKPDQKGVRIRRID  350

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGII-RA  1403
             PT+     L   DV++SFD V +  +GTVPFR  ERI F YL+S+K+SGD+A + ++ R 
Sbjct  351   PTAPESMLLMPSDVLLSFDGVDIANDGTVPFRHGERIGFSYLVSQKYSGDSAAVKVLRRN  410

Query  1404  GEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKL  1571
              E +  +I L+ ++ LVP H +G  PSY I+AG VFT +S P ++ E     E    +KL
Sbjct  411   SEILNFKIKLATQMRLVPAHNKGRPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKL  470

Query  1572  LTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSC  1751
             L K  + F     EQIVV+SQVL  ++NIGYE+I N Q+L  NGK ++N+  LA ++++C
Sbjct  471   LDKLLHEFRQSPDEQIVVVSQVLVADINIGYEEIVNTQVLAFNGKPVKNLKSLARMVENC  530

Query  1752  KDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
              D++L  +     +VVL+ E A + ++ IL  + IPS  S DL
Sbjct  531   NDEFLKLDLEYQQVVVLQTETAKSATSDILTTHCIPSAMSEDL  573



>ref|XP_009379979.1| PREDICTED: protease Do-like 9 [Musa acuminata subsp. malaccensis]
Length=578

 Score =   522 bits (1344),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 247/462 (53%), Positives = 342/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  115   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHYTQVKLKKRGS  174

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKYVA VLA G ECDIA+L+V+++EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  175   DTKYVATVLAIGTECDIAMLTVDNDEFWEGVSPVEFGSLPALQDAVTVVGYPIGGDTISV  234

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  235   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVEN  294

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+ DYE++G+YTGFP LG+  QK+ENP LR  +++ P  +GV +R++E
Sbjct  295   IGYVIPTPVIMHFINDYEKSGEYTGFPMLGIEWQKMENPDLRKAMEMKPDQKGVRVRRIE  354

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT      LK  D+I+SFD V +  +GTVPFR  ERIAF YL+S+K++G+ A + ++R  
Sbjct  355   PTGPEFEFLKSSDIILSFDGVDIANDGTVPFRHGERIAFSYLVSQKYTGENALVKVLRDS  414

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  +  I L+    L+P HI+G  PSY I+AG VFT +S P ++ E     E    +KLL
Sbjct  415   KVYEFNIKLATHKRLIPAHIKGKPPSYYIIAGFVFTAISVPYLRSEYGKDYEYDAPVKLL  474

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A+   EQ+VV+SQVL  +VNIGYEDI N Q++  NGK ++N+  LA+++++C 
Sbjct  475   DKLLHTMAHSHDEQLVVISQVLVADVNIGYEDIVNTQVMAFNGKPVKNLRTLANMVENCS  534

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             +++L F+     +VVL+ + A   +  IL  + IPS  S DL
Sbjct  535   EEFLKFDLEYQQIVVLQTKTAKAATPDILATHCIPSAVSEDL  576



>ref|XP_002981859.1| hypothetical protein SELMODRAFT_154815 [Selaginella moellendorffii]
 gb|EFJ16952.1| hypothetical protein SELMODRAFT_154815 [Selaginella moellendorffii]
Length=466

 Score =   517 bits (1332),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 256/462 (55%), Positives = 342/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++ VVKV+C HT P++SLPWQ++RQ++++ S F+I   +LLTNAH VEH TQVK+K+RG 
Sbjct  1     MDNVVKVFCVHTEPNFSLPWQRKRQFSTSSSGFVIEGKRLLTNAHSVEHHTQVKIKKRGS  60

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+LSV  EEFW+G  P+ FG LPRLQDAVTVVGYP+GGDTISV
Sbjct  61    DTKYLANVLAIGTECDIAMLSVNDEEFWEGITPVTFGSLPRLQDAVTVVGYPIGGDTISV  120

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIEVTSY HG++EL+G+QIDAA+N GNSGGPAFN  GEC+G+AFQ  R ++VEN
Sbjct  121   TSGVVSRIEVTSYVHGATELIGVQIDAAINSGNSGGPAFNHRGECVGIAFQSLRHEDVEN  180

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+ DY+R+G YTGFP LGV  QK+ENP LR  + + P+ +GV IR+VE
Sbjct  181   IGYVIPTPVIEHFINDYKRSGDYTGFPILGVEWQKMENPDLRKAVGMAPNQKGVRIRRVE  240

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+ A   L+  D+++SFDDV +  +GTVPFR  ERI+F YL+S+K++G+ A++ I+R G
Sbjct  241   PTAPAAQYLRHSDILLSFDDVAIANDGTVPFRLGERISFSYLVSQKYTGELAKVKILRDG  300

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
                +  + L     LVP HI+G  PSY IVAG+VF  ++ P ++ E     +    +KLL
Sbjct  301   NVNEYNLELRYHKRLVPAHIKGITPSYYIVAGVVFAAITVPYLRSEYGKDYDYDAPVKLL  360

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S A  + EQ+VV+SQVL  +VNIGYEDI N Q+L  NG  + N+ HLA++++SCK
Sbjct  361   NKLLHSMAKTQDEQLVVVSQVLVADVNIGYEDIVNTQVLAFNGTSVTNLKHLANMVESCK  420

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+     ++VLE + A   + +IL  + IPS  SSDL
Sbjct  421   DEFLKFDLDHQQVLVLETQRAKAATPAILATHCIPSPMSSDL  462



>ref|XP_009609751.1| PREDICTED: protease Do-like 9 [Nicotiana tomentosiformis]
Length=577

 Score =   521 bits (1342),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 253/463 (55%), Positives = 337/463 (73%), Gaps = 6/463 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P+YSLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  113   MDAVVKVFCVHTEPNYSLPWQRKRQYSSSSSGFVIKGRRVLTNAHSVEHYTQVKLKKRGS  172

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKYVA VLA G ECDIALL+V+ +EFW+G   ++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  173   DTKYVATVLAIGTECDIALLTVDDDEFWEGVSAVEFGDLPALQDAVTVVGYPIGGDTISV  232

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++VEN
Sbjct  233   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDVEN  292

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR+++
Sbjct  293   IGYVIPTPVIMHFIQDYEKNGAYTGFPILGVEWQKMENPDLRLSMGMKPDQKGVRIRRID  352

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGII-RA  1403
             PT+     L   DV++SFD V +  +GTVPFR  ERI F YL+S+K+SGD+A + ++ R 
Sbjct  353   PTAPESMLLMPSDVLLSFDGVDIANDGTVPFRHGERIGFSYLVSQKYSGDSAAVKVLRRN  412

Query  1404  GEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKL  1571
              E +  +I L+ ++ LVP H +G  PSY IVAG VFT +S P ++ E     E    +KL
Sbjct  413   SEILNFKIKLATQMRLVPAHNKGRPPSYYIVAGFVFTTVSVPYLRSEYGKDYEYEAPVKL  472

Query  1572  LTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSC  1751
             L K  + F     EQIVV+SQVL  ++NIGYE+I N Q+L  NGK ++N+  LA ++++C
Sbjct  473   LDKLLHEFRQSPDEQIVVVSQVLVADINIGYEEIVNTQVLAFNGKPVKNLKSLASMVENC  532

Query  1752  KDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
              D++L  +     +VVL+ + A + ++ IL  + IPS  S DL
Sbjct  533   NDEFLKLDLEYQQVVVLQTKTAKSATSDILTTHCIPSAMSEDL  575



>ref|XP_003608950.1| hypothetical protein MTR_4g106730 [Medicago truncatula]
 gb|AES91147.1| serine endopeptidase degp2 protein, putative [Medicago truncatula]
Length=590

 Score =   521 bits (1341),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 249/462 (54%), Positives = 333/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             +++VVKV+C HT P++SLPWQ++RQY+S+ + F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  127   MDSVVKVFCVHTEPNFSLPWQRKRQYSSSSTGFVISGKRVLTNAHSVEHYTQVKLKKRGS  186

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFW+G  P+ FG LP LQDAVTVVGYP+GGDTISV
Sbjct  187   DTKYLATVLAIGTECDIAMLTVDDDEFWQGMSPVDFGELPTLQDAVTVVGYPIGGDTISV  246

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFN  G C+G+AFQ  + ++VEN
Sbjct  247   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNGKGTCVGIAFQSLKHEDVEN  306

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + S++ GV IR+++
Sbjct  307   IGYVIPTPVIMHFIQDYEKNGGYTGFPILGVEWQKMENPDLRMAMGMKSDQKGVRIRRID  366

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PTS   N LK  DVI+SFD V +  +GTVPFR  ERI F YLIS+K++GD A + ++R+ 
Sbjct  367   PTSPESNVLKPSDVILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDDAAIKVLRSS  426

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
               +K  I L     L+P H +G  PSY I+AG VF+ +S P ++ E     E    +K+L
Sbjct  427   NVLKFNIKLDGHRRLIPAHSKGKPPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEAPVKIL  486

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  Y+      EQ+VV+SQVL  ++NIGYE+I N Q++  NGK ++N+  LA +++SC 
Sbjct  487   DKLLYAMPQSPDEQLVVISQVLVADINIGYEEIVNTQVVGFNGKPVKNLKSLAAMVESCD  546

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL F+     +VVL  + A   +  IL  + IPS  S DL
Sbjct  547   DEYLKFDLDYEQIVVLRTKTAKAATLDILATHCIPSAMSDDL  588



>ref|XP_009348028.1| PREDICTED: protease Do-like 9 [Pyrus x bretschneideri]
Length=563

 Score =   519 bits (1337),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 243/460 (53%), Positives = 334/460 (73%), Gaps = 3/460 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HTAP++SLPWQ+++QY+S+ S F+IG  ++LTNAH V+H TQVK+K+RG 
Sbjct  74    MDAVVKVFCVHTAPNFSLPWQRKKQYSSSSSGFVIGGRRILTNAHSVDHHTQVKLKKRGS  133

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  134   DTKYLATVLAIGAECDIAMLTVSDDEFWEGISPVEFGDLPALQDAVTVVGYPIGGDTISV  193

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+  Y HGS+ELLG+QIDAA+N GNSGGPAFND GEC+G+AFQ  + +  EN
Sbjct  194   TSGVVSRMEILPYVHGSTELLGMQIDAAINSGNSGGPAFNDKGECVGIAFQSLKHEAAEN  253

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIP  V+ HF++DYE+NG YTGFP LG+  QK+ENP LR  + + P  +G+ IR++E
Sbjct  254   IGYVIPVPVIMHFIRDYEKNGAYTGFPILGIEWQKMENPDLRMSMGMRPDQKGIRIRRLE  313

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  DVI+SFD V +  +GTVPF+  ERI F YL+S+K+ GD A + ++R  
Sbjct  314   PTAPESQLLKPSDVILSFDGVNIANDGTVPFKHGERIGFSYLVSQKYLGDNALIKVLRNF  373

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED--SIGLKLLTK  1580
             E ++  I L+   +L+P HIEG  PS+ I+AG VFT +S P ++ E  +   + +KLL K
Sbjct  374   ETLEFNIKLAKHKELIPSHIEGKPPSFYIIAGFVFTAVSVPYLRSEFGNIFDVPIKLLDK  433

Query  1581  ARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDK  1760
               ++ A    EQ++V+SQVL  ++NIGYEDI N Q+L  NG  ++N+ +L  ++++C D+
Sbjct  434   HLHAMARSIDEQLIVVSQVLVADINIGYEDIVNNQVLTFNGMPVKNLKNLVSMVENCDDE  493

Query  1761  YLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             YL F    N +VVL+ + A   +  IL  + I S  S DL
Sbjct  494   YLKFGLECNQMVVLQTKTAKAATLDILTTHCISSSMSDDL  533



>ref|XP_007140930.1| hypothetical protein PHAVU_008G153200g [Phaseolus vulgaris]
 gb|ESW12924.1| hypothetical protein PHAVU_008G153200g [Phaseolus vulgaris]
Length=568

 Score =   518 bits (1334),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 340/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F++G  ++LTNAH VEH TQVK+K+RG 
Sbjct  105   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFLVGGRRVLTNAHSVEHHTQVKLKKRGS  164

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG +P LQDAVTVVGYP+GGDTISV
Sbjct  165   DTKYLATVLAIGTECDIAMLTVSDDEFWEGVSPVEFGDMPALQDAVTVVGYPIGGDTISV  224

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPA ND G+C+G+AFQ  + ++VEN
Sbjct  225   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPALNDKGKCVGIAFQSLKHEDVEN  284

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR++E
Sbjct  285   IGYVIPTPVIQHFIQDYEKNGAYTGFPILGVEWQKMENPDLRMSMGMGPDKKGVRIRRIE  344

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++GD A++ ++R  
Sbjct  345   PTAPESHVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLVSQKYTGDRAQVKVLRDS  404

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + ++  I L+    LVP HI+G  PSY I+AG VFT +S P ++ E     E    +KLL
Sbjct  405   QILEFNIKLATHKRLVPAHIKGRPPSYYIIAGFVFTAVSVPYLRSEYGKDYEFDAPVKLL  464

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S A    EQ+VV+SQVL +++NIGYE+I N Q+L  NGK ++N+ +LA +++SC 
Sbjct  465   NKHLHSMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGKPVKNLKNLASMVESCD  524

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL F+     +VVL+   A   +  IL  + IPS  S DL
Sbjct  525   DEYLKFDLEYQQIVVLKASTAKAATLDILTTHCIPSAMSEDL  566



>ref|XP_010254385.1| PREDICTED: protease Do-like 9 [Nelumbo nucifera]
Length=577

 Score =   518 bits (1334),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 245/464 (53%), Positives = 338/464 (73%), Gaps = 9/464 (2%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVV+V+C HT P++SLPWQ++RQ++S+ S F+I   ++LTNAH V++ TQVK+K+RG 
Sbjct  114   MDAVVRVFCVHTKPNFSLPWQRKRQFSSSSSGFVIAGRRILTNAHSVDYHTQVKLKKRGS  173

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  174   DTKYLATVLAIGTECDIAMLTVKDDEFWEGISPVEFGSLPALQDAVTVVGYPIGGDTISV  233

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T G+VSRIE+ SY HG+SELLG+Q DAA+N GNSGGPAFND G C+G+AFQ  + +  +N
Sbjct  234   TSGIVSRIEMLSYVHGASELLGLQTDAAINSGNSGGPAFNDKGHCVGIAFQSLKHEIADN  293

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT VV HF+QDYERNG+YTGFP+LGV LQK+ENP LR  + + S++ GV +R++E
Sbjct  294   IGYVIPTPVVMHFIQDYERNGEYTGFPTLGVDLQKMENPDLRMAMGMASDQKGVRVRRIE  353

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PTS     LK  DVI+SFD + V  + TVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  354   PTSPLSQVLKPSDVILSFDGIDVANDETVPFRHGERIGFSYLVSQKYTGENAVVKVLRDS  413

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQE------ECEDSIGLK  1568
             E ++  I L+    L+P HI+G  PSY I+AG VFT +S P ++       EC+  +  K
Sbjct  414   EILEFNIKLATYKRLIPAHIKGRPPSYYIIAGFVFTMVSVPYLRSEYGKDYECDAPV--K  471

Query  1569  LLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDS  1748
             LL K  ++ A    E++VV+SQVL  ++NIGYE+I N Q+L  NGK ++N+  L +++++
Sbjct  472   LLDKHLHAMAQSDDEELVVVSQVLVADINIGYENIVNTQVLAFNGKPVKNLKSLCNMVEN  531

Query  1749  CKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             C D++L FE     LVVL+ + A   +  IL  + IPS  S DL
Sbjct  532   CDDEFLKFELEYQQLVVLQTKTAKAATPDILTTHCIPSAMSGDL  575



>ref|XP_008341479.1| PREDICTED: protease Do-like 9 [Malus domestica]
Length=564

 Score =   517 bits (1332),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 242/460 (53%), Positives = 334/460 (73%), Gaps = 3/460 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HTAP++SLPWQ+++QY+S+ S F+IG   +LTNAH V+H TQVK+K+RG 
Sbjct  74    MDAVVKVFCVHTAPNFSLPWQRKKQYSSSSSGFVIGGRMILTNAHSVDHHTQVKLKKRGS  133

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  134   DTKYLATVLAVGAECDIAMLTVSDDEFWEGISPVEFGELPALQDAVTVVGYPIGGDTISV  193

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+  Y HG +ELLG+QIDAA+N GNSGGPAFND GEC+G+AFQ  + ++ EN
Sbjct  194   TSGVVSRMEILPYVHGFTELLGMQIDAAINSGNSGGPAFNDKGECVGIAFQCLKHEDAEN  253

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIP  V+ HF++DYE+NG YTGFP LG+  QK+ENP LR  + + P  +G+ IR++E
Sbjct  254   IGYVIPVPVIMHFIRDYEKNGAYTGFPILGIEWQKMENPDLRMSMGMRPDQKGIRIRRLE  313

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  DVI+SFD V +  +GTVPFR+ ERI F YL+++K+  D A + ++R  
Sbjct  314   PTAPESQLLKPSDVILSFDGVNIASDGTVPFRNGERIGFSYLVTQKYIRDNALIKVLRNF  373

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED--SIGLKLLTK  1580
             E ++  I L+   +L+P HIEG  PS+ I+AG VFT +S P ++ E  +   + +KLL K
Sbjct  374   ETLEFNIKLAKHKELIPSHIEGKPPSFYIIAGFVFTAVSVPYLRSEFGNIFDVPIKLLDK  433

Query  1581  ARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDK  1760
               ++ A    EQ++V+SQVL  ++NIGYEDI N Q+L  NG  ++N+ +LA ++++C D+
Sbjct  434   HLHAMAQSIDEQLIVVSQVLVADINIGYEDIVNNQVLTFNGMPVKNLKNLASMIENCDDE  493

Query  1761  YLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             YL F    N +VVL+ + A   +  IL  + I S  S DL
Sbjct  494   YLKFGLEYNQMVVLQTKTAKAATLDILTTHCISSSMSDDL  533



>ref|XP_009349861.1| PREDICTED: protease Do-like 9 [Pyrus x bretschneideri]
Length=580

 Score =   517 bits (1332),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 252/462 (55%), Positives = 337/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  117   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIRGRRVLTNAHSVEHYTQVKLKKRGS  176

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             +TKY+A VLA G ECDIA+L+V  +EFWKG  PL+FG LP LQDAVTVVGYP+GGDTISV
Sbjct  177   ETKYLATVLAIGTECDIAMLTVSDDEFWKGVSPLEFGELPALQDAVTVVGYPIGGDTISV  236

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND GEC+G+AFQ  + ++ EN
Sbjct  237   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGECVGIAFQSLKHEDAEN  296

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LG+  QK+ENP LR  + + P  +GV +R+VE
Sbjct  297   IGYVIPTPVIKHFIQDYEKNGAYTGFPVLGIEWQKMENPDLRISMGMRPDQKGVRVRRVE  356

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + L+  DVI+SFD V +  +GTVPFR  ERI F YL+S+K++GD+A + ++R  
Sbjct  357   PTAPHSHVLQPSDVILSFDGVNIANDGTVPFRHGERIGFNYLVSQKYTGDSALVKVLRNS  416

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E ++  I L     L+P HI+G  PSY IV G VF  +S P ++ E     E    +KLL
Sbjct  417   EILEYNIKLGTHKRLIPAHIKGKPPSYYIVGGFVFAAVSVPYLRSEYGKDYEFDAPVKLL  476

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYEDI N Q+L  NG+ ++N+  L  ++++C 
Sbjct  477   DKHLHAMAESIDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGRPVKNLKSLVSMVENCD  536

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             DKYL F+   N +VVLE + A+ ++  IL  + IPS  S DL
Sbjct  537   DKYLKFDLEYNQMVVLETKTAMASTLDILLTHCIPSAMSDDL  578



>gb|KCW49312.1| hypothetical protein EUGRSUZ_K02868 [Eucalyptus grandis]
 gb|KCW49313.1| hypothetical protein EUGRSUZ_K02868 [Eucalyptus grandis]
Length=474

 Score =   513 bits (1322),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 246/463 (53%), Positives = 332/463 (72%), Gaps = 3/463 (1%)
 Frame = +3

Query  501   ANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKR  680
             A  + AVVKV+C HT P++SLPWQ +RQY+S  S F+I   ++LTNAH VEH TQVKVK+
Sbjct  10    APAMEAVVKVFCVHTEPNFSLPWQMKRQYSSNSSGFVIKGRRVLTNAHSVEHYTQVKVKK  69

Query  681   RGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDT  860
             RG DTKYVAKVLA G ECDIA+L+V+ +EFW+G   ++FG LP LQDAVTVVGYP+GGDT
Sbjct  70    RGSDTKYVAKVLAIGTECDIAMLTVDDDEFWEGVSSVEFGDLPALQDAVTVVGYPIGGDT  129

Query  861   ISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDE  1040
             +SVT GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFN+ G+C+G+AFQ  + ++
Sbjct  130   VSVTSGVVSRIEILSYVHGSTELLGLQIDAAINAGNSGGPAFNNKGKCVGIAFQSLKQED  189

Query  1041  VENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIR  1217
             VENIGYVIPT V+ HF+QDYE+NG Y GFP LG+  QK+ENP LR  + + +++ GV IR
Sbjct  190   VENIGYVIPTPVIMHFIQDYEKNGGYMGFPLLGIEWQKMENPDLRMAMGMNADQKGVRIR  249

Query  1218  KVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGII  1397
             +++PTS     LK  D+I+SFD V +  +GTVP R  ERI F YL+S+K++GDT+ + ++
Sbjct  250   RIDPTSPESAVLKPSDIILSFDGVDIANDGTVPSRHGERIGFSYLVSQKYTGDTSVIKVL  309

Query  1398  RAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED--SIGLKL  1571
             R  +     + L     ++P H EG  PSY I+AG VF+ +S P ++ E +D     +KL
Sbjct  310   RDSKIFIFDVKLGMHKRVIPLHSEGRPPSYYIIAGFVFSTISVPYLRSEYKDESEAPVKL  369

Query  1572  LTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSC  1751
             L K  +S      EQ+VV+SQVLA ++N+GYEDI N  +L  NGK + N+  LA +++SC
Sbjct  370   LDKLLHSMPQSPDEQLVVVSQVLAGDINVGYEDIVNTPVLAFNGKPVENLKSLASMVESC  429

Query  1752  KDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             ++++L F+     +VVL  E A   +  ILK + IPS  S DL
Sbjct  430   EEEFLKFDLEYQQIVVLRTETARAATLDILKTHCIPSAMSDDL  472



>ref|XP_002511438.1| serine endopeptidase degp2, putative [Ricinus communis]
 gb|EEF52040.1| serine endopeptidase degp2, putative [Ricinus communis]
Length=569

 Score =   517 bits (1331),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 338/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P+YSLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  106   MDAVVKVFCVHTEPNYSLPWQRKRQYSSSSSGFVIGGKRVLTNAHSVEHYTQVKLKKRGS  165

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  166   DTKYLATVLAIGTECDIAMLTVNDDEFWEGVSPVEFGQLPALQDAVTVVGYPIGGDTISV  225

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  226   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGQCVGIAFQSLKHEDVEN  285

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V++HF+QDYE+NG YTGFP LG+  QK+ENP LR  + +  ++ GV IR+++
Sbjct  286   IGYVIPTPVITHFIQDYEKNGAYTGFPYLGIEWQKMENPDLRTAMGMKHDQKGVRIRRID  345

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD A + ++R  
Sbjct  346   PTAPESEVLRPSDIILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIKVLRNS  405

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
               +   I LS    L+P H++G  PSY I+AGLVF+ +S P ++    +E E    +KLL
Sbjct  406   AALNFDIKLSTHRKLIPSHVKGRPPSYYIIAGLVFSTVSVPYLRSEYGKEYEFEAPVKLL  465

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++      EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+  LA++++SC 
Sbjct  466   DKLMHAMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLANMVESCN  525

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L FE     +VVL  + A   +  IL  + IPS  S DL
Sbjct  526   DEFLKFELEYEQIVVLRTKTAKAATVDILTTHCIPSAMSEDL  567



>ref|XP_009349862.1| PREDICTED: protease Do-like 9 [Pyrus x bretschneideri]
Length=562

 Score =   516 bits (1330),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 241/460 (52%), Positives = 334/460 (73%), Gaps = 3/460 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HTAP++SLPWQ+++Q++S+ S F+IG  ++LTNAH V+H TQVK+K+RG 
Sbjct  73    MDAVVKVFCVHTAPNFSLPWQRKKQHSSSSSGFVIGGRRILTNAHSVDHHTQVKLKKRGS  132

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  133   DTKYLATVLAIGAECDIAMLTVSDDEFWEGISPVEFGDLPALQDAVTVVGYPIGGDTISV  192

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+  Y HGS+ELLG+QIDAA+N GNSGGPAFND GEC+G+AFQ  + +  EN
Sbjct  193   TSGVVSRMEILPYVHGSTELLGMQIDAAINSGNSGGPAFNDKGECVGIAFQSLKHEAAEN  252

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIP  V+ HF++DYE+NG YTGFP LG+  QK+ENP LR  + + P  +G+ IR++E
Sbjct  253   IGYVIPVPVIMHFIRDYEKNGAYTGFPILGIEWQKMENPDLRMSMGMRPDQKGIRIRRLE  312

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  DVI+SFD V +  +GTVPF+  ERI F YL+S+K+ GD A + ++R  
Sbjct  313   PTAPESQLLKPSDVILSFDGVNIANDGTVPFKHGERIGFSYLVSQKYLGDNALIKVLRNF  372

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED--SIGLKLLTK  1580
             E ++  I L+   +L+P HIEG  PS+ I+AG +FT +S P ++ E  +   + +KLL K
Sbjct  373   ETLEFNIKLAKHKELIPSHIEGKPPSFYIIAGFIFTAVSVPYLRSEFGNIFDVPIKLLDK  432

Query  1581  ARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDK  1760
               ++ A    EQ++V+SQVL  ++NIGYEDI N Q+L  NG  ++N+ +L  ++++C D+
Sbjct  433   HLHAMARSIDEQLIVVSQVLVADINIGYEDIVNNQVLTFNGTPVKNLKNLVSMVENCDDE  492

Query  1761  YLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             YL F    N +VVL+ + A   +  IL  + I S  S DL
Sbjct  493   YLKFGLECNQMVVLQTKTAKAATLDILTTHCISSSMSDDL  532



>ref|XP_007031392.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY02318.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
Length=587

 Score =   517 bits (1332),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 256/462 (55%), Positives = 339/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P+YSLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  124   MDAVVKVFCVHTEPNYSLPWQRKRQYSSSSSGFIIGGKRVLTNAHSVEHYTQVKLKKRGS  183

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  184   DTKYLATVLAIGTECDIAMLTVSDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  243

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  244   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVEN  303

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR++E
Sbjct  304   IGYVIPTPVIMHFIQDYEKNGAYTGFPILGVEWQKMENPDLRLAMGMKPDQKGVRIRRIE  363

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + LK  D+I+SFD V+V  +GTVPFR  ERI F YL+S+K++GDTA + ++R  
Sbjct  364   PTAAESHLLKPSDIILSFDGVKVANDGTVPFRHGERIGFSYLVSQKYTGDTALVKVLRDS  423

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E +   I L+    L+P H  G  PSY I+AG VFT ++ P ++ E     E    +KLL
Sbjct  424   EIVAHDIKLATHKRLIPAHTNGKPPSYYIIAGFVFTAVTVPYLRSEYGKDYEFDAPVKLL  483

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYE+I N Q+L  NGK ++N+  LAH++++C 
Sbjct  484   DKHLHAMAESTDEQLVVVSQVLVADINIGYEEIVNTQVLAFNGKLVKNLRSLAHMVENCN  543

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL FE     +VVL+ +AA   +  IL  + I S  S DL
Sbjct  544   DEYLRFELEYQQIVVLQTKAAKAATLDILTTHCISSAMSDDL  585



>ref|XP_002517376.1| serine endopeptidase degp2, putative [Ricinus communis]
 gb|EEF44918.1| serine endopeptidase degp2, putative [Ricinus communis]
Length=582

 Score =   517 bits (1331),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 255/462 (55%), Positives = 344/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  119   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  178

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG+LP LQDAVTVVGYP+GGDTISV
Sbjct  179   DTKYLATVLAIGTECDIALLTVNDDEFWEGVTPVEFGNLPALQDAVTVVGYPIGGDTISV  238

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  239   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVEN  298

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V++HF++DYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR++E
Sbjct  299   IGYVIPTPVITHFIRDYEKNGAYTGFPILGVEWQKMENPDLRLSMGMGPDIKGVRIRRIE  358

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   N LK  DVI+SFD V++  +GT+PFR  ERI+F YL+S+K++GD A + ++R  
Sbjct  359   PTAPESNLLKPSDVILSFDGVKIANDGTIPFRHGERISFSYLVSQKYTGDKAMVKVLRNS  418

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E ++  I L+    L+P HI G  PSY I+AG VFT +S P ++ E     E    +K+L
Sbjct  419   EILEFNIKLAIHKRLIPAHIRGKPPSYYIIAGFVFTAVSVPYLRSEYGKDYEFDAPVKIL  478

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+ +LA+++DSC 
Sbjct  479   DKHLHAMAQSVDEQVVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKNLAYMVDSCS  538

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L+F+     +VVL  + A   +  IL  + IPS  S DL
Sbjct  539   DEFLMFDLEYQQIVVLHAKNAKAATLDILATHCIPSAMSDDL  580



>ref|XP_003057446.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59091.1| predicted protein [Micromonas pusilla CCMP1545]
Length=463

 Score =   511 bits (1316),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 250/462 (54%), Positives = 327/462 (71%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+CTHT P+YSLPWQ++RQ  ST S F+I   ++LTNAH VEH T VK+K+RG 
Sbjct  1     MDAVVKVFCTHTEPNYSLPWQRKRQSASTSSGFIIRGRRILTNAHSVEHHTSVKLKKRGG  60

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             D KY A+VLA GVECD+ALL+V+ +EF+ G  P+ FG LP LQ AVTVVGYP+GG  ISV
Sbjct  61    DKKYEARVLAIGVECDLALLTVDDDEFFAGTTPIDFGQLPSLQAAVTVVGYPIGGVAISV  120

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIEVTSY+HGSSELLG+QIDAA+N GNSGGPAFN  G C+GVAFQ  ++D+ EN
Sbjct  121   TSGVVSRIEVTSYSHGSSELLGLQIDAAINSGNSGGPAFNAQGGCVGVAFQSLKADDAEN  180

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF++DYE+NGKYTGFP+L    QKLENP +R  LK+ P+ +GV++R+V+
Sbjct  181   IGYVIPTPVIMHFIRDYEKNGKYTGFPTLPATWQKLENPNMRKFLKMTPAQKGVMVRRVD  240

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             P S   N LK GDV++SFD V +  +GTVPFR+ ERI+F YL++ KF G+ A +  +R G
Sbjct  241   PVSPGSNKLKNGDVLLSFDGVEIANDGTVPFRTGERISFHYLVTEKFVGEKARVTFLRDG  300

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
                 V + L+    LVP HIEG  PS+ I AGLVFT +  P ++ E     +    + +L
Sbjct  301   TTHAVDLPLTQVPRLVPVHIEGVPPSFYIAAGLVFTTVCVPYLKSEYGKDYDYDAPVPIL  360

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              +  Y     KG+ +VV++ VL+  +NIGYEDI N  +   NGK + N+  LA + D CK
Sbjct  361   NRMMYDQVTDKGQNVVVVAHVLSAPINIGYEDIVNTVVNGFNGKPVSNLKQLADMCDGCK  420

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D ++ FE   N LVVL+ + A   +  ILK + IPS +S DL
Sbjct  421   DPFMRFELDHNLLVVLKTKEAHGATQDILKTHCIPSAKSQDL  462



>ref|XP_010037587.1| PREDICTED: protease Do-like 9 [Eucalyptus grandis]
Length=579

 Score =   515 bits (1326),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 246/463 (53%), Positives = 332/463 (72%), Gaps = 3/463 (1%)
 Frame = +3

Query  501   ANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKR  680
             A  + AVVKV+C HT P++SLPWQ +RQY+S  S F+I   ++LTNAH VEH TQVKVK+
Sbjct  115   APAMEAVVKVFCVHTEPNFSLPWQMKRQYSSNSSGFVIKGRRVLTNAHSVEHYTQVKVKK  174

Query  681   RGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDT  860
             RG DTKYVAKVLA G ECDIA+L+V+ +EFW+G   ++FG LP LQDAVTVVGYP+GGDT
Sbjct  175   RGSDTKYVAKVLAIGTECDIAMLTVDDDEFWEGVSSVEFGDLPALQDAVTVVGYPIGGDT  234

Query  861   ISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDE  1040
             +SVT GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFN+ G+C+G+AFQ  + ++
Sbjct  235   VSVTSGVVSRIEILSYVHGSTELLGLQIDAAINAGNSGGPAFNNKGKCVGIAFQSLKQED  294

Query  1041  VENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIR  1217
             VENIGYVIPT V+ HF+QDYE+NG Y GFP LG+  QK+ENP LR  + + +++ GV IR
Sbjct  295   VENIGYVIPTPVIMHFIQDYEKNGGYMGFPLLGIEWQKMENPDLRMAMGMNADQKGVRIR  354

Query  1218  KVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGII  1397
             +++PTS     LK  D+I+SFD V +  +GTVP R  ERI F YL+S+K++GDT+ + ++
Sbjct  355   RIDPTSPESAVLKPSDIILSFDGVDIANDGTVPSRHGERIGFSYLVSQKYTGDTSVIKVL  414

Query  1398  RAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED--SIGLKL  1571
             R  +     + L     ++P H EG  PSY I+AG VF+ +S P ++ E +D     +KL
Sbjct  415   RDSKIFIFDVKLGMHKRVIPLHSEGRPPSYYIIAGFVFSTISVPYLRSEYKDESEAPVKL  474

Query  1572  LTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSC  1751
             L K  +S      EQ+VV+SQVLA ++N+GYEDI N  +L  NGK + N+  LA +++SC
Sbjct  475   LDKLLHSMPQSPDEQLVVVSQVLAGDINVGYEDIVNTPVLAFNGKPVENLKSLASMVESC  534

Query  1752  KDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             ++++L F+     +VVL  E A   +  ILK + IPS  S DL
Sbjct  535   EEEFLKFDLEYQQIVVLRTETARAATLDILKTHCIPSAMSDDL  577



>gb|KFM26933.1| Protease Do-like 9 [Auxenochlorella protothecoides]
Length=465

 Score =   509 bits (1311),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 240/462 (52%), Positives = 334/462 (72%), Gaps = 7/462 (2%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             + AVVKV+  H+ P++SLPWQ++RQ++S+GS F++   ++LTNAHCV+H TQVKVKRRG 
Sbjct  1     MEAVVKVFAVHSEPNFSLPWQRKRQFSSSGSGFVVAGRRILTNAHCVDHHTQVKVKRRGS  60

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             D KYVA VLA G ECDIA+L+V  E+FW G E ++FG LPRLQD++TV+GYP+GGDT+SV
Sbjct  61    DAKYVASVLAVGQECDIAMLTVADEDFWAGLEAVRFGALPRLQDSITVIGYPIGGDTMSV  120

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIEVTSY HG++ELLG  +DAA+N GNSGGPAF+D GEC+G+AFQ  + ++ EN
Sbjct  121   TSGVVSRIEVTSYVHGAAELLG--VDAAINSGNSGGPAFSDRGECVGIAFQSLKHEDAEN  178

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             I Y+IPT V+ HF+ DYERN  YTGFPSLGV  QK+E+P LR  L + PS  GV++R++E
Sbjct  179   ISYIIPTPVIEHFINDYERNQAYTGFPSLGVEWQKMESPVLRKALGMQPSQRGVMVRRIE  238

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PTS     + +GDV+++FD + +G +GTVPFRS ERI F YLIS+K++GD A L ++  G
Sbjct  239   PTSPVSKVVCQGDVLLAFDGIEIGTDGTVPFRSGERIGFSYLISQKYTGDMATLRVLHEG  298

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
                +V + L+    L+P HI    PSY I+ GLVFTP++ PL++    +E +    +KLL
Sbjct  299   AARQVTVPLTTPFKLIPVHIHNRPPSYFILGGLVFTPVTVPLLRSEYGKEFDYDAPVKLL  358

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A+  G+QIVVL+QVLA +VN+GYEDI N Q+  +NG+R+  +  L    +   
Sbjct  359   DKMMHAMADAPGQQIVVLAQVLAADVNVGYEDIVNTQVHAVNGQRVTCLAELVAAAEGGA  418

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
              +Y+  +   N +V+L +E A     +IL+ + I ++RS DL
Sbjct  419   GEYIRLDLEYNQVVILGKEEAAAAMPAILEQHCIAADRSEDL  460



>ref|XP_007217173.1| hypothetical protein PRUPE_ppa003383mg [Prunus persica]
 gb|EMJ18372.1| hypothetical protein PRUPE_ppa003383mg [Prunus persica]
Length=579

 Score =   513 bits (1322),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 338/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             + AVVKV+C HT P+ SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  116   MEAVVKVFCVHTEPNLSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHHTQVKLKKRGS  175

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             +TKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  176   ETKYLATVLAIGTECDIAMLTVSDDEFWEGVSPVEFGELPALQDAVTVVGYPIGGDTISV  235

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  236   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVEN  295

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG+YTGFP +GV  QK+ENP LR  + + +++ GV IR++E
Sbjct  296   IGYVIPTPVIMHFIQDYEKNGEYTGFPVIGVEWQKMENPDLRTSIGMRTDQKGVRIRRIE  355

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++GD A + ++R  
Sbjct  356   PTAPESHVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLVSQKYTGDNALVKVLRNS  415

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E ++  I LS    L+P HI G  PSY I+AG VF  +S P ++ E     E    +KLL
Sbjct  416   EILEYSIKLSTHKRLIPAHINGKPPSYYIIAGFVFAAVSVPYLRSEYGKDYEFDAPVKLL  475

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S A    EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK + N+ +LA ++++C 
Sbjct  476   DKHLHSMAQSIDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVNNLKNLASMVENCD  535

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL F+   + +VVL+ + A   +  IL  + IPS  S DL
Sbjct  536   DEYLKFDLEYDQMVVLQTKTAKAATLDILLTHCIPSAMSDDL  577



>ref|XP_008230647.1| PREDICTED: protease Do-like 9 [Prunus mume]
Length=560

 Score =   512 bits (1319),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 250/461 (54%), Positives = 338/461 (73%), Gaps = 3/461 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HTAP++SLPWQ+++QY+S+ S F+IG  ++LTNAH V+H TQVK+K+RG 
Sbjct  67    MDAVVKVFCVHTAPNFSLPWQRKKQYSSSSSGFVIGGRRVLTNAHSVDHHTQVKLKKRGS  126

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  127   DTKYLATVLAIGTECDIAMLTVSDDEFWEGISPVKFGCLPALQDAVTVVGYPIGGDTISV  186

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  187   TSGVVSRMEILSYVHGSTELLGMQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  246

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIP  V+ HF++DYE+NG YTGFP LG+  QK+ENP LR  + + P  +GV IR++E
Sbjct  247   IGYVIPIPVIMHFIEDYEKNGAYTGFPILGIEWQKMENPDLRMSMGMGPDQKGVRIRRIE  306

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PTS     LK  DVI+SFD V +  +GTVPFR  ERI F YL+S+K+ GD A + ++R  
Sbjct  307   PTSPESQLLKPSDVILSFDGVNIANDGTVPFRHGERIGFSYLVSQKYIGDNAVVKVLRNS  366

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED--SIGLKLLTK  1580
             E ++  I L+   +L+P HIEG +PSY I+AG VFT +S P ++ E  +   + +KLL K
Sbjct  367   ETLEFNIKLAKHKELIPSHIEGKRPSYYIIAGFVFTAVSLPYLRSEFGNLFDVPIKLLDK  426

Query  1581  ARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDK  1760
               ++ A    EQ+VV+SQVL  ++NIGYEDI N Q+L  NG  ++N+  LA ++++C D+
Sbjct  427   HLHAMAQSIDEQLVVVSQVLVADINIGYEDIVNNQVLTFNGMPVKNLKSLASMVENCDDE  486

Query  1761  YLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLM  1883
             YL F    N +VVL+ + A   +  IL  + I S  S DLM
Sbjct  487   YLKFGLEYNQMVVLQTKIARAATLDILMTHCISSAVSDDLM  527



>gb|KHN18478.1| Protease Do-like 9 [Glycine soja]
Length=464

 Score =   508 bits (1309),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 332/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             +++VVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  1     MDSVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGS  60

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  61    DTKYLATVLAIGTECDIAMLTVDDDEFWQGMSPVEFGELPTLQDAVTVVGYPIGGDTISV  120

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  121   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDAEN  180

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR    + P  +GV IR+++
Sbjct  181   IGYVIPTPVIMHFIQDYEKNGGYTGFPILGVEWQKMENPDLRMATGMKPDQKGVRIRRID  240

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  DVI+SFD V +  +GTVPFR  ERI F YLIS+K++GD A + ++R  
Sbjct  241   PTAPESKVLKPSDVILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIKVLRNS  300

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + +K  I L     L+P H +G  PSY I+AG VFT +S P ++ E     E    +KLL
Sbjct  301   DILKFDIKLDSHRRLIPAHSKGKPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLL  360

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S      EQ+VV+SQVL  ++NIGYED  N Q+L  NG+ ++N+  LA +++SC 
Sbjct  361   DKLLHSMPQSPDEQLVVVSQVLVADINIGYEDFVNTQVLAFNGQPVKNLKSLATMVESCN  420

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL F+   + +VVL  + A   +  IL  + IPS  S DL
Sbjct  421   DEYLKFDLDYDQIVVLRTKTAKAATLDILSTHCIPSAMSDDL  462



>ref|XP_005649879.1| trypsin-like serine protease [Coccomyxa subellipsoidea C-169]
 gb|EIE25335.1| trypsin-like serine protease [Coccomyxa subellipsoidea C-169]
Length=479

 Score =   509 bits (1310),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 250/467 (54%), Positives = 331/467 (71%), Gaps = 9/467 (2%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMI----GDGKLLTNAHCVEHDTQVKVK  677
             ++AVVKVYC HT P++SLPWQ++RQY ST S FM+    G   LLTNAH VE+ +QVKVK
Sbjct  1     MDAVVKVYCVHTEPNFSLPWQRKRQYASTSSGFMVQGAKGQKWLLTNAHSVEYHSQVKVK  60

Query  678   RRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGD  857
             RRGDD K++A+VLA G ECDIALL+V  E FW+G  PL+ G LPRLQDAV VVGYP+GGD
Sbjct  61    RRGDDQKFLAEVLAIGTECDIALLTVADEAFWEGVVPLELGPLPRLQDAVAVVGYPIGGD  120

Query  858   TISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSD  1037
             TISVT GVVSRIEVTSY HGS+ELLG+QIDAA+N GNSGGP FN+ G+C+G+AFQ     
Sbjct  121   TISVTSGVVSRIEVTSYVHGSTELLGVQIDAAINSGNSGGPVFNEIGQCVGIAFQSMAGS  180

Query  1038  EVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLI  1214
             + ENIGYVIPT V++HFL DY+RNG++TGFP LGV  Q++E+  LRA   + P  +GVL+
Sbjct  181   DAENIGYVIPTPVINHFLTDYQRNGRFTGFPVLGVKWQRMESAGLRASYGLMPPLKGVLV  240

Query  1215  RKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGI  1394
             R + PTS         D+I+ FD ++V C+GTVPFR+ ERI F YLIS+K++G+ A+L +
Sbjct  241   RSIWPTSPLAAVAGPDDIIMRFDGIQVACDGTVPFRTGERIHFNYLISQKYTGEHAQLDL  300

Query  1395  IRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEEC-EDSIG---  1562
             +R G+ + +++ L     LVP H+ G QPSYL+VAG+VFT   EP ++ E   D I    
Sbjct  301   LRKGQEVSLRVPLDRPHALVPLHLGGHQPSYLVVAGIVFTVCCEPYLESEYGADYISETP  360

Query  1563  LKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLL  1742
             +KLL +  Y       E++V+LSQVLA +  +GYED+ N Q+LK N   +RN+ HLA L 
Sbjct  361   VKLLDRLLYGQREHIDEEVVILSQVLACDATLGYEDLFNTQVLKFNETPVRNLRHLAQLA  420

Query  1743  DSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLM  1883
              +C D ++ F+   N +V+LE + A   +  IL  + IP+  S DL+
Sbjct  421   TACSDPFMRFDLEYNEVVILETKNAHAATKEILALHSIPASVSKDLL  467



>ref|XP_007216372.1| hypothetical protein PRUPE_ppa021785mg, partial [Prunus persica]
 gb|EMJ17571.1| hypothetical protein PRUPE_ppa021785mg, partial [Prunus persica]
Length=535

 Score =   511 bits (1316),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 249/461 (54%), Positives = 337/461 (73%), Gaps = 3/461 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HTAP++SLPWQ+++QY+S+ S F+IG  ++LTNAH V+H TQVK+K+RG 
Sbjct  67    MDAVVKVFCVHTAPNFSLPWQRKKQYSSSSSGFVIGGRRVLTNAHSVDHHTQVKLKKRGS  126

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  127   DTKYLATVLAIGTECDIAMLTVSDDEFWEGISPVKFGCLPALQDAVTVVGYPIGGDTISV  186

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  187   TSGVVSRMEILSYVHGSTELLGMQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  246

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIP  V+ HF++DYE+NG YTGFP LG+  QK+ENP LR  + + P  +GV IR++E
Sbjct  247   IGYVIPIPVIMHFIEDYEKNGAYTGFPILGIEWQKMENPDLRMSMGMGPDQKGVRIRRIE  306

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PTS     LK  DVI+SFD V +  +GTVPFR  ERI F YL+S+K+ GD A + ++R  
Sbjct  307   PTSPESQLLKPSDVILSFDGVNIANDGTVPFRHGERIGFSYLVSQKYIGDNAVVKVLRNS  366

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED--SIGLKLLTK  1580
             E ++  I L+   +L+P HIEG +PSY I+AG VFT +S P ++ E  +   + +KLL K
Sbjct  367   ETLEFNIKLAKHKELIPSHIEGKRPSYYIIAGFVFTAVSLPYLRSEFGNLFDVPIKLLDK  426

Query  1581  ARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDK  1760
               ++ A    EQ+VV+SQVL  ++NIGYEDI N Q+L  NG  ++++  LA ++++C D+
Sbjct  427   HLHAMAQSIDEQLVVVSQVLVADINIGYEDIVNNQVLTFNGMPVKDLKSLASMVENCDDE  486

Query  1761  YLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLM  1883
             YL F    N +VVL+   A   +  IL  + I S  S DLM
Sbjct  487   YLKFGLEYNQMVVLQTNTARAATLDILTTHCISSAMSDDLM  527



>ref|XP_010450719.1| PREDICTED: protease Do-like 9 [Camelina sativa]
Length=588

 Score =   513 bits (1320),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 252/462 (55%), Positives = 338/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S  S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  121   MDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  180

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  181   DTKYLATVLAIGTECDIALLTVTDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  240

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  241   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  300

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYER+ KYTGFP LG+  QK+ENP LR  + + S++ GV IR++E
Sbjct  301   IGYVIPTPVIVHFIQDYERHDKYTGFPVLGIEWQKMENPDLRKSMGMESHQKGVRIRRIE  360

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD+A + ++R  
Sbjct  361   PTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVKVLRNK  420

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             E ++  I L+    L+P HI G  PSY IVAG VFT +S P ++    +E E    +KLL
Sbjct  421   EILEFNIKLAIHKRLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLL  480

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL +++NIGYE+I N Q++  NGK ++N+  LA +++ C+
Sbjct  481   EKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVVAFNGKPVKNLKGLAEMVEKCE  540

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+Y+ F    N +VVL  + A   +  IL  + IPS  S DL
Sbjct  541   DEYMKFNLDYNQIVVLSTKTAKEATLDILTTHCIPSAMSDDL  582



>ref|XP_002511437.1| serine endopeptidase degp2, putative [Ricinus communis]
 gb|EEF52039.1| serine endopeptidase degp2, putative [Ricinus communis]
Length=524

 Score =   510 bits (1314),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 246/460 (53%), Positives = 334/460 (73%), Gaps = 4/460 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P+YSLPWQ++RQY+ST S  +IG  ++LTNAH V+H TQVK+K+RG 
Sbjct  64    MDAVVKVFCVHTEPNYSLPWQRKRQYSSTSSGLVIGGKRILTNAHSVQHYTQVKLKKRGS  123

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFW+G  P+QFG LP LQDAV VVGYP+GGDTISV
Sbjct  124   DTKYLATVLAIGTECDIAMLTVDDDEFWEGVSPVQFGELPALQDAVIVVGYPIGGDTISV  183

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+  YAHGS+ELLG+QIDAA+N GNSGGP FND+ +C+G+AFQ +   E EN
Sbjct  184   TSGVVSRIEILPYAHGSTELLGLQIDAAINSGNSGGPVFNDNAQCVGIAFQSFSHAEAEN  243

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V++HF+QDYE+NG YTGFP LG+  QK+ENP LR  + +  ++ GV IR++E
Sbjct  244   IGYVIPTPVITHFIQDYEKNGAYTGFPLLGIEWQKMENPDLRMAMGMKHDQKGVRIRRIE  303

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++GD A + ++R  
Sbjct  304   PTASEFEVLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSKKYTGDYAAIKVLRNS  363

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECE--DSIGLKLLTK  1580
             E +   I LS    ++P H++ G+PSY I+ G VF+ +S P ++ E    D I +KL+ K
Sbjct  364   ETLTFDIRLSVHGKIIPPHVQ-GRPSYYIIGGFVFSAVSVPYLRSEYNNFDEIPVKLMDK  422

Query  1581  ARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDK  1760
               +S +    EQ+VV+SQVL  ++NIGYEDI N Q+   NGK ++N+  LA++++ C D+
Sbjct  423   LMHSMSQSPDEQLVVVSQVLVADINIGYEDIVNTQVFTFNGKSVKNLKSLANMVECCNDE  482

Query  1761  YLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             +L FE   + +VVL  + A   +  IL  + IPS  S DL
Sbjct  483   FLKFELEQDQIVVLRTKTAKAATIDILTTHCIPSAMSHDL  522



>ref|XP_005850048.1| hypothetical protein CHLNCDRAFT_34342 [Chlorella variabilis]
 gb|EFN57946.1| hypothetical protein CHLNCDRAFT_34342 [Chlorella variabilis]
Length=606

 Score =   513 bits (1321),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 248/468 (53%), Positives = 340/468 (73%), Gaps = 9/468 (2%)
 Frame = +3

Query  504   NFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMI----GDGKLLTNAHCVEHDTQVK  671
             + ++AVVK+YCTHT P+YSLPWQ++RQY+ST S F++    G   LLTNAH VEH +Q K
Sbjct  62    DVMDAVVKIYCTHTEPNYSLPWQRKRQYSSTSSGFVVAGEAGQRYLLTNAHSVEHYSQTK  121

Query  672   VKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLG  851
             VKRRGDD K++A VLA G ECD+ALL+V+ EEFW+G +PL+FG LP LQ++V VVGYP+G
Sbjct  122   VKRRGDDRKWLATVLAIGTECDVALLTVDDEEFWQGVQPLRFGPLPNLQESVYVVGYPIG  181

Query  852   GDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYR  1031
             GDTISVT GVVSRIEVT+YAHG++ELLG+QIDAA+N GNSGGP FN+ GE +G+AFQ Y 
Sbjct  182   GDTISVTSGVVSRIEVTAYAHGATELLGVQIDAAINSGNSGGPVFNELGEVVGIAFQSYA  241

Query  1032  SDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GV  1208
               + ENIGYVIPT V++HFL DYERNG +TGFP+LGV  Q++E+ ALR    +   + GV
Sbjct  242   GSDAENIGYVIPTPVINHFLDDYERNGTFTGFPALGVQWQRMESAALRKHFNMSEEQKGV  301

Query  1209  LIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAEL  1388
             L+R V+P S AH  L  GDV+++FD V V  +GTVPF S ERIAF YL S+KF+GD A L
Sbjct  302   LVRSVQPISHAHGQLFPGDVLLAFDGVEVASDGTVPFLSGERIAFSYLTSQKFTGDLATL  361

Query  1389  GIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIG--  1562
              I+R G+ M++QI L     LV +H+ G  PSYL+VAG+VFT ++EP ++ E     G  
Sbjct  362   DILREGKPMRLQIKLMRPNSLVQHHLGGRDPSYLVVAGIVFTVVTEPYLESEYGAEYGRE  421

Query  1563  --LKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAH  1736
               +KLL K  +++ +   +++VV+SQVLA    +GYE++ N Q+ K NG  +RN+ HL  
Sbjct  422   APIKLLDKLLHAWKDEPDQEVVVISQVLACNATLGYEEVFNTQVHKFNGTPVRNLKHLTE  481

Query  1737  LLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             ++ +CK++++ F+   + ++V++   A   +  IL+ + IP+  S DL
Sbjct  482   MVLTCKEQHMRFDVDYSEVIVIDTAVANEATEEILRLHSIPAMGSKDL  529



>ref|XP_003525265.1| PREDICTED: protease Do-like 9-like [Glycine max]
Length=584

 Score =   512 bits (1319),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 252/462 (55%), Positives = 333/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             +++VVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  121   MDSVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGS  180

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  181   DTKYLATVLAIGTECDIAMLTVDDDEFWQGMSPVEFGELPTLQDAVTVVGYPIGGDTISV  240

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  241   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDAEN  300

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR+++
Sbjct  301   IGYVIPTPVIMHFIQDYEKNGGYTGFPILGVEWQKMENPDLRMAMGMKPDQKGVRIRRID  360

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  DVI+SFD V +  +GTVPFR  ERI F YLIS+K++GD A + ++R  
Sbjct  361   PTAPESKVLKPSDVILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIKVLRNS  420

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  K  I L     L+P H +G  PSY I+AG VFT +S P ++ E     E    +KLL
Sbjct  421   DIFKFDIKLDSHRRLIPAHSKGKPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLL  480

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S      EQ+VV+SQVL  ++NIGYEDI N Q+L  NG+ ++N+  LA +++SC 
Sbjct  481   DKLLHSMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGQPVKNLKSLATMVESCN  540

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL F+   + +VVL  + A   +  IL  + IPS  S DL
Sbjct  541   DEYLKFDLDYDQIVVLRMKTAKAATLDILATHCIPSAMSDDL  582



>ref|XP_006283387.1| hypothetical protein CARUB_v10004432mg [Capsella rubella]
 gb|EOA16285.1| hypothetical protein CARUB_v10004432mg [Capsella rubella]
Length=590

 Score =   512 bits (1318),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 339/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S  S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  123   MDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  182

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  183   DTKYLATVLAIGTECDIALLTVTDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  242

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  243   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  302

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++ KYTGFP LG+  QK+ENP LR  + + S++ GV IR++E
Sbjct  303   IGYVIPTPVIVHFIQDYEKHDKYTGFPVLGIEWQKMENPDLRKSMGMESHQKGVRIRRIE  362

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD+A + ++R  
Sbjct  363   PTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVKVLRNK  422

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             E ++  I L+    L+P HI G  PSY IVAG VFT +S P ++    +E E    +KLL
Sbjct  423   EILEFNIKLAIHKRLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLL  482

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL +++NIGYE+I N Q+L  NGK ++N+  L  ++++C+
Sbjct  483   EKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGKPVKNLKGLVEMVENCE  542

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+Y+ F    N +VVL+ + A   +  IL  + IPS  S DL
Sbjct  543   DEYMKFNLDYNQIVVLDTKTAKEATLDILTTHCIPSAMSDDL  584



>ref|XP_002868670.1| hypothetical protein ARALYDRAFT_493972 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44929.1| hypothetical protein ARALYDRAFT_493972 [Arabidopsis lyrata subsp. 
lyrata]
Length=592

 Score =   512 bits (1318),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 252/462 (55%), Positives = 338/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S  S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  125   MDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  184

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  185   DTKYLATVLAIGTECDIALLTVTDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  244

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  245   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  304

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++ KYTGFP LG+  QK+ENP LR  + + S++ GV IR++E
Sbjct  305   IGYVIPTPVIVHFIQDYEKHDKYTGFPVLGIEWQKMENPDLRKSMGMESHQKGVRIRRIE  364

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD+A + ++R  
Sbjct  365   PTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVKVLRNT  424

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             E ++  I L+    L+P HI G  PSY IVAG VFT +S P ++    +E E    +KLL
Sbjct  425   EILEFNIKLAIHKRLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLL  484

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL +++NIGYE+I N Q+L  NGK ++N+  LA +++ C+
Sbjct  485   EKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGKPVKNLKGLAEMVEKCE  544

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+Y+ F    + LV LE + A   +  IL  + IPS  S DL
Sbjct  545   DEYMKFNLDYDQLVTLETKRAKEATLDILTTHCIPSAMSDDL  586



>ref|XP_006655949.1| PREDICTED: protease Do-like 9-like, partial [Oryza brachyantha]
Length=504

 Score =   508 bits (1308),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 343/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  41    MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHYTQVKLKKRGS  100

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+VE +EFWKG  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  101   DTKYLATVLAIGTECDIAMLTVEDDEFWKGVSPVEFGSLPALQDAVTVVGYPIGGDTISV  160

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  161   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVEN  220

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V++HF+QDYE++G+YTGFP L +  QK+ENP LR  + + S++ GV IR+VE
Sbjct  221   IGYVIPTPVINHFIQDYEKSGEYTGFPILAIEWQKMENPDLRKAMGMKSDQKGVRIRRVE  280

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+  +  L+  D+++SFD V +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  281   PTAPEYEFLQSSDIVLSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGEKAHVKVLRNS  340

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             + ++  I L+    L+P HI+G  PSY IVAG VF  +S P ++    +E E    +KLL
Sbjct  341   KVLEFNIKLATHKRLIPAHIKGKPPSYYIVAGFVFMAVSVPYLRSEYGKEYEYDAPVKLL  400

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYE+I N Q+L  NGK I+N+ HLA ++++C 
Sbjct  401   DKHLHAMAQSPDEQLVVVSQVLVADINIGYEEIVNIQVLAFNGKTIKNLKHLATMVEACS  460

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             +++L F+     LVVLE + A   +  IL  + IPS  S DL
Sbjct  461   EEFLKFDMDYEQLVVLETKTAKAATQDILTTHCIPSAISEDL  502



>ref|XP_007031393.1| Protease Do-like 9 isoform 2 [Theobroma cacao]
 gb|EOY02319.1| Protease Do-like 9 isoform 2 [Theobroma cacao]
Length=575

 Score =   511 bits (1315),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 251/449 (56%), Positives = 333/449 (74%), Gaps = 5/449 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P+YSLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  124   MDAVVKVFCVHTEPNYSLPWQRKRQYSSSSSGFIIGGKRVLTNAHSVEHYTQVKLKKRGS  183

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  184   DTKYLATVLAIGTECDIAMLTVSDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  243

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  244   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVEN  303

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR++E
Sbjct  304   IGYVIPTPVIMHFIQDYEKNGAYTGFPILGVEWQKMENPDLRLAMGMKPDQKGVRIRRIE  363

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + LK  D+I+SFD V+V  +GTVPFR  ERI F YL+S+K++GDTA + ++R  
Sbjct  364   PTAAESHLLKPSDIILSFDGVKVANDGTVPFRHGERIGFSYLVSQKYTGDTALVKVLRDS  423

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E +   I L+    L+P H  G  PSY I+AG VFT ++ P ++ E     E    +KLL
Sbjct  424   EIVAHDIKLATHKRLIPAHTNGKPPSYYIIAGFVFTAVTVPYLRSEYGKDYEFDAPVKLL  483

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYE+I N Q+L  NGK ++N+  LAH++++C 
Sbjct  484   DKHLHAMAESTDEQLVVVSQVLVADINIGYEEIVNTQVLAFNGKLVKNLRSLAHMVENCN  543

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSIL  1841
             D+YL FE     +VVL+ +AA   +  IL
Sbjct  544   DEYLRFELEYQQIVVLQTKAAKAATLDIL  572



>ref|XP_010678716.1| PREDICTED: protease Do-like 9 isoform X1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010678717.1| PREDICTED: protease Do-like 9 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=487

 Score =   507 bits (1306),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 240/461 (52%), Positives = 331/461 (72%), Gaps = 3/461 (1%)
 Frame = +3

Query  507   FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRG  686
              +++VVKV+C HT P++SLPWQ++RQ+ S+ + F+I   ++LTNAH VE+ TQVK+K+RG
Sbjct  21    LMDSVVKVFCVHTKPNFSLPWQRKRQHRSSSTGFVIAGRRILTNAHSVEYYTQVKLKKRG  80

Query  687   DDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTIS  866
              DTKY+A VLA G ECDIALL+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTIS
Sbjct  81    SDTKYLATVLAIGAECDIALLTVKDDEFWEGVSPVEFGELPALQDAVTVVGYPIGGDTIS  140

Query  867   VTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVE  1046
             VT GVVSR+E+ SY HG +ELLG+Q+DAA+N GNSGGPAFND G C+G+AFQ  + ++ E
Sbjct  141   VTSGVVSRMEILSYVHGWTELLGLQVDAAINSGNSGGPAFNDKGNCVGIAFQSMKHEDAE  200

Query  1047  NIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKV  1223
             NIGYVIPT V+ HF+QDYERNG YTGFP +G   QK+ENP LR  + + S++ G+L+ +V
Sbjct  201   NIGYVIPTPVIIHFIQDYERNGAYTGFPIIGFEWQKMENPDLRMAMGMKSDQRGILVTRV  260

Query  1224  EPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRA  1403
             E T+     L+  DVI+SFD V +G +GTVPFR  ERI F YLIS+K++GD A++ ++R 
Sbjct  261   EATAPEAVVLQPSDVILSFDGVGIGNDGTVPFRHGERIGFNYLISKKYTGDHAKIKLLRD  320

Query  1404  GEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED--SIGLKLLT  1577
                 +  I L P   L+P  I+ G PSY I AG VFT +S P +  E  D   + ++LL 
Sbjct  321   SVMHEFDIKLDPYKKLIPACIKDGPPSYYIFAGFVFTAVSVPYLFSEYSDESDVPVELLH  380

Query  1578  KARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKD  1757
             K  +S A+ K E+++++SQVL  ++NIGYE+I+N Q+  +NGK ++N+     +++SC +
Sbjct  381   KLHHSMADSKDEELLIISQVLVADINIGYENITNVQVTAVNGKPVKNLKSFTSMVESCSE  440

Query  1758  KYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             +YL F+   N  VVL  E A   +  IL  + IPS  S DL
Sbjct  441   EYLKFDLEFNKKVVLRTETAKAATADILATHCIPSAMSDDL  481



>ref|XP_010029214.1| PREDICTED: protease Do-like 9 [Eucalyptus grandis]
Length=589

 Score =   511 bits (1315),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 252/462 (55%), Positives = 340/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVKVK+RG 
Sbjct  126   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHHTQVKVKKRGS  185

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V S+EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  186   DTKYLATVLAIGTECDIALLTVNSDEFWEGVAPVEFGELPALQDAVTVVGYPIGGDTISV  245

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SYAHGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  246   TSGVVSRMEMLSYAHGSTELLGVQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  305

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVP-SNEGVLIRKVE  1226
             IGY+IPT V+ HF+ DYE+NG YTGFP LGV  QK+ENP LR  + +    +GV IR++E
Sbjct  306   IGYIIPTPVIMHFIHDYEKNGLYTGFPILGVEWQKMENPDLRMAMGMKLDKKGVRIRRIE  365

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + LK  DVI+SFD + +  +GTVPFR  ERI F YL+S+K++GD A + ++R  
Sbjct  366   PTAPESHVLKPSDVILSFDGINIANDGTVPFRHGERIGFGYLVSQKYTGDKAHVQVLRNS  425

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + ++  I L+    L+P HI G  PSY I+AG VFT +S P ++ E     E    +KLL
Sbjct  426   KILEFDIKLATHKRLIPAHISGKSPSYYIIAGFVFTAVSVPYLRSEYGKDYEFDAPVKLL  485

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S A    EQ+VV+SQVL  ++NIGYEDI N Q+L  NG+ ++N+  LA+++++C+
Sbjct  486   DKLLHSMAGSVNEQLVVVSQVLVADINIGYEDIVNTQVLAFNGEPVKNLKSLANMVENCE  545

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL F+     +VVL  + A   ++ IL  + IPS  S+DL
Sbjct  546   DEYLRFDLEYQQVVVLRTKTAKVATSDILTTHCIPSAMSNDL  587



>ref|XP_011087156.1| PREDICTED: protease Do-like 9 [Sesamum indicum]
Length=573

 Score =   510 bits (1314),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 247/464 (53%), Positives = 329/464 (71%), Gaps = 9/464 (2%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             +++VVKV+C HT P++SLPWQ++RQY+S+ S F+I   ++LT+AH VEH TQ+K+K+RG 
Sbjct  110   MDSVVKVFCVHTDPNFSLPWQRKRQYSSSSSGFVIQGRRVLTSAHSVEHYTQIKLKKRGS  169

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKYVA VLA GVECDIALL+V  +EFW+G  P+ FG LP LQDAVTVVGYP+GGDTISV
Sbjct  170   DTKYVATVLAIGVECDIALLTVNDDEFWEGISPVVFGDLPALQDAVTVVGYPIGGDTISV  229

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAAVN GNSGGPAFND G C+G+AFQ  + ++VEN
Sbjct  230   TSGVVSRIEILSYVHGSTELLGLQIDAAVNSGNSGGPAFNDRGICVGIAFQSIKYEDVEN  289

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVP-SNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++G YTGFP L +  QK+EN  LR  + +   + G+ IR++ 
Sbjct  290   IGYVIPTPVIMHFIQDYEKHGMYTGFPVLAIEWQKMENKDLRLSMGMKLDHNGIRIRRIG  349

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             P+S     LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++ D+AE+ ++R  
Sbjct  350   PSSPLFKVLKPSDIILSFDGVDIAEDGTVPFRHGERIGFSYLVSQKYTDDSAEIEVLRNS  409

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQE------ECEDSIGLK  1568
             E +K ++ L     LVP H  G  PSY I+AG VFTP+S P ++       ECE  +  K
Sbjct  410   ERLKFKVDLGTHTRLVPAHNNGKPPSYYIIAGFVFTPVSVPYLRSEYGKEYECEGPV--K  467

Query  1569  LLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDS  1748
             LL K  +       EQIVV+SQVL  ++NIGYEDI N Q+L  NG+ ++N+  L  +++S
Sbjct  468   LLDKVLHEMPQSVDEQIVVISQVLVADINIGYEDIVNTQVLAFNGQPVKNLKSLVTMVES  527

Query  1749  CKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             C DKY+ F+     +VVL    A   + +IL  + +PS  S DL
Sbjct  528   CTDKYMKFDLEYQQIVVLRTRTAKAATLNILTRHCVPSAMSDDL  571



>ref|XP_010928580.1| PREDICTED: protease Do-like 9 [Elaeis guineensis]
Length=579

 Score =   510 bits (1314),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 248/462 (54%), Positives = 335/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  116   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIISGRRVLTNAHSVEHYTQVKLKKRGS  175

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKYVA VLA G ECDIA+L+V  +EFW G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  176   DTKYVATVLAIGTECDIAMLTVSDDEFWAGVSPVEFGSLPALQDAVTVVGYPIGGDTISV  235

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  236   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVEN  295

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+ DYE++G+YTGFP LG+  QK+ENP LR  L + P  +GV +R+VE
Sbjct  296   IGYVIPTPVILHFIHDYEKSGEYTGFPILGIEWQKMENPDLRKALGMSPDQKGVRVRRVE  355

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  356   PTAPESDFLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGENAMVKVLREK  415

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  +  + L+    LVP HI+G  PSY I+AGLVF  +S P ++ E     E    +KLL
Sbjct  416   KVYEFNVKLATHKRLVPAHIKGKPPSYYIIAGLVFAAISVPYLRSEYGKDYEYDAPVKLL  475

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+  LA ++++C 
Sbjct  476   DKHLHAMAQAHDEQLVVISQVLVADINIGYEDIVNTQVLSFNGKPVKNLKSLASMVENCD  535

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             +++L F+     +VVL+   A   +  IL  + IPS  S DL
Sbjct  536   EEFLQFDLEYQQIVVLKTRTAKAATKDILLTHCIPSAMSGDL  577



>ref|NP_001057235.1| Os06g0234100 [Oryza sativa Japonica Group]
 dbj|BAD37774.1| putative DegP2 protease [Oryza sativa Japonica Group]
 dbj|BAD37915.1| putative DegP2 protease [Oryza sativa Japonica Group]
 dbj|BAF19149.1| Os06g0234100 [Oryza sativa Japonica Group]
 dbj|BAG99912.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80287.1| hypothetical protein OsI_22290 [Oryza sativa Indica Group]
 gb|EEE65395.1| hypothetical protein OsJ_20719 [Oryza sativa Japonica Group]
Length=628

 Score =   511 bits (1317),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 254/462 (55%), Positives = 342/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  165   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGHRVLTNAHSVEHYTQVKLKKRGS  224

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+VE +EFWKG  PL+FG LP LQDAVTVVGYP+GGDTISV
Sbjct  225   DTKYLATVLAIGTECDIAMLTVEDDEFWKGVSPLEFGSLPALQDAVTVVGYPIGGDTISV  284

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  285   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVEN  344

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V++HF+QDYE++G+YTGFP LG+  QK+ENP LR  + + S++ GV +R+VE
Sbjct  345   IGYVIPTPVINHFIQDYEKSGEYTGFPILGIEWQKMENPDLRKAMGMKSDQKGVRVRRVE  404

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD + +  +GTVPFR  ERI F YLIS+K++G+ A + I+R  
Sbjct  405   PTAPESGCLQPSDIILSFDGIDIANDGTVPFRHGERIGFSYLISQKYTGEKAHVKILRNS  464

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + ++  I L+    L+P HI+G  PSY IVAG VF  +S P ++ E     E    +KLL
Sbjct  465   KVLEFNIKLATHKRLIPAHIKGRPPSYYIVAGFVFMVVSVPYLRSEYGKDYEYDAPVKLL  524

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYE+I N Q+L  NGK ++N+ HLA +++ C 
Sbjct  525   DKHLHAMAQSPDEQLVVVSQVLVADINIGYEEIVNIQVLSFNGKPVKNLKHLATMVEDCN  584

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             ++YL F+   + LVVLE + A   +  IL  + IPS  S DL
Sbjct  585   EEYLKFDMDYDQLVVLEAKTAKAATQDILTTHCIPSAMSEDL  626



>gb|KFK33145.1| hypothetical protein AALP_AA6G336800 [Arabis alpina]
Length=581

 Score =   509 bits (1312),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 252/462 (55%), Positives = 337/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S  S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  118   MDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  177

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  178   DTKYLATVLAIGTECDIALLTVNDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  237

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  238   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  297

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++ KYTGFP +G+  QK+ENP LR  + + S++ GV IR++E
Sbjct  298   IGYVIPTPVIVHFIQDYEKHDKYTGFPVIGIEWQKMENPDLRKKMGMASHQKGVRIRRIE  357

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD+A + ++R  
Sbjct  358   PTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVKVLRNK  417

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             E ++  I L+    L+P HI G  PSY IVAG VFT +S P ++    +E E    +KLL
Sbjct  418   EILEFNIKLAIHKRLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLL  477

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL +++NIGYE+I N Q+L  NGK ++N+  LA +++ C 
Sbjct  478   EKHLHAMAQSMDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGKPVKNLKGLAEMVEKCD  537

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+Y+ F      LVVL  + A  T+  IL  + IPS  S DL
Sbjct  538   DEYMEFNLDYEQLVVLHTKTAKETTLDILTTHCIPSAMSDDL  579



>ref|XP_003550747.1| PREDICTED: protease Do-like 9-like [Glycine max]
Length=576

 Score =   509 bits (1311),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 332/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             +++VVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  113   MDSVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGS  172

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  173   DTKYLATVLAIGTECDIAMLTVDDDEFWQGMSPVEFGELPTLQDAVTVVGYPIGGDTISV  232

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  233   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDAEN  292

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR    + P  +GV IR+++
Sbjct  293   IGYVIPTPVIMHFIQDYEKNGGYTGFPILGVEWQKMENPDLRMATGMKPDQKGVRIRRID  352

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  DVI+SFD V +  +GTVPFR  ERI F YLIS+K++GD A + ++R  
Sbjct  353   PTAPESKVLKPSDVILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIKVLRNS  412

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + +K  I L     L+P H +G  PSY I+AG VFT +S P ++ E     E    +KLL
Sbjct  413   DILKFDIKLDSHRRLIPAHSKGKPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLL  472

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S      EQ+VV+SQVL  ++NIGYED  N Q+L  NG+ ++N+  LA +++SC 
Sbjct  473   DKLLHSMPQSPDEQLVVVSQVLVADINIGYEDFVNTQVLAFNGQPVKNLKSLATMVESCN  532

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL F+   + +VVL  + A   +  IL  + IPS  S DL
Sbjct  533   DEYLKFDLDYDQIVVLRTKTAKAATLDILSTHCIPSAMSDDL  574



>ref|XP_008230646.1| PREDICTED: protease Do-like 9 [Prunus mume]
Length=579

 Score =   509 bits (1311),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 250/462 (54%), Positives = 336/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             + AVVKV+C HT P+ SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  116   MEAVVKVFCVHTEPNLSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHHTQVKLKKRGS  175

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             +TKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  176   ETKYLATVLAIGTECDIAMLTVSDDEFWEGVSPVEFGELPALQDAVTVVGYPIGGDTISV  235

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  236   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVEN  295

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG+YTGFP +GV  QK+ENP LR  + + +++ GV IR++E
Sbjct  296   IGYVIPTPVIMHFIQDYEKNGEYTGFPVIGVEWQKMENPDLRTSIGMRTDQKGVRIRRIE  355

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + LK  D+I+SFD V +  +GTV FR  ERI F YL+S+K++GD A + ++R  
Sbjct  356   PTAPESHVLKPSDIILSFDGVNIANDGTVQFRHGERIGFSYLVSQKYTGDNALVKVLRNS  415

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E ++  I LS    L+P HI G  PSY I+AG VF  +S P ++ E     E    +KLL
Sbjct  416   EILEYNIKLSTHKRLIPAHINGKPPSYYIIAGFVFAAVSVPYLRSEYGKDYEFDAPVKLL  475

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S A    EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK + N+  LA ++++C 
Sbjct  476   DKHLHSMAQSIDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVNNLKKLASMVENCD  535

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL F+   + +VVL+ + A   +  IL  + IPS  S DL
Sbjct  536   DEYLKFDLEYDQMVVLQTKTAKAATLDILLTHCIPSAMSDDL  577



>emb|CBI34956.3| unnamed protein product [Vitis vinifera]
Length=464

 Score =   505 bits (1300),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 250/462 (54%), Positives = 335/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  1     MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIEGRRVLTNAHSVEHHTQVKLKKRGS  60

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW G +P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  61    DTKYLATVLAIGTECDIALLTVNDDEFWDGVKPVEFGDLPALQDAVTVVGYPIGGDTISV  120

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPA ND G+C+G+AFQ  + ++VEN
Sbjct  121   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAINDKGKCVGIAFQSLKHEDVEN  180

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF++DYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR++E
Sbjct  181   IGYVIPTPVIMHFIRDYEKNGAYTGFPILGVEWQKMENPDLRVSMGMGPDQKGVRIRRIE  240

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + LK  DVI+SFD V +  +GTVPFR  ERI F YL+S+K++GD A + ++R  
Sbjct  241   PTAPESHVLKPSDVILSFDGVNIANDGTVPFRHGERIGFSYLVSQKYTGDNAVVKVLRNS  300

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + ++  I L+    L+  HI+G  PSY I+ G VFT +S P ++ E     E    +KLL
Sbjct  301   QILEFCIKLAIHKRLIAAHIKGRPPSYYIIGGFVFTAVSVPYLRSEYGKDYEFDAPVKLL  360

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  YS A    EQ+VV++QVL  ++NIGYE+I N Q+L  NGK ++N+  LA +++SC 
Sbjct  361   DKHLYSMAQSVDEQLVVVAQVLVADINIGYEEIVNTQVLSFNGKPVKNLKSLATMVESCD  420

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L FE     +VVL+ + A   +  IL  + IPS  S DL
Sbjct  421   DEFLKFELEYQQIVVLQTKTAKAATLDILTTHCIPSAMSDDL  462



>ref|XP_006476739.1| PREDICTED: protease Do-like 9-like isoform X1 [Citrus sinensis]
Length=585

 Score =   509 bits (1311),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 250/473 (53%), Positives = 341/473 (72%), Gaps = 5/473 (1%)
 Frame = +3

Query  477   VETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEH  656
             VE G  +    ++AVVKV+C HT P++SLPWQ++RQY+S+ S F IG  ++LTNAH VEH
Sbjct  111   VEPGVARVVPAMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEH  170

Query  657   DTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVV  836
              TQVK+K+RG DTKY+A VLA G ECDIA+L+VE +EFW+G  P++FG LP LQDAVTVV
Sbjct  171   YTQVKLKKRGSDTKYLATVLAIGTECDIAMLTVEDDEFWEGVLPVEFGELPALQDAVTVV  230

Query  837   GYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVA  1016
             GYP+GGDTISVT GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+A
Sbjct  231   GYPIGGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIA  290

Query  1017  FQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPS  1196
             FQ  + ++VENIGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + +
Sbjct  291   FQSLKHEDVENIGYVIPTPVIMHFIQDYEKNGAYTGFPLLGVEWQKMENPDLRVAMSMKA  350

Query  1197  NE-GVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSG  1373
             ++ GV IR+V+PT+     LK  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G
Sbjct  351   DQKGVRIRRVDPTAPESEVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTG  410

Query  1374  DTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE---  1544
             D+A + ++R  + +   I L+    L+P H +G  PSY I+AG VF+ +S P ++ E   
Sbjct  411   DSAAVKVLRDSKILNFNITLATHRRLIPSHNKGRPPSYYIIAGFVFSTVSVPYLRSEYGK  470

Query  1545  -CEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNI  1721
               E    +KLL K  YS      EQ+VV+SQVL  ++NIGYE+I N Q+L  NG  ++N+
Sbjct  471   DYEYEAPVKLLDKLLYSMPQLPDEQLVVVSQVLVADINIGYEEIVNTQVLAFNGNPVKNL  530

Query  1722  HHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
               LA+++++C D++L F+   + +VVL  + +   +  IL  + IPS  S DL
Sbjct  531   KSLANMVENCDDEFLKFDLEYDQVVVLRTKTSKAATLDILATHCIPSAMSDDL  583



>ref|NP_568577.1| DegP protease 9 [Arabidopsis thaliana]
 sp|Q9FL12.1|DEGP9_ARATH RecName: Full=Protease Do-like 9 [Arabidopsis thaliana]
 dbj|BAB10901.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AAK76697.1| putative DegP protease [Arabidopsis thaliana]
 gb|AAN13177.1| putative DegP protease [Arabidopsis thaliana]
 gb|AED94519.1| DegP protease 9 [Arabidopsis thaliana]
Length=592

 Score =   509 bits (1312),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 250/462 (54%), Positives = 340/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S  S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  125   MDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  184

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  185   DTKYLATVLAIGTECDIALLTVTDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  244

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  245   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  304

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++ KYTGFP LG+  QK+ENP LR  + + S++ GV IR++E
Sbjct  305   IGYVIPTPVIVHFIQDYEKHDKYTGFPVLGIEWQKMENPDLRKSMGMESHQKGVRIRRIE  364

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD+A + ++R  
Sbjct  365   PTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVKVLRNK  424

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             E ++  I L+    L+P HI G  PSY IVAG VFT +S P ++    +E E    +KLL
Sbjct  425   EILEFNIKLAIHKRLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLL  484

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL +++NIGYE+I N Q++  NGK ++N+  LA ++++C+
Sbjct  485   EKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVVAFNGKPVKNLKGLAGMVENCE  544

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+Y+ F    + +VVL+ + A   +  IL  + IPS  S DL
Sbjct  545   DEYMKFNLDYDQIVVLDTKTAKEATLDILTTHCIPSAMSDDL  586



>gb|KDP45394.1| hypothetical protein JCGZ_09643 [Jatropha curcas]
Length=585

 Score =   509 bits (1311),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 252/462 (55%), Positives = 340/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  122   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  181

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  182   DTKYLATVLAIGTECDIALLTVNDDEFWEGVTPVEFGDLPALQDAVTVVGYPIGGDTISV  241

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  242   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVEN  301

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+ DYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR++E
Sbjct  302   IGYVIPTPVIMHFIHDYEKNGAYTGFPILGVEWQKMENPDLRVSMGMGPDMKGVRIRRIE  361

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + LK  DVI+SFD V++  +GT+PFR  ERI+F YL+S+K++GD A + ++R  
Sbjct  362   PTAPESHLLKPSDVILSFDGVKIANDGTIPFRHGERISFSYLVSQKYTGDKAVVKVLRNS  421

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E ++  I L+    L+P HI+G  PSY I+AG VFT +S P ++ E     E    +K+L
Sbjct  422   EILEFNIKLAAHKRLIPAHIKGKPPSYFIIAGFVFTSVSVPYLRSEYGKDYEFDAPVKIL  481

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYE+I N Q+L  NGK ++N+ +LA ++++C 
Sbjct  482   DKHLHAMAQSVDEQVVVVSQVLVADINIGYEEIVNTQVLSFNGKPVKNLKNLADMVENCD  541

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL F+     +VVL+   A   +  IL  + IPS  S DL
Sbjct  542   DEYLKFDLEYQQIVVLQTSNAKAATLGILATHCIPSAMSDDL  583



>ref|XP_004298924.1| PREDICTED: protease Do-like 9-like [Fragaria vesca subsp. vesca]
Length=567

 Score =   508 bits (1309),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 248/462 (54%), Positives = 336/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+CTHT P++SLPWQ++RQ++S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  104   MDAVVKVFCTHTEPNFSLPWQRKRQFSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGS  163

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  164   DTKYLATVLAIGTECDIAMLTVDDDEFWEGVSPVEFGELPALQDAVTVVGYPIGGDTISV  223

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  224   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGTCVGIAFQSLKHEDAEN  283

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF++DYE+NG YTGFP LG+  QK+ENP LR  + + P  +GV IR+++
Sbjct  284   IGYVIPTPVIMHFIKDYEKNGAYTGFPILGIEWQKMENPDLRTSMGMKPDQKGVRIRRID  343

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+++SFD V +  +GTVPFR  ERI F YLIS+K++GD +++ ++R  
Sbjct  344   PTALESQVLKPSDILLSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDNSKVKVLRNS  403

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E +   I L+    L+P HI+G  PSY IVAG VFT +S P ++ E     E    +KLL
Sbjct  404   EILSFDIKLASHKRLIPSHIKGRPPSYYIVAGFVFTAVSVPYLRSEYGKDYEFEAPVKLL  463

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S      EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+  LA ++++C 
Sbjct  464   DKMLHSLRQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLASMVENCD  523

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+     + VL+ + A   +  IL  + IPS  S DL
Sbjct  524   DEFLKFDLEYQQVAVLQTKTAKAATLDILATHCIPSAMSDDL  565



>emb|CBI15070.3| unnamed protein product [Vitis vinifera]
Length=464

 Score =   504 bits (1298),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 245/462 (53%), Positives = 336/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  1     MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGS  60

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             D KY+A VLA G ECDIA+L+V  +EFW+G  P++FG+LP LQDAVTVVGYP+GGDTISV
Sbjct  61    DVKYLATVLAIGTECDIAMLTVNDDEFWEGVSPVEFGNLPTLQDAVTVVGYPIGGDTISV  120

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFN+ G C+G+AFQ  + ++ EN
Sbjct  121   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNEKGNCVGIAFQSLKHEDAEN  180

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP L +  QK+ENP LR  + + P  +GV +R+++
Sbjct  181   IGYVIPTPVIKHFIQDYEKNGAYTGFPILCLEWQKMENPDLRMAMGMKPDQKGVRVRRID  240

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++GD A + ++R  
Sbjct  241   PTAPESKVLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDNATITVLRDS  300

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + +K  I L+    ++P H +G  PSY I+AG VF+ +S P ++ E     E    +KLL
Sbjct  301   KMLKFNIKLATHRRIIPAHNKGKPPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEAPVKLL  360

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S    + EQ+VV+SQVL  ++NIGYEDI N Q+L LNGK ++N+  LA++++SC 
Sbjct  361   DKLLHSMPQSEDEQLVVVSQVLVADINIGYEDIVNTQVLALNGKPVKNLKSLANMVESCD  420

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+     +VVL  + A   +  IL  + IPS+ S DL
Sbjct  421   DEFLKFDLEYQQIVVLRTKTAKAATLDILTTHCIPSKMSDDL  462



>ref|XP_007155398.1| hypothetical protein PHAVU_003G198000g [Phaseolus vulgaris]
 gb|ESW27392.1| hypothetical protein PHAVU_003G198000g [Phaseolus vulgaris]
Length=588

 Score =   509 bits (1310),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 334/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             +++VVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  125   MDSVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGS  184

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  185   DTKYLATVLAIGTECDIAMLTVDDDEFWQGMSPVEFGELPALQDAVTVVGYPIGGDTISV  244

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  245   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDAEN  304

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF++DYE+NG YTGFP LGV  QK+ENP LR    + P  +GV IR+++
Sbjct  305   IGYVIPTPVIMHFIRDYEKNGGYTGFPILGVEWQKMENPDLRMATGMRPDQKGVRIRRID  364

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  DVI+SFD + +  +GTVPFR  ERI F YLIS+K++GD A + ++R  
Sbjct  365   PTAPESKVLEPSDVILSFDGIDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIKVLRNP  424

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + +K  I L     L+P H +G  PSY I+AG VFT +S P ++ E     E    +KLL
Sbjct  425   DILKFDIKLDSHRRLIPSHSKGKPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLL  484

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S      EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+  LA +++SC 
Sbjct  485   DKLLHSLPQSPDEQLVVVSQVLVADINIGYEDIVNIQVLAFNGKPVKNLKSLATMVESCN  544

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL F+   + +VVL  + A  T+  IL  + IPS  S DL
Sbjct  545   DEYLKFDLDYDQIVVLRSKTAKATTLDILATHCIPSAMSDDL  586



>ref|XP_004508846.1| PREDICTED: protease Do-like 9-like [Cicer arietinum]
Length=582

 Score =   508 bits (1309),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 252/462 (55%), Positives = 334/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             +++VVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  119   MDSVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGS  178

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  179   DTKYLATVLAIGTECDIAMLTVDDDEFWQGMSPVEFGDLPTLQDAVTVVGYPIGGDTISV  238

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFN  G C+G+AFQ  + ++VEN
Sbjct  239   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNGKGNCVGIAFQSLKHEDVEN  298

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + S++ GV IR+++
Sbjct  299   IGYVIPTPVIMHFIQDYEKNGGYTGFPILGVEWQKMENPDLRMSMGMKSDQKGVRIRRID  358

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PTS  +  LK  DVI+SFD V +  +GTVPFR  ERI F YLIS+K++GD A + ++R  
Sbjct  359   PTSPEYKVLKPSDVILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDDAAIKVLRNS  418

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
               +K  I L     L+P H +G  PSY IVAG VF+ +S P ++ E     E    +K+L
Sbjct  419   NVLKFNIKLDGHRRLIPAHSKGKPPSYYIVAGFVFSTVSVPYLRSEYGKDYEYEAPVKIL  478

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  Y+      EQ+VV+SQVL  ++NIGYEDI N Q++  NGK ++N+  LA +++SC 
Sbjct  479   EKLLYAMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVVAFNGKPVKNLKSLAAMVESCD  538

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL F+     +VVL  + A   +  IL  + IPS  S DL
Sbjct  539   DEYLKFDLDYEQIVVLRTKTAKAATLDILTTHCIPSAMSDDL  580



>ref|XP_008341480.1| PREDICTED: protease Do-like 9 [Malus domestica]
Length=580

 Score =   508 bits (1307),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 250/462 (54%), Positives = 335/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  117   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHHTQVKLKKRGS  176

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             +TKY+A VLA G ECDIA+L+V  +EFWKG   L+FG LP LQDAVTVVGYP+GGDTISV
Sbjct  177   ETKYLATVLAIGTECDIAMLTVSDDEFWKGVSXLEFGELPALQDAVTVVGYPIGGDTISV  236

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND GEC+G+AFQ  + ++ EN
Sbjct  237   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGECVGIAFQSLKHEDAEN  296

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LG+  QK+ENP LR  + +  ++ GV IR+VE
Sbjct  297   IGYVIPTPVIKHFIQDYEKNGAYTGFPVLGIEWQKMENPDLRISMGMRXDQKGVRIRRVE  356

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + L+  DVI+SFD V +  +GTVPFR  ERI F YL+S+K++ D+A + ++R  
Sbjct  357   PTAPHSHVLQPSDVILSFDGVNIANDGTVPFRHGERIGFSYLVSQKYTXDSALVKVLRNS  416

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E ++  I L     L+P HI+G  PSY IV G VF  +S P ++ E     E    +KLL
Sbjct  417   EILEYNIKLGTHKRLIPAHIKGKPPSYYIVGGFVFAAVSVPYLRSEYGKDYEYDAPVKLL  476

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+  L  ++++C 
Sbjct  477   DKHLHAMAESIDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLVSMVENCD  536

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL F+   N +VVL+ + A  ++  IL  + IPS  S DL
Sbjct  537   DEYLKFDLEYNQMVVLQTKTAKASTLDILLTHCIPSAMSDDL  578



>emb|CDY53116.1| BnaCnng24440D [Brassica napus]
Length=581

 Score =   508 bits (1307),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 338/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S  S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  118   MDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  177

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  178   DTKYLATVLAIGTECDIALLTVNDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  237

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  238   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGRCVGIAFQSLKHEDAEN  297

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++ KYTGFP +G+  QK+ENP LR  + + S++ GV IR++E
Sbjct  298   IGYVIPTPVIGHFIQDYEKHNKYTGFPVIGIEWQKMENPDLRKKMGMESHQKGVRIRRIE  357

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD+A + I+R  
Sbjct  358   PTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVKILRNK  417

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             E ++  I L+    L+P HI G  PSY IVAG VFT +S P ++    +E E    +KLL
Sbjct  418   EILEFNIKLAIHKKLIPGHIGGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLL  477

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL +++NIGYE+I N Q+L  NGK ++N+  LA ++++C 
Sbjct  478   DKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGKPVKNLKCLAEMVENCD  537

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+Y+ F    + +VVL+ + A   +  IL  + IPS  S DL
Sbjct  538   DEYMEFSLDYDQIVVLQTKTAKEATLDILTTHCIPSAMSDDL  579



>ref|XP_007036141.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036142.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036143.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036144.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036145.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036146.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20642.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20643.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20644.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20645.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20646.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20647.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
Length=589

 Score =   508 bits (1307),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 334/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVKVK+RG 
Sbjct  126   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKVKKRGS  185

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  186   DTKYLATVLAIGTECDIAMLTVNDDEFWEGVSPVEFGELPALQDAVTVVGYPIGGDTISV  245

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++VEN
Sbjct  246   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDVEN  305

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+N  YTGFP LGV  QK+ENP LRA + +  ++ GV IR+V+
Sbjct  306   IGYVIPTPVIQHFIQDYEKNEAYTGFPILGVEWQKMENPDLRAAMGMKIDQKGVRIRRVD  365

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++GD++ + ++R  
Sbjct  366   PTAPESGVLKSSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYAGDSSAIKVLRNS  425

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E +   I L+    L+P H +G  PSY I+AG VFT +S P ++ E     E    +KLL
Sbjct  426   EILNFNIKLASHRRLIPAHNKGRPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLL  485

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S      EQ+VV+SQVL  + NIGYEDI N Q+L  NGK ++N+  LA ++++C+
Sbjct  486   DKLLHSMPQSPDEQLVVVSQVLVADTNIGYEDIVNTQVLAFNGKPVKNLKSLAEMVENCE  545

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+     +VVL  + A   +  IL  + IPS  S DL
Sbjct  546   DEFLKFDLEYEQMVVLRTKTAKAATPDILAMHCIPSAMSEDL  587



>ref|XP_006836679.1| hypothetical protein AMTR_s00088p00077590 [Amborella trichopoda]
 gb|ERM99532.1| hypothetical protein AMTR_s00088p00077590 [Amborella trichopoda]
Length=594

 Score =   508 bits (1307),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 249/462 (54%), Positives = 344/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F++   ++LTNAH VEH TQVK+K+RG 
Sbjct  131   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIVSGRRVLTNAHSVEHYTQVKLKKRGS  190

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  191   DTKYLATVLAIGTECDIAMLTVNDDEFWQGVSPVEFGSLPALQDAVTVVGYPIGGDTISV  250

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  251   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGQCVGIAFQSLKHEDVEN  310

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF++DYE++G YTGFP LGV  QK+ENP LR  + + SN+ GV IR+VE
Sbjct  311   IGYVIPTPVIMHFIKDYEQSGDYTGFPVLGVEWQKMENPDLRKAMGMTSNQKGVRIRRVE  370

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+ A   LK+ D+I+SFDD+ +  +GTVPFR  ERI F YL+S+K++G+TA++ I+R  
Sbjct  371   PTAPAFKFLKQSDIILSFDDIDIANDGTVPFRHGERIGFSYLVSQKYTGETAKIKILRNA  430

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIG----LKLL  1574
             + ++ ++ L+    LVP HI+G  PSY I+AG VF+ +S P ++ E          +KLL
Sbjct  431   KILEYKVELATHKRLVPAHIKGKPPSYYIIAGFVFSAISVPYLRSEYGKDYDYDSPVKLL  490

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S +  + EQ+VV+SQVL  ++NIGYEDI N Q+L  NG+ I+N+ HLA+L+++ +
Sbjct  491   DKLLHSMSQTEDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGQPIKNLKHLANLVENYE  550

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
              ++L F      +VVLE + A   +  IL  + IP+  S DL
Sbjct  551   GEFLQFNLDYQQIVVLETKTARAATVDILTTHCIPAAMSDDL  592



>emb|CDY44585.1| BnaA04g10050D [Brassica napus]
Length=581

 Score =   507 bits (1306),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 338/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S  S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  118   MDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  177

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  178   DTKYLATVLAIGTECDIALLTVNDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  237

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  238   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGRCVGIAFQSLKHEDAEN  297

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++ KYTGFP +G+  QK+ENP LR  + + S++ GV IR++E
Sbjct  298   IGYVIPTPVIGHFIQDYEKHNKYTGFPVIGIEWQKMENPDLRKKMGMESHQKGVRIRRIE  357

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD+A + I+R  
Sbjct  358   PTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVKILRNK  417

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             E ++  I L+    L+P HI G  PSY IVAG VFT +S P ++    +E E    +KLL
Sbjct  418   EILEFNIKLAIHKKLIPGHIGGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLL  477

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL +++NIGYE+I N Q+L  NGK ++N+  LA ++++C 
Sbjct  478   DKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGKPVKNLKCLAEMVENCD  537

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+Y+ F    + +VVL+ + A   +  IL  + IPS  S DL
Sbjct  538   DEYMEFSLDYDQIVVLQTKTAKEATLDILTTHCIPSAMSDDL  579



>ref|XP_009139975.1| PREDICTED: protease Do-like 9 [Brassica rapa]
Length=581

 Score =   507 bits (1305),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 338/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S  S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  118   MDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  177

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  178   DTKYLATVLAIGTECDIALLTVNDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  237

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  238   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGRCVGIAFQSLKHEDAEN  297

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++ KYTGFP +G+  QK+ENP LR  + + S++ GV IR++E
Sbjct  298   IGYVIPTPVIGHFIQDYEKHNKYTGFPVIGIEWQKMENPDLRKKMGMESHQKGVRIRRIE  357

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD+A + I+R  
Sbjct  358   PTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVKILRNK  417

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             E ++  I L+    L+P HI G  PSY IVAG VFT +S P ++    +E E    +KLL
Sbjct  418   EILEFNIKLAIHKKLIPGHIGGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLL  477

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL +++NIGYE+I N Q+L  NGK ++N+  LA ++++C 
Sbjct  478   DKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGKPVKNLKCLAEMVENCD  537

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+Y+ F    + +VVL+ + A   +  IL  + IPS  S DL
Sbjct  538   DEYMEFSLDYDQIVVLQTKTAKEATLDILTTHCIPSAMSDDL  579



>ref|XP_010678718.1| PREDICTED: protease Do-like 9 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score =   503 bits (1296),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 240/461 (52%), Positives = 331/461 (72%), Gaps = 4/461 (1%)
 Frame = +3

Query  507   FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRG  686
              +++VVKV+C HT P++SLPWQ++RQ+ S+ + F+I   ++LTNAH VE+ TQVK+K+RG
Sbjct  21    LMDSVVKVFCVHTKPNFSLPWQRKRQHRSSSTGFVIAGRRILTNAHSVEYYTQVKLKKRG  80

Query  687   DDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTIS  866
              DTKY+A VLA G ECDIALL+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTIS
Sbjct  81    SDTKYLATVLAIGAECDIALLTVKDDEFWEGVSPVEFGELPALQDAVTVVGYPIGGDTIS  140

Query  867   VTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVE  1046
             VT GVVSR+E+ SY HG +ELLG+Q+DAA+N GNSGGPAFND G C+G+AFQ  + ++ E
Sbjct  141   VTSGVVSRMEILSYVHGWTELLGLQVDAAINSGNSGGPAFNDKGNCVGIAFQSMKHEDAE  200

Query  1047  NIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKV  1223
             NIGYVIPT V+ HF+QDYERNG YTGFP +G   QK+ENP LR  + + S++ G+L+ +V
Sbjct  201   NIGYVIPTPVIIHFIQDYERNGAYTGFPIIGFEWQKMENPDLRMAMGMKSDQRGILVTRV  260

Query  1224  EPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRA  1403
             E T+     L+  DVI+SFD V +G +GTVPFR  ERI F YLIS+K++GD A++ ++R 
Sbjct  261   EATAPEAVVLQPSDVILSFDGVGIGNDGTVPFRHGERIGFNYLISKKYTGDHAKIKLLRD  320

Query  1404  GEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED--SIGLKLLT  1577
                 +  I L P   L+P  I+ G PSY I AG VFT +S P +  E  D   + ++LL 
Sbjct  321   SVMHEFDIKLDPYKKLIPACIKDGPPSYYIFAGFVFTAVSVPYLFSEYSDESDVPVELLH  380

Query  1578  KARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKD  1757
             K  +S A+ K E+++++SQVL  ++NIGYE+I+N Q+  +NGK ++N+     +++SC +
Sbjct  381   KLHHSMADSKDEELLIISQVLVADINIGYENITNVQVTAVNGKPVKNLKSFTSMVESCSE  440

Query  1758  KYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             +YL F+   N  VVL  E A   +  IL  + IPS  S DL
Sbjct  441   EYLKFDLEFN-KVVLRTETAKAATADILATHCIPSAMSDDL  480



>ref|XP_006405537.1| hypothetical protein EUTSA_v10027697mg [Eutrema salsugineum]
 gb|ESQ46990.1| hypothetical protein EUTSA_v10027697mg [Eutrema salsugineum]
Length=589

 Score =   507 bits (1305),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 250/465 (54%), Positives = 338/465 (73%), Gaps = 5/465 (1%)
 Frame = +3

Query  501   ANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKR  680
             A  ++AVVKV+C HT P++SLPWQ++RQY+S  S F+IG  ++LTNAH VEH TQVK+K+
Sbjct  123   APSMDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQVKLKK  182

Query  681   RGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDT  860
             RG DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP L + VTVVGYP+GGDT
Sbjct  183   RGSDTKYLATVLAIGTECDIALLTVTDDEFWEGVSPVEFGDLPALHNDVTVVGYPIGGDT  242

Query  861   ISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDE  1040
             ISVT GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++
Sbjct  243   ISVTSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHED  302

Query  1041  VENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIR  1217
              ENIGYVIPT V+ HF+QDYE++ KYTGFP +G+  QK+ENP LR  + + S++ GV IR
Sbjct  303   AENIGYVIPTPVIKHFIQDYEKHDKYTGFPVIGIEWQKMENPDLRKKMGMESHQKGVRIR  362

Query  1218  KVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGII  1397
             ++EPT+     LK  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD+A + ++
Sbjct  363   RIEPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVKVL  422

Query  1398  RAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGL  1565
             R  E ++  I L+    L+P HI G  PSY IVAG VFT +S P ++    +E E    +
Sbjct  423   RNKEILEFNIKLAIHKKLIPAHISGKPPSYYIVAGFVFTTVSVPYLRSEYGKEYEFDAPV  482

Query  1566  KLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLD  1745
             KLL K  ++ A    EQ+VV+SQVL +++NIGYEDI N Q+L  NGK ++N+  LA +++
Sbjct  483   KLLDKHLHAMAQSVDEQLVVVSQVLVSDINIGYEDIVNTQVLAFNGKPVKNLKSLAEMVE  542

Query  1746  SCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             +C D+Y+ F    + LVVL+ + A   +  IL  + IPS  S DL
Sbjct  543   NCDDEYMEFNLDYDQLVVLQTKTAKEATLDILTTHCIPSAMSDDL  587



>ref|XP_011028602.1| PREDICTED: protease Do-like 9 [Populus euphratica]
Length=556

 Score =   506 bits (1302),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 250/462 (54%), Positives = 335/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  93    MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIRGRRVLTNAHSVEHYTQVKLKKRGS  152

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  153   DTKYLATVLAIGTECDIALLTVNDDEFWEGVSPVEFGELPALQDAVTVVGYPIGGDTISV  212

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  213   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGQCVGIAFQSLKHEDAEN  272

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LG+  QK+ENP LR  + + P  +GV IR+V+
Sbjct  273   IGYVIPTPVIKHFIQDYEKNGAYTGFPFLGIEWQKMENPDLRMAMGMKPDQKGVRIRRVD  332

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD A + + R  
Sbjct  333   PTALESEVLQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIKVFRNS  392

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             + ++  I LS    L+P H++G  PSY I+AG VFT +S P ++    +E E    +KLL
Sbjct  393   KTLEFVIKLSTHRRLIPPHVKGKPPSYYIIAGFVFTTVSVPYLRSEYGKEYEFEAPVKLL  452

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S      EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+  LA ++++C 
Sbjct  453   DKLLHSMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLASMVENCD  512

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+   + +VVL  + A   +  IL  + IPS  S DL
Sbjct  513   DEFLKFDLEYDQIVVLRMKTAKEATVDILTTHCIPSAISDDL  554



>ref|XP_002275131.1| PREDICTED: protease Do-like 9 [Vitis vinifera]
 ref|XP_010660947.1| PREDICTED: protease Do-like 9 [Vitis vinifera]
 ref|XP_010660948.1| PREDICTED: protease Do-like 9 [Vitis vinifera]
Length=579

 Score =   506 bits (1304),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 250/462 (54%), Positives = 335/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  116   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIEGRRVLTNAHSVEHHTQVKLKKRGS  175

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW G +P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  176   DTKYLATVLAIGTECDIALLTVNDDEFWDGVKPVEFGDLPALQDAVTVVGYPIGGDTISV  235

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPA ND G+C+G+AFQ  + ++VEN
Sbjct  236   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAINDKGKCVGIAFQSLKHEDVEN  295

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF++DYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR++E
Sbjct  296   IGYVIPTPVIMHFIRDYEKNGAYTGFPILGVEWQKMENPDLRVSMGMGPDQKGVRIRRIE  355

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + LK  DVI+SFD V +  +GTVPFR  ERI F YL+S+K++GD A + ++R  
Sbjct  356   PTAPESHVLKPSDVILSFDGVNIANDGTVPFRHGERIGFSYLVSQKYTGDNAVVKVLRNS  415

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + ++  I L+    L+  HI+G  PSY I+ G VFT +S P ++ E     E    +KLL
Sbjct  416   QILEFCIKLAIHKRLIAAHIKGRPPSYYIIGGFVFTAVSVPYLRSEYGKDYEFDAPVKLL  475

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  YS A    EQ+VV++QVL  ++NIGYE+I N Q+L  NGK ++N+  LA +++SC 
Sbjct  476   DKHLYSMAQSVDEQLVVVAQVLVADINIGYEEIVNTQVLSFNGKPVKNLKSLATMVESCD  535

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L FE     +VVL+ + A   +  IL  + IPS  S DL
Sbjct  536   DEFLKFELEYQQIVVLQTKTAKAATLDILTTHCIPSAMSDDL  577



>ref|XP_008239730.1| PREDICTED: protease Do-like 9 [Prunus mume]
Length=587

 Score =   506 bits (1304),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 249/462 (54%), Positives = 332/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  124   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGS  183

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+  EFW G  P++FG LP LQD+VTVVGYP+GGDTISV
Sbjct  184   DTKYLATVLAIGTECDIAMLTVDDNEFWDGVSPVEFGDLPALQDSVTVVGYPIGGDTISV  243

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  244   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDRGNCVGIAFQSLKHEDAEN  303

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR+++
Sbjct  304   IGYVIPTPVIMHFIQDYEKNGAYTGFPILGVEWQKMENPDLRMSMGMKPDQKGVRIRRID  363

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD + + ++R  
Sbjct  364   PTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDNSVVKVLRNS  423

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E +   I L+    L+P H +G  PSY I+AG VFT +S P ++ E     E    +KLL
Sbjct  424   EILSFDIKLASHKRLIPAHNKGRPPSYYIIAGFVFTAVSVPYLRSEYGKDYEFEAPVKLL  483

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S      EQ+VV+SQVL  ++NIGYE+I N Q+L LNGK ++N+ +LA +++ C+
Sbjct  484   DKMLHSLPQSPDEQLVVVSQVLVADINIGYEEIVNTQVLALNGKPVKNLKNLASMVEECE  543

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+     +VVL    A   +  IL  + IPS  S DL
Sbjct  544   DEFLKFDLEYQQMVVLRTNTAKEATLDILATHCIPSAMSDDL  585



>ref|XP_002280249.1| PREDICTED: protease Do-like 9 [Vitis vinifera]
Length=575

 Score =   506 bits (1303),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 245/462 (53%), Positives = 336/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  112   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGS  171

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             D KY+A VLA G ECDIA+L+V  +EFW+G  P++FG+LP LQDAVTVVGYP+GGDTISV
Sbjct  172   DVKYLATVLAIGTECDIAMLTVNDDEFWEGVSPVEFGNLPTLQDAVTVVGYPIGGDTISV  231

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFN+ G C+G+AFQ  + ++ EN
Sbjct  232   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNEKGNCVGIAFQSLKHEDAEN  291

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP L +  QK+ENP LR  + + P  +GV +R+++
Sbjct  292   IGYVIPTPVIKHFIQDYEKNGAYTGFPILCLEWQKMENPDLRMAMGMKPDQKGVRVRRID  351

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++GD A + ++R  
Sbjct  352   PTAPESKVLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDNATITVLRDS  411

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + +K  I L+    ++P H +G  PSY I+AG VF+ +S P ++ E     E    +KLL
Sbjct  412   KMLKFNIKLATHRRIIPAHNKGKPPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEAPVKLL  471

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S    + EQ+VV+SQVL  ++NIGYEDI N Q+L LNGK ++N+  LA++++SC 
Sbjct  472   DKLLHSMPQSEDEQLVVVSQVLVADINIGYEDIVNTQVLALNGKPVKNLKSLANMVESCD  531

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+     +VVL  + A   +  IL  + IPS+ S DL
Sbjct  532   DEFLKFDLEYQQIVVLRTKTAKAATLDILTTHCIPSKMSDDL  573



>emb|CAN74170.1| hypothetical protein VITISV_013882 [Vitis vinifera]
Length=576

 Score =   506 bits (1303),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 245/462 (53%), Positives = 336/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  113   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGS  172

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             D KY+A VLA G ECDIA+L+V  +EFW+G  P++FG+LP LQDAVTVVGYP+GGDTISV
Sbjct  173   DVKYLATVLAIGTECDIAMLTVNDDEFWEGVSPVEFGNLPTLQDAVTVVGYPIGGDTISV  232

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFN+ G C+G+AFQ  + ++ EN
Sbjct  233   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNEKGNCVGIAFQSLKHEDAEN  292

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP L +  QK+ENP LR  + + P  +GV +R+++
Sbjct  293   IGYVIPTPVIKHFIQDYEKNGAYTGFPILCLEWQKMENPDLRMAMGMKPDQKGVRVRRID  352

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++GD A + ++R  
Sbjct  353   PTAPESKVLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDNATITVLRDS  412

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + +K  I L+    ++P H +G  PSY I+AG VF+ +S P ++ E     E    +KLL
Sbjct  413   KMLKFNIKLATHRRIIPAHNKGKPPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEAPVKLL  472

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S    + EQ+VV+SQVL  ++NIGYEDI N Q+L LNGK ++N+  LA++++SC 
Sbjct  473   DKLLHSMPQSEDEQLVVVSQVLVADINIGYEDIVNTQVLALNGKPVKNLKSLANMVESCD  532

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+     +VVL  + A   +  IL  + IPS+ S DL
Sbjct  533   DEFLKFDLEYQQIVVLRTKTAKAATLDILTTHCIPSKMSDDL  574



>ref|XP_004306333.1| PREDICTED: protease Do-like 9-like [Fragaria vesca subsp. vesca]
Length=541

 Score =   504 bits (1299),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 243/462 (53%), Positives = 337/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             +++VVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  78    MDSVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGKRVLTNAHSVEHHTQVKLKKRGS  137

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             +TKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  138   ETKYLATVLAIGTECDIAMLTVSDDEFWEGVSPVEFGELPALQDAVTVVGYPIGGDTISV  197

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  198   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGTCVGIAFQSLKHEDAEN  257

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+ DYE+NG YTGFP +G+  QK+ENP LR  + + +++ GV IR++E
Sbjct  258   IGYVIPTPVIKHFITDYEKNGAYTGFPIIGIEWQKMENPDLRTSMGMKADQKGVRIRRIE  317

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + L+  DVI+SFD V +  +GTVPFR  ERI F YL+S+K++GDTA + ++R  
Sbjct  318   PTAPDSHLLQPSDVILSFDRVNIANDGTVPFRHGERIGFSYLVSQKYTGDTALVKVLRNS  377

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + ++ +I L     L+P HI G  PSY I+ G VF+ +S P ++ E     +    +KLL
Sbjct  378   KILEFKIKLGTHKRLIPAHINGKPPSYYIIGGFVFSAVSVPYLRSEYGKDYDFDAPVKLL  437

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+ +LA +++SC 
Sbjct  438   DKHLHAMAESSDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKNLATMVESCD  497

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             ++YL F+   N +V L+ + A   +  IL  + IPS  S DL
Sbjct  498   EEYLKFDLEYNQMVALQTKTAKAATLDILLTHCIPSAMSDDL  539



>ref|XP_003516811.1| PREDICTED: protease Do-like 9-like [Glycine max]
Length=544

 Score =   504 bits (1299),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 250/462 (54%), Positives = 334/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             + AVVKV+C HT P++SLPWQ++RQY+S+ S  ++G  ++LTNAH VEH TQVK+K+RG 
Sbjct  81    MEAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGLIVGGRRVLTNAHSVEHHTQVKLKKRGS  140

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  141   DTKYLATVLAIGTECDIAMLTVSDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  200

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  201   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVEN  260

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF++DYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR++E
Sbjct  261   IGYVIPTPVILHFIRDYEKNGAYTGFPILGVEWQKMENPDLRMSMGMGPDQKGVRIRRIE  320

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + LK  DVI+SFD V +  +GTVPFR  ERI F YL+S+K++GD A + + R  
Sbjct  321   PTAPESHVLKPSDVILSFDGVNISNDGTVPFRHGERIGFSYLVSQKYTGDRALVKVFRNL  380

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + ++  + L+    LVP HI+G  PSY I+AG VFT +S P ++ E     E    +KLL
Sbjct  381   QILEFNVKLATHKRLVPAHIKGRPPSYYIIAGFVFTAVSVPYLRSEYGKDYEFDAPVKLL  440

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S A    EQ+VV+SQVL +++NIGYE+I N Q+L  N K ++N+  LA++++SC 
Sbjct  441   EKHLHSMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNDKPVKNLKSLANIVESCD  500

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D YL F+      VVL+   A   +  IL  + IPS  S DL
Sbjct  501   DDYLKFDLEYQQKVVLKTSTAKAATLDILTTHCIPSAMSDDL  542



>ref|XP_006363999.1| PREDICTED: protease Do-like 9-like [Solanum tuberosum]
Length=582

 Score =   506 bits (1302),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 249/462 (54%), Positives = 342/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  119   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  178

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VL+ G ECDIA+L+V  +EFW+G  PL+FG LP LQDAVTVVGYP+GGDTISV
Sbjct  179   DTKYLATVLSIGTECDIAMLTVNDDEFWEGVSPLEFGDLPALQDAVTVVGYPIGGDTISV  238

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY H S+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  239   TSGVVSRIEILSYVHVSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  298

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP +G+  QK+ENP LR  + +  N+ GV IR+VE
Sbjct  299   IGYVIPTPVIMHFIQDYEKNGAYTGFPIIGIEWQKMENPDLRLSVGMAHNQKGVRIRRVE  358

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   N LK  DVI+SFD V +  +GTVPFR  ERI F YL+S+K++GD A++ ++R  
Sbjct  359   PTAPESNVLKPSDVILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDDAQVKVLRKS  418

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + ++ +I L+    L+P HI+G  PSY IV G VF+ +S P ++ E     E    +KLL
Sbjct  419   KILEFKIKLNAHKRLIPAHIKGKPPSYYIVGGFVFSAVSVPYLRSEYGKDYEFDAPVKLL  478

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYE++ N Q++  NGK ++N+  LA+++++CK
Sbjct  479   DKLLHAMAQSIDEQLVVVSQVLVADINIGYEELVNTQVIAFNGKPVKNLKSLANMVEACK  538

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             ++YL F+   N +VVL+ + A   ++ IL  + IPS  S DL
Sbjct  539   EEYLKFDLDYNQIVVLQTKNAKAATSDILAMHCIPSAMSDDL  580



>ref|XP_007514393.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15830.1| predicted protein [Bathycoccus prasinos]
Length=555

 Score =   504 bits (1297),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 248/463 (54%), Positives = 331/463 (71%), Gaps = 6/463 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
              +AVVKVY  HT P+YSLPWQ++RQ  ST + F++   ++LTNAH VEH TQVK+K+RG 
Sbjct  91    FDAVVKVYAVHTEPNYSLPWQRKRQMPSTSTGFVVEGKRILTNAHSVEHSTQVKLKKRGS  150

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             D K++AKVLA G ECD+ALLSVE E+F++   PL+ G LP+LQD+VTVVGYP+GG  ISV
Sbjct  151   DKKFIAKVLAIGTECDLALLSVEDEKFFENITPLKLGALPKLQDSVTVVGYPIGGVAISV  210

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+EVT YAHG++ELL +QIDAA+N GNSGGPAFN  G   GVAFQ  + D+ EN
Sbjct  211   TSGVVSRVEVTQYAHGATELLSLQIDAAINSGNSGGPAFNSKGMVCGVAFQSLKHDDAEN  270

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V++HF++DYE N +YTGFP+LG   QKLEN  L+   KVP  E GVL+RK+E
Sbjct  271   IGYVIPTPVITHFVRDYELNKRYTGFPALGCDFQKLENADLKRSKKVPEGESGVLLRKLE  330

Query  1227  PTSD-AHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRA  1403
             P S+ A + LK GDV+ +FD V V  +GTVPFR+ ERI+F +L+S+KF G+ AE+ I+R 
Sbjct  331   PISNSAKSGLKTGDVLQNFDGVAVASDGTVPFRAGERISFSHLVSKKFVGENAEIEILRD  390

Query  1404  GEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKL  1571
             G+ MK  + +  +  LVP H+EG  P Y I+AGLVFT +S P ++ E     E    ++L
Sbjct  391   GKPMKFSVPMENKKRLVPVHMEGKTPEYFIIAGLVFTTVSCPYLKSEFGKDWEYDAPVQL  450

Query  1572  LTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSC  1751
             L++          +++V+ SQVLA+E+NIGYED SN  + K NGK I+N+  L  L++SC
Sbjct  451   LSRMYLKDMTEPDQELVICSQVLAHEINIGYEDFSNLAVEKFNGKPIKNLKQLVDLVESC  510

Query  1752  KDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
              ++YL FE     LVVL+ E A  ++  IL  + IPS++S +L
Sbjct  511   SEEYLTFELDMKTLVVLDNEKAKQSTREILDVHAIPSDKSKNL  553



>ref|XP_010528270.1| PREDICTED: protease Do-like 9 [Tarenaya hassleriana]
Length=604

 Score =   505 bits (1301),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 253/462 (55%), Positives = 340/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  141   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIISGRRVLTNAHSVEHHTQVKLKKRGS  200

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  201   DTKYLATVLAIGTECDIALLTVSDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  260

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  261   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  320

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYERNG+YTGFP LGV  QK+ENP LR  + + +++ GV IR++E
Sbjct  321   IGYVIPTPVIVHFIQDYERNGRYTGFPVLGVEWQKMENPDLRKSMGMEAHQKGVRIRRIE  380

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  DVI+SFD V +  +GTVPFR  ERI F YLIS+K++GD+A + ++R  
Sbjct  381   PTAPESQVLKPSDVILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVKVLRNK  440

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             + ++  I LS    L+P HI G  PSY I+AG VFT +S P ++    +E E    +KLL
Sbjct  441   QILEFNIKLSSHKRLIPAHINGKPPSYFIIAGFVFTTVSVPYLRSEYGKEYEFDAPVKLL  500

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S A    EQ+VV+SQVL +++NIGYE+I N Q+L  NGK ++N+  LA ++++C 
Sbjct  501   DKHLHSMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGKPVKNLKSLAEMVENCN  560

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+Y+ FE     +VVL+ + A   +  +L  + IPS  S DL
Sbjct  561   DEYMKFELEYEQIVVLQTKTAKDATLDVLTTHCIPSAMSDDL  602



>ref|XP_008438126.1| PREDICTED: protease Do-like 9 [Cucumis melo]
Length=586

 Score =   504 bits (1299),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 248/462 (54%), Positives = 333/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  123   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGS  182

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFW G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  183   DTKYLATVLAIGTECDIAMLTVDDDEFWVGVSPVEFGELPALQDAVTVVGYPIGGDTISV  242

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  243   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDAEN  302

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF++DYE+NG YTGFP LG+  QK+ENP LR  + +  ++ GV IR+++
Sbjct  303   IGYVIPTPVILHFIRDYEKNGAYTGFPILGLEWQKMENPDLREAMGMKQDQKGVRIRRID  362

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT      LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++GD+A + ++R  
Sbjct  363   PTGPESKVLKPADIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDSAAIKVLRNS  422

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E +     L+    L+P H EG  PSY IVAG VF+ +S P ++ E     E    +KLL
Sbjct  423   ETLSFNYQLATYRRLIPAHNEGRPPSYYIVAGFVFSTVSVPYLRSEYGKDYEYEAPVKLL  482

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S      EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+  LA++++SC 
Sbjct  483   DKLLHSMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLANMVESCD  542

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+     +VVL    A   ++ IL  + IPS  S+DL
Sbjct  543   DEFLKFDLEYQQIVVLRTSTAKAATSDILATHCIPSAMSNDL  584



>ref|XP_004152460.1| PREDICTED: protease Do-like 9-like [Cucumis sativus]
 ref|XP_004157795.1| PREDICTED: protease Do-like 9-like [Cucumis sativus]
 gb|KGN64293.1| hypothetical protein Csa_1G045910 [Cucumis sativus]
Length=586

 Score =   504 bits (1299),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 248/462 (54%), Positives = 333/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  123   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGS  182

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFW G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  183   DTKYLATVLAIGTECDIAMLTVDDDEFWVGVSPVEFGELPALQDAVTVVGYPIGGDTISV  242

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  243   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDAEN  302

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF++DYE+NG YTGFP LG+  QK+ENP LR  + +  ++ GV IR+++
Sbjct  303   IGYVIPTPVILHFIRDYEKNGAYTGFPILGLEWQKMENPDLREAMGMKQDQKGVRIRRID  362

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT      LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++GD+A + ++R  
Sbjct  363   PTGPESKVLKPADIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDSATIKVLRNS  422

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E +     L+    L+P H EG  PSY IVAG VF+ +S P ++ E     E    +KLL
Sbjct  423   ETLSFNYQLATYRRLIPAHNEGRPPSYYIVAGFVFSTVSVPYLRSEYGKDYEYEAPVKLL  482

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S      EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+  LA++++SC 
Sbjct  483   DKLLHSMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLANMVESCD  542

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+     +VVL    A   ++ IL  + IPS  S+DL
Sbjct  543   DEFLKFDLEYQQIVVLRTSTAKAATSDILATHCIPSAMSNDL  584



>ref|XP_004252664.1| PREDICTED: protease Do-like 9 [Solanum lycopersicum]
Length=582

 Score =   504 bits (1298),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 248/462 (54%), Positives = 340/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  119   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  178

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VL+ G ECDIA+L+V  +EFW+G  PL+FG LP LQDAVTVVGYP+GGDTISV
Sbjct  179   DTKYLATVLSIGTECDIAMLTVNDDEFWEGVSPLEFGDLPALQDAVTVVGYPIGGDTISV  238

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY H S+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  239   TSGVVSRIEILSYVHVSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  298

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP +G+  QK+ENP LR  + +  N+ GV IR+VE
Sbjct  299   IGYVIPTPVIMHFIQDYEKNGAYTGFPIIGIEWQKMENPDLRLSMGMAHNQKGVRIRRVE  358

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   N LK  DVI+SFD V +  +GTVPFR  ERI F YL+S+K++GD A++ ++R  
Sbjct  359   PTAPESNVLKPSDVILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDDAQVKVLRKS  418

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + ++ +I L+    L+P HI+G  PSY IV G VF+ +S P ++ E     E    +KLL
Sbjct  419   KTLEFKIKLNAHKRLIPAHIKGKPPSYYIVGGFVFSAVSVPYLRSEYGKDYEFDAPVKLL  478

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYE++ N Q++  NGK ++N+  LA ++++CK
Sbjct  479   DKLLHAMAQSMDEQLVVVSQVLVADINIGYEELVNTQVIAFNGKPVKNLKSLAKMVEACK  538

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             ++Y+ F+   N +VVL+   A   ++ IL  + IPS  S DL
Sbjct  539   EEYMKFDLDYNQIVVLQTTNAKAATSDILAMHCIPSAMSDDL  580



>ref|XP_004306334.1| PREDICTED: protease Do-like 9-like [Fragaria vesca subsp. vesca]
Length=530

 Score =   502 bits (1293),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 245/460 (53%), Positives = 335/460 (73%), Gaps = 3/460 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ+++QY+++ S F+I   ++LTNAH V+H TQVKVK+RG 
Sbjct  67    MDAVVKVFCVHTEPNFSLPWQRKKQYSTSSSGFVIKGRRVLTNAHSVDHHTQVKVKKRGS  126

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  127   DTKYLATVLAIGTECDIAMLTVSDDEFWEGISPVEFGTLPALQDAVTVVGYPIGGDTISV  186

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+++ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  187   TSGVVSRMQILSYVHGSTELLGMQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVEN  246

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIP  V+ HF+ DYE+NG YTGFP +G+  QK+ENP LR  + + P  +GV IR++E
Sbjct  247   IGYVIPIPVIMHFILDYEKNGAYTGFPIIGIEWQKMENPDLRMSMGMTPDQKGVRIRRME  306

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PTS     LK  DVI+SFD V +  +GTV FR  ERI F YL+S+K+ GD A + ++R  
Sbjct  307   PTSPESLLLKPSDVILSFDGVNIANDGTVSFRHGERIGFSYLVSQKYIGDNALVKVLRNS  366

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED--SIGLKLLTK  1580
             + ++  I L+   +L+P HIEG  PSY I+AG VFT +S P ++ E  +   + +KLL K
Sbjct  367   QTLEFNIKLAKHKELIPSHIEGKPPSYYIIAGFVFTAVSVPYLRSEFGNLFDVPIKLLDK  426

Query  1581  ARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDK  1760
               ++ A    EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+  LA+++++C D+
Sbjct  427   HLHAMAESVDEQLVVVSQVLVADINIGYEDIVNNQVLDFNGKPVKNLKSLANMVENCNDE  486

Query  1761  YLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             YL F    N +VVL+ + A   +  IL  + I S  S DL
Sbjct  487   YLKFSLEYNQMVVLQTKTARAATLDILTTHCISSSMSDDL  526



>ref|XP_009140230.1| PREDICTED: protease Do-like 9 [Brassica rapa]
Length=584

 Score =   504 bits (1297),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 248/462 (54%), Positives = 337/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ +RQY+S  S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  121   MDAVVKVFCVHTDPNFSLPWQMKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  180

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  181   DTKYLATVLAIGTECDIALLTVSDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  240

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  241   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  300

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++ KYTGFP +G+  QK+ENP LR  + + S++ GV IR++E
Sbjct  301   IGYVIPTPVIGHFIQDYEKHNKYTGFPVIGIEWQKMENPDLRKKMGMESHQKGVRIRRIE  360

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD+A + I+R  
Sbjct  361   PTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVKILRNR  420

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             E ++  + L+    L+P HI G  PSY IVAG VFT +S P ++    +E E    +KLL
Sbjct  421   EILEFNVKLAIHKKLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEYDAPVKLL  480

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++      EQ+VV+SQVL +++NIGYE+I N Q++  NGK ++N+  LA ++++C 
Sbjct  481   EKHLHAMTQSVDEQLVVVSQVLVSDINIGYEEIVNTQVVAFNGKPVKNLKCLAEMVENCV  540

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+Y+ F    + +VVL+ + A   +  IL  + IPS  S DL
Sbjct  541   DEYMEFYLDYHQIVVLQTKTAKEATLDILTTHCIPSAMSDDL  582



>ref|XP_010254399.1| PREDICTED: protease Do-like 9 isoform X1 [Nelumbo nucifera]
 ref|XP_010254407.1| PREDICTED: protease Do-like 9 isoform X1 [Nelumbo nucifera]
Length=585

 Score =   504 bits (1297),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 249/462 (54%), Positives = 338/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  123   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  182

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  183   DTKYLATVLAIGTECDIAMLTVNDDEFWEGVSPVEFGSLPALQDAVTVVGYPIGGDTISV  242

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++VEN
Sbjct  243   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDVEN  302

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+ DYERN +YTGFP+LGV  QK+ENP LR  + + S++ GV IR+VE
Sbjct  303   IGYVIPTPVIMHFIIDYERNKEYTGFPTLGVEWQKMENPDLRMAMGMTSDQKGVRIRRVE  362

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+++SFD + +  +GTVPFR  ERI F YL+S+K++G+ + + ++R  
Sbjct  363   PTAPESQVLKPSDILLSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGENSVVKVLRNS  422

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E  +  I L+    L+P HI+G  PSY I+AG VFT +S P ++ E     E    +KLL
Sbjct  423   EIFEFNIKLATYKRLIPAHIKGRPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYDAPVKLL  482

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A  + EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+  LA ++++C 
Sbjct  483   DKHLHAMAQSEDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLASMVENCD  542

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L FE     LVVL+ + A   +  I+  + IPS  S DL
Sbjct  543   DEFLKFELEYQQLVVLQTKIAKAATLDIVTTHCIPSAMSEDL  584



>ref|XP_004965071.1| PREDICTED: protease Do-like 9-like [Setaria italica]
Length=604

 Score =   503 bits (1296),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 248/462 (54%), Positives = 338/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  141   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  200

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+VE +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  201   DTKYLATVLAIGTECDIAMLTVEDDEFWEGVSPVEFGSLPALQDAVTVVGYPIGGDTISV  260

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  261   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  320

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF++DYE++G+YTGFP LG+  QK+ENP LR  + + S++ GV +R+VE
Sbjct  321   IGYVIPTPVIKHFIEDYEKSGEYTGFPILGIEWQKMENPDLRKAMGMKSDQKGVRVRRVE  380

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L   D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  381   PTAPESGCLHPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKARVKLLRNS  440

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  +  I L+    L+P HI+G  PSY IVAG VFT +S P ++ E     E    +KLL
Sbjct  441   KIHEFNIKLATHKRLIPAHIKGRPPSYYIVAGFVFTVVSVPYLRSEYGKDYEYDAPVKLL  500

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL +++NIGYEDI N Q+L  NG  ++N+ HLA +++ C 
Sbjct  501   DKHSHAMAQSPDEQLVVVSQVLVSDINIGYEDIVNIQVLAFNGTPVKNLKHLATMVEECN  560

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             + +L F+   + LVVLE + A   +  IL  + IPS  S DL
Sbjct  561   EAFLKFDLDYDQLVVLETKTAKAATQDILTTHCIPSAMSEDL  602



>emb|CDY15934.1| BnaA04g11770D [Brassica napus]
Length=583

 Score =   503 bits (1294),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 248/462 (54%), Positives = 335/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ +RQY+S  S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  120   MDAVVKVFCVHTDPNFSLPWQMKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  179

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  180   DTKYLATVLAIGTECDIALLTVSDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  239

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  240   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGRCVGIAFQSLKHEDAEN  299

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++ KYTGFP +G+  QK+ENP LR  + + S++ GV IR++E
Sbjct  300   IGYVIPTPVIGHFIQDYEKHNKYTGFPVIGIEWQKMENPDLRKKMGMESHQKGVRIRRIE  359

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D I+SFD V +  +GTVPFR  ERI F YLIS+K++GD+A + I+R  
Sbjct  360   PTAPESQVLKPSDTILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVKILRNR  419

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             E ++  + L+    L+P HI G  PSY IVAG VFT +S P ++    +E E    +KLL
Sbjct  420   EILEFNVKLAIHKKLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEYDAPVKLL  479

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++      EQ+VV+SQVL +++NIGYE+I N Q++  NGK ++N+  LA ++++C 
Sbjct  480   EKHLHAMTQSVDEQLVVVSQVLVSDINIGYEEIVNTQVVAFNGKPVKNLKCLAEMVENCV  539

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+Y+ F    + +VVL+ + A   +  IL  + IPS  S DL
Sbjct  540   DEYMEFYLDYHQIVVLQTKTAKEATLDILTTHCIPSAMSDDL  581



>ref|XP_010272002.1| PREDICTED: protease Do-like 9 [Nelumbo nucifera]
Length=551

 Score =   499 bits (1284),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 238/464 (51%), Positives = 332/464 (72%), Gaps = 9/464 (2%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVV+V+C HT P++SLPWQ++RQ++S+ S F+I   ++LTNAH V++ TQVK+K+RG 
Sbjct  88    MDAVVRVFCVHTKPNFSLPWQRKRQFSSSSSGFVIDGRRVLTNAHSVDYHTQVKLKKRGS  147

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  148   DTKYLATVLAIGTECDIAMLTVKDDEFWEGISPVKFGSLPALQDAVTVVGYPIGGDTISV  207

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T G+VSRIE+ SY HG+++LLG+Q DAA+N GNSGGPAFND G+C+G+AFQ  + +  +N
Sbjct  208   TSGIVSRIEMLSYVHGAAKLLGLQTDAAINSGNSGGPAFNDKGQCVGIAFQSIKHEIADN  267

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIP  VV HF+QDYERNG+YTGFP+LGV LQK+ENP LR  + + P  +GV +R++E
Sbjct  268   IGYVIPVPVVMHFIQDYERNGEYTGFPTLGVDLQKMENPDLRLAMGMTPDQKGVRVRRIE  327

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PTS     LK  DVI+SFD   +  + TV FR+ E I F YL+S+KF G+ A + ++R  
Sbjct  328   PTSPLSQVLKPSDVILSFDGTDITNDETVSFRNGEHIGFSYLVSQKFMGENAVIKVLRNS  387

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQE------ECEDSIGLK  1568
             E  +  I+L+    L+P HI+G  P Y I+AG VFT +S   ++       EC+  +  K
Sbjct  388   ETFEFNIMLASHKRLIPAHIKGRPPPYYIIAGFVFTTVSVLYLRSEYGKDYECDAPV--K  445

Query  1569  LLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDS  1748
             LL K  ++ A  + E++VV+SQVL  ++NIGYE+I N Q+L  NG  ++N+  LA ++++
Sbjct  446   LLDKHLHAMAQSEDEELVVVSQVLVADINIGYENIVNTQVLACNGNPVKNLKSLASMVEN  505

Query  1749  CKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             C D++L FE     LVVL+ + A   +  IL  + IPS  S DL
Sbjct  506   CDDQFLKFELEYQQLVVLQTKTAKAATLDILTTHCIPSAMSDDL  549



>ref|XP_010913539.1| PREDICTED: protease Do-like 9 isoform X1 [Elaeis guineensis]
Length=582

 Score =   500 bits (1287),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 248/462 (54%), Positives = 335/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  119   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHYTQVKLKKRGS  178

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKYVA VLA G ECDIALL+V  +EFWKG  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  179   DTKYVASVLAIGTECDIALLTVSDDEFWKGVSPVEFGSLPALQDAVTVVGYPIGGDTISV  238

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  239   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVEN  298

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACL-KVPSNEGVLIRKVE  1226
             IGYVIPT V+ HF+ DYE++G+YTGFP LG+  QK+ENP LR  +  +P  +GV +R+VE
Sbjct  299   IGYVIPTPVILHFIHDYEKSGEYTGFPILGIEWQKMENPDLRKAMGMMPDQKGVRVRRVE  358

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     +K  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  359   PTAPESEFIKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGENAVVKVLREK  418

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  +  I L+    L+P HI G  PSY I+AG VF  +S P ++ E     E    +KLL
Sbjct  419   KVYEFNIKLATHKRLIPAHIRGKPPSYYIIAGFVFAAISVPYLRSEYGKDYEYDAPVKLL  478

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S A    EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+  LA ++++C 
Sbjct  479   DKHLHSMAQSHDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLATMVENCD  538

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             +++L F+     +VVL+ + A   +  IL  + IPS  S DL
Sbjct  539   EEFLRFDLEYQQIVVLQTKTAKAATKDILLTHCIPSAVSDDL  580



>ref|XP_009344540.1| PREDICTED: protease Do-like 9 isoform X2 [Pyrus x bretschneideri]
Length=552

 Score =   498 bits (1283),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 244/460 (53%), Positives = 331/460 (72%), Gaps = 3/460 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ+++QY+S+ S F+I   ++LTNAH V+H TQVK+K+RG 
Sbjct  68    MDAVVKVFCVHTEPNFSLPWQRKKQYSSSSSGFVIRGRRVLTNAHSVDHHTQVKLKKRGS  127

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  128   DTKYLATVLAIGTECDIAMLTVSDDEFWEGISPVEFGDLPALQDAVTVVGYPIGGDTISV  187

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+  Y HGS+ELLG+QIDAA+N GNSGGPAFND GEC+G+AFQ  + ++ EN
Sbjct  188   TSGVVSRMEILPYVHGSTELLGMQIDAAINSGNSGGPAFNDKGECVGIAFQSLKHEDAEN  247

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIP  V+ HF++DYE+NG YTGFP LG+  QK+ENP LR  + + P  +G+ IR++E
Sbjct  248   IGYVIPVPVIMHFIRDYEKNGVYTGFPILGIKWQKMENPDLRMSMGMRPDQKGIRIRRLE  307

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  DVI+SFD V +  +GTVPFR  ERI F YL+S+K+ GD A + ++R  
Sbjct  308   PTAPEFQLLKPSDVILSFDGVNIASDGTVPFRHGERIGFSYLVSQKYIGDNAVVQVLRNS  367

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED--SIGLKLLTK  1580
             E ++  I L+   +L+P HIEG  PSY IVAG V T +S P ++ E  +   + +KLL K
Sbjct  368   ETLEFSIKLAKHKELIPSHIEGKPPSYYIVAGFVLTAVSLPYLRSEFGNLFDVPIKLLDK  427

Query  1581  ARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDK  1760
               ++ A    EQ+VV+SQVL  ++NIGYEDI N Q+L  N   ++N+  L  ++++C D+
Sbjct  428   HLHAMAQSTDEQLVVVSQVLVADINIGYEDIVNNQVLTFNDMPVKNLKSLVIMVENCDDE  487

Query  1761  YLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             YL F    N +VVL+ +AA   +  IL  + I S  S DL
Sbjct  488   YLKFGLEYNQMVVLQTKAAKAATLDILTTHCISSSMSDDL  527



>gb|AFW76813.1| hypothetical protein ZEAMMB73_778886 [Zea mays]
Length=596

 Score =   500 bits (1287),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 339/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  133   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHYTQVKLKKRGS  192

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+VE +EFWKG  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  193   DTKYLATVLAIGTECDIAMLTVEDDEFWKGVSPVEFGSLPALQDAVTVVGYPIGGDTISV  252

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  253   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  312

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V++HF++DY+++G+YTGFP LG+  QK+ENP LR  + + +N+ GV IR+VE
Sbjct  313   IGYVIPTPVINHFIEDYKKSGEYTGFPILGIEWQKMENPDLRKAMGMKANQKGVRIRRVE  372

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  373   PTAPESGCLEPSDIILSFDGIDIANDGTVPFRHGERIGFTYLVSQKYTGEKARVKVLRNS  432

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             +  +  I L+    L+P HI+G  PSY IVAG VF  +S P ++    +E E    +KLL
Sbjct  433   KIHEFNIKLATHKRLIPAHIKGRPPSYYIVAGFVFMAVSVPYLRSEYGKEYEYDAPVKLL  492

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYEDI N Q+L  NG  ++N+ HLA +++ C 
Sbjct  493   DKHLHAMAQSSDEQLVVVSQVLVADINIGYEDIVNIQVLAFNGTPVKNLKHLATMVEECN  552

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             + +L F+   + +VVLE + A   +  IL  + IPS  S +L
Sbjct  553   EAFLKFDLDFDQVVVLETKTAKAATQDILTTHCIPSAASEEL  594



>ref|XP_009344539.1| PREDICTED: protease Do-like 9 isoform X1 [Pyrus x bretschneideri]
Length=558

 Score =   498 bits (1282),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 244/460 (53%), Positives = 331/460 (72%), Gaps = 3/460 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ+++QY+S+ S F+I   ++LTNAH V+H TQVK+K+RG 
Sbjct  68    MDAVVKVFCVHTEPNFSLPWQRKKQYSSSSSGFVIRGRRVLTNAHSVDHHTQVKLKKRGS  127

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  128   DTKYLATVLAIGTECDIAMLTVSDDEFWEGISPVEFGDLPALQDAVTVVGYPIGGDTISV  187

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+  Y HGS+ELLG+QIDAA+N GNSGGPAFND GEC+G+AFQ  + ++ EN
Sbjct  188   TSGVVSRMEILPYVHGSTELLGMQIDAAINSGNSGGPAFNDKGECVGIAFQSLKHEDAEN  247

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIP  V+ HF++DYE+NG YTGFP LG+  QK+ENP LR  + + P  +G+ IR++E
Sbjct  248   IGYVIPVPVIMHFIRDYEKNGVYTGFPILGIKWQKMENPDLRMSMGMRPDQKGIRIRRLE  307

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  DVI+SFD V +  +GTVPFR  ERI F YL+S+K+ GD A + ++R  
Sbjct  308   PTAPEFQLLKPSDVILSFDGVNIASDGTVPFRHGERIGFSYLVSQKYIGDNAVVQVLRNS  367

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED--SIGLKLLTK  1580
             E ++  I L+   +L+P HIEG  PSY IVAG V T +S P ++ E  +   + +KLL K
Sbjct  368   ETLEFSIKLAKHKELIPSHIEGKPPSYYIVAGFVLTAVSLPYLRSEFGNLFDVPIKLLDK  427

Query  1581  ARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDK  1760
               ++ A    EQ+VV+SQVL  ++NIGYEDI N Q+L  N   ++N+  L  ++++C D+
Sbjct  428   HLHAMAQSTDEQLVVVSQVLVADINIGYEDIVNNQVLTFNDMPVKNLKSLVIMVENCDDE  487

Query  1761  YLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             YL F    N +VVL+ +AA   +  IL  + I S  S DL
Sbjct  488   YLKFGLEYNQMVVLQTKAAKAATLDILTTHCISSSMSDDL  527



>ref|XP_008780936.1| PREDICTED: protease Do-like 9 [Phoenix dactylifera]
Length=582

 Score =   499 bits (1285),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 339/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  119   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  178

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKYVA VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  179   DTKYVASVLAIGTECDIALLTVSDDEFWEGVSPVEFGSLPALQDAVTVVGYPIGGDTISV  238

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  239   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVEN  298

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+ DYE++G+YTGFP LG+  QK+ENP LR  + + P  +GV +R+VE
Sbjct  299   IGYVIPTPVILHFIHDYEKSGEYTGFPILGIEWQKMENPDLRKAMGMTPDQKGVRVRRVE  358

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     +K  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  359   PTAPESEFIKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGEHAVVKVLREK  418

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             +  +  I L+    L+P HI+G  PSY I+AG VF+ +S P ++    +E E    +KLL
Sbjct  419   KVYEFNIKLATHKRLIPAHIKGKPPSYYIIAGFVFSAISVPYLRSEYGKEYEYDAPVKLL  478

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+  LA ++++C 
Sbjct  479   EKHLHAMAQSHDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLATMVENCD  538

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             +++L F+     +VVL+ + A   +  IL  + IPS  S+DL
Sbjct  539   EEFLQFDLEYQQIVVLQTKTAKAATKDILLTHCIPSAVSNDL  580



>ref|XP_010111534.1| Protease Do-like 9 [Morus notabilis]
 gb|EXC31167.1| Protease Do-like 9 [Morus notabilis]
Length=581

 Score =   499 bits (1284),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 332/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  118   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGS  177

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  178   DTKYLATVLAIGTECDIAMLTVDDDEFWQGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  237

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY +GS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++VEN
Sbjct  238   TSGVVSRIEILSYVYGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDVEN  297

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LG+  QK+ENP LR  + + P  +GV IR+V+
Sbjct  298   IGYVIPTPVIMHFIQDYEKNGAYTGFPILGIEWQKMENPDLRKSMGMKPEQKGVRIRRVD  357

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD+A + ++R  
Sbjct  358   PTAPESQVLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDSAAVRVLRNS  417

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E +   I L     L+P H  G  PSY I+AG VFT +S P  + E     E    +KLL
Sbjct  418   EILNFNIKLGTHKRLIPAHNRGRPPSYYIIAGFVFTAVSVPYFRSEYGKDYEYEAPVKLL  477

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +       EQ+VV+SQVL   +NIGYE+I N Q+L  NGK ++N+ +LA +++SCK
Sbjct  478   DKLLHHLPQSPDEQLVVVSQVLVANINIGYEEIVNTQVLAFNGKPVKNLKNLASMVESCK  537

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+     +VVL  + A   +  IL  + IPS  S DL
Sbjct  538   DEFLRFDLEYQQIVVLRTKTAKAATLDILATHCIPSATSDDL  579



>ref|XP_008647464.1| PREDICTED: uncharacterized protein LOC100217136 isoform X1 [Zea 
mays]
 gb|AFW76815.1| hypothetical protein ZEAMMB73_778886 [Zea mays]
Length=608

 Score =   500 bits (1287),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 339/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  145   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHYTQVKLKKRGS  204

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+VE +EFWKG  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  205   DTKYLATVLAIGTECDIAMLTVEDDEFWKGVSPVEFGSLPALQDAVTVVGYPIGGDTISV  264

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  265   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  324

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V++HF++DY+++G+YTGFP LG+  QK+ENP LR  + + +N+ GV IR+VE
Sbjct  325   IGYVIPTPVINHFIEDYKKSGEYTGFPILGIEWQKMENPDLRKAMGMKANQKGVRIRRVE  384

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  385   PTAPESGCLEPSDIILSFDGIDIANDGTVPFRHGERIGFTYLVSQKYTGEKARVKVLRNS  444

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             +  +  I L+    L+P HI+G  PSY IVAG VF  +S P ++    +E E    +KLL
Sbjct  445   KIHEFNIKLATHKRLIPAHIKGRPPSYYIVAGFVFMAVSVPYLRSEYGKEYEYDAPVKLL  504

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYEDI N Q+L  NG  ++N+ HLA +++ C 
Sbjct  505   DKHLHAMAQSSDEQLVVVSQVLVADINIGYEDIVNIQVLAFNGTPVKNLKHLATMVEECN  564

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             + +L F+   + +VVLE + A   +  IL  + IPS  S +L
Sbjct  565   EAFLKFDLDFDQVVVLETKTAKAATQDILTTHCIPSAASEEL  606



>ref|XP_003564034.1| PREDICTED: protease Do-like 9 [Brachypodium distachyon]
Length=599

 Score =   499 bits (1284),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 244/462 (53%), Positives = 341/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++S+PWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  136   MDAVVKVFCVHTEPNFSMPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHYTQVKLKKRGS  195

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFWKG  PL+FG LP LQDAVTVVGYP+GGDTISV
Sbjct  196   DTKYLATVLAIGNECDIAMLTVDDDEFWKGVLPLEFGSLPALQDAVTVVGYPIGGDTISV  255

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  256   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  315

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V++HF+QDYE++G+YTGFP LG+  QK+ENP LR  + + +++ GV IR++E
Sbjct  316   IGYVIPTPVINHFIQDYEKSGEYTGFPILGIEWQKMENPDLRKAMGMKTDQKGVRIRRIE  375

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     ++  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G+ A + ++R+ 
Sbjct  376   PTAPESGCMQPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKAHVKVLRSS  435

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  + +I L+    L+P HI+G  PSY IVAG VF  +S P ++ E     E    +KLL
Sbjct  436   KIHEFKIKLAIHKKLIPAHIKGRPPSYYIVAGFVFMVVSVPFLRSEYGKDYEFDAPVKLL  495

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYE++ N Q+L  NGK + N+  LA +++ CK
Sbjct  496   DKHLHAMAQSPDEQLVVVSQVLVADINIGYEELVNTQVLAFNGKPVNNLKQLATMVEDCK  555

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             +++L F+   + +VVLE + A   +  IL  + IPS  S DL
Sbjct  556   EEFLKFDMDYDQVVVLETKTAKAATQDILATHCIPSAMSDDL  597



>ref|XP_005644766.1| trypsin-like serine protease [Coccomyxa subellipsoidea C-169]
 gb|EIE20222.1| trypsin-like serine protease [Coccomyxa subellipsoidea C-169]
Length=473

 Score =   494 bits (1272),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 235/462 (51%), Positives = 331/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             +  VVKV+C H+ P+YSLPWQ++RQ++ST S F+I   ++LTNAH V+H TQVKV+RRG 
Sbjct  1     METVVKVFCMHSEPNYSLPWQRKRQFSSTSSGFIISGKRILTNAHSVDHHTQVKVRRRGS  60

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTK+VA VLA G ECDIA+L+VE EEFW+G  P+ FG LPRLQD VTV+G+P+ G++ISV
Sbjct  61    DTKFVAAVLAVGTECDIAMLTVEDEEFWEGLCPVNFGELPRLQDQVTVIGFPIDGESISV  120

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIEVTSY HG++ELLG+QIDAA+N GNSGGPAFN+ G+C+G+AFQ  + ++ EN
Sbjct  121   TSGVVSRIEVTSYVHGAAELLGVQIDAAINSGNSGGPAFNNRGQCVGIAFQSLKHEDAEN  180

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGY+IP  V+ HF+ D+ERNG+YT FP+LG+  QK+E+P LR  L +   + GV IR+VE
Sbjct  181   IGYIIPPPVIQHFITDFERNGRYTAFPALGIEWQKMESPFLRKSLGMKEGQKGVYIRRVE  240

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PTS A   L EGD+++SF+   +  +GTVPFRS ERI+F YLIS+KF+ + A++ +++ G
Sbjct  241   PTSPASEVLSEGDILMSFEGTDIANDGTVPFRSGERISFSYLISQKFTDEQAKVRLLKDG  300

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             +   + + L     L+P HI G  P Y I+ GLVFT ++ P ++    +E +    +KLL
Sbjct  301   QERTLSVNLRAPHRLIPVHIGGRPPPYFILGGLVFTQVTVPYLRSEYGKEYDFDAPVKLL  360

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
                 +  A  KG+ +VVL QVLA ++NIGYED+ N ++  +NG  ++N+  L   +++CK
Sbjct  361   DAMMHEQALGKGQHVVVLGQVLAADINIGYEDLVNIRVKAVNGVPVKNLRGLMEAVEACK  420

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             DKYL F+   N LV++E +A    +  IL  + I  +RS +L
Sbjct  421   DKYLRFQMEYNQLVIMETQATRKATEDILTMHYITHDRSEEL  462



>ref|XP_006439771.1| hypothetical protein CICLE_v10019344mg [Citrus clementina]
 gb|ESR53011.1| hypothetical protein CICLE_v10019344mg [Citrus clementina]
Length=612

 Score =   499 bits (1285),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 246/500 (49%), Positives = 340/500 (68%), Gaps = 32/500 (6%)
 Frame = +3

Query  477   VETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEH  656
             VE G  +    ++AVVKV+C HT P++SLPWQ++RQY+S+ S F IG  ++LTNAH VEH
Sbjct  111   VEPGVARVVPAMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEH  170

Query  657   DTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVV  836
              TQVK+K+RG DTKY+A VLA G ECDIA+L+VE +EFW+G  P++FG LP LQDAVTVV
Sbjct  171   YTQVKLKKRGSDTKYLATVLAIGTECDIAMLTVEDDEFWEGVLPVEFGELPALQDAVTVV  230

Query  837   GYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVA  1016
             GYP+GGDTISVT GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+A
Sbjct  231   GYPIGGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIA  290

Query  1017  FQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPS  1196
             FQ  + ++VENIGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + +
Sbjct  291   FQSLKHEDVENIGYVIPTPVIMHFIQDYEKNGAYTGFPLLGVEWQKMENPDLRVAMGMKA  350

Query  1197  NE-GVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSG  1373
             ++ GV IR+V+PT+     LK  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G
Sbjct  351   DQKGVRIRRVDPTAPESEVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTG  410

Query  1374  DTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE---  1544
             D+A + ++R  + +   I L+    L+P H +G  PSY I+AG VF+ +S P ++ E   
Sbjct  411   DSAAVKVLRDSKILNFNITLATHRRLIPSHNKGRPPSYYIIAGFVFSTVSVPYLRSEYGK  470

Query  1545  -CEDSIGLKLLTKARYSFANFKG----------------EQIVVLS-----------QVL  1640
               E    +KLL K  YS    +                  ++ +LS           +VL
Sbjct  471   DYEYEAPVKLLDKLLYSMPQLQMSSLLWCLRSPLCLNCFNKVFLLSLSLTFSFPWFCKVL  530

Query  1641  ANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAAL  1820
               ++NIGYE+I N Q+L  NG  ++N+  LA+++++C D++L F+   + +VVL  + + 
Sbjct  531   VADINIGYEEIVNTQVLAFNGNPVKNLKSLANMVENCDDEFLKFDLEYDQVVVLRTKTSK  590

Query  1821  TTSTSILKDYGIPSERSSDL  1880
               +  IL  + IPS  S DL
Sbjct  591   AATLDILATHCIPSAMSDDL  610



>ref|XP_001774430.1| predicted protein [Physcomitrella patens]
 gb|EDQ60793.1| predicted protein [Physcomitrella patens]
Length=467

 Score =   493 bits (1270),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 249/463 (54%), Positives = 331/463 (71%), Gaps = 6/463 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQ++S  S F+I   ++LTNAH VEH TQVKVK+RG 
Sbjct  1     MDAVVKVFCVHTEPNFSLPWQRKRQFSSNSSGFIIKGRRVLTNAHSVEHHTQVKVKKRGS  60

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V ++EFW+   P+ FG LPRLQD VTVVGYP+GGDTISV
Sbjct  61    DTKYLATVLAIGTECDIAMLTVSNDEFWEDVTPVNFGSLPRLQDGVTVVGYPIGGDTISV  120

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIEVTSY HG++ELLG+QIDAA+N GNSGGPAFND GEC+G+AFQ  + ++ EN
Sbjct  121   TSGVVSRIEVTSYVHGATELLGVQIDAAINAGNSGGPAFNDRGECVGIAFQSLKHEDAEN  180

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTG-FPSLGVLLQKLENPALRACLKVPSNE-GVLIRKV  1223
             IGYVIPT V+ HF+ DY RN  YTG FP LG+  QK+ENP LR  L + S + GV IR+V
Sbjct  181   IGYVIPTPVIDHFITDYVRNNDYTGRFPILGIEWQKMENPDLRKALGMKSTQKGVRIRRV  240

Query  1224  EPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRA  1403
             EPT+ A   L+  D+++SFD + +  +GTVPFR  ERI F YL+S+K+SG+ A++ I+R 
Sbjct  241   EPTAPAFAQLRASDILMSFDGIDIANDGTVPFRHGERIGFSYLVSKKYSGECAKVKILRD  300

Query  1404  GEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKL  1571
             G+  +  I L     LVP HI+G  PSY I+AG+VF  +S P ++ E     +    +KL
Sbjct  301   GKSKEFDIDLVNHKRLVPAHIKGKPPSYYILAGIVFAAISVPYLRSEYGKDYDYDAPVKL  360

Query  1572  LTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSC  1751
             L K  +S +  + EQ+VV+SQVL  ++NIGYEDI N Q++  N   +RN+ HLA+L++ C
Sbjct  361   LDKLLHSMSQSEDEQLVVVSQVLVADINIGYEDIVNTQVVAFNDTPVRNLKHLANLVEKC  420

Query  1752  KDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
              D +L F      +V+LE + A   +  IL  + IPS  S DL
Sbjct  421   TDPFLRFGLDYQQIVILETQTAKAATPEILATHCIPSAMSHDL  463



>ref|XP_006649039.1| PREDICTED: protease Do-like 9-like, partial [Oryza brachyantha]
Length=477

 Score =   493 bits (1270),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 245/462 (53%), Positives = 339/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  14    MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHYTQVKLKKRGS  73

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V+ +EFW G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  74    DTKYLATVLAIGTECDIALLTVDDDEFWDGVSPVEFGSLPALQDAVTVVGYPIGGDTISV  133

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAF+D G+C+G+AFQ  + ++ EN
Sbjct  134   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFSDRGKCVGIAFQSLKHEDAEN  193

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++G+YTGFP LG+  QK+ENP LR  + + S++ GV +R+VE
Sbjct  194   IGYVIPTPVIMHFIQDYEKSGEYTGFPILGIEWQKMENPDLRKAMGMKSDQKGVRVRRVE  253

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  254   PTAPESGCLQPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKALVKVLRNS  313

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  + +I L+    LV  H++G  PSY IVAG VF  +S P ++ E     E    +KLL
Sbjct  314   KIHEFKIKLATHKRLVAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLL  373

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL   +NIGYE+I N Q+L  NG+ ++N+ +LA ++++CK
Sbjct  374   VKHLHAMAQSPDEQLVVVSQVLVANINIGYEEIVNTQVLAFNGQPVKNLKNLASMVENCK  433

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+   + +VVLE + A   +  IL  + IPS  S DL
Sbjct  434   DEFLKFDLEYDQIVVLETKTAKAATRDILTTHCIPSAMSDDL  475



>gb|EYU46653.1| hypothetical protein MIMGU_mgv1a0034321mg, partial [Erythranthe 
guttata]
Length=289

 Score =   486 bits (1250),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 232/289 (80%), Positives = 261/289 (90%), Gaps = 0/289 (0%)
 Frame = +3

Query  1125  FPSLGVLLQKLENPALRACLKVPSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCE  1304
             FPSLGVLLQKLENPALRACL VPSNEGVL+RK+EPT+ A + LKEGDVIVSFD+VRVG E
Sbjct  1     FPSLGVLLQKLENPALRACLSVPSNEGVLVRKIEPTAHASDVLKEGDVIVSFDNVRVGSE  60

Query  1305  GTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPS  1484
             GT+PFRS+ERIAFRYLIS+KF+GD AELGIIR G+FMKVQ++L+ RV LVPYHI+GGQPS
Sbjct  61    GTIPFRSSERIAFRYLISQKFTGDAAELGIIRNGQFMKVQVILNTRVHLVPYHIDGGQPS  120

Query  1485  YLIVAGLVFTPLSEPLIQEECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGY  1664
             YLIVAGLVFTPLSEPLI EECEDSIGLKLLTKARYS   FKGEQIVVLSQVLANEVNIGY
Sbjct  121   YLIVAGLVFTPLSEPLIDEECEDSIGLKLLTKARYSMPKFKGEQIVVLSQVLANEVNIGY  180

Query  1665  EDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILK  1844
             ED+SNEQ+LKLNG  I+NIHHLAHL+DSCKDKYL+FEF DNFLVVLERE+AL+ S SILK
Sbjct  181   EDMSNEQVLKLNGTWIKNIHHLAHLVDSCKDKYLIFEFEDNFLVVLERESALSASESILK  240

Query  1845  DYGIPSERSSDLMGPYVDSIGQNDAVDQQEFGDSAESNSEFGFDGLLWA  1991
              YGIPS RS DL+ PY+DS GQN+ +++ EFGD+  SNSE G+DGLLWA
Sbjct  241   GYGIPSVRSCDLLEPYIDSAGQNEYINRHEFGDTPVSNSEVGYDGLLWA  289



>ref|XP_009609244.1| PREDICTED: protease Do-like 9 [Nicotiana tomentosiformis]
Length=574

 Score =   496 bits (1278),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 250/462 (54%), Positives = 339/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  111   MDAVVKVFCVHTDPNFSLPWQRKRQYSSSSSGFIISGKRVLTNAHSVEHHTQVKLKKRGS  170

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VL+ G ECDIA+L+V  +EFW+G  PL+FG LP LQDAVTVVGYP+GGDTISV
Sbjct  171   DTKYLATVLSIGTECDIAMLTVNDDEFWEGVSPLEFGDLPALQDAVTVVGYPIGGDTISV  230

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY H S+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  231   TSGVVSRIEILSYVHVSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  290

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP +GV  QK+ENP LR  + +  N+ GV IR+VE
Sbjct  291   IGYVIPTPVIMHFIQDYEKNGAYTGFPVIGVEWQKMENPDLRQSVGMAHNQKGVRIRRVE  350

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   N LK  DVI+SFD V +  +GTVPFR  ERI F YL+S+K++GD A + ++R  
Sbjct  351   PTAPESNVLKPSDVILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDDARVKVLRKS  410

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + ++ +I L+    L+P HI+G  PSY IV G VFT +S P ++ E     E    +KLL
Sbjct  411   KTLEFKIKLNAHKRLIPAHIKGKPPSYYIVGGFVFTAVSVPYLRSEYGKDYEFDAPVKLL  470

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYE++ N Q+L  NGK I+N+  LA++ ++CK
Sbjct  471   DKLLHAMAQSIDEQLVVVSQVLVADINIGYEELVNTQVLAFNGKPIKNLKSLANMAEACK  530

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             ++Y+ F+   + +VVL+ + A   ++ IL  + IPS  S DL
Sbjct  531   EEYMKFDLDYDQIVVLQTKNAKAATSDILAMHCIPSAMSDDL  572



>gb|KDD74963.1| hypothetical protein H632_c960p1 [Helicosporidium sp. ATCC 50920]
Length=538

 Score =   495 bits (1274),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 242/507 (48%), Positives = 341/507 (67%), Gaps = 48/507 (9%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             + AVVKV+C H+ P++SLPWQ++RQ++S+GS F+I   ++LTNAHCV+H TQV+VKRRG 
Sbjct  30    MEAVVKVFCVHSEPNFSLPWQRKRQFSSSGSGFVISGRRILTNAHCVDHHTQVRVKRRGS  89

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             D K VA+VLA G ECD+ALL+V+ + FW+G EP++ G LPRLQDAV VVGYP+GGDT+SV
Sbjct  90    DAKLVARVLAVGPECDVALLTVDDDAFWEGLEPVRLGPLPRLQDAVAVVGYPIGGDTMSV  149

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIEVTSY HG++ELLG+Q+DAA+N GNSGGPAF   GEC+G+AFQ  + ++ EN
Sbjct  150   TSGVVSRIEVTSYVHGAAELLGVQVDAAINSGNSGGPAFGPGGECVGIAFQSLKHEDAEN  209

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             I Y+IPT VV HF++DYE +G YTGFPSLG+  QK+E+P +R  L + P   GVL+R+VE
Sbjct  210   ISYIIPTPVVEHFIRDYETHGAYTGFPSLGIEWQKMESPVMRRALGMAPDERGVLVRRVE  269

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRA-  1403
             PTS     L +GDV++SFD V +G +GTVPFR  ERI F YL+S+K++GD+A+LG+ RA 
Sbjct  270   PTSPLAPLLGQGDVLLSFDGVAIGSDGTVPFRFGERIGFNYLVSQKYTGDSAQLGVRRAR  329

Query  1404  --GEFMKVQIVLS----------PRVD-----------------------------LVPY  1460
               G+  K  + +S          P+V                              L+P 
Sbjct  330   RDGDSAKQSVGVSCVRQLPVPKVPKVSARGTSKTAASQPHASEVCLFELQLQAFSRLIPV  389

Query  1461  HIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLLTKARYSFANFKGEQIVVL  1628
             HI+   PSY I  GLVFTP + PL++    +E +    +KLL K  ++ A   G+Q+++L
Sbjct  390   HIDNRPPSYFIYGGLVFTPATVPLLRSEYGKEFDFDAPVKLLDKMMHAMAQSPGQQVIIL  449

Query  1629  SQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLV-FEFADNFLVVLE  1805
             SQVLA E N+GYED+ N Q+L ++G+ + ++  L  L++    + ++ F+      + L+
Sbjct  450   SQVLAAEANVGYEDVVNTQVLAVDGQAVHSLRELVALVEGGPPREIIRFDLEYQQAIALD  509

Query  1806  REAALTTSTSILKDYGIPSERSSDLMG  1886
             R      +  IL+ + IP++RS DL+G
Sbjct  510   RAQVAAATADILRQHCIPADRSVDLLG  536



>ref|XP_008643959.1| PREDICTED: uncharacterized protein LOC100381831 isoform X1 [Zea 
mays]
Length=563

 Score =   496 bits (1276),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 341/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  100   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHYTQVKLKKRGS  159

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  160   DTKYLATVLAIGTECDIALLTVNDDEFWEGVSPVEFGTLPALQDAVTVVGYPIGGDTISV  219

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  220   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDRGKCVGIAFQSLKHEDAEN  279

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V++HF++DY+++G+YTGFP LGV  QK+ENP LR  + + P  +GV +R+VE
Sbjct  280   IGYVIPTPVITHFIEDYKKSGEYTGFPILGVEWQKMENPDLRKAMGMKPDQKGVRVRRVE  339

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  340   PTAPESGCLRPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGEKALVKVLRDS  399

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  + +I L+    LV  H++G  PSY IVAG VF  +S P ++ E     E    +KLL
Sbjct  400   KVHEFKIRLATHKRLVAAHVKGRPPSYYIVAGFVFAAISVPYLRSEYGKDYEYDAPVKLL  459

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL +++NIGYE+I N Q+L  NG+ ++N+ +LA ++++CK
Sbjct  460   VKHLHAMAESPDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGQPVKNLKNLATMVENCK  519

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+   + +VVLE + A   +  IL  + IPS  S DL
Sbjct  520   DEFLKFDLEYDQIVVLETKTAKAATQDILTTHCIPSATSDDL  561



>ref|XP_008348037.1| PREDICTED: protease Do-like 9 [Malus domestica]
Length=557

 Score =   495 bits (1274),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 243/460 (53%), Positives = 329/460 (72%), Gaps = 3/460 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ+++QY+S+ S F+I   ++LTNAH V+H TQVK+K+RG 
Sbjct  73    MDAVVKVFCVHTEPNFSLPWQRKKQYSSSSSGFVIRGRRVLTNAHSVDHHTQVKLKKRGS  132

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQD VTVVGYP+GGDTISV
Sbjct  133   DTKYLATVLAIGTECDIAMLTVSDDEFWEGISPVEFGDLPALQDXVTVVGYPIGGDTISV  192

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+  Y HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  193   TSGVVSRMEILPYVHGSTELLGMQIDAAINSGNSGGPAFNDKGXCVGIAFQSLKHEDXEN  252

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIP  V+ HF+QDYE+NG YTGFP LG+  QK+ENP LR  + + P  +G+ IR++E
Sbjct  253   IGYVIPVPVIMHFIQDYEKNGVYTGFPILGIKWQKMENPDLRMSMGMRPDQKGIRIRRLE  312

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K+ GD A + ++R  
Sbjct  313   PTALESQLLKPSDIILSFDGVNIASDGTVPFRHGERIGFSYLVSQKYIGDNALVKVLRNS  372

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED--SIGLKLLTK  1580
             E ++  I L+   +L+P HIEG  PSY IVAG V T +S P ++ E  +   + +KLL K
Sbjct  373   ETLEFSIKLAKHKELIPSHIEGKPPSYYIVAGFVLTAVSLPYLRSEFGNIFDVPIKLLDK  432

Query  1581  ARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDK  1760
               ++ A    EQ+VV+SQVL  ++NIGYEDI N Q+L  N   ++N+  LA ++++C D+
Sbjct  433   HLHAMAQSIDEQLVVVSQVLVADINIGYEDIVNNQVLSFNDMPVKNLKSLAIMVENCXDE  492

Query  1761  YLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             YL F    N +VVL+ +AA      IL  + I S  S DL
Sbjct  493   YLKFGLEYNQMVVLQTKAAKAAMLDILTTHCISSSMSDDL  532



>dbj|BAD15737.1| putative DegP2 protease [Oryza sativa Japonica Group]
Length=567

 Score =   495 bits (1274),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 245/462 (53%), Positives = 339/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  104   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHYTQVKLKKRGS  163

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  164   DTKYLATVLAIGTECDIALLTVDDDEFWEGVLPVEFGSLPALQDAVTVVGYPIGGDTISV  223

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  224   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDRGKCVGIAFQSLKHEDAEN  283

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++G+YTGFP LG+  QK+ENP LR  + + P  +GV +R+VE
Sbjct  284   IGYVIPTPVIMHFIQDYEKSGEYTGFPILGIEWQKMENPDLRKAMGMKPDQKGVRVRRVE  343

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  344   PTAPESGCLQPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKALVKVLRNS  403

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  + +I L+    LV  H++G  PSY IVAG VF  +S P ++ E     E    +KLL
Sbjct  404   KVHEFKIKLATHKRLVAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLL  463

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYE+I N Q+L  NG+ ++N+ +L  ++++CK
Sbjct  464   VKHLHAMAQSPDEQLVVVSQVLVADINIGYEEIVNTQVLAFNGQPVKNLKNLVSMVENCK  523

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+   + +VVLE + A   +  IL  + IPS  S DL
Sbjct  524   DEFLKFDLEYDQIVVLETKTAKAATQDILTTHCIPSAMSDDL  565



>gb|EAY87490.1| hypothetical protein OsI_08898 [Oryza sativa Indica Group]
Length=567

 Score =   495 bits (1274),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 245/462 (53%), Positives = 339/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  104   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHYTQVKLKKRGS  163

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  164   DTKYLATVLAIGTECDIALLTVDDDEFWEGVLPVEFGSLPALQDAVTVVGYPIGGDTISV  223

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  224   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDRGKCVGIAFQSLKHEDAEN  283

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++G+YTGFP LG+  QK+ENP LR  + + P  +GV +R+VE
Sbjct  284   IGYVIPTPVIMHFIQDYEKSGEYTGFPILGIEWQKMENPDLRKAMGMKPDQKGVRVRRVE  343

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  344   PTAPESGCLQPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKALVKVLRNS  403

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  + +I L+    LV  H++G  PSY IVAG VF  +S P ++ E     E    +KLL
Sbjct  404   KVHEFKIKLATHKRLVAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLL  463

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYE+I N Q+L  NG+ ++N+ +L  ++++CK
Sbjct  464   VKHLHAMAQSPDEQLVVVSQVLVADINIGYEEIVNTQVLAFNGQPVKNLKNLVSMVENCK  523

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+   + +VVLE + A   +  IL  + IPS  S DL
Sbjct  524   DEFLKFDLEYDQIVVLETKTAKAATQDILTTHCIPSAMSDDL  565



>gb|KDO66274.1| hypothetical protein CISIN_1g036586mg [Citrus sinensis]
Length=568

 Score =   495 bits (1274),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 248/512 (48%), Positives = 344/512 (67%), Gaps = 23/512 (4%)
 Frame = +3

Query  360   SNVDDRNTNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANFLNAVVKVYCT  539
             S+ D+ N+  N  S      S    R G+G        + E+  ++    ++AVVKV+C 
Sbjct  73    SSNDNHNSANNTNSNVGHVASPERSRHGEGNDITILPPRWESVAVKAVPSMDAVVKVFCV  132

Query  540   HTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLA  719
             HT P++SLPWQ++RQY+S+ S F++G  ++LTNAH VEH TQVKVK+RG DTKY+A VL+
Sbjct  133   HTEPNFSLPWQRKRQYSSSSSGFIVGGRRVLTNAHSVEHHTQVKVKKRGSDTKYLATVLS  192

Query  720   RGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEV  899
              G ECDIALL+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISVT GVVSR+E+
Sbjct  193   IGTECDIALLTVKDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISVTSGVVSRMEI  252

Query  900   TSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVV  1079
              SY HGS+ELLG+Q                  G+C+G+AFQ  ++D+VENIGYVIPT V+
Sbjct  253   LSYVHGSTELLGLQ------------------GKCVGIAFQSLKNDDVENIGYVIPTPVI  294

Query  1080  SHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVEPTSDAHNTLK  1256
              HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR++EPT+   + LK
Sbjct  295   IHFIQDYEKNGAYTGFPILGVEWQKMENPDLRISMGMRPGQKGVRIRRIEPTAPESHVLK  354

Query  1257  EGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLS  1436
               D+I+SFD + +  +GTVPFR  ERI F YL+S+K++GD+A + ++R  E  +  I LS
Sbjct  355   PSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNSEVHEFNIKLS  414

Query  1437  PRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLLTKARYSFANF  1604
                 L+P HI G  PSY I+AG VFT ++ P ++ E     E    +KLL K  ++ A  
Sbjct  415   THKRLIPAHINGRPPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDAPVKLLDKLLHAMAQS  474

Query  1605  KGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFAD  1784
               EQIVV+SQVL  ++NIGYE+I N Q+L LNGK ++N+  LA +++S +D++L F+   
Sbjct  475   VDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVQNLKSLADMVESSEDEFLKFDLEY  534

Query  1785  NFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
               +VVL+ + A   ++ IL  + IPS  S DL
Sbjct  535   QQIVVLKSKTAKEATSDILATHCIPSAMSGDL  566



>ref|XP_009348035.1| PREDICTED: protease Do-like 9, partial [Pyrus x bretschneideri]
Length=449

 Score =   490 bits (1262),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 243/447 (54%), Positives = 323/447 (72%), Gaps = 5/447 (1%)
 Frame = +3

Query  555   YSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVEC  734
             ++LPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG +TKY+A VLA G EC
Sbjct  1     FALPWQRKRQYSSSSSGFVIRGRRVLTNAHSVEHYTQVKLKKRGSETKYLATVLAIGTEC  60

Query  735   DIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAH  914
             DIA+L+V  +EFWKG  PL+FG LP LQDAVTVVGYP+GGDTISVT GVVSR+E+ SY H
Sbjct  61    DIAMLTVSDDEFWKGVSPLEFGELPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVH  120

Query  915   GSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQ  1094
             GS+ELLG+QIDAA+N GNSGGPAFND GEC+G+AFQ  + ++ ENIGYVIPT V+ HF+Q
Sbjct  121   GSTELLGLQIDAAINSGNSGGPAFNDKGECVGIAFQSLKHEDAENIGYVIPTPVIKHFIQ  180

Query  1095  DYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVEPTSDAHNTLKEGDVI  1271
             DYE+NG YTGFP LG+  QK+ENP LR  + + P  +GV +R+VEPT+   + L+  DVI
Sbjct  181   DYEKNGAYTGFPVLGIEWQKMENPDLRISMGMRPDQKGVRVRRVEPTAPHSHVLQPSDVI  240

Query  1272  VSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDL  1451
             +SFD V +  +GTVPFR  ERI F YL+S+K++GD+A + ++R  E ++  I L     L
Sbjct  241   LSFDGVNIANDGTVPFRHGERIGFNYLVSQKYTGDSALVKVLRNSEILEYNIKLGTHKRL  300

Query  1452  VPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLLTKARYSFANFKGEQI  1619
             +P HI+G  PSY IV G VF  +S P ++ E     E    +KLL K  ++ A    EQ+
Sbjct  301   IPAHIKGKPPSYYIVGGFVFAAVSVPYLRSEYGKDYEFDAPVKLLDKHLHAMAESIDEQL  360

Query  1620  VVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVV  1799
             VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+  L  ++++C DKYL F+   N +VV
Sbjct  361   VVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLVSMVENCDDKYLKFDLEYNQMVV  420

Query  1800  LEREAALTTSTSILKDYGIPSERSSDL  1880
             LE + A  ++  IL  + IPS  S DL
Sbjct  421   LETKTAKASTLDILLTHCIPSAMSDDL  447



>ref|XP_004953885.1| PREDICTED: protease Do-like 9-like [Setaria italica]
Length=565

 Score =   494 bits (1272),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 339/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  102   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHYTQVKLKKRGS  161

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  162   DTKYLATVLAIGTECDIALLTVSDDEFWEGVSPVEFGTLPALQDAVTVVGYPIGGDTISV  221

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  222   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDRGKCVGIAFQSLKHEDAEN  281

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V++HF+QDYE++G+YTGFP LG+  QK+ENP LR  + + P  +GV +R+VE
Sbjct  282   IGYVIPTPVITHFIQDYEKSGEYTGFPILGIEWQKMENPDLRKSMGMKPDQKGVHVRRVE  341

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  342   PTAPESGCLQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGEKALVKVLRNS  401

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  + +I L+    LV  H++G  PSY IVAG VF  +S P ++ E     E    +KLL
Sbjct  402   KVHEFKIRLATHKRLVAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLL  461

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYE+I N Q+L  NG+ ++N+ +L  ++++CK
Sbjct  462   VKHLHAMAESPDEQLVVVSQVLVADINIGYEEIVNTQVLAFNGQPVKNLKNLVTMVENCK  521

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+   + +VVLE + A   +  IL  + IPS  S DL
Sbjct  522   DEFLKFDLEYDQIVVLETKTAKAATQDILTTHCIPSAMSDDL  563



>ref|XP_010554015.1| PREDICTED: protease Do-like 9 [Tarenaya hassleriana]
Length=605

 Score =   494 bits (1273),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 250/462 (54%), Positives = 338/462 (73%), Gaps = 6/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S  S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  143   MDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIISGRRVLTNAHSVEHHTQVKLKKRGS  202

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  203   DTKYLATVLAIGTECDIALLTVSDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  262

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  263   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  322

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYERNGKYTGFP LGV  QK+ENP LR  + + +++ GV I+++E
Sbjct  323   IGYVIPTPVIVHFIQDYERNGKYTGFPVLGVEWQKMENPDLRKSMGMEAHQKGVRIKRIE  382

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  DVI+SFD V +  +GTVPFR  ERI F YLIS+K++GD A + ++R  
Sbjct  383   PTAPESQVLRPSDVILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDFAIVKVLRNK  442

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             + ++ +I L+    L+P H+  G+P Y I+AG VFT +S P ++    +E E    +KLL
Sbjct  443   QILEFKIRLAAHKRLIPAHV-NGKPPYYIIAGFVFTTVSVPYLRSEYGKEYEFDAPVKLL  501

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL +++NIGYE+I N Q L  NGK ++N+  LA ++++C 
Sbjct  502   EKHLHAMAQTVDEQLVVVSQVLVSDINIGYEEIVNTQALAFNGKPVKNLKSLAEMVENCN  561

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL FE   + +VVL  + A   +  IL  + IPS  S DL
Sbjct  562   DEYLKFELEYDQIVVLNTKTAKEATLDILTMHCIPSAMSDDL  603



>ref|XP_008793849.1| PREDICTED: protease Do-like 9 [Phoenix dactylifera]
Length=586

 Score =   493 bits (1269),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 249/461 (54%), Positives = 335/461 (73%), Gaps = 5/461 (1%)
 Frame = +3

Query  513   NAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDD  692
             +AVVKV+C HT P++SLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG D
Sbjct  124   DAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIISGRRVLTNAHSVEHYTQVKLKKRGSD  183

Query  693   TKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVT  872
             TKYVA VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISVT
Sbjct  184   TKYVATVLAIGTECDIAMLTVSDDEFWEGVSPVEFGSLPALQDAVTVVGYPIGGDTISVT  243

Query  873   KGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENI  1052
              GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + D+VENI
Sbjct  244   SGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHDDVENI  303

Query  1053  GYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVEP  1229
             GYVIPT V+ HF+ DYE++G+YTGFP LG+  QK+ENP LR  + + P+ +GV +R+VEP
Sbjct  304   GYVIPTPVILHFINDYEKSGEYTGFPILGIEWQKMENPDLRKAIGMSPNQKGVRVRRVEP  363

Query  1230  TSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGE  1409
             T+   + LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++G+ A + ++R   
Sbjct  364   TAPESDFLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGENAVVKVLREKR  423

Query  1410  FMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLLT  1577
               +  I L+    LVP HI G  PSY I+AG VFT +S P ++ E     E    +KLL 
Sbjct  424   VYEFNIKLATHKRLVPAHIRGKPPSYYIIAGFVFTTISVPYLRSEYGKDYEYDAPVKLLD  483

Query  1578  KARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKD  1757
             K  ++ A    EQ+VV+SQVL  ++NIGYEDI N Q+L  NG+ ++N+  LA ++++C +
Sbjct  484   KHLHAMAQSHDEQLVVVSQVLVADINIGYEDIVNNQVLSFNGQPVKNLKTLASMVENCDE  543

Query  1758  KYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             ++L F+     +VVL+ E A   +  IL  + IPS  S DL
Sbjct  544   EFLQFDLEYQQIVVLKTETAKAATKDILLTHCIPSAMSDDL  584



>dbj|BAK07966.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=563

 Score =   492 bits (1267),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 334/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  100   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHFTQVKLKKRGS  159

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  160   DTKYLATVLAIGTECDIALLTVSDDEFWEGVTPVEFGSLPALQDAVTVVGYPIGGDTISV  219

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++VEN
Sbjct  220   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDRGICVGIAFQSLKHEDVEN  279

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++G YTGFP +G+  QK+ENP LR  + + P  +GV +R+VE
Sbjct  280   IGYVIPTPVIKHFIQDYEKSGAYTGFPIIGIEWQKMENPDLRKAMGMKPDQKGVRVRRVE  339

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++GD A + ++R  
Sbjct  340   PTAPESGCLQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDKALIKVLRDS  399

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  + +I L+    L+  H++G  PSY IVAG VF  +S P ++ E     E    +KLL
Sbjct  400   KVHEFKIKLATHKRLIAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLL  459

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +S      EQ+VV+SQVL  ++NIGYE+I N Q+L +NG  ++N+  L   +++CK
Sbjct  460   VKHLHSMVESPDEQLVVVSQVLVADINIGYEEIVNTQVLAVNGHPVKNLKDLVTTVENCK  519

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+   + +VVLE + A   +  IL  + IPS  S DL
Sbjct  520   DEFLKFDLEYDQIVVLETKTAKAATQDILTTHCIPSAMSDDL  561



>dbj|BAJ90442.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score =   493 bits (1270),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 244/462 (53%), Positives = 336/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++S+PWQ+++QY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  138   MDAVVKVFCVHTEPNFSMPWQRKKQYSSSSSGFIIGGRRVLTNAHSVEHYTQVKLKKRGS  197

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFWKG  PL+FG LP LQDAVTVVGYP+GGDTISV
Sbjct  198   DTKYLATVLAIGNECDIAMLTVDDDEFWKGVLPLEFGLLPALQDAVTVVGYPIGGDTISV  257

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  258   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDQGKCVGIAFQSLKHEDAEN  317

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++G+YTGFP LG+  QK+ENP LR  + + S++ GV IR++E
Sbjct  318   IGYVIPTPVIKHFIQDYEKSGEYTGFPILGIEWQKMENPDLRKAMGMKSDQKGVRIRRIE  377

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     ++  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G+ A + ++R+ 
Sbjct  378   PTAPESGCMQPSDIILSFDGIEIANDGTVPFRHGERIGFSYLVSQKYTGEKARVKVLRSS  437

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  +  I LS    L+P HI+G  PSY IVAG VF  +S P ++ E     E    +KLL
Sbjct  438   KIHEFNIKLSIHKKLIPAHIKGRPPSYYIVAGFVFMVVSVPYLRSEYGKDYEFDAPVKLL  497

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYE+I N Q+   NGK + N+  LA +++ C 
Sbjct  498   DKHLHAMAQSPDEQLVVVSQVLVADINIGYEEIVNTQVRAFNGKPVNNLKQLATMVEDCN  557

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
              ++L F+   + +VVLE + A   +  IL  + IPS  S DL
Sbjct  558   KEFLKFDMDYDQVVVLETKTARAATQDILTTHCIPSAMSDDL  599



>ref|XP_010227815.1| PREDICTED: protease Do-like 9, partial [Brachypodium distachyon]
Length=473

 Score =   488 bits (1256),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 240/461 (52%), Positives = 334/461 (72%), Gaps = 5/461 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++S+PWQ++RQY S  S+F+IG  ++LTNAH VEH TQV +K+RG 
Sbjct  10    MDAVVKVFCVHTEPNFSMPWQRKRQYNSNSSSFIIGGRRVLTNAHSVEHYTQVTLKKRGS  69

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFWKG  PL+FG LP LQDAVTVVGYP+GGDTISV
Sbjct  70    DTKYLATVLAIGNECDIAMLTVDDDEFWKGVLPLEFGSLPALQDAVTVVGYPIGGDTISV  129

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  130   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  189

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V++HF+QDYE + K +GFP LG+  QK+ENP LR  + + +++ GV IR++E
Sbjct  190   IGYVIPTPVINHFIQDYENSEKKSGFPILGIEWQKMENPDLRKAMGMKTDQKGVRIRRIE  249

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     ++  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G+ A + ++R+ 
Sbjct  250   PTAPESGCMQPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKAHVKVLRSS  309

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  + +I L+    L+P HI+G  PSY IVAG VF  +S P ++ E     E    +KLL
Sbjct  310   KIHEFKIKLAIHKKLIPAHIKGRPPSYYIVAGFVFMVVSVPFLRAEYGKDYEFDAPVKLL  369

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYE++ N Q+L  NGK + N+  LA +++ CK
Sbjct  370   DKHLHAMAQSPDEQLVVVSQVLVADINIGYEELVNTQVLAFNGKPVNNLKQLATMVEDCK  429

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSD  1877
             ++ L F+   + +VVLE + A   +  IL  + IPS  S D
Sbjct  430   EELLKFDMDYDQVVVLETKTAKAATQDILATHCIPSVMSDD  470



>ref|XP_011071818.1| PREDICTED: protease Do-like 9 isoform X1 [Sesamum indicum]
Length=977

 Score =   505 bits (1300),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 244/462 (53%), Positives = 323/462 (70%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             L+AVVKV+C HT P++S+PWQ +RQY+S  S  +I   ++LT AH VE+ T V + +RG 
Sbjct  514   LDAVVKVFCVHTHPNFSMPWQMKRQYSSISSGVVIEGRRVLTFAHSVENCTHVNLLKRGS  573

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
              TKYVA VLA G +CD ALL+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  574   HTKYVATVLAIGSQCDTALLTVDDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  633

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++VEN
Sbjct  634   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDVEN  693

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++G YTGFP LGV  QK+ENP LR  + + P  +GV IR+++
Sbjct  694   IGYVIPTPVIMHFIQDYEKHGTYTGFPILGVEWQKMENPDLRLSMGMKPDQKGVRIRRID  753

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++GD A + ++R  
Sbjct  754   PTAPEFKVLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDNAAIEVLRNS  813

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E +K  + L     L+P H +G  PSY IVAG VFT +S P ++ E     E    +KLL
Sbjct  814   ETLKFNVKLGTHRRLIPAHNKGRPPSYYIVAGFVFTTVSVPYLRSEYGKDYEYEAPVKLL  873

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +       EQIVV+SQVL  ++NIGYEDI N Q+   NGK ++N+  LAH++++C 
Sbjct  874   DKLLHEMPQSPEEQIVVVSQVLVADINIGYEDIVNTQVHAFNGKPVKNLKSLAHMVENCD  933

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL F+     +VVL  + A   +  IL  + IPS  S DL
Sbjct  934   DEYLKFDLEYQQIVVLRTKNAKAATLDILSTHCIPSAMSDDL  975



>ref|XP_010272003.1| PREDICTED: protease Do-like 9 [Nelumbo nucifera]
Length=589

 Score =   492 bits (1267),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 336/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  126   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIISGRRVLTNAHSVEHHTQVKLKKRGS  185

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  186   DTKYLATVLAIGTECDIAMLTVNDDEFWEGVSPVEFGSLPALQDAVTVVGYPIGGDTISV  245

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPA ND G+C+G+AFQ  + ++VEN
Sbjct  246   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPALNDKGKCVGIAFQSLKHEDVEN  305

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+ DYERN +YTGFP+LGV  QK+ENP LR  + + S++ GV IR++E
Sbjct  306   IGYVIPTPVIMHFITDYERNKEYTGFPTLGVEWQKMENPDLRMAMGMASDQKGVRIRRIE  365

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  366   PTAPESQVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGENAVVKVLRDS  425

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E ++  I L+    L+P HI+G  PSY I+AG VFT +S   ++ E     E    +KLL
Sbjct  426   EILEFNIKLATHKRLIPAHIKGRPPSYYIIAGFVFTTVSVLYLRSEYGKDYEYDAPVKLL  485

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A  + EQ+VV+SQVL  ++NIGYEDI N Q+L  NG+ ++N+  LA ++++C 
Sbjct  486   DKHLHAMAQSEDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGQPVKNLKSLASMVENCN  545

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L FE     LVVL  + A   +  IL  + +PS  S DL
Sbjct  546   DEFLKFELEYQQLVVLHTKTAKAATLDILTTHCVPSAISDDL  587



>ref|XP_002502087.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63345.1| predicted protein [Micromonas sp. RCC299]
Length=463

 Score =   484 bits (1246),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 238/462 (52%), Positives = 322/462 (70%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+CTHT P+YSLPWQ++RQ  ST S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  1     MDAVVKVFCTHTEPNYSLPWQRKRQSASTSSGFVIPGRRVLTNAHSVEHHTQVKLKKRGS  60

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             D KYVAKVLA GVECD+ALL+VE ++F++G  P+QFG LP L   V+V+GYP+GG  IS+
Sbjct  61    DVKYVAKVLAIGVECDLALLTVEDDDFFEGIAPVQFGPLPHLSAPVSVIGYPIGGVAISI  120

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR EVT+YAHG  +LLG+QIDAA+N GNSGGPAFN  GEC+GVAFQ  + D+ EN
Sbjct  121   TSGVVSRTEVTNYAHGGIDLLGVQIDAAINSGNSGGPAFNSKGECVGVAFQSLKHDDAEN  180

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+ DY+RN  YTGFPSL    Q++E+PA+R  LK+ + + GVLI  VE
Sbjct  181   IGYVIPTPVIHHFITDYDRNKTYTGFPSLPFSWQRVESPAMRKWLKMRTGQKGVLISAVE  240

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             P       LK+ DV+VS D   +  +GTVPFR+ E I F YL+S K+ G++A++  +R G
Sbjct  241   PLMKDKINLKKNDVLVSIDGTDIASDGTVPFRAGEPITFNYLVSEKYVGESAQVRYLRDG  300

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  +  I  +    LVP+HIEG  PSY I  GLVFT +  P ++ E     +    +KLL
Sbjct  301   KMQECSITFNAMKRLVPWHIEGTPPSYFIAGGLVFTTVCVPFLKNEYGKDYDFDAPVKLL  360

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +     +G+Q+V+ +QVLA EVN GYED+ N  +   NG +I N+  LA  ++S K
Sbjct  361   EKFCHGRVEEEGQQVVICAQVLAAEVNRGYEDLHNTIVQSFNGVKIFNLKQLAQAVESSK  420

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+++ FE      VV++ +AA + + +ILK + IPS +S+DL
Sbjct  421   DEFMRFELDHEISVVMDTKAANSATKAILKTHAIPSAKSADL  462



>ref|XP_010236126.1| PREDICTED: protease Do-like 9 isoform X1 [Brachypodium distachyon]
Length=563

 Score =   488 bits (1255),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 242/462 (52%), Positives = 339/462 (73%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  100   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHFTQVKLKKRGS  159

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  160   DTKYLATVLAIGTECDIALLTVSDDEFWEGVSPIEFGSLPALQDAVTVVGYPIGGDTISV  219

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++VEN
Sbjct  220   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDRGICVGIAFQSLKHEDVEN  279

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++G+YTGFP +G+  QK+ENP LR  + + P  +GV +R+VE
Sbjct  280   IGYVIPTPVIQHFIQDYEKSGEYTGFPIIGIEWQKMENPDLRKAMGMKPDQKGVRVRRVE  339

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  340   PTAPESGYLRPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKAVVKVLRDS  399

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  + ++ L+    L+  H++G  PSY IVAG VF  +S P ++ E     E    +KLL
Sbjct  400   KVHEFRMKLATHKRLIAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLL  459

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYE+I N Q+L +NG+ ++N+ +L  ++++CK
Sbjct  460   VKHLHAMAESPDEQLVVVSQVLVADINIGYEEIVNTQVLAVNGQPVKNLKNLVTMVENCK  519

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+   + +VVL+ + A   +  IL  + IPS  S DL
Sbjct  520   DEFLKFDLEYDQIVVLKTKTAKAATKDILTTHCIPSAMSDDL  561



>ref|XP_002452567.1| hypothetical protein SORBIDRAFT_04g028270 [Sorghum bicolor]
 gb|EES05543.1| hypothetical protein SORBIDRAFT_04g028270 [Sorghum bicolor]
Length=565

 Score =   488 bits (1255),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 340/462 (74%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  102   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIISGRRVLTNAHSVEHHTQVKLKKRGS  161

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  162   DTKYLATVLAIGTECDIALLTVNDDEFWEGVSPVEFGTLPALQDAVTVVGYPIGGDTISV  221

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  R ++ EN
Sbjct  222   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDRGKCVGIAFQSLRHEDAEN  281

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V++HF++DY+++G+YTGFP LGV  QK+ENP LR  + + P  +GV +R+VE
Sbjct  282   IGYVIPTPVITHFIEDYKKSGEYTGFPILGVEWQKMENPDLRKAMGMKPDQKGVRVRRVE  341

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  342   PTAPESGCLQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGEKALVKVLRDS  401

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  + +I L+    LV  H++G  PSY IVAG VF  +S P ++ E     E    +KLL
Sbjct  402   KVHEFKIRLATHKRLVAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLL  461

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL +++NIGYE+I N Q+L  NG+ ++N+ +LA ++++CK
Sbjct  462   VKHLHAMAESPDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGQPVKNLKNLATMVENCK  521

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+   + +VVLE + A   +  IL  + IPS  S DL
Sbjct  522   DEFLKFDLEYDQIVVLETKTAKAATQDILTTHCIPSAMSDDL  563



>ref|XP_010254417.1| PREDICTED: protease Do-like 9 isoform X2 [Nelumbo nucifera]
Length=566

 Score =   487 bits (1254),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 237/428 (55%), Positives = 321/428 (75%), Gaps = 5/428 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  123   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  182

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  183   DTKYLATVLAIGTECDIAMLTVNDDEFWEGVSPVEFGSLPALQDAVTVVGYPIGGDTISV  242

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++VEN
Sbjct  243   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDVEN  302

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+ DYERN +YTGFP+LGV  QK+ENP LR  + + S++ GV IR+VE
Sbjct  303   IGYVIPTPVIMHFIIDYERNKEYTGFPTLGVEWQKMENPDLRMAMGMTSDQKGVRIRRVE  362

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+++SFD + +  +GTVPFR  ERI F YL+S+K++G+ + + ++R  
Sbjct  363   PTAPESQVLKPSDILLSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGENSVVKVLRNS  422

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E  +  I L+    L+P HI+G  PSY I+AG VFT +S P ++ E     E    +KLL
Sbjct  423   EIFEFNIKLATYKRLIPAHIKGRPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYDAPVKLL  482

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A  + EQ+VV+SQVL  ++NIGYEDI N Q+L  NGK ++N+  LA ++++C 
Sbjct  483   DKHLHAMAQSEDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLASMVENCD  542

Query  1755  DKYLVFEF  1778
             D++L FE 
Sbjct  543   DEFLKFEL  550



>gb|AFW73360.1| hypothetical protein ZEAMMB73_819902 [Zea mays]
Length=577

 Score =   488 bits (1255),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 246/476 (52%), Positives = 341/476 (72%), Gaps = 19/476 (4%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  100   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHYTQVKLKKRGS  159

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  160   DTKYLATVLAIGTECDIALLTVNDDEFWEGVSPVEFGTLPALQDAVTVVGYPIGGDTISV  219

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  220   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDRGKCVGIAFQSLKHEDAEN  279

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V++HF++DY+++G+YTGFP LGV  QK+ENP LR  + + P  +GV +R+VE
Sbjct  280   IGYVIPTPVITHFIEDYKKSGEYTGFPILGVEWQKMENPDLRKAMGMKPDQKGVRVRRVE  339

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  340   PTAPESGCLRPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGEKALVKVLRDS  399

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  + +I L+    LV  H++G  PSY IVAG VF  +S P ++ E     E    +KLL
Sbjct  400   KVHEFKIRLATHKRLVAAHVKGRPPSYYIVAGFVFAAISVPYLRSEYGKDYEYDAPVKLL  459

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL +++NIGYE+I N Q+L  NG+ ++N+ +LA ++++CK
Sbjct  460   VKHLHAMAESPDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGQPVKNLKNLATMVENCK  519

Query  1755  DKYLVFEFADN--------------FLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L F+   +               +VVLE + A   +  IL  + IPS  S DL
Sbjct  520   DEFLKFDLEYDQLIKAFLMDTNIWSLIVVLETKTAKAATQDILTTHCIPSATSDDL  575



>gb|KDO69730.1| hypothetical protein CISIN_1g007213mg [Citrus sinensis]
Length=612

 Score =   487 bits (1253),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 243/500 (49%), Positives = 334/500 (67%), Gaps = 32/500 (6%)
 Frame = +3

Query  477   VETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEH  656
             VE G  +    ++AVVKV+C HT P++SLPWQ++RQY+S+ S F IG  ++LTNAH VEH
Sbjct  111   VEPGVARVVPAMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEH  170

Query  657   DTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVV  836
              TQVK+K+RG DTKY+A VLA G ECDIA+L+VE +EFW+G  P++FG LP LQDAVTVV
Sbjct  171   YTQVKLKKRGSDTKYLATVLAIGTECDIAMLTVEDDEFWEGVLPVEFGELPALQDAVTVV  230

Query  837   GYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVA  1016
             GYP+GGDTISVT GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+A
Sbjct  231   GYPIGGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIA  290

Query  1017  FQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPS  1196
             FQ  + ++VENIGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + +
Sbjct  291   FQSLKHEDVENIGYVIPTPVIMHFIQDYEKNGAYTGFPLLGVEWQKMENPDLRVAMSMKA  350

Query  1197  NE-GVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSG  1373
             ++ GV IR+V+PT+     LK  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G
Sbjct  351   DQKGVRIRRVDPTAPESEVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTG  410

Query  1374  DTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVF-------TPLSEPL  1532
             D+A + ++R  + +   I L+    L+P H +G  PSY I+AG VF       + LS   
Sbjct  411   DSAAVKVLRDSKILNFNITLATHRRLIPSHNKGRPPSYYIIAGFVFSRCLYLISVLSMER  470

Query  1533  IQE-------------ECEDSIGLKLLTKARYSFANFKGEQIVVLS-----------QVL  1640
             I               +C +     LL   R         ++ +LS           +VL
Sbjct  471   IMNMKLRSSFWTSSCIQCHNCQMSSLLWCLRSPLCLNCFNKVFLLSLSLTFSFPWFCKVL  530

Query  1641  ANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAAL  1820
               ++NIGYE+I N Q+L  NG  ++N+  LA+++++C D++L F+   + +VVL  + + 
Sbjct  531   VADINIGYEEIVNTQVLAFNGNPVKNLKSLANMVENCDDEFLKFDLEYDQVVVLRTKTSK  590

Query  1821  TTSTSILKDYGIPSERSSDL  1880
               +  IL  + IPS  S DL
Sbjct  591   AATLDILATHCIPSAMSDDL  610



>ref|XP_006439769.1| hypothetical protein CICLE_v10019344mg [Citrus clementina]
 gb|ESR53009.1| hypothetical protein CICLE_v10019344mg [Citrus clementina]
Length=578

 Score =   483 bits (1244),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 237/475 (50%), Positives = 329/475 (69%), Gaps = 16/475 (3%)
 Frame = +3

Query  477   VETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEH  656
             VE G  +    ++AVVKV+C HT P++SLPWQ++RQY+S+ S F IG  ++LTNAH VEH
Sbjct  111   VEPGVARVVPAMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEH  170

Query  657   DTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVV  836
              TQVK+K+RG DTKY+A VLA G ECDIA+L+VE +EFW+G  P++FG LP LQDAVTVV
Sbjct  171   YTQVKLKKRGSDTKYLATVLAIGTECDIAMLTVEDDEFWEGVLPVEFGELPALQDAVTVV  230

Query  837   GYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVA  1016
             GYP+GGDTISVT GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+A
Sbjct  231   GYPIGGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIA  290

Query  1017  FQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPS  1196
             FQ  + ++VENIGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + +
Sbjct  291   FQSLKHEDVENIGYVIPTPVIMHFIQDYEKNGAYTGFPLLGVEWQKMENPDLRVAMGMKA  350

Query  1197  NE-GVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSG  1373
             ++ GV IR+V+PT+     LK  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G
Sbjct  351   DQKGVRIRRVDPTAPESEVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTG  410

Query  1374  DTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE---  1544
             D+A + ++R  + +   I L+    L+P H +G  PSY I+AG VF+ +S P ++ E   
Sbjct  411   DSAAVKVLRDSKILNFNITLATHRRLIPSHNKGRPPSYYIIAGFVFSTVSVPYLRSEYGK  470

Query  1545  -CEDSIGLKLLTKARYSFANFKGEQIV--VLSQVLANEVNIGYEDISNEQILKLNGKRIR  1715
               E    +KLL K  YS    +   ++  + S +  N  N         ++L  NG  ++
Sbjct  471   DYEYEAPVKLLDKLLYSMPQLQMSSLLWCLRSPLCLNCFN---------KVLAFNGNPVK  521

Query  1716  NIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             N+  LA+++++C D++L F+   + +VVL  + +   +  IL  + IPS  S DL
Sbjct  522   NLKSLANMVENCDDEFLKFDLEYDQVVVLRTKTSKAATLDILATHCIPSAMSDDL  576



>gb|EPS65237.1| hypothetical protein M569_09541, partial [Genlisea aurea]
Length=413

 Score =   476 bits (1225),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 231/399 (58%), Positives = 294/399 (74%), Gaps = 7/399 (2%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  14    MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIKGRRVLTNAHSVEHYTQVKLKKRGS  73

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECD+ALL+VE  EFW+G  P+ FG LP LQDAVTVVGYP+GGDTISV
Sbjct  74    DTKYLASVLAIGTECDVALLTVEDNEFWEGVSPVDFGELPALQDAVTVVGYPIGGDTISV  133

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  134   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDAEN  193

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALR--ACLKVPSNEGVLIRKV  1223
             IGYVIPT V+ HF+QDYERNG YTGFP LGV  QK+ENP LR  + +KV   +GV IRK+
Sbjct  194   IGYVIPTPVIIHFIQDYERNGAYTGFPILGVEWQKMENPDLRLSSGMKV-DQKGVRIRKI  252

Query  1224  EPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRA  1403
             +PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++GD+A + ++R 
Sbjct  253   DPTAPEFKVLKASDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDSAAIKVLRD  312

Query  1404  GEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKL  1571
                +K  I LS    L+P H +G  PSY I+ G VFT +S P ++ E     E    +KL
Sbjct  313   SAILKFDIKLSTNRRLIPAHNKGRPPSYYIIGGFVFTAVSVPYLRSEYGKDYEYEAPVKL  372

Query  1572  LTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQI  1688
             L K  + F     EQIVV+SQVL  ++NIGYEDI N Q+
Sbjct  373   LDKLLHEFPQSPDEQIVVVSQVLVADINIGYEDIVNTQV  411



>gb|KFM29273.1| Protease Do-like 9 [Auxenochlorella protothecoides]
Length=542

 Score =   478 bits (1230),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 245/489 (50%), Positives = 326/489 (67%), Gaps = 26/489 (5%)
 Frame = +3

Query  492   LQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMI-------GDGKLLTNAHCV  650
             L+  N ++AV KV+C HT PD SLPWQ++RQY+ST S F+I       G   LLTNAH V
Sbjct  40    LETINVMDAVCKVFCVHTEPDMSLPWQRKRQYSSTSSGFVIALEGDRFGGKYLLTNAHSV  99

Query  651   EHDTQ--------------VKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEP  788
             E+ +Q              VKVKRR DD+K++AKVLA G ECDIALL+VE  EFWK  EP
Sbjct  100   ENHSQARFGGGGGETERRHVKVKRRDDDSKFLAKVLAIGTECDIALLTVEDPEFWKDVEP  159

Query  789   LQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGN  968
             +  G LP+LQD+V VVGYP+GGDTISVT GVVSRIEVTSYAHG++ELLG+QIDAA+N GN
Sbjct  160   VVLGPLPQLQDSVFVVGYPVGGDTISVTSGVVSRIEVTSYAHGATELLGVQIDAAINSGN  219

Query  969   SGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLL  1148
             SGGP FN+ GEC+GVAFQ Y   E ENIGYVIPT V+ HFL DY+RNG +TGFP+LG+  
Sbjct  220   SGGPVFNEAGECVGVAFQSYAGSEAENIGYVIPTPVIHHFLVDYQRNGTFTGFPALGIQW  279

Query  1149  QKLENPALRACLKV-PSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRS  1325
             Q++E+  LR    + P  +GVL+R+V P S+A   L+ GDV++ FD  ++  +GTV FRS
Sbjct  280   QRMESATLRHSHGMAPGQKGVLVREVLPLSEAAGVLQPGDVLMQFDQTQIANDGTVGFRS  339

Query  1326  TERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGL  1505
              ERIA+ +L S+KF+GD A L ++R G+ + + I L     LVP+H+    PSY +VAGL
Sbjct  340   NERIAYSFLTSQKFTGDVASLRVLREGKELDLCIKLMRPDFLVPHHLFNKDPSYFVVAGL  399

Query  1506  VFTPLSEPLIQEECEDSI----GLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDI  1673
             VFT L+EP +  E          +KLL +  Y+  +  G+Q+V+L+QVLA E  IGYEDI
Sbjct  400   VFTNLTEPYLASEFGPDYLREAPVKLLDRLLYTHKDRPGQQVVMLNQVLACEATIGYEDI  459

Query  1674  SNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYG  1853
             SN Q+ K N  ++ ++ HL  L+   ++ ++ F      ++VL+   A   +  +   + 
Sbjct  460   SNSQVAKFNDVKVNSLQHLVELVQENREPFMRFNLESKEVLVLDASLAQACTEEMQVFHS  519

Query  1854  IPSERSSDL  1880
             IP   S DL
Sbjct  520   IPHALSKDL  528



>emb|CEF97941.1| Serine endopeptidase DegP2 [Ostreococcus tauri]
Length=545

 Score =   478 bits (1230),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 241/462 (52%), Positives = 332/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AV+KV+CTHT P+YSLPWQ++RQ +ST + F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  83    IDAVIKVFCTHTEPNYSLPWQRKRQSSSTSTGFVIDGNRVLTNAHSVEHHTQVKLKKRGS  142

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             D KYVAKVLA GVECD+ALL+VE +EF++  +P++FG LPRLQD+VTVVGYP+GG  ISV
Sbjct  143   DKKYVAKVLAIGVECDLALLTVEDKEFFEDVDPVRFGILPRLQDSVTVVGYPVGGIAISV  202

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIEVTSY+HG++ELLG+QIDAA+N GNSGGPAFN +G+C+GVAFQ  +  + EN
Sbjct  203   TSGVVSRIEVTSYSHGAAELLGVQIDAAINSGNSGGPAFNREGKCVGVAFQSLKDSDTEN  262

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGY+IPT V+ HFL D++R GKY GFP+L    Q+LENP+LR  L + S + GVL+R++ 
Sbjct  263   IGYIIPTPVIDHFLSDFDRTGKYNGFPALQCEFQRLENPSLRKSLGMTSTQKGVLLRRIS  322

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             P S     LK GDV++ FD V V  +GTV FR+ ERI F YL+SRK+ GD A + + R G
Sbjct  323   PLSPTAKVLKCGDVLMKFDGVDVASDGTVAFRTGERINFSYLVSRKYVGDAASVTVFRGG  382

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + +  ++ L+    LVP HIEG  PSY I AG+VF  ++ P ++ E     +    L+LL
Sbjct  383   KVIDFKVGLAMHDRLVPVHIEGVPPSYYICAGIVFAVVTVPYLRSEYGKDYDYDAPLRLL  442

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +     K +Q+VV+SQVL++++NIGYEDI N  +  +NG+ I N+  L  +++ CK
Sbjct  443   MKMMHGHKEKKDDQVVVVSQVLSSDINIGYEDIVNVIVTGVNGRPINNLRSLVKIIEECK  502

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL  E   +  +VL ++ A  ++  IL  + IP+ +S DL
Sbjct  503   DEYLKIELDQSMQLVLAQKEAKKSTKDILATHCIPNPKSVDL  544



>ref|XP_001417982.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96275.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=550

 Score =   475 bits (1223),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 244/462 (53%), Positives = 329/462 (71%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             L+AVVKV+ THT P++SLPWQ++RQ +ST + F+I    +LTNAH VEH TQVK+K+RG 
Sbjct  88    LDAVVKVFATHTEPNWSLPWQRKRQSSSTSTGFVIEGNMVLTNAHSVEHHTQVKLKKRGS  147

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             D KYVAKVL  GVECD+ALL+VE +EF++G  P++FG LPRLQD+VTVVGYP+GG  ISV
Sbjct  148   DKKYVAKVLTIGVECDLALLTVEEKEFFEGVAPVKFGVLPRLQDSVTVVGYPVGGIAISV  207

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIEVTSY+HG++ELLG+QIDAA+N GNSGGPAF  +G+C+GVAFQ  +  + E 
Sbjct  208   TSGVVSRIEVTSYSHGATELLGVQIDAAINSGNSGGPAFGREGQCVGVAFQSLKDSDTEG  267

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGY+IPT VV HF+ D++R G Y GFP+L    Q+LENP+LR  L + P++ GVL+R++ 
Sbjct  268   IGYIIPTPVVDHFISDFKRTGVYNGFPALQCEFQRLENPSLRKSLGMKPAHNGVLLRRLS  327

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             P + A   LK GDV++ FD V V  +GTV FR+ ERI F YL+SRK+ GD+A + ++R G
Sbjct  328   PLAPAAKVLKRGDVLMKFDGVDVASDGTVVFRTGERINFSYLVSRKYVGDSAAVTVLRDG  387

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + M   I L+P   LVP HIEG  PSY I AG+VFT +  P ++ E     +    L+LL
Sbjct  388   KMMNFDISLTPHDRLVPVHIEGKPPSYYICAGIVFTVVCVPYLRSEYGKDYDYDAPLRLL  447

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
             TK  +       +Q+VV+SQVL +++NIGYEDI N  +  +NGK +RN+  L  +++ CK
Sbjct  448   TKMMHGHKEKPDDQVVVVSQVLNSDINIGYEDIVNVVVCGVNGKSVRNLRELVKIVEGCK  507

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
              +YL  E   +  +VLE +AA  ++  IL  + IP+  S DL
Sbjct  508   HEYLKIELDQSIQIVLETKAAKKSTKEILHTHCIPNASSVDL  549



>ref|XP_003079294.1| putative DegP2 protease (ISS) [Ostreococcus tauri]
Length=737

 Score =   480 bits (1236),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 241/462 (52%), Positives = 331/462 (72%), Gaps = 5/462 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AV+KV+CTHT P+YSLPWQ++RQ +ST + F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  275   IDAVIKVFCTHTEPNYSLPWQRKRQSSSTSTGFVIDGNRVLTNAHSVEHHTQVKLKKRGS  334

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             D KYVAKVLA GVECD+ALL+VE +EF++  +P++FG LPRLQD+VTVVGYP+GG  ISV
Sbjct  335   DKKYVAKVLAIGVECDLALLTVEDKEFFEDVDPVRFGILPRLQDSVTVVGYPVGGIAISV  394

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIEVTSY+HG++ELLG+QIDAA+N GNSGGPAFN +G+C+GVAFQ  +  + EN
Sbjct  395   TSGVVSRIEVTSYSHGAAELLGVQIDAAINSGNSGGPAFNREGKCVGVAFQSLKDSDTEN  454

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGY+IPT V+ HFL D++R GKY GFP+L    Q+LENP+LR  L + S + GVL+R++ 
Sbjct  455   IGYIIPTPVIDHFLSDFDRTGKYNGFPALQCEFQRLENPSLRKSLGMTSTQKGVLLRRIS  514

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             P S     LK GDV++ FD V V  +GTV FR+ ERI F YL+SRK+ GD A + + R G
Sbjct  515   PLSPTAKVLKCGDVLMKFDGVDVASDGTVAFRTGERINFSYLVSRKYVGDAASVTVFRGG  574

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + +  ++ L+    LVP HIEG  PSY I AG+VF  ++ P ++ E     +    L+LL
Sbjct  575   KVIDFKVGLAMHDRLVPVHIEGVPPSYYICAGIVFAVVTVPYLRSEYGKDYDYDAPLRLL  634

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  +     K +Q+VV+SQVL++++NIGYEDI N  +  +NG+ I N+  L  +++ CK
Sbjct  635   MKMMHGHKEKKDDQVVVVSQVLSSDINIGYEDIVNVIVTGVNGRPINNLRSLVKIIEECK  694

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+YL  E   +  +VL ++ A  ++  IL  + IP  +S DL
Sbjct  695   DEYLKIELDQSMQLVLAQKEAKKSTKDILATHWIPKPKSVDL  736



>ref|XP_005704064.1| serine-type endopeptidase isoform 1 [Galdieria sulphuraria]
 gb|EME27544.1| serine-type endopeptidase isoform 1 [Galdieria sulphuraria]
Length=569

 Score =   474 bits (1220),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 253/543 (47%), Positives = 347/543 (64%), Gaps = 29/543 (5%)
 Frame = +3

Query  330   TRRSKGERFFSN--VDDRNTNKNGRSQSTSFKSFGVQRKGKGVQFDSK----------EL  473
              RR   ER   N  +D+     +     TS  S GV R+ K  +  SK          E+
Sbjct  22    VRRKSRERKSGNTDLDEELLYHSSSPDQTSRISGGVNRRSKMDRSHSKLGNSNLCLQDEV  81

Query  474   QVET----GNLQD--------ANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIG  617
             +VE      N++D        A+ L++V K+Y TH  P+YSLPWQK+RQ  ST +AF +G
Sbjct  82    EVEDYMHDDNVKDVEMSAGFPADVLDSVFKLYVTHCEPNYSLPWQKRRQTYSTSTAFAVG  141

Query  618   DGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQF  797
             + ++LTNAHCVEH T VK+K+RG + KY+A+V++ G +CDIALLSVE E FW+G E L  
Sbjct  142   NRRILTNAHCVEHSTVVKIKKRGSEKKYMAQVVSIGNDCDIALLSVEDESFWEGVECLSS  201

Query  798   GHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGG  977
             G LP LQ+AVTVVGYP+GG+ ISVT GVVSR+E+  Y+HG+ +LLG+QIDAA+NPGNSGG
Sbjct  202   GRLPYLQEAVTVVGYPIGGENISVTAGVVSRVELQQYSHGAIDLLGVQIDAAINPGNSGG  261

Query  978   PAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKL  1157
             PAFN   EC+G+AFQ   + E ENIGY+IP  VV HFL D++RNG YTGF   G   Q++
Sbjct  262   PAFNSRFECVGIAFQSLLTTEAENIGYIIPWLVVQHFLDDFDRNGYYTGFCYCGFEFQRM  321

Query  1158  ENPALRACLKVPSNE-GVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTER  1334
             EN  LR    +     GVLI+++ PTS     L++GDVI  FD V +  +GTV +R  ER
Sbjct  322   ENEYLRKSFHLSDESGGVLIKRIAPTSPCSKVLQKGDVITHFDGVPIANDGTVSYRGGER  381

Query  1335  IAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFT  1514
             I F YLI+ KF G++  + I+R G  M+V   L     LVP H +   P YL VAGLVF 
Sbjct  382   INFHYLITLKFVGESCTVRIVRNGNIMEVSYPLFELPLLVPIHEKRPVPEYLTVAGLVFV  441

Query  1515  PLSEPLIQ----EECEDSIGLKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNE  1682
              LSEP ++    E+ +    +KLL K  Y +     EQ+V+LSQVL   +N+GYE ++N 
Sbjct  442   ALSEPYLRSEYGEKWDFEAPVKLLDKLLYGYKRTANEQVVILSQVLNARINVGYECLTNT  501

Query  1683  QILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPS  1862
             ++L  NG R+ N+ HLA+L+D   +++L F+   + ++V+E++AAL  S+ IL  +GIP+
Sbjct  502   ELLHFNGTRVENLCHLANLIDETSEEFLRFDLEFDEVIVIEKQAALEQSSQILVQHGIPT  561

Query  1863  ERS  1871
              RS
Sbjct  562   PRS  564



>gb|EMT08042.1| Protease Do-like protein 9 [Aegilops tauschii]
Length=538

 Score =   472 bits (1214),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 236/445 (53%), Positives = 325/445 (73%), Gaps = 10/445 (2%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV C HT P++S+PWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  23    MDAVVKVCCVHTEPNFSMPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHYTQVKLKKRGS  82

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFWKG  PL+FG LP LQDAVTVVGYP+GGDTISV
Sbjct  83    DTKYLATVLAIGNECDIAMLTVDDDEFWKGVLPLEFGLLPALQDAVTVVGYPIGGDTISV  142

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  143   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDQGKCVGIAFQSLKHEDAEN  202

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++G+YTGFP LG+  QK+ENP LR  + + S++ GV IR++E
Sbjct  203   IGYVIPTPVIKHFIQDYEKSGEYTGFPILGIEWQKMENPDLRKAMGMKSDQKGVRIRRIE  262

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     ++  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  263   PTAPESGCMQPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKARVKVLRNS  322

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  +  I LS    L+P HI+G  PSY IVAG VF  +S P ++ E     E    +KLL
Sbjct  323   KIHEFNIKLSIHKKLIPAHIKGRPPSYYIVAGFVFMVVSVPYLRSEYGKDYEFDAPVKLL  382

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++ A    EQ+VV+SQVL  ++NIGYE++ N Q+   NGK + N+  LA +++ CK
Sbjct  383   DKHLHAMAQSPDEQLVVVSQVLVADINIGYEELVNTQVRAFNGKPVNNLKQLATMVEDCK  442

Query  1755  DKYLVFEFADNFLVVLEREAALTTS  1829
             +++L F+   +     +R  A +TS
Sbjct  443   EEFLKFDMDYD-----QRALAWSTS  462



>gb|EMS45662.1| Protease Do-like 9 [Triticum urartu]
Length=510

 Score =   469 bits (1208),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 244/508 (48%), Positives = 337/508 (66%), Gaps = 51/508 (10%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++S+PWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  1     MDAVVKVFCVHTEPNFSMPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHYTQVKLKKRGS  60

Query  690   DTKYVAKVLARGVECDI-------------------------------------------  740
             DTKY+A VLA G ECDI                                           
Sbjct  61    DTKYLATVLAIGNECDIVLAARDFDCHKHTGVLRNCLDMWIIVSIFLKNGGHNTTEVVWR  120

Query  741   ---ALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYA  911
                A+L+V+ +EFWKG  PL+FG LP LQDAVTVVGYP+GGDTISVT GVVSRIE+ SY 
Sbjct  121   HMVAMLTVDDDEFWKGVLPLEFGLLPALQDAVTVVGYPIGGDTISVTSGVVSRIEILSYV  180

Query  912   HGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFL  1091
             HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ ENIGYVIPT V+ HF+
Sbjct  181   HGSTELLGLQIDAAINSGNSGGPAFNDQGKCVGIAFQSLKHEDAENIGYVIPTPVIKHFI  240

Query  1092  QDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVEPTSDAHNTLKEGDV  1268
             QDYE++G+YTGFP LG+  QK+ENP LR  + + S++ GV IR++EPT+     ++  D+
Sbjct  241   QDYEKSGEYTGFPILGIEWQKMENPDLRKAMGMKSDQKGVRIRRIEPTAPESGCMQPSDI  300

Query  1269  IVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVD  1448
             I+SFD + +  +GTVPFR  ERI F YL+S+K++G+ A + ++R+ +  +  I LS    
Sbjct  301   ILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKARVKVLRSSKIHEFNIKLSIHKK  360

Query  1449  LVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLLTKARYSFANFKGEQ  1616
             L+P HI+G  PSY IVAG VF  +S P ++ E     E    +KLL K  ++ A    EQ
Sbjct  361   LIPAHIKGRPPSYYIVAGFVFMVVSVPYLRSEYGKDYEFDAPVKLLDKHLHAMAQSPDEQ  420

Query  1617  IVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLV  1796
             +VV+SQVL  ++NIGYE++ N Q+   NGK + N+  LA +++ C +++L F+   + +V
Sbjct  421   LVVVSQVLVADINIGYEELVNTQVRAFNGKPVNNLKQLATMVEDCNEEFLKFDMDYDQVV  480

Query  1797  VLEREAALTTSTSILKDYGIPSERSSDL  1880
             VLE + A   +  IL  + IPS  S DL
Sbjct  481   VLETKTARAATQDILTTHCIPSAMSDDL  508



>ref|XP_007031394.1| Protease Do-like 9 isoform 3 [Theobroma cacao]
 gb|EOY02320.1| Protease Do-like 9 isoform 3 [Theobroma cacao]
Length=529

 Score =   468 bits (1205),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 231/402 (57%), Positives = 302/402 (75%), Gaps = 5/402 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P+YSLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  124   MDAVVKVFCVHTEPNYSLPWQRKRQYSSSSSGFIIGGKRVLTNAHSVEHYTQVKLKKRGS  183

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  184   DTKYLATVLAIGTECDIAMLTVSDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  243

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++VEN
Sbjct  244   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVEN  303

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR++E
Sbjct  304   IGYVIPTPVIMHFIQDYEKNGAYTGFPILGVEWQKMENPDLRLAMGMKPDQKGVRIRRIE  363

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + LK  D+I+SFD V+V  +GTVPFR  ERI F YL+S+K++GDTA + ++R  
Sbjct  364   PTAAESHLLKPSDIILSFDGVKVANDGTVPFRHGERIGFSYLVSQKYTGDTALVKVLRDS  423

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E +   I L+    L+P H  G  PSY I+AG VFT ++ P ++ E     E    +KLL
Sbjct  424   EIVAHDIKLATHKRLIPAHTNGKPPSYYIIAGFVFTAVTVPYLRSEYGKDYEFDAPVKLL  483

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLN  1700
              K  ++ A    EQ+VV+SQVL  ++NIGYE+I N Q+  L+
Sbjct  484   DKHLHAMAESTDEQLVVVSQVLVADINIGYEEIVNTQVFLLS  525



>ref|XP_002958880.1| serine protease [Volvox carteri f. nagariensis]
 gb|EFJ40068.1| serine protease [Volvox carteri f. nagariensis]
Length=509

 Score =   467 bits (1202),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 242/481 (50%), Positives = 321/481 (67%), Gaps = 24/481 (5%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMI---GDGKLLTNAHCVEHDTQVKVKR  680
             ++AVVKVYC HT P+YSLPWQ++RQY+S+ S F++   G   LLTNAH V++ TQVKVKR
Sbjct  1     MDAVVKVYCMHTEPNYSLPWQRKRQYSSSSSGFVVRYGGRNWLLTNAHSVDYHTQVKVKR  60

Query  681   RGDDTKYVAKVLARGVECDIALLSVESEEFW--------KGAEPLQFGHLPRLQDAVTVV  836
             RGDD K++A+V++ GVECDIA L V+  EFW        +    L+ G LPRLQD V VV
Sbjct  61    RGDDRKFLARVVSLGVECDIAALEVDDPEFWGALGVGSGRQLPVLELGPLPRLQDGVAVV  120

Query  837   GYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVA  1016
             GYP+GGDTISVT GVVSRIEVT Y+HGS+ELL IQIDAA+N GNSGGP FN   +C+G+A
Sbjct  121   GYPVGGDTISVTAGVVSRIEVTDYSHGSTELLAIQIDAAINGGNSGGPVFNRACQCVGIA  180

Query  1017  FQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-P  1193
             FQ     +VEN+GYVIPT VV HFL+DY R   +TGFP+LG+  Q++E+ ALR    + P
Sbjct  181   FQALVGSDVENVGYVIPTPVVIHFLEDYLRTSTFTGFPALGLQWQRMESEALRRAYGMSP  240

Query  1194  SNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSG  1373
               +GVL R + PTS A + L+  DV+++FD   +  +GTVPFR+ ERIAF YLI+ KF G
Sbjct  241   GQKGVLTRSINPTSAAASVLQPDDVVLAFDGTPISNDGTVPFRTGERIAFSYLITSKFVG  300

Query  1374  DTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED  1553
             DTA+L ++R G+ M++ + LS    LVP H+    P YLIV GLVFT  SEP +Q E   
Sbjct  301   DTAKLDVLRGGKKMELNVTLSKPKALVPPHLNNRDPPYLIVGGLVFTTASEPYLQSEYGS  360

Query  1554  SIG----LKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNI  1721
               G    +KLL +  + F   + E++VVLSQVLA +  +GYED+ N Q+LK NG+ I N+
Sbjct  361   DYGTDAPVKLLDRLYHGFPKTQDEEVVVLSQVLACDATLGYEDVYNVQLLKFNGRHISNL  420

Query  1722  HHLAH---LLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPY  1892
               LA    +       +L F+   N +VV+E    L  +  +L+ + IP +     M P+
Sbjct  421   TQLAEEGPVAGDGGGGFLRFDLDYNEVVVVEAGDVLKVTPDVLRAHSIPQD-----MAPH  475

Query  1893  V  1895
             V
Sbjct  476   V  476



>gb|KDO69729.1| hypothetical protein CISIN_1g007213mg [Citrus sinensis]
Length=578

 Score =   469 bits (1207),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 231/470 (49%), Positives = 323/470 (69%), Gaps = 6/470 (1%)
 Frame = +3

Query  477   VETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEH  656
             VE G  +    ++AVVKV+C HT P++SLPWQ++RQY+S+ S F IG  ++LTNAH VEH
Sbjct  111   VEPGVARVVPAMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEH  170

Query  657   DTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVV  836
              TQVK+K+RG DTKY+A VLA G ECDIA+L+VE +EFW+G  P++FG LP LQDAVTVV
Sbjct  171   YTQVKLKKRGSDTKYLATVLAIGTECDIAMLTVEDDEFWEGVLPVEFGELPALQDAVTVV  230

Query  837   GYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVA  1016
             GYP+GGDTISVT GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+A
Sbjct  231   GYPIGGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIA  290

Query  1017  FQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPS  1196
             FQ  + ++VENIGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + +
Sbjct  291   FQSLKHEDVENIGYVIPTPVIMHFIQDYEKNGAYTGFPLLGVEWQKMENPDLRVAMSMKA  350

Query  1197  NE-GVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSG  1373
             ++ GV IR+V+PT+     LK  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G
Sbjct  351   DQKGVRIRRVDPTAPESEVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTG  410

Query  1374  DTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECED  1553
             D+A + ++R  + +   I L+    L+P H +G  PSY I+AG VF+     +     E 
Sbjct  411   DSAAVKVLRDSKILNFNITLATHRRLIPSHNKGRPPSYYIIAGFVFSRCLYLISVLSMER  470

Query  1554  SIGLKLLTK-ARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHL  1730
              + +KL +     S       Q+  L   L + + +   +    ++L  NG  ++N+  L
Sbjct  471   IMNMKLRSSFWTSSCIQCHNCQMSSLLWCLRSPLCLNCFN----KVLAFNGNPVKNLKSL  526

Query  1731  AHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             A+++++C D++L F+   + +VVL  + +   +  IL  + IPS  S DL
Sbjct  527   ANMVENCDDEFLKFDLEYDQVVVLRTKTSKAATLDILATHCIPSAMSDDL  576



>ref|XP_010678715.1| PREDICTED: protease Do-like 9 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   463 bits (1191),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 216/462 (47%), Positives = 315/462 (68%), Gaps = 3/462 (1%)
 Frame = +3

Query  507   FLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRG  686
              +++VVKV+C HT P++ LPWQ++RQ++S+ + F+I   ++LTNA  VE+ TQ+ +K+RG
Sbjct  21    LMDSVVKVFCVHTMPNFFLPWQRKRQHSSSSTGFVIAGRRILTNAKSVEYHTQIMLKKRG  80

Query  687   DDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTIS  866
              DTKY+A VL  G EC+IALL+V  +EFW+   P++FG LP LQDAVTVVGYP+GGDTI 
Sbjct  81    SDTKYLATVLVIGTECNIALLTVNDDEFWEDVSPVKFGELPALQDAVTVVGYPIGGDTIC  140

Query  867   VTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVE  1046
             VT+GVVSR+++ SY  G ++L  +Q+DAA+N GN+GGPAFND G C+G+AFQ  + ++  
Sbjct  141   VTRGVVSRMKILSYVRGWTKLTCLQVDAAINSGNAGGPAFNDKGNCVGIAFQSIKHEDAV  200

Query  1047  NIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKV  1223
             NIGYVIPT V+ HF+QDYERN  YTGFP +G   QK+ENP LR  + + S++ G+L+ +V
Sbjct  201   NIGYVIPTPVIIHFIQDYERNEAYTGFPIIGFEWQKMENPDLRMAMGMKSDQKGILVTRV  260

Query  1224  EPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRA  1403
             E  +     L+  DVI+SFD V +G +GTV FR  ERI F YLIS+K++GD  ++ ++R 
Sbjct  261   EAAALGSEILQPSDVILSFDGVDIGNDGTVVFRHGERIGFNYLISQKYTGDNTKIKLLRD  320

Query  1404  GEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECE--DSIGLKLLT  1577
              E  +  I   P   L+P   +   PSY I+AG VFT +S   +  E        ++LL 
Sbjct  321   SEMHEFDIKFDPHKKLIPTCTDDRPPSYYILAGFVFTAVSVSYLFSEYSSMSDFPVELLY  380

Query  1578  KARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKD  1757
             K  YS A    E+++++SQVL  ++NIGYED++N Q++ +NG  ++N+    ++++SC  
Sbjct  381   KLHYSMAKSNDEELIIISQVLVADINIGYEDLTNVQVIAVNGNPVKNLKSFKNMVESCNS  440

Query  1758  KYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLM  1883
             ++L F+   N +VVL  E A  T+  IL  + IPS  S DL+
Sbjct  441   EFLKFDLEFNMMVVLRTETAKATTAEILATHCIPSAMSDDLL  482



>gb|EMT18472.1| Protease Do-like protein 9 [Aegilops tauschii]
Length=496

 Score =   463 bits (1191),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 236/442 (53%), Positives = 318/442 (72%), Gaps = 5/442 (1%)
 Frame = +3

Query  570   QKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALL  749
             Q++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG DTKY+A VLA G ECDIALL
Sbjct  53    QRKRQYSSSSSGFIIGGRRVLTNAHSVEHFTQVKLKKRGSDTKYLATVLAIGTECDIALL  112

Query  750   SVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSEL  929
             +V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISVT GVVSRIE+ SY HGS+EL
Sbjct  113   TVSDDEFWEGVTPVEFGSLPALQDAVTVVGYPIGGDTISVTSGVVSRIEILSYVHGSTEL  172

Query  930   LGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERN  1109
             LG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++VENIGYVIPT V+ HF+QDYE++
Sbjct  173   LGLQIDAAINSGNSGGPAFNDRGICVGIAFQSLKHEDVENIGYVIPTPVIKHFIQDYEKS  232

Query  1110  GKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDD  1286
             G YTGFP +G+  QK+ENP LR  + + P  +GV +R+VEPT+     L+  D+I+SFD 
Sbjct  233   GAYTGFPIIGIEWQKMENPDLRKAMGMKPDQKGVRVRRVEPTAPESGCLQPSDIILSFDG  292

Query  1287  VRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHI  1466
             V +  +GTVPFR  ERI F YL+S+K++GD A + ++R  +  + +I L+    L+  H+
Sbjct  293   VDIANDGTVPFRHGERIGFSYLVSQKYTGDKALIKVLRNSKVHEFKIKLATHKRLIAAHV  352

Query  1467  EGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLLTKARYSFANFKGEQIVVLSQ  1634
             +G  PSY IVAG VF  +S P ++ E     E    +KLL K  +S A    EQ+VV+SQ
Sbjct  353   KGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLLVKHLHSMAESPDEQLVVVSQ  412

Query  1635  VLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREA  1814
             VL  ++NIGYEDI N Q+L +NG  ++N+  L   +++CKD++L F+   + +VVLER+ 
Sbjct  413   VLVADINIGYEDIVNTQVLAVNGHPVKNLRDLVTTVENCKDEFLKFDLEYDQIVVLERKT  472

Query  1815  ALTTSTSILKDYGIPSERSSDL  1880
             A   +  IL  + IPS  S DL
Sbjct  473   AKAATEDILTTHCIPSAMSDDL  494



>ref|XP_005704063.1| serine-type endopeptidase isoform 2 [Galdieria sulphuraria]
 gb|EME27543.1| serine-type endopeptidase isoform 2 [Galdieria sulphuraria]
Length=584

 Score =   464 bits (1195),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 251/558 (45%), Positives = 346/558 (62%), Gaps = 44/558 (8%)
 Frame = +3

Query  330   TRRSKGERFFSN--VDDRNTNKNGRSQSTSFKSFGVQRKGKGVQFDSK----------EL  473
              RR   ER   N  +D+     +     TS  S GV R+ K  +  SK          E+
Sbjct  22    VRRKSRERKSGNTDLDEELLYHSSSPDQTSRISGGVNRRSKMDRSHSKLGNSNLCLQDEV  81

Query  474   QVET----GNLQD--------ANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIG  617
             +VE      N++D        A+ L++V K+Y TH  P+YSLPWQK+RQ  ST +AF +G
Sbjct  82    EVEDYMHDDNVKDVEMSAGFPADVLDSVFKLYVTHCEPNYSLPWQKRRQTYSTSTAFAVG  141

Query  618   DGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQF  797
             + ++LTNAHCVEH T VK+K+RG + KY+A+V++ G +CDIALLSVE E FW+G E L  
Sbjct  142   NRRILTNAHCVEHSTVVKIKKRGSEKKYMAQVVSIGNDCDIALLSVEDESFWEGVECLSS  201

Query  798   GHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGG  977
             G LP LQ+AVTVVGYP+GG+ ISVT GVVSR+E+  Y+HG+ +LLG+QIDAA+NPGNSGG
Sbjct  202   GRLPYLQEAVTVVGYPIGGENISVTAGVVSRVELQQYSHGAIDLLGVQIDAAINPGNSGG  261

Query  978   PAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKL  1157
             PAFN   EC+G+AFQ   + E ENIGY+IP  VV HFL D++RNG YTGF   G   Q++
Sbjct  262   PAFNSRFECVGIAFQSLLTTEAENIGYIIPWLVVQHFLDDFDRNGYYTGFCYCGFEFQRM  321

Query  1158  ENPALRACLKVPSNEG----------------VLIRKVEPTSDAHNTLKEGDVIVSFDDV  1289
             EN  LR    +    G                ++I ++ PTS     L++GDVI  FD V
Sbjct  322   ENEYLRKSFHLSDESGGVLIKRVGEHEIFFMKLIIAQIAPTSPCSKVLQKGDVITHFDGV  381

Query  1290  RVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIE  1469
              +  +GTV +R  ERI F YLI+ KF G++  + I+R G  M+V   L     LVP H +
Sbjct  382   PIANDGTVSYRGGERINFHYLITLKFVGESCTVRIVRNGNIMEVSYPLFELPLLVPIHEK  441

Query  1470  GGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLLTKARYSFANFKGEQIVVLSQV  1637
                P YL VAGLVF  LSEP ++    E+ +    +KLL K  Y +     EQ+V+LSQV
Sbjct  442   RPVPEYLTVAGLVFVALSEPYLRSEYGEKWDFEAPVKLLDKLLYGYKRTANEQVVILSQV  501

Query  1638  LANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAA  1817
             L   +N+GYE ++N ++L  NG R+ N+ HLA+L+D   +++L F+   + ++V+E++AA
Sbjct  502   LNARINVGYECLTNTELLHFNGTRVENLCHLANLIDETSEEFLRFDLEFDEVIVIEKQAA  561

Query  1818  LTTSTSILKDYGIPSERS  1871
             L  S+ IL  +GIP+ RS
Sbjct  562   LEQSSQILVQHGIPTPRS  579



>emb|CBJ48373.1| conserved unknown protein [Ectocarpus siliculosus]
Length=633

 Score =   466 bits (1199),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 232/482 (48%), Positives = 317/482 (66%), Gaps = 12/482 (2%)
 Frame = +3

Query  450   VQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKL  629
             V  D +E   ET        L+ V+++YCTH  P++SLPWQ+ +Q  ST + F+I   ++
Sbjct  10    VFVDDREFMEET--------LDNVLRIYCTHNMPNWSLPWQRLKQEQSTSTGFVIDGRRI  61

Query  630   LTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLP  809
             +TNAH VE+ T ++V+RRG D K+ A   A G ECD+A+L+VE EEFW+GA PL FG LP
Sbjct  62    ITNAHAVEYSTMIQVRRRGCDRKFQASRYAVGEECDLAILTVEDEEFWEGAAPLAFGELP  121

Query  810   RLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFN  989
              L D V+V+GYP+GG+ IS+T GVVSR+E+T YA    ELL IQIDAA+NPGNSGGP  N
Sbjct  122   ELTDDVSVIGYPVGGECISITAGVVSRVEMTVYAQAEKELLSIQIDAAINPGNSGGPVVN  181

Query  990   DDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYER-NGKYTGFPSLGVLLQKLENP  1166
             DDGE +GVAFQ     +VENIGYV+P  V+ HFL+D  R +GKY GFP LG+  Q LE+P
Sbjct  182   DDGEVVGVAFQSLDGSDVENIGYVVPVNVLEHFLEDVRRHDGKYLGFPRLGITHQHLESP  241

Query  1167  ALRACLKV-PSNEGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAF  1343
             ALR  L++ P   GV+I  V+PT  A N L++GDVI+  D +RV  +G++PFR+ ER+A 
Sbjct  242   ALRGSLRMSPQQTGVMITGVQPTCPAVNVLRKGDVIMKVDGIRVANDGSIPFRAGERVAL  301

Query  1344  RYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLS  1523
             +Y +S+ F  D  E+ ++R    M V + L     L P H  G  PSY ++ GLVFT +S
Sbjct  302   KYYMSQLFPEDKTEVELLRDDSVMSVTVPLYVSDFLCPVHFGGRAPSYFVLGGLVFTVMS  361

Query  1524  EPLIQEECEDSIG--LKLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKL  1697
              P ++ E E+  G    LL+ A +       E IV+L+QVLA+EVN+GYE  SN Q+L  
Sbjct  362   APYLEHEIEEGAGGLAHLLSTAEHGVRASNDEDIVILTQVLAHEVNVGYEGFSNMQLLSF  421

Query  1698  NGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSD  1877
             NG+R++++ HL  L D+ + ++L FE   + L+VLE       +T I KD  IPS RSSD
Sbjct  422   NGERVKSLKHLVRLADANRQEFLRFELFRDRLIVLEAAGVPDATTQICKDNSIPSPRSSD  481

Query  1878  LM  1883
             L+
Sbjct  482   LV  483



>gb|KCW56073.1| hypothetical protein EUGRSUZ_I01831 [Eucalyptus grandis]
Length=552

 Score =   463 bits (1191),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 229/398 (58%), Positives = 299/398 (75%), Gaps = 5/398 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVKVK+RG 
Sbjct  126   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHHTQVKVKKRGS  185

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V S+EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  186   DTKYLATVLAIGTECDIALLTVNSDEFWEGVAPVEFGELPALQDAVTVVGYPIGGDTISV  245

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SYAHGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  246   TSGVVSRMEMLSYAHGSTELLGVQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  305

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVP-SNEGVLIRKVE  1226
             IGY+IPT V+ HF+ DYE+NG YTGFP LGV  QK+ENP LR  + +    +GV IR++E
Sbjct  306   IGYIIPTPVIMHFIHDYEKNGLYTGFPILGVEWQKMENPDLRMAMGMKLDKKGVRIRRIE  365

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + LK  DVI+SFD + +  +GTVPFR  ERI F YL+S+K++GD A + ++R  
Sbjct  366   PTAPESHVLKPSDVILSFDGINIANDGTVPFRHGERIGFGYLVSQKYTGDKAHVQVLRNS  425

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + ++  I L+    L+P HI G  PSY I+AG VFT +S P ++ E     E    +KLL
Sbjct  426   KILEFDIKLATHKRLIPAHISGKSPSYYIIAGFVFTAVSVPYLRSEYGKDYEFDAPVKLL  485

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQI  1688
              K  +S A    EQ+VV+SQVL  ++NIGYEDI N Q+
Sbjct  486   DKLLHSMAGSVNEQLVVVSQVLVADINIGYEDIVNTQV  523



>emb|CAN62736.1| hypothetical protein VITISV_027750 [Vitis vinifera]
Length=558

 Score =   459 bits (1181),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 234/462 (51%), Positives = 317/462 (69%), Gaps = 26/462 (6%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+I   ++LTNAH VEH TQVK+K+RG 
Sbjct  116   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIEGRRVLTNAHSVEHHTQVKLKKRGS  175

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW G +P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  176   DTKYLATVLAIGTECDIALLTVNDDEFWDGVKPVEFGDLPALQDAVTVVGYPIGGDTISV  235

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELL                     G+C+G+AFQ  + ++VEN
Sbjct  236   TSGVVSRMEILSYVHGSTELL---------------------GKCVGIAFQSLKHEDVEN  274

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF++DYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR++E
Sbjct  275   IGYVIPTPVIMHFIRDYEKNGAYTGFPILGVEWQKMENPDLRVSMGMGPDQKGVRIRRIE  334

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + LK  DVI+SFD V +  +GTVPFR  ERI F YL+S+K++GD A + ++R  
Sbjct  335   PTAPESHVLKPSDVILSFDGVNIANDGTVPFRHGERIGFSYLVSQKYTGDNAVVKVLRNS  394

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             + ++  I L+    L+  HI+G  PSY I+ G VFT +S P ++ E     E    +KLL
Sbjct  395   QILEFCIKLAIHKRLIAAHIKGRPPSYYIIGGFVFTAVSVPYLRSEYGKDYEFDAPVKLL  454

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  YS A    EQ+VV++QVL  ++NIGYE+I N Q+L  NGK ++N+  LA +++SC 
Sbjct  455   DKHLYSMAQSVDEQLVVVAQVLVADINIGYEEIVNTQVLSFNGKPVKNLKSLATMVESCD  514

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D++L FE     +VVL+ + A   +  IL  + IPS  S DL
Sbjct  515   DEFLKFELEYQQIVVLQTKTAKAATLDILTTHCIPSAMSDDL  556



>emb|CDX99642.1| BnaC04g33990D [Brassica napus]
Length=560

 Score =   456 bits (1172),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 232/462 (50%), Positives = 318/462 (69%), Gaps = 28/462 (6%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ +RQY+S  S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  120   MDAVVKVFCVHTDPNFSLPWQMKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQVKLKKRGS  179

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  180   DTKYLATVLAIGTECDIALLTVSDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV  239

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  240   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  299

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             I                       GFP +G+  QK+ENP LR  + + S++ GV IR++E
Sbjct  300   I-----------------------GFPVIGIEWQKMENPDLRKKMGMESHQKGVRIRRIE  336

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD+A + I+R  
Sbjct  337   PTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVKILRNK  396

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             E ++  + L+    L+P HI G  PSY IVAG VFT +S P ++    +E E    +KLL
Sbjct  397   EILEFNVKLAIHKKLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEYDAPVKLL  456

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCK  1754
              K  ++      EQ+VV+SQVL +++NIGYE+I N Q++  NGK ++N+  LA ++++C+
Sbjct  457   EKHLHAMTQSVDEQLVVVSQVLVSDINIGYEEIVNTQVVAFNGKPVKNLKCLAEMVENCE  516

Query  1755  DKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             D+Y+ F    + +VVL+ + A   +  IL  + IPS  S DL
Sbjct  517   DEYMEFNLDYHQIVVLQTKTAKMATLDILTTHCIPSAMSDDL  558



>ref|XP_008647465.1| PREDICTED: uncharacterized protein LOC100217136 isoform X2 [Zea 
mays]
 gb|AFW76814.1| hypothetical protein ZEAMMB73_778886 [Zea mays]
Length=556

 Score =   454 bits (1169),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 224/397 (56%), Positives = 301/397 (76%), Gaps = 5/397 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  145   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHYTQVKLKKRGS  204

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+VE +EFWKG  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  205   DTKYLATVLAIGTECDIAMLTVEDDEFWKGVSPVEFGSLPALQDAVTVVGYPIGGDTISV  264

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+AFQ  + ++ EN
Sbjct  265   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAEN  324

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             IGYVIPT V++HF++DY+++G+YTGFP LG+  QK+ENP LR  + + +N+ GV IR+VE
Sbjct  325   IGYVIPTPVINHFIEDYKKSGEYTGFPILGIEWQKMENPDLRKAMGMKANQKGVRIRRVE  384

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G+ A + ++R  
Sbjct  385   PTAPESGCLEPSDIILSFDGIDIANDGTVPFRHGERIGFTYLVSQKYTGEKARVKVLRNS  444

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLKLL  1574
             +  +  I L+    L+P HI+G  PSY IVAG VF  +S P ++    +E E    +KLL
Sbjct  445   KIHEFNIKLATHKRLIPAHIKGRPPSYYIVAGFVFMAVSVPYLRSEYGKEYEYDAPVKLL  504

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQ  1685
              K  ++ A    EQ+VV+SQVL  ++NIGYEDI N Q
Sbjct  505   DKHLHAMAQSSDEQLVVVSQVLVADINIGYEDIVNIQ  541



>ref|XP_006439767.1| hypothetical protein CICLE_v10019344mg [Citrus clementina]
 gb|ESR53007.1| hypothetical protein CICLE_v10019344mg [Citrus clementina]
Length=526

 Score =   451 bits (1159),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 213/382 (56%), Positives = 282/382 (74%), Gaps = 5/382 (1%)
 Frame = +3

Query  477   VETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEH  656
             VE G  +    ++AVVKV+C HT P++SLPWQ++RQY+S+ S F IG  ++LTNAH VEH
Sbjct  111   VEPGVARVVPAMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEH  170

Query  657   DTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVV  836
              TQVK+K+RG DTKY+A VLA G ECDIA+L+VE +EFW+G  P++FG LP LQDAVTVV
Sbjct  171   YTQVKLKKRGSDTKYLATVLAIGTECDIAMLTVEDDEFWEGVLPVEFGELPALQDAVTVV  230

Query  837   GYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVA  1016
             GYP+GGDTISVT GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+A
Sbjct  231   GYPIGGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIA  290

Query  1017  FQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPS  1196
             FQ  + ++VENIGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + +
Sbjct  291   FQSLKHEDVENIGYVIPTPVIMHFIQDYEKNGAYTGFPLLGVEWQKMENPDLRVAMGMKA  350

Query  1197  NE-GVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSG  1373
             ++ GV IR+V+PT+     LK  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G
Sbjct  351   DQKGVRIRRVDPTAPESEVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTG  410

Query  1374  DTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE---  1544
             D+A + ++R  + +   I L+    L+P H +G  PSY I+AG VF+ +S P ++ E   
Sbjct  411   DSAAVKVLRDSKILNFNITLATHRRLIPSHNKGRPPSYYIIAGFVFSTVSVPYLRSEYGK  470

Query  1545  -CEDSIGLKLLTKARYSFANFK  1607
               E    +KLL K  YS    +
Sbjct  471   DYEYEAPVKLLDKLLYSMPQLQ  492



>dbj|BAK01822.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=501

 Score =   448 bits (1152),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 223/398 (56%), Positives = 296/398 (74%), Gaps = 5/398 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  100   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHFTQVKLKKRGS  159

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIALL+V  +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISV
Sbjct  160   DTKYLATVLAIGTECDIALLTVSDDEFWEGVTPVEFGSLPALQDAVTVVGYPIGGDTISV  219

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++VEN
Sbjct  220   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDRGICVGIAFQSLKHEDVEN  279

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE++G YTGFP +G+  QK+ENP LR  + + P  +GV +R+VE
Sbjct  280   IGYVIPTPVIKHFIQDYEKSGAYTGFPIIGIEWQKMENPDLRKAMGMKPDQKGVRVRRVE  339

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     L+  D+I+SFD V +  +GTVPFR  ERI F YL+S+K++GD A + ++R  
Sbjct  340   PTAPESGCLQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDKALIKVLRDS  399

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             +  + +I L+    L+  H++G  PSY IVAG VF  +S P ++ E     E    +KLL
Sbjct  400   KVHEFKIKLATHKRLIAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLL  459

Query  1575  TKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQI  1688
              K  +S      EQ+VV+SQVL  ++NIGYE+I N Q+
Sbjct  460   VKHLHSMVESPDEQLVVVSQVLVADINIGYEEIVNTQV  497



>ref|XP_007209088.1| hypothetical protein PRUPE_ppa003679mg [Prunus persica]
 gb|EMJ10287.1| hypothetical protein PRUPE_ppa003679mg [Prunus persica]
Length=557

 Score =   446 bits (1146),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 209/367 (57%), Positives = 273/367 (74%), Gaps = 5/367 (1%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  124   MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQVKLKKRGS  183

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             DTKY+A VLA G ECDIA+L+V+ +EFW G  P++FG LP LQD+VTVVGYP+GGDTISV
Sbjct  184   DTKYLATVLAIGTECDIAMLTVDDDEFWDGVSPVEFGDLPALQDSVTVVGYPIGGDTISV  243

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ EN
Sbjct  244   TSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDRGNCVGIAFQSLKHEDAEN  303

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + P  +GV IR+++
Sbjct  304   IGYVIPTPVIMHFIQDYEKNGAYTGFPILGVEWQKMENPDLRMSMGMKPDQKGVRIRRID  363

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+     LK  D+I+SFD V +  +GTVPFR  ERI F YLIS+K++GD + + ++R  
Sbjct  364   PTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDNSVVKVLRNS  423

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLL  1574
             E +   I L+    L+P H +G  PSY I+AG VFT +S P ++ E     E    +KLL
Sbjct  424   EILSFDIKLASHKRLIPAHNKGRPPSYYIIAGFVFTAVSVPYLRSEYGKDYEFEAPVKLL  483

Query  1575  TKARYSF  1595
              K  +S 
Sbjct  484   DKMLHSL  490



>gb|KDO69731.1| hypothetical protein CISIN_1g007213mg [Citrus sinensis]
Length=526

 Score =   442 bits (1137),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 203/347 (59%), Positives = 267/347 (77%), Gaps = 1/347 (0%)
 Frame = +3

Query  477   VETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEH  656
             VE G  +    ++AVVKV+C HT P++SLPWQ++RQY+S+ S F IG  ++LTNAH VEH
Sbjct  111   VEPGVARVVPAMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEH  170

Query  657   DTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVV  836
              TQVK+K+RG DTKY+A VLA G ECDIA+L+VE +EFW+G  P++FG LP LQDAVTVV
Sbjct  171   YTQVKLKKRGSDTKYLATVLAIGTECDIAMLTVEDDEFWEGVLPVEFGELPALQDAVTVV  230

Query  837   GYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVA  1016
             GYP+GGDTISVT GVVSRIE+ SY HGS+ELLG+QIDAA+N GNSGGPAFND G+C+G+A
Sbjct  231   GYPIGGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIA  290

Query  1017  FQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPS  1196
             FQ  + ++VENIGYVIPT V+ HF+QDYE+NG YTGFP LGV  QK+ENP LR  + + +
Sbjct  291   FQSLKHEDVENIGYVIPTPVIMHFIQDYEKNGAYTGFPLLGVEWQKMENPDLRVAMSMKA  350

Query  1197  NE-GVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSG  1373
             ++ GV IR+V+PT+     LK  D+I+SFD + +  +GTVPFR  ERI F YL+S+K++G
Sbjct  351   DQKGVRIRRVDPTAPESEVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTG  410

Query  1374  DTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFT  1514
             D+A + ++R  + +   I L+    L+P H +G  PSY I+AG VF+
Sbjct  411   DSAAVKVLRDSKILNFNITLATHRRLIPSHNKGRPPSYYIIAGFVFS  457



>ref|XP_005537155.1| DegP protease [Cyanidioschyzon merolae strain 10D]
 dbj|BAM81119.1| DegP protease [Cyanidioschyzon merolae strain 10D]
Length=596

 Score =   435 bits (1119),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 223/461 (48%), Positives = 308/461 (67%), Gaps = 7/461 (2%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             L++++KV+ TH  P+YSLPWQ ++Q  ST S F+I   ++LTNAH VE+ T V+VK+RG 
Sbjct  55    LDSILKVFSTHCTPNYSLPWQMRKQEYSTSSGFIIDGNRILTNAHSVENFTVVRVKKRGS  114

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
               K  A+V+A G ECDIALL+V+   F++   PL  G LP+LQD VTVVGYP+GG++ISV
Sbjct  115   AEKVTARVVAIGDECDIALLTVDDPTFFEDTCPLSLGSLPQLQDRVTVVGYPIGGESISV  174

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T+GVVSRIE+  YAHG++ELL +QIDAA+NPGNSGGPA N   ECIG+AFQ   + E EN
Sbjct  175   TEGVVSRIEIQQYAHGATELLSVQIDAAINPGNSGGPALNARLECIGIAFQSLSAREAEN  234

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKVPSNE-GVLIRKVE  1226
             +GYVIPT VV+HFL D +RNG+YTGF S G+  Q LEN ALR  L + ++E GVL+R++ 
Sbjct  235   VGYVIPTPVVNHFLTDVQRNGRYTGFCSAGIDWQALENSALRRFLGMDASETGVLLRRIH  294

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             P S A   L++ DV++ F+  R+G +GTV FR  ERI F +L+  K+ GD  +L I+R  
Sbjct  295   PLSGATAVLQKNDVLLEFEGNRIGNDGTVQFRKNERINFNFLVKEKYVGDECDLRILRGK  354

Query  1407  EFMKVQIVL--SPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQ----EECEDSIGLK  1568
               + V+  L  S    LVP H +  QP YL+VAGLVF  L+EP ++    E  E    +K
Sbjct  355   TRLDVRYKLDESSSSQLVPVHEKRRQPEYLVVAGLVFVVLTEPYLRSEYGERFEFEAPVK  414

Query  1569  LLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDS  1748
             LL K  +    F  EQ+V+LS V+ +E+  GY+ ++N Q+L+ N   +RN+ HLA L+  
Sbjct  415   LLNKLMHGEKKFPNEQVVILSHVIHHEITTGYQSLNNLQLLRFNDIEVRNLAHLAELVSK  474

Query  1749  CKDKYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERS  1871
              +  ++ F      LVV+E E +   +  IL  + IPS+RS
Sbjct  475   FEGVFMRFHLDYEELVVVETETSRRCTAEILTQHCIPSDRS  515



>ref|XP_006858733.1| hypothetical protein AMTR_s00066p00121670 [Amborella trichopoda]
 gb|ERN20200.1| hypothetical protein AMTR_s00066p00121670 [Amborella trichopoda]
Length=573

 Score =   426 bits (1095),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 220/462 (48%), Positives = 304/462 (66%), Gaps = 7/462 (2%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+   ++P+Y LPWQ + Q  + GS F+I   ++LTNAH V   T V+V++ G 
Sbjct  101   IDAVVKVFTVSSSPNYFLPWQNKSQRETMGSGFVIPGRRILTNAHVVADHTFVRVRKHGS  160

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
               KY A+V A G ECD+AL+ VESEEFW+G   L+ G +P LQ++V VVGYP GGD+ISV
Sbjct  161   PAKYRAEVQAVGHECDLALIVVESEEFWEGMHFLELGDIPFLQESVAVVGYPQGGDSISV  220

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             TKGVVSR+E T YAHG+++L+ IQIDAA+NPGNSGGPA   D +  GVAFQ       EN
Sbjct  221   TKGVVSRVEPTQYAHGATQLMAIQIDAAINPGNSGGPAIMGD-KVAGVAFQNLSG--AEN  277

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGY+IP  V+ HFL D + +GKY GF SLG+  Q  EN  LR    + P   GVL+ K+ 
Sbjct  278   IGYIIPVPVIKHFLSDVDESGKYVGFCSLGLSCQPSENAQLREHFHMHPEMTGVLVSKIN  337

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             P SDAH  LK+ D+I++FD V +  +GTVPFR+ ERI F +L+S K + +TA + ++R G
Sbjct  338   PISDAHRVLKKDDIILAFDGVPIANDGTVPFRNRERITFDHLVSMKKANETANIRVLRDG  397

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGL---KLLT  1577
             + +++ +V+ P   LVP H     PSY I AGLVF PL++P + E  ED       +L  
Sbjct  398   QELELSVVVHPLKALVPVHEYEKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCE  457

Query  1578  KARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKD  1757
             +A        GEQ+V+LSQVL +E+N+GYE ++  Q+ K+NG  I N+ HL  L++ CK+
Sbjct  458   RALRELPEKVGEQLVILSQVLMDEINVGYERLAELQVKKVNGVEIDNLKHLCELVEDCKE  517

Query  1758  KYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLM  1883
             + L F+  D  +VVL    A   ++ ILK + IPS  S+DL+
Sbjct  518   ESLRFDLDDERVVVLNYNKAKLATSRILKRHRIPSAMSTDLL  559



>gb|KEH24728.1| DegP protease [Medicago truncatula]
Length=550

 Score =   424 bits (1090),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 226/490 (46%), Positives = 306/490 (62%), Gaps = 7/490 (1%)
 Frame = +3

Query  426   GVQRKGKGVQFDSKELQVETGNLQDANFLNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSA  605
             G++R+ K +Q  S      T N       N+VVK++    +P+Y LPWQ + Q  S GS 
Sbjct  52    GIRRERKNIQPRSAAALTHTTNTAVELAFNSVVKIFTVSCSPNYLLPWQNKSQRESMGSG  111

Query  606   FMIGDGKLLTNAHCVEHDTQVKVKRRGDDTKYVAKVLARGVECDIALLSVESEEFWKGAE  785
             F+I   K+LTNAH V   + V V++ G   KY A+V A G ECD+ALL V+S EFW G  
Sbjct  112   FVIHGRKILTNAHVVADHSFVLVRKHGSPNKYRAQVKAVGHECDLALLIVDSHEFWDGML  171

Query  786   PLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSELLGIQIDAAVNPG  965
             PL+FG +P LQ AV VVGYP GGDTISVTKGVVSR+E T Y HG+S+L+ IQIDAA+NPG
Sbjct  172   PLEFGDIPFLQQAVAVVGYPQGGDTISVTKGVVSRVEPTQYVHGASQLMAIQIDAAINPG  231

Query  966   NSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYERNGKYTGFPSLGVL  1145
             NSGGPA   + +  GVAFQ       ENIGY+IP  V+ HF+ D E NGKY GF SLG+ 
Sbjct  232   NSGGPAIMGN-KVAGVAFQ--NLSGAENIGYIIPVPVIKHFISDVEENGKYIGFCSLGLS  288

Query  1146  LQKLENPALRACLKVPSN-EGVLIRKVEPTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFR  1322
              Q  EN  LR    +     GVL+ K+ P SDA+  LK+ D+I+SFD V +  +GTVPFR
Sbjct  289   CQTTENVHLRNHFGMQRGMTGVLVNKINPLSDAYRVLKKNDIILSFDGVPIANDGTVPFR  348

Query  1323  STERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAG  1502
             + ERI F +L+S K   + A + ++R G+ +++ I L P   LVP H     PSY I AG
Sbjct  349   NRERITFDHLVSMKKLNEKAVVRVMRDGQELELSITLQPIQPLVPVHQFDKLPSYYIFAG  408

Query  1503  LVFTPLSEPLIQEECEDSIGL---KLLTKARYSFANFKGEQIVVLSQVLANEVNIGYEDI  1673
             LVF PL++P + E  ED       +L  +A       + +Q+V+LSQVL +++N GYE +
Sbjct  409   LVFVPLTQPYLHEYGEDWYNASPRRLCERALRELPKKENQQLVILSQVLMDDINAGYERL  468

Query  1674  SNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLEREAALTTSTSILKDYG  1853
             ++ Q+LK+NG  I N+ HL  L+++C    L F+  DN ++VL  E A   ++ IL  + 
Sbjct  469   ADLQVLKVNGTEIDNLEHLCQLVENCTKDSLHFDLDDNRVIVLNYETAKIATSRILTRHR  528

Query  1854  IPSERSSDLM  1883
             IPS  S+DL+
Sbjct  529   IPSSMSADLI  538



>ref|XP_004962074.1| PREDICTED: protease Do-like 10, mitochondrial-like [Setaria italica]
Length=586

 Score =   423 bits (1088),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 219/462 (47%), Positives = 302/462 (65%), Gaps = 7/462 (2%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             L++VVKV+   ++P+Y LPWQ + Q  S GS F+I   +++TNAH V   T V V++ G 
Sbjct  113   LDSVVKVFTVSSSPNYFLPWQNKAQRESMGSGFVIPGRRIVTNAHVVADHTFVLVRKHGS  172

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
              TKY A+V A G ECD+ALL+VESEEFW G   L+ G +P LQ+AV VVGYP GGD ISV
Sbjct  173   PTKYKAEVQAVGHECDLALLTVESEEFWDGVNSLELGEIPFLQEAVAVVGYPQGGDNISV  232

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             TKGVVSR+E T YAHG+++L+ IQIDAA+NPGNSGGPA   D +  GVAFQ       EN
Sbjct  233   TKGVVSRVEPTQYAHGATQLMAIQIDAAINPGNSGGPAIMGD-KVAGVAFQNLSG--AEN  289

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGY+IP  V+  F+   E NGKY+GF +LGV  Q  EN  LR C  + P   GVL+ ++ 
Sbjct  290   IGYIIPVPVIKRFISGVEENGKYSGFCTLGVSCQATENIQLRECFGMRPEMTGVLVSRIN  349

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             P SDAH  LK+ D++++FD V +  +GTVPFR+ ERI F +L+S K  G+TA L  +R G
Sbjct  350   PLSDAHKILKKDDILLAFDGVPIANDGTVPFRNRERITFDHLVSMKKPGETAVLKALRDG  409

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGL---KLLT  1577
             +  ++ ++L P   LVP H     PSY I AG VF PL++P + E  ED       +L  
Sbjct  410   KEQELSVILRPLQPLVPVHQFDKLPSYYIFAGFVFIPLTQPYLHEFGEDWYNASPRRLCE  469

Query  1578  KARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKD  1757
             +A        GEQ+VVLSQVL +++N+GYE ++  Q+ K+NG  + N+ HL  L++SC +
Sbjct  470   RALRELPKKAGEQLVVLSQVLMDDINVGYERLAELQVKKVNGVEVENLKHLCSLVESCTE  529

Query  1758  KYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLM  1883
             + L F+  D  +++L+ + A   ++ +LK + IPS  SSDL+
Sbjct  530   ENLRFDLDDERVIILKYQNARLATSRVLKRHRIPSAMSSDLV  571



>gb|EYU42545.1| hypothetical protein MIMGU_mgv1a0052332mg, partial [Erythranthe 
guttata]
Length=386

 Score =   415 bits (1067),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 204/384 (53%), Positives = 268/384 (70%), Gaps = 5/384 (1%)
 Frame = +3

Query  744   LLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSS  923
             LL+V+ +EFW+G  P++FG LP LQDAVTVVGYP+GGDTISVT GVVSRIE+ SY HGS+
Sbjct  1     LLTVDDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISVTSGVVSRIEILSYVHGST  60

Query  924   ELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIGYVIPTTVVSHFLQDYE  1103
             ELLG+QIDAA+N GNSGGPAFND G C+G+AFQ  + ++ ENIGYVIPT V+ HF+QDYE
Sbjct  61    ELLGLQIDAAINSGNSGGPAFNDKGNCVGIAFQSLKHEDAENIGYVIPTPVIMHFIQDYE  120

Query  1104  RNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVEPTSDAHNTLKEGDVIVSF  1280
             +NGKYTGFP LGV  QK+ENP LR  + + P  +GV IR+++PT+     LK  D+I+SF
Sbjct  121   KNGKYTGFPILGVEWQKMENPDLRLSMGMKPDQKGVRIRRIDPTAPEFAVLKPSDIILSF  180

Query  1281  DDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEFMKVQIVLSPRVDLVPY  1460
             D V +  +GTVPFR  ERI F YL+S+K+SGD A + ++R+ E +K  I L     L+P 
Sbjct  181   DRVDIANDGTVPFRHGERIGFSYLVSQKYSGDNAAIKVLRSSETLKFNIKLDTHKRLIPA  240

Query  1461  HIEGGQPSYLIVAGLVFTPLSEPLIQEE----CEDSIGLKLLTKARYSFANFKGEQIVVL  1628
             H  G  PSY IVAG VFT +S P ++ E     E    +KLL K  +       EQIVV+
Sbjct  241   HNRGKPPSYYIVAGFVFTTVSVPYLRSEYGKDYEYEAPVKLLDKLLHEMRQSAEEQIVVV  300

Query  1629  SQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKYLVFEFADNFLVVLER  1808
             SQVL  ++NIGYE+I N Q+L  NG+ ++N+  LA +++SC D+YL F+     +VVL+ 
Sbjct  301   SQVLVADINIGYEEIVNTQVLAFNGQPVKNLKSLASMVESCSDEYLKFDLEYQQIVVLQT  360

Query  1809  EAALTTSTSILKDYGIPSERSSDL  1880
             + A   +  IL  + IPS  S DL
Sbjct  361   KTAKAATLDILSTHCIPSAMSDDL  384



>ref|XP_004489189.1| PREDICTED: protease Do-like 10, mitochondrial-like [Cicer arietinum]
Length=550

 Score =   420 bits (1080),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 223/486 (46%), Positives = 306/486 (63%), Gaps = 17/486 (3%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
              N+VVK++    +P+Y LPWQ + Q  +TGS F+I   ++LTNAH V   + V V++ G 
Sbjct  77    FNSVVKIFTVSCSPNYLLPWQNKAQRETTGSGFVIMGKQILTNAHVVADHSFVLVRKHGS  136

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
              TKY A+V A G ECD+ALL V S+EFW G  PL FGH+P LQ AV VVGYP GGDTISV
Sbjct  137   PTKYRAQVKAVGHECDLALLLVHSQEFWDGMIPLDFGHIPFLQQAVAVVGYPQGGDTISV  196

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             TKGVVSR+E T Y HG+S+L+ IQIDAA+NPGNSGGPA   + +  GVAFQ       EN
Sbjct  197   TKGVVSRVEPTQYVHGASQLMAIQIDAAINPGNSGGPAIMGN-KVAGVAFQ--NLSGAEN  253

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGY+IP  V+ HF+   E NGKY+GF SLG+  Q  EN  LR    + P   GVL+ K+ 
Sbjct  254   IGYIIPVPVIKHFISGVEENGKYSGFCSLGLSCQTTENVHLRNHFGMQPGMTGVLVNKIN  313

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             P SDA+  LK+ D+I+SFD V +  +GTV FR+ ERI F +L+S K   + A + ++R G
Sbjct  314   PLSDAYKVLKKDDIILSFDGVPIANDGTVSFRNRERITFDHLVSMKKLDEKAVVRVLRGG  373

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGL---KLLT  1577
             + +++ I L P   LVP H     PSY I AGLVF PL++P + E  ED       +L  
Sbjct  374   QEIELSITLRPIQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNASPRRLCE  433

Query  1578  KARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKD  1757
             +A       + +Q+V+LSQVL +++N GYE +++ Q+LK+NG  I N+ HL  L+++C  
Sbjct  434   RALRELPKKENQQLVILSQVLMDDINAGYERLADFQVLKVNGTEIDNLEHLCQLVENCST  493

Query  1758  KYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLMGPYVDSIGQNDAVDQQEF  1937
             + L F+  D+ ++VL  E A   ++ ILK + IPS  S+DL          N A +  +F
Sbjct  494   ESLHFDLDDDRVIVLNYETAKIATSRILKRHRIPSSMSTDL----------NKAQNNVQF  543

Query  1938  GDSAES  1955
             G +  +
Sbjct  544   GQTTST  549



>ref|XP_008353481.1| PREDICTED: protease Do-like 9, partial [Malus domestica]
Length=395

 Score =   414 bits (1065),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 187/303 (62%), Positives = 242/303 (80%), Gaps = 1/303 (0%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             ++AVVKV+C HT P++SLPWQ++RQY+S+ S F+IG  ++LTNAH VEH TQVK+K+RG 
Sbjct  92    MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHHTQVKLKKRGS  151

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
             +TKY+A VLA G ECDIA+L+V  +EFWKG   L+FG LP LQDAVTVVGYP+GGDTISV
Sbjct  152   ETKYLATVLAIGTECDIAMLTVSDDEFWKGVSHLEFGELPALQDAVTVVGYPIGGDTISV  211

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             T GVVSR+E+ SY HGS+ELLG+QIDAA+N GNSGGPAFND GEC+G+AFQ  + ++ EN
Sbjct  212   TSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGECVGIAFQSLKHEDAEN  271

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGYVIPT V+ HF+QDYE+NG YTGFP LG+  QK+ENP LR  + + P  +GV IR+VE
Sbjct  272   IGYVIPTPVIKHFIQDYEKNGAYTGFPVLGIEWQKMENPDLRISMGMRPDQKGVRIRRVE  331

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             PT+   + L+  DVI+SFD V +  +GTVPFR  ERI F YL+S+K++GD+A + ++R  
Sbjct  332   PTAPHSHVLQPSDVILSFDGVNIANDGTVPFRHGERIGFSYLVSQKYTGDSALVKVLRNS  391

Query  1407  EFM  1415
             E +
Sbjct  392   EIL  394



>gb|EYU39504.1| hypothetical protein MIMGU_mgv1a003194mg [Erythranthe guttata]
Length=601

 Score =   420 bits (1079),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 225/520 (43%), Positives = 320/520 (62%), Gaps = 13/520 (3%)
 Frame = +3

Query  351   RFFSNVDDRNTNKNGRSQSTSFKSFGVQRKGKGVQFDSKELQVETGNLQDANF-----LN  515
             + +S   + + +  G   +  F S GV+  G   +  +  + V  G + +A +     L+
Sbjct  72    KLYSTCSESSASTPGDDAALKFSS-GVENGGADSEAVADSVAVRNGAMDEAYYAIELALD  130

Query  516   AVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDT  695
             +VVK++   ++P Y LPWQ + Q  S GS F+I   ++LTNAH V   T V V++ G  T
Sbjct  131   SVVKIFTVASSPSYFLPWQNKSQRESMGSGFVISGKRILTNAHVVADHTFVLVRKHGSPT  190

Query  696   KYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISVTK  875
             KY A+V A G ECD+A+L VE+EEFW+G   L+ G +P LQ+AV VVGYP GGD ISVTK
Sbjct  191   KYRAEVKAVGHECDLAILVVENEEFWEGMNSLELGDIPFLQEAVAVVGYPQGGDNISVTK  250

Query  876   GVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVENIG  1055
             GVVSR+E T Y HG+++LL IQIDAA+NPGNSGGPA   D +  GVAFQ       ENIG
Sbjct  251   GVVSRVEPTQYVHGATQLLAIQIDAAINPGNSGGPAIMGD-KVAGVAFQ--NLSNAENIG  307

Query  1056  YVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVEPT  1232
             Y+IP  V+ HF+   E  G Y GF S+G+  Q  EN  LR   K+ P   GVL+ ++ PT
Sbjct  308   YIIPVPVIKHFISGVEETGDYVGFCSMGLSCQPTENAQLREHFKMRPDLTGVLVSRINPT  367

Query  1233  SDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAGEF  1412
             SDAH  LK+ D+I+SFD V +  +G+V FR+ ERI F +L+S K   DTA++ ++R+GE 
Sbjct  368   SDAHRVLKKDDIILSFDGVPIANDGSVAFRNRERITFDHLVSMKKPNDTAQVKVLRSGEE  427

Query  1413  MKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGL---KLLTKA  1583
              +  + L P   LVP H     PSYLI AGLVF PL++P + E  ED       +L  +A
Sbjct  428   HEFTVTLRPLHPLVPVHQFDKLPSYLIFAGLVFVPLTQPYLHEYGEDWYNASPRRLCERA  487

Query  1584  RYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKDKY  1763
                     G+Q V+LSQVL +++N GYE +++ Q+ K+NG  + N+ HL  L++   ++ 
Sbjct  488   LRELPQKPGQQFVILSQVLMDDINTGYERLADLQVKKVNGVEVDNLKHLRQLVEDGGNEN  547

Query  1764  LVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLM  1883
             + F+  D  ++VL  ++A T ++ ILK + IPS  S DL+
Sbjct  548   VRFDLDDERVIVLNYDSAKTATSRILKRHRIPSAMSDDLI  587



>ref|XP_007028414.1| DegP protease 10 isoform 1 [Theobroma cacao]
 gb|EOY08916.1| DegP protease 10 isoform 1 [Theobroma cacao]
Length=602

 Score =   416 bits (1068),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 219/461 (48%), Positives = 297/461 (64%), Gaps = 7/461 (2%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             L++VVK++   ++P+Y LPWQ + Q  + GS F+I   K+LTNAH V   T V V++ G 
Sbjct  134   LDSVVKIFTVTSSPNYFLPWQNKSQRETMGSGFVIPGKKILTNAHVVADHTFVLVRKHGS  193

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
              TKY A+VLA G ECD+A+L VES+EFW+G   L+ G +P LQ+AV VVGYP GGD ISV
Sbjct  194   PTKYRAEVLAVGHECDLAILVVESQEFWEGVNFLELGDIPFLQEAVAVVGYPQGGDNISV  253

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             TKGVVSR+E T Y HG+++L+ IQIDAA+NPGNSGGPA   + +  GVAFQ       EN
Sbjct  254   TKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGN-KVAGVAFQ--NLSGAEN  310

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGY+IP  V+ HF+   E +GKY GF S+G+  Q  EN  LR   K+ P   GVL+ K+ 
Sbjct  311   IGYIIPVPVIKHFIAGVEESGKYVGFCSMGLSCQPTENVQLRNHFKMQPQMTGVLVSKIN  370

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             P SDAH  LK+ D+I+ FD V +  +GTVPFR+ ERI F +L+S K   +TA + ++R G
Sbjct  371   PLSDAHRVLKKDDIILEFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETAVVKVLRNG  430

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGL---KLLT  1577
             E     I L P   LVP H     PSY I AGLVF PL++P + E  ED       +L  
Sbjct  431   EEHAFTITLRPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCE  490

Query  1578  KARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKD  1757
             +A        GEQ+V+LSQVL +++N GYE ++  Q+ K+NG  I+N+ HL  L+++C  
Sbjct  491   RALRELPKQAGEQLVILSQVLMDDINAGYERLAELQVKKVNGIEIQNLKHLCQLVENCST  550

Query  1758  KYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDL  1880
             + L F+  D+ +V L  E+A   ++ IL+ + IPS  SSDL
Sbjct  551   ESLRFDLDDDRVVALNFESARIATSRILERHRIPSRMSSDL  591



>ref|XP_002441105.1| hypothetical protein SORBIDRAFT_09g020480 [Sorghum bicolor]
 gb|EES19535.1| hypothetical protein SORBIDRAFT_09g020480 [Sorghum bicolor]
Length=587

 Score =   415 bits (1066),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 215/462 (47%), Positives = 300/462 (65%), Gaps = 7/462 (2%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             L++VVKV+   ++P+Y LPWQ + Q  S GS F+I   +++TNAH V   T V V++ G 
Sbjct  114   LDSVVKVFTVSSSPNYFLPWQNKAQRESMGSGFVIPGRRIVTNAHVVADHTFVLVRKHGS  173

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
              TKY A+V A G ECD+ALL+VESEEFW G   L+ G +P LQ+AV VVGYP GGD ISV
Sbjct  174   PTKYKAEVQAVGHECDLALLTVESEEFWDGVNSLELGDIPFLQEAVAVVGYPQGGDNISV  233

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             TKGVVSR+E T YAHG+++L+ IQIDAA+NPGNSGGPA   D +  GVAFQ       EN
Sbjct  234   TKGVVSRVEPTQYAHGATQLMAIQIDAAINPGNSGGPAIMGD-KVAGVAFQNLSG--AEN  290

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGY+IP  V+  F+   E +GKY+GF +LGV  Q  EN  LR C  + P   GVL+ ++ 
Sbjct  291   IGYIIPVPVIKRFISGVEESGKYSGFCTLGVSCQATENIQLRECFGMRPEMTGVLVSRIN  350

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             P SDA+  LK+ D+++ FD V +  +GTVPFR+ ERI F +L+S K   +TA L ++R G
Sbjct  351   PLSDAYKILKKDDILLEFDGVPIANDGTVPFRNRERITFDHLVSMKKPEETAVLKVLRDG  410

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGL---KLLT  1577
             +  ++++ L P   LVP H     PSY I AG VF PL++P + E  ED       +L  
Sbjct  411   KEQELKVTLRPLQPLVPVHQFDKLPSYYIFAGFVFIPLTQPYLHEFGEDWYNASPRRLCE  470

Query  1578  KARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKD  1757
             +A        GEQ+V+LSQVL +++N+GYE ++  Q+ K+NG  + N+ HL  L++ C +
Sbjct  471   RALRELPKKAGEQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENLKHLCSLVEGCTE  530

Query  1758  KYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLM  1883
             + L F+  D  ++VL+ + A   ++ +LK + IPS  SSDL+
Sbjct  531   ENLRFDLDDERVIVLKYQNARLATSRVLKRHRIPSAISSDLV  572



>gb|KDP32493.1| hypothetical protein JCGZ_13418 [Jatropha curcas]
Length=565

 Score =   414 bits (1064),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 217/462 (47%), Positives = 295/462 (64%), Gaps = 7/462 (2%)
 Frame = +3

Query  510   LNAVVKVYCTHTAPDYSLPWQKQRQYTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD  689
             L++VVK++   ++P+Y LPWQ + Q  + GS F+I   K+LTNAH V   T V V+R G 
Sbjct  96    LDSVVKIFTVSSSPNYFLPWQNKPQRETMGSGFVIPGKKILTNAHVVADHTFVLVRRHGS  155

Query  690   DTKYVAKVLARGVECDIALLSVESEEFWKGAEPLQFGHLPRLQDAVTVVGYPLGGDTISV  869
              TKY A+V A G ECD+A+L +ESEEFW+G   L+ G +P LQ+AV VVGYP GGD ISV
Sbjct  156   PTKYKAEVQAVGHECDLAILVIESEEFWEGMNFLELGDVPFLQEAVAVVGYPQGGDNISV  215

Query  870   TKGVVSRIEVTSYAHGSSELLGIQIDAAVNPGNSGGPAFNDDGECIGVAFQVYRSDEVEN  1049
             TKGVVSR+E T Y HG+S+L+ IQIDAA+NPGNSGGPA   + +  GVAFQ       EN
Sbjct  216   TKGVVSRVEPTQYVHGASQLMAIQIDAAINPGNSGGPAIMGN-KVAGVAFQNLSG--AEN  272

Query  1050  IGYVIPTTVVSHFLQDYERNGKYTGFPSLGVLLQKLENPALRACLKV-PSNEGVLIRKVE  1226
             IGY+IP  V+ HF+   E NGKY GF SLG+  Q  EN  LR    + P   GV + K+ 
Sbjct  273   IGYIIPVPVIEHFIAGVEENGKYVGFCSLGLSCQPTENIQLRKHFNMHPEMTGVFVSKIN  332

Query  1227  PTSDAHNTLKEGDVIVSFDDVRVGCEGTVPFRSTERIAFRYLISRKFSGDTAELGIIRAG  1406
             P SDA+  +++ D+I++FDDV +  +GTVPFR+ ERI F +L+S K   +TA L I R G
Sbjct  333   PLSDAYRIIRKDDIIMAFDDVPIANDGTVPFRNRERITFDHLVSMKKPNETALLRIFREG  392

Query  1407  EFMKVQIVLSPRVDLVPYHIEGGQPSYLIVAGLVFTPLSEPLIQEECEDSIGL---KLLT  1577
             +  +  I + P   LVP H     PSY I AGLVF PLS+P + E  ED       +L  
Sbjct  393   KEHEFSITVRPLQPLVPVHQFDKLPSYYIFAGLVFVPLSQPYLHEYGEDWYNTSPRRLCE  452

Query  1578  KARYSFANFKGEQIVVLSQVLANEVNIGYEDISNEQILKLNGKRIRNIHHLAHLLDSCKD  1757
             +A        GEQ+V+LSQVL +++N GYE ++  Q+ ++NG  I N+ HL H+++ C  
Sbjct  453   RALRDLPKKAGEQLVILSQVLMDDINAGYERLAELQVKEVNGVEIENLKHLCHIVERCTA  512

Query  1758  KYLVFEFADNFLVVLEREAALTTSTSILKDYGIPSERSSDLM  1883
             + L F+  D+ ++VL   +A   ++ ILK + IPS  S DL+
Sbjct  513   ESLRFDLDDDRVIVLNYSSARVATSRILKRHRIPSPMSRDLV  554



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8189276358304