BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14595_g2_i1 len=332 path=[1924:0-331]

Length=332
                                                                      Score     E

ref|XP_009599825.1|  PREDICTED: probable pectate lyase P59 isofor...    155   2e-42   
ref|XP_009599826.1|  PREDICTED: probable pectate lyase P59 isofor...    155   2e-42   
emb|CDP02198.1|  unnamed protein product                                153   1e-41   
ref|XP_006361835.1|  PREDICTED: probable pectate lyase P59-like         152   1e-41   
ref|XP_004234779.1|  PREDICTED: probable pectate lyase P59              152   1e-41   
sp|P15722.1|PLY59_SOLLC  RecName: Full=Probable pectate lyase P59...    152   2e-41   Solanum lycopersicum
ref|XP_009779191.1|  PREDICTED: probable pectate lyase P59              152   3e-41   
gb|EPS66620.1|  hypothetical protein M569_08154                         150   1e-40   
ref|XP_007046218.1|  Pectate lyase family protein, putative             150   1e-40   
ref|XP_010033216.1|  PREDICTED: pectate lyase-like                      149   3e-40   
ref|XP_002520133.1|  Pectate lyase precursor, putative                  147   1e-39   Ricinus communis
ref|XP_010317101.1|  PREDICTED: probable pectate lyase P59              146   1e-39   
ref|XP_007153840.1|  hypothetical protein PHAVU_003G069100g             147   1e-39   
ref|XP_009587689.1|  PREDICTED: probable pectate lyase P59              147   2e-39   
ref|XP_009789921.1|  PREDICTED: probable pectate lyase P59              147   2e-39   
ref|XP_004232242.1|  PREDICTED: probable pectate lyase P59              146   4e-39   
ref|XP_006338480.1|  PREDICTED: probable pectate lyase P59-like         145   7e-39   
ref|XP_009408830.1|  PREDICTED: pectate lyase-like                      145   8e-39   
gb|KHN01171.1|  Putative pectate lyase 3                                145   8e-39   
ref|XP_006573090.1|  PREDICTED: probable pectate lyase 3-like           145   9e-39   
gb|EYU36839.1|  hypothetical protein MIMGU_mgv1a006379mg                145   1e-38   
ref|XP_003530685.1|  PREDICTED: probable pectate lyase 3-like           144   1e-38   
ref|XP_002270089.1|  PREDICTED: pectate lyase                           144   1e-38   Vitis vinifera
ref|XP_004135462.1|  PREDICTED: probable pectate lyase P59-like         144   2e-38   
ref|XP_004155392.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    144   2e-38   
gb|KHN13490.1|  Putative pectate lyase 3                                143   2e-38   
ref|XP_004514773.1|  PREDICTED: probable pectate lyase 3-like           144   2e-38   
gb|EYU34111.1|  hypothetical protein MIMGU_mgv1a006386mg                144   2e-38   
ref|XP_011025954.1|  PREDICTED: probable pectate lyase P59              144   2e-38   
ref|XP_002311599.2|  pectate lyase family protein                       143   3e-38   Populus trichocarpa [western balsam poplar]
ref|XP_010256490.1|  PREDICTED: pectate lyase-like                      142   7e-38   
ref|XP_007157384.1|  hypothetical protein PHAVU_002G065800g             142   7e-38   
gb|EYU24412.1|  hypothetical protein MIMGU_mgv1a011674mg                139   8e-38   
ref|XP_006357122.1|  PREDICTED: probable pectate lyase P59-like         142   8e-38   
ref|XP_003613596.1|  Pectate lyase                                      142   8e-38   
ref|XP_004490004.1|  PREDICTED: probable pectate lyase 3-like iso...    141   1e-37   
gb|KEH19822.1|  pectate lyase-like protein                              142   1e-37   
ref|XP_004490003.1|  PREDICTED: probable pectate lyase 3-like iso...    142   1e-37   
ref|XP_009342871.1|  PREDICTED: pectate lyase-like                      142   1e-37   
ref|XP_009761969.1|  PREDICTED: probable pectate lyase P59              141   1e-37   
ref|XP_008357758.1|  PREDICTED: pectate lyase-like                      142   1e-37   
ref|XP_008365507.1|  PREDICTED: pectate lyase-like                      141   2e-37   
ref|XP_009381244.1|  PREDICTED: pectate lyase-like                      140   3e-37   
ref|XP_010678579.1|  PREDICTED: pectate lyase-like                      140   3e-37   
ref|XP_003613595.1|  Pectate lyase                                      140   3e-37   
ref|XP_008446316.1|  PREDICTED: probable pectate lyase P59              140   3e-37   
ref|XP_004162547.1|  PREDICTED: probable pectate lyase P59-like         140   4e-37   
emb|CDP14850.1|  unnamed protein product                                140   4e-37   
ref|XP_010112093.1|  putative pectate lyase 7                           140   4e-37   
ref|XP_004146792.1|  PREDICTED: probable pectate lyase P59-like         140   5e-37   
ref|XP_011087217.1|  PREDICTED: pectate lyase-like                      140   5e-37   
ref|XP_011098575.1|  PREDICTED: probable pectate lyase P59              140   6e-37   
ref|XP_008786760.1|  PREDICTED: pectate lyase-like                      140   6e-37   
gb|KCW52797.1|  hypothetical protein EUGRSUZ_J02132                     140   7e-37   
ref|XP_010066949.1|  PREDICTED: pectate lyase                           140   7e-37   
ref|XP_008456459.1|  PREDICTED: pectate lyase-like                      139   7e-37   
ref|XP_008341537.1|  PREDICTED: pectate lyase-like                      140   8e-37   
ref|XP_009617495.1|  PREDICTED: probable pectate lyase P59              140   8e-37   
ref|XP_009615547.1|  PREDICTED: probable pectate lyase P59              139   8e-37   
ref|XP_009802165.1|  PREDICTED: probable pectate lyase P59              139   9e-37   
ref|XP_009598230.1|  PREDICTED: pectate lyase-like                      139   2e-36   
ref|XP_009788285.1|  PREDICTED: pectate lyase-like                      138   2e-36   
ref|XP_009369346.1|  PREDICTED: pectate lyase-like                      138   2e-36   
ref|XP_008374522.1|  PREDICTED: pectate lyase-like                      138   3e-36   
ref|XP_008230729.1|  PREDICTED: pectate lyase                           138   3e-36   
ref|XP_006374492.1|  hypothetical protein POPTR_0015s07590g             138   3e-36   
ref|XP_007215366.1|  hypothetical protein PRUPE_ppa005602mg             138   4e-36   
gb|ACU23277.1|  unknown                                                 137   4e-36   Glycine max [soybeans]
ref|XP_003543726.1|  PREDICTED: pectate lyase                           137   4e-36   
ref|XP_006354795.1|  PREDICTED: pectate lyase-like                      137   4e-36   
gb|KHN13240.1|  Putative pectate lyase 3                                137   5e-36   
ref|XP_008366366.1|  PREDICTED: pectate lyase-like                      137   6e-36   
ref|XP_002282500.3|  PREDICTED: pectate lyase                           137   7e-36   Vitis vinifera
emb|CBI22159.3|  unnamed protein product                                137   8e-36   
emb|CAN79927.1|  hypothetical protein VITISV_042447                     137   8e-36   Vitis vinifera
gb|KHN08706.1|  Putative pectate lyase 3                                137   8e-36   
ref|XP_003519771.2|  PREDICTED: probable pectate lyase 3-like           137   9e-36   
emb|CAN77957.1|  hypothetical protein VITISV_021245                     136   9e-36   Vitis vinifera
ref|XP_011013803.1|  PREDICTED: pectate lyase-like                      136   9e-36   
ref|XP_002272638.2|  PREDICTED: pectate lyase-like                      137   1e-35   Vitis vinifera
gb|AAQ62997.1|  oil palm polygalacturonase allergen PEST411             137   1e-35   Elaeis guineensis
ref|XP_009403112.1|  PREDICTED: pectate lyase-like                      137   1e-35   
ref|XP_010925369.1|  PREDICTED: pectate lyase                           137   1e-35   
ref|XP_007037229.1|  Pectate lyase family protein                       135   2e-35   
ref|XP_009360393.1|  PREDICTED: probable pectate lyase 3                135   3e-35   
gb|KHN45481.1|  Putative pectate lyase 3                                134   4e-35   
ref|XP_006842121.1|  hypothetical protein AMTR_s00078p00106380          135   4e-35   
ref|XP_009389712.1|  PREDICTED: pectate lyase-like                      134   5e-35   
ref|XP_008221660.1|  PREDICTED: probable pectate lyase 3                134   6e-35   
ref|XP_003554335.1|  PREDICTED: pectate lyase-like                      134   7e-35   
ref|XP_004165454.1|  PREDICTED: pectate lyase-like                      134   1e-34   
ref|XP_008389523.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    134   1e-34   
gb|ABK28696.1|  unknown                                                 134   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197015.4|  putative pectate lyase 19                             134   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007227702.1|  hypothetical protein PRUPE_ppa005744mg             134   1e-34   
ref|XP_004152537.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    133   1e-34   
gb|EPS62426.1|  hypothetical protein M569_12361                         132   2e-34   
ref|XP_010527871.1|  PREDICTED: probable pectate lyase 3 isoform X1     134   4e-34   
ref|XP_008446067.1|  PREDICTED: pectate lyase-like                      131   4e-34   
ref|XP_006579282.1|  PREDICTED: probable pectate lyase P59-like         132   5e-34   
emb|CDP02199.1|  unnamed protein product                                130   5e-34   
gb|KDP45476.1|  hypothetical protein JCGZ_09725                         132   6e-34   
ref|XP_009126031.1|  PREDICTED: probable pectate lyase 19               132   7e-34   
emb|CDX85564.1|  BnaA02g02490D                                          132   7e-34   
gb|KHN08855.1|  Putative pectate lyase P59                              131   8e-34   
gb|ACN96346.1|  hypothetical protein                                    128   8e-34   Zea luxurians [Florida teosinte]
ref|XP_010068708.1|  PREDICTED: pectate lyase-like                      131   9e-34   
gb|ACN96342.1|  hypothetical protein                                    128   9e-34   Zea luxurians [Florida teosinte]
gb|ACN96341.1|  hypothetical protein                                    128   9e-34   Zea luxurians [Florida teosinte]
ref|XP_011087066.1|  PREDICTED: pectate lyase                           131   1e-33   
ref|XP_007137422.1|  hypothetical protein PHAVU_009G125800g             131   1e-33   
ref|XP_003621115.1|  Pectate lyase                                      131   1e-33   
ref|XP_010242445.1|  PREDICTED: pectate lyase                           131   1e-33   
ref|XP_008339935.1|  PREDICTED: probable pectate lyase 3                131   1e-33   
ref|XP_006357289.1|  PREDICTED: probable pectate lyase 3-like           131   1e-33   
gb|ACN96380.1|  hypothetical protein                                    128   1e-33   Tripsacum sp. JRI-2009
ref|XP_004147462.1|  PREDICTED: probable pectate lyase 7-like           130   1e-33   
ref|XP_004236194.1|  PREDICTED: probable pectate lyase P59              130   1e-33   
ref|XP_006344502.1|  PREDICTED: probable pectate lyase P59-like         130   1e-33   
ref|XP_008443432.1|  PREDICTED: probable pectate lyase 19               130   1e-33   
ref|XP_011097774.1|  PREDICTED: pectate lyase-like                      130   1e-33   
gb|KGN59593.1|  hypothetical protein Csa_3G827350                       130   2e-33   
ref|XP_004508770.1|  PREDICTED: probable pectate lyase P59-like         130   2e-33   
ref|XP_008339934.1|  PREDICTED: probable pectate lyase 3                130   2e-33   
ref|XP_004951474.1|  PREDICTED: pectate lyase-like                      130   2e-33   
ref|XP_007209148.1|  hypothetical protein PRUPE_ppa005859mg             130   3e-33   
gb|ACN96322.1|  hypothetical protein                                    127   3e-33   Zea mays subsp. mays [corn]
gb|ACN96356.1|  hypothetical protein                                    127   3e-33   Zea mays subsp. mexicana [annual teosinte]
gb|ACN96372.1|  hypothetical protein                                    127   3e-33   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACN96354.1|  hypothetical protein                                    127   3e-33   Zea mays subsp. mexicana [annual teosinte]
gb|ACN96353.1|  hypothetical protein                                    127   3e-33   Zea mays subsp. mexicana [annual teosinte]
gb|ACN96364.1|  hypothetical protein                                    127   3e-33   Zea mays subsp. mexicana [annual teosinte]
gb|ACN96358.1|  hypothetical protein                                    127   3e-33   Zea mays subsp. mexicana [annual teosinte]
gb|ACN96379.1|  hypothetical protein                                    127   3e-33   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACN96360.1|  hypothetical protein                                    127   3e-33   Zea mays subsp. mexicana [annual teosinte]
gb|ACN96359.1|  hypothetical protein                                    127   3e-33   Zea mays subsp. mexicana [annual teosinte]
gb|ACN96320.1|  hypothetical protein                                    127   3e-33   Zea mays subsp. mays [corn]
gb|ACN96362.1|  hypothetical protein                                    127   3e-33   Zea mays subsp. mexicana [annual teosinte]
gb|ACN96319.1|  hypothetical protein                                    127   3e-33   Zea mays subsp. mays [corn]
gb|ACN96355.1|  hypothetical protein                                    127   3e-33   Zea mays subsp. mexicana [annual teosinte]
ref|XP_010463548.1|  PREDICTED: probable pectate lyase 7                129   4e-33   
ref|XP_009380431.1|  PREDICTED: pectate lyase-like                      129   4e-33   
gb|ACF87417.1|  unknown                                                 129   5e-33   Zea mays [maize]
ref|XP_008679844.1|  PREDICTED: pectate lyase                           129   5e-33   
ref|XP_002453531.1|  hypothetical protein SORBIDRAFT_04g007450          129   5e-33   Sorghum bicolor [broomcorn]
gb|KFK37588.1|  hypothetical protein AALP_AA3G002600                    129   6e-33   
ref|XP_008239834.1|  PREDICTED: pectate lyase-like                      129   6e-33   
ref|XP_007138209.1|  hypothetical protein PHAVU_009G189800g             129   7e-33   
ref|XP_002270112.1|  PREDICTED: pectate lyase                           129   7e-33   Vitis vinifera
gb|AES91206.2|  pectate lyase P59-like protein                          129   8e-33   
emb|CAN69904.1|  hypothetical protein VITISV_001006                     129   9e-33   Vitis vinifera
gb|AAA86241.1|  pectate lyase homolog                                   129   9e-33   Medicago sativa [alfalfa]
ref|XP_011086389.1|  PREDICTED: pectate lyase-like                      128   1e-32   
ref|XP_010513594.1|  PREDICTED: probable pectate lyase 7                127   2e-32   
ref|XP_006826355.1|  hypothetical protein AMTR_s00004p00123190          127   2e-32   
ref|XP_009758350.1|  PREDICTED: pectate lyase-like                      127   2e-32   
ref|XP_004301165.1|  PREDICTED: probable pectate lyase P59-like         127   2e-32   
ref|XP_010485518.1|  PREDICTED: probable pectate lyase 7                127   3e-32   
ref|XP_009599232.1|  PREDICTED: pectate lyase-like                      127   3e-32   
ref|XP_007151201.1|  hypothetical protein PHAVU_004G026400g             127   3e-32   
ref|XP_011085780.1|  PREDICTED: probable pectate lyase P59              127   3e-32   
gb|EEE56553.1|  hypothetical protein OsJ_05879                          127   3e-32   Oryza sativa Japonica Group [Japonica rice]
emb|CDY09356.1|  BnaA02g26540D                                          127   3e-32   
emb|CDY41679.1|  BnaC02g34750D                                          127   3e-32   
gb|EAY85003.1|  hypothetical protein OsI_06363                          127   3e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_009129128.1|  PREDICTED: probable pectate lyase 6                127   3e-32   
ref|XP_002892805.1|  hypothetical protein ARALYDRAFT_471616             127   3e-32   
ref|NP_001046281.1|  Os02g0214400                                       127   4e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010476496.1|  PREDICTED: probable pectate lyase 3                126   5e-32   
gb|KFK33456.1|  hypothetical protein AALP_AA5G015800                    126   5e-32   
gb|AAA16476.1|  pectate lyase homolog                                   126   6e-32   Zea mays [maize]
ref|XP_009148818.1|  PREDICTED: probable pectate lyase 3                126   7e-32   
ref|XP_004489168.1|  PREDICTED: pectate lyase-like                      126   7e-32   
emb|CDY45254.1|  BnaA06g09240D                                          126   7e-32   
emb|CAN69905.1|  hypothetical protein VITISV_001007                     125   8e-32   Vitis vinifera
ref|XP_010670318.1|  PREDICTED: pectate lyase-like                      126   8e-32   
ref|XP_010496063.1|  PREDICTED: probable pectate lyase 3                125   1e-31   
gb|KFK43687.1|  hypothetical protein AALP_AA1G160000                    125   1e-31   
emb|CDY39314.1|  BnaC05g10650D                                          125   1e-31   
ref|NP_172894.1|  putative pectate lyase 3                              125   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAB69759.1|  putative pectate lyase                                  125   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008221658.1|  PREDICTED: pectate lyase-like                      125   2e-31   
ref|XP_007224275.1|  hypothetical protein PRUPE_ppa019055mg             125   2e-31   
emb|CDX74293.1|  BnaA03g27540D                                          125   2e-31   
emb|CDX91953.1|  BnaC03g32550D                                          125   2e-31   
ref|NP_001056786.1|  Os06g0145100                                       124   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056781.1|  Os06g0144200                                       124   3e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010523445.1|  PREDICTED: probable pectate lyase 3                124   3e-31   
gb|EAY99626.1|  hypothetical protein OsI_21605                          124   3e-31   Oryza sativa Indica Group [Indian rice]
emb|CDY53552.1|  BnaA09g57110D                                          124   3e-31   
dbj|BAD68402.1|  putative pectate lyase homolog                         124   3e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009114192.1|  PREDICTED: probable pectate lyase 6                124   3e-31   
ref|XP_003571658.1|  PREDICTED: pectate lyase-like                      124   3e-31   
emb|CDX81636.1|  BnaC08g39650D                                          124   3e-31   
ref|XP_010683249.1|  PREDICTED: pectate lyase-like                      124   4e-31   
emb|CDY04133.1|  BnaA09g19110D                                          124   4e-31   
ref|XP_009110541.1|  PREDICTED: probable pectate lyase 3                124   4e-31   
ref|XP_010320663.1|  PREDICTED: probable pectate lyase 3                123   4e-31   
emb|CDX96854.1|  BnaA08g23970D                                          124   4e-31   
ref|XP_010527872.1|  PREDICTED: probable pectate lyase 3 isoform X2     124   4e-31   
ref|XP_006363934.1|  PREDICTED: pectate lyase-like                      124   4e-31   
gb|EAY99621.1|  hypothetical protein OsI_21600                          124   4e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_006306515.1|  hypothetical protein CARUB_v10012514mg             124   5e-31   
gb|KHG05193.1|  hypothetical protein F383_30875                         123   5e-31   
ref|NP_001056784.1|  Os06g0144900                                       123   6e-31   Oryza sativa Japonica Group [Japonica rice]
emb|CDY68729.1|  BnaCnng60280D                                          123   6e-31   
dbj|BAH20311.1|  AT3G01270                                              122   6e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KHG23093.1|  hypothetical protein F383_29772                         123   7e-31   
ref|XP_009117903.1|  PREDICTED: probable pectate lyase 3                123   7e-31   
emb|CDY17432.1|  BnaC09g21050D                                          123   8e-31   
gb|AAM60924.1|  putative pectate lyase                                  123   8e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_186776.1|  putative pectate lyase 7                              123   8e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KEH24975.1|  pectate lyase P59-like protein                          123   9e-31   
ref|XP_006655782.1|  PREDICTED: pectate lyase-like                      122   1e-30   
ref|XP_010683248.1|  PREDICTED: pectate lyase-like                      122   1e-30   
ref|XP_007032453.1|  Pectate lyase family protein                       122   1e-30   
ref|XP_006656188.1|  PREDICTED: pectate lyase-like                      122   1e-30   
ref|XP_009134622.1|  PREDICTED: probable pectate lyase 7                122   1e-30   
ref|XP_006292606.1|  hypothetical protein CARUB_v10018855mg             122   2e-30   
ref|XP_004298448.1|  PREDICTED: probable pectate lyase 3-like           122   2e-30   
ref|XP_006477525.1|  PREDICTED: pectate lyase-like                      122   2e-30   
ref|XP_010425041.1|  PREDICTED: probable pectate lyase 6                122   2e-30   
ref|XP_004489374.1|  PREDICTED: pectate lyase-like                      121   3e-30   
ref|XP_010502279.1|  PREDICTED: probable pectate lyase 6                121   4e-30   
ref|XP_010514040.1|  PREDICTED: probable pectate lyase 6                121   4e-30   
ref|XP_004228388.1|  PREDICTED: pectate lyase                           121   4e-30   
ref|XP_003563707.1|  PREDICTED: pectate lyase-like                      120   6e-30   
ref|XP_003609009.1|  Pectate lyase                                      120   8e-30   
ref|XP_002437815.1|  hypothetical protein SORBIDRAFT_10g003090          120   8e-30   Sorghum bicolor [broomcorn]
ref|XP_006439649.1|  hypothetical protein CICLE_v10020193mg             120   9e-30   
ref|XP_002436463.1|  hypothetical protein SORBIDRAFT_10g003080          120   1e-29   Sorghum bicolor [broomcorn]
ref|XP_007139601.1|  hypothetical protein PHAVU_008G043600g             120   1e-29   
gb|KDO76053.1|  hypothetical protein CISIN_1g013757mg                   119   1e-29   
gb|EMS65801.1|  hypothetical protein TRIUR3_32637                       117   2e-29   
gb|KFK25747.1|  hypothetical protein AALP_AA8G154300                    119   2e-29   
ref|NP_178375.1|  putative pectate lyase 6                              119   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb|EMS45831.1|  Pectate lyase                                           120   2e-29   
ref|XP_010322971.1|  PREDICTED: probable pectate lyase P59              117   3e-29   
gb|KGN47799.1|  hypothetical protein Csa_6G404140                       118   3e-29   
ref|XP_004302354.1|  PREDICTED: probable pectate lyase P59-like         118   4e-29   
gb|AGT16685.1|  pectate lyase precursor                                 117   4e-29   
ref|XP_006286712.1|  hypothetical protein CARUB_v10002862mg             119   4e-29   
ref|XP_004964534.1|  PREDICTED: pectate lyase-like                      117   6e-29   
ref|XP_010453638.1|  PREDICTED: probable pectate lyase 19               118   7e-29   
ref|XP_010420163.1|  PREDICTED: probable pectate lyase 19 isoform X1    118   7e-29   
dbj|BAK06965.1|  predicted protein                                      117   7e-29   
ref|XP_002871648.1|  pectate lyase family protein                       117   8e-29   
ref|XP_010420164.1|  PREDICTED: probable pectate lyase 19 isoform X2    117   8e-29   
gb|KHG08055.1|  putative pectate lyase P59                              117   8e-29   
gb|AGT16687.1|  pectate lyase                                           117   8e-29   
ref|XP_010492335.1|  PREDICTED: probable pectate lyase 19               117   8e-29   
sp|Q9LFP5.1|PLY19_ARATH  RecName: Full=Probable pectate lyase 19;...    117   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420165.1|  PREDICTED: probable pectate lyase 19 isoform X3    118   9e-29   
ref|XP_003552513.1|  PREDICTED: pectate lyase-like                      117   9e-29   
gb|KHN13652.1|  Pectate lyase                                           117   9e-29   
ref|XP_002875142.1|  pectate lyase family protein                       117   1e-28   
ref|XP_010550068.1|  PREDICTED: probable pectate lyase 19               117   1e-28   
ref|XP_010551866.1|  PREDICTED: probable pectate lyase 19               116   2e-28   
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22               116   2e-28   
ref|NP_001150425.1|  LOC100284055 precursor                             116   2e-28   Zea mays [maize]
emb|CDY66593.1|  BnaCnng51570D                                          116   3e-28   
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                115   3e-28   
ref|XP_009121613.1|  PREDICTED: probable pectate lyase 19               116   3e-28   
gb|ACN35280.1|  unknown                                                 114   4e-28   Zea mays [maize]
dbj|BAJ99909.1|  predicted protein                                      114   4e-28   
dbj|BAK05605.1|  predicted protein                                      115   5e-28   
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22               115   5e-28   
ref|XP_008793504.1|  PREDICTED: pectate lyase-like                      115   7e-28   
ref|XP_010527219.1|  PREDICTED: probable pectate lyase 10               114   7e-28   
ref|XP_004233352.1|  PREDICTED: pectate lyase-like                      114   1e-27   
ref|XP_010264036.1|  PREDICTED: probable pectate lyase 8                114   1e-27   
gb|ACF84425.1|  unknown                                                 112   1e-27   Zea mays [maize]
gb|KDO65869.1|  hypothetical protein CISIN_1g013239mg                   114   1e-27   
ref|XP_006480190.1|  PREDICTED: probable pectate lyase 8-like           114   1e-27   
gb|AEI55398.1|  pectate lyase                                           109   2e-27   
gb|EPS58564.1|  hypothetical protein M569_16249                         113   2e-27   
gb|AAB69762.1|  putative pectate lyase                                  111   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     113   2e-27   
ref|XP_002446075.1|  hypothetical protein SORBIDRAFT_06g001410          113   2e-27   Sorghum bicolor [broomcorn]
ref|XP_010106682.1|  hypothetical protein L484_004616                   113   2e-27   
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               113   2e-27   
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     113   2e-27   
ref|XP_010532870.1|  PREDICTED: putative pectate lyase 14               113   3e-27   
ref|XP_006357121.1|  PREDICTED: pectate lyase-like                      112   3e-27   
gb|KHG12411.1|  hypothetical protein F383_06737                         112   3e-27   
gb|AAX88800.1|  ripening-related pectate lyase                          112   4e-27   
ref|XP_002521130.1|  Pectate lyase precursor, putative                  112   4e-27   
ref|XP_010038352.1|  PREDICTED: probable pectate lyase 8                112   5e-27   
ref|NP_001141589.1|  uncharacterized protein LOC100273705               112   5e-27   
ref|XP_006443655.1|  hypothetical protein CICLE_v10019202mg             114   5e-27   
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5                112   5e-27   
emb|CDY53564.1|  BnaC04g55760D                                          112   5e-27   
ref|XP_010096345.1|  putative pectate lyase 7                           112   5e-27   
ref|XP_009587688.1|  PREDICTED: pectate lyase-like                      112   5e-27   
gb|ADT79197.1|  pectate lyase                                           108   5e-27   
gb|EMS64552.1|  hypothetical protein TRIUR3_22914                       113   5e-27   
ref|XP_009789922.1|  PREDICTED: pectate lyase-like                      112   5e-27   
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     112   5e-27   
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     112   6e-27   
ref|XP_002437204.1|  hypothetical protein SORBIDRAFT_10g022830          112   6e-27   
ref|XP_007201029.1|  hypothetical protein PRUPE_ppa006229mg             112   6e-27   
gb|EYU22243.1|  hypothetical protein MIMGU_mgv1a007460mg                112   6e-27   
ref|XP_008235520.1|  PREDICTED: probable pectate lyase 8                112   6e-27   
gb|AAK81877.1|  putative pectate lyase PL1                              107   6e-27   
emb|CAE02420.2|  OSJNBa0095E20.8                                        112   7e-27   
dbj|BAK06362.1|  predicted protein                                      112   7e-27   
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                112   7e-27   
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    112   7e-27   
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               112   7e-27   
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    112   7e-27   
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5                112   8e-27   
dbj|BAC42832.1|  putative pectate lyase                                 110   8e-27   
gb|EEE60442.1|  hypothetical protein OsJ_13660                          112   8e-27   
emb|CDP03845.1|  unnamed protein product                                112   8e-27   
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    112   8e-27   
ref|XP_010933171.1|  PREDICTED: probable pectate lyase 8 isoform X1     112   8e-27   
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    112   9e-27   
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               112   9e-27   
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          112   9e-27   
ref|XP_009397895.1|  PREDICTED: probable pectate lyase 8                112   9e-27   
ref|NP_001052103.1|  Os04g0137100                                       112   9e-27   
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          112   9e-27   
gb|EEC76710.1|  hypothetical protein OsI_14719                          112   9e-27   
gb|KHG22755.1|  hypothetical protein F383_29653                         111   9e-27   
ref|NP_567409.1|  probable pectate lyase 15                             112   1e-26   
gb|KHG30349.1|  hypothetical protein F383_15991                         112   1e-26   
ref|XP_010933172.1|  PREDICTED: probable pectate lyase 8 isoform X2     111   1e-26   
ref|XP_007155507.1|  hypothetical protein PHAVU_003G207400g             111   1e-26   
ref|XP_008804450.1|  PREDICTED: probable pectate lyase 8 isoform X2     111   1e-26   
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     111   1e-26   
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             111   1e-26   
ref|XP_008804449.1|  PREDICTED: probable pectate lyase 8 isoform X1     111   1e-26   
ref|XP_004515847.1|  PREDICTED: probable pectate lyase 22-like          111   1e-26   
ref|XP_002870357.1|  pectate lyase family protein                       112   1e-26   
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             112   1e-26   
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     111   1e-26   
ref|XP_010100325.1|  hypothetical protein L484_027633                   111   1e-26   
gb|KHN34377.1|  Putative pectate lyase 22                               111   1e-26   
ref|NP_001190720.1|  probable pectate lyase 15                          111   1e-26   
ref|XP_003526981.1|  PREDICTED: probable pectate lyase 18-like          111   1e-26   
ref|XP_004975048.1|  PREDICTED: probable pectate lyase 15-like is...    111   1e-26   
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     111   1e-26   
emb|CDY18738.1|  BnaC08g08780D                                          112   1e-26   
ref|XP_010243989.1|  PREDICTED: probable pectate lyase 8                111   1e-26   
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                111   1e-26   
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  111   1e-26   
ref|XP_004975046.1|  PREDICTED: probable pectate lyase 15-like is...    112   1e-26   
ref|NP_001242543.1|  uncharacterized protein LOC100779940 precursor     111   1e-26   
ref|XP_010918897.1|  PREDICTED: probable pectate lyase 8 isoform X2     111   1e-26   
ref|XP_008667903.1|  PREDICTED: pectate lyase 8 isoform X1              111   1e-26   
ref|NP_001147553.1|  pectate lyase 8                                    111   1e-26   
ref|XP_009385867.1|  PREDICTED: probable pectate lyase 8 isoform X2     111   1e-26   
emb|CDX70590.1|  BnaC03g06740D                                          111   1e-26   
ref|XP_009385866.1|  PREDICTED: probable pectate lyase 8 isoform X1     112   1e-26   
ref|XP_009131435.1|  PREDICTED: probable pectate lyase 19               111   1e-26   
gb|AAF19196.1|AF206320_1  pectate lyase 2                               111   1e-26   
ref|XP_008789532.1|  PREDICTED: probable pectate lyase 8                110   1e-26   
ref|XP_010918895.1|  PREDICTED: probable pectate lyase 8 isoform X1     111   1e-26   
ref|XP_004975047.1|  PREDICTED: probable pectate lyase 15-like is...    111   1e-26   
ref|XP_011085777.1|  PREDICTED: probable pectate lyase P59              111   2e-26   
ref|XP_002321242.2|  pectate lyase family protein                       110   2e-26   
ref|NP_568967.1|  putative pectate lyase 22                             111   2e-26   
gb|KHN05801.1|  Putative pectate lyase 22                               110   2e-26   
ref|XP_003523121.1|  PREDICTED: probable pectate lyase 18-like          110   2e-26   
ref|XP_011002172.1|  PREDICTED: probable pectate lyase 8                111   2e-26   
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8                111   2e-26   
ref|XP_011009338.1|  PREDICTED: probable pectate lyase 8                111   2e-26   
ref|XP_002297822.1|  pectate lyase family protein                       111   2e-26   
dbj|BAB10560.1|  pectate lyase                                          110   2e-26   
ref|XP_002285340.1|  PREDICTED: probable pectate lyase 5                110   2e-26   
emb|CAN75298.1|  hypothetical protein VITISV_008675                     111   2e-26   
emb|CAC80136.1|  pectate lyase II enzyme                                111   2e-26   
emb|CAA43413.1|  pectate lyase                                          109   2e-26   
ref|XP_011080166.1|  PREDICTED: probable pectate lyase 8                110   2e-26   
ref|XP_010484044.1|  PREDICTED: probable pectate lyase 22               110   2e-26   
ref|XP_002323835.1|  hypothetical protein POPTR_0017s11450g             110   2e-26   
gb|KFK39718.1|  hypothetical protein AALP_AA3G279700                    110   2e-26   
ref|XP_002265100.1|  PREDICTED: probable pectate lyase 8                110   2e-26   
ref|XP_007037817.1|  Pectate lyase family protein isoform 3             109   2e-26   
ref|XP_003608909.1|  Pectate lyase                                      110   2e-26   
ref|XP_010444198.1|  PREDICTED: probable pectate lyase 22               110   2e-26   
ref|XP_006352706.1|  PREDICTED: probable pectate lyase 10-like          110   2e-26   
ref|XP_009411363.1|  PREDICTED: probable pectate lyase 8                110   2e-26   
gb|AFK44189.1|  unknown                                                 110   2e-26   
ref|XP_010444201.1|  PREDICTED: probable pectate lyase 22 isoform X3    110   2e-26   
ref|XP_002304700.1|  pectate lyase family protein                       110   2e-26   
emb|CDY65626.1|  BnaC03g74840D                                          110   2e-26   
gb|KFK39719.1|  hypothetical protein AALP_AA3G279700                    110   2e-26   
ref|XP_010109687.1|  hypothetical protein L484_015172                   110   2e-26   
gb|EPS73633.1|  hypothetical protein M569_01123                         110   2e-26   
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8                110   2e-26   
ref|XP_010459939.1|  PREDICTED: probable pectate lyase 22               110   2e-26   
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                    110   2e-26   
ref|XP_007037816.1|  Pectin lyase-like superfamily protein isoform 2    110   2e-26   
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               110   2e-26   
ref|XP_006653139.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    110   2e-26   
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           110   2e-26   
gb|EYU46355.1|  hypothetical protein MIMGU_mgv1a007094mg                110   3e-26   
ref|XP_006280553.1|  hypothetical protein CARUB_v10026494mg             110   3e-26   
ref|XP_011029589.1|  PREDICTED: probable pectate lyase 5                110   3e-26   
ref|XP_002301766.2|  hypothetical protein POPTR_0002s23990g             110   3e-26   
ref|XP_011024740.1|  PREDICTED: probable pectate lyase 20               110   3e-26   
ref|XP_002882189.1|  pectate lyase family protein                       110   3e-26   
emb|CDY01151.1|  BnaA04g06680D                                          110   3e-26   
ref|XP_008800563.1|  PREDICTED: probable pectate lyase 8 isoform X1     110   3e-26   
gb|KDP26417.1|  hypothetical protein JCGZ_17575                         110   3e-26   
ref|XP_008800564.1|  PREDICTED: probable pectate lyase 8 isoform X2     110   3e-26   
gb|EMT28700.1|  hypothetical protein F775_17439                         110   3e-26   
ref|XP_002884619.1|  pectate lyase family protein                       110   3e-26   
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             110   3e-26   
ref|NP_189110.1|  probable pectate lyase 10                             110   3e-26   
ref|XP_002866540.1|  pectate lyase                                      110   3e-26   
gb|AFZ78654.1|  pectate lyase                                           110   3e-26   
gb|ABO28477.1|  pectate lyase precursor                                 109   3e-26   
dbj|BAB01216.1|  pectate lyase                                          110   3e-26   
gb|ACB12931.1|  pectate lyase 1-27                                      110   3e-26   
gb|AAM67091.1|  putative pectate lyase                                  110   3e-26   
ref|XP_009349844.1|  PREDICTED: probable pectate lyase 8                110   3e-26   
ref|XP_008382653.1|  PREDICTED: probable pectate lyase 10               110   3e-26   
dbj|BAF43573.1|  pectate lyase                                          110   3e-26   
ref|XP_006302330.1|  hypothetical protein CARUB_v10020387mg             110   3e-26   
dbj|BAF01663.1|  pectate lyase like protein                             108   3e-26   
ref|XP_004310004.1|  PREDICTED: probable pectate lyase 5-like           110   3e-26   
gb|KFK41187.1|  hypothetical protein AALP_AA2G097000                    110   3e-26   
ref|XP_008812405.1|  PREDICTED: probable pectate lyase 8                110   4e-26   
ref|XP_009609746.1|  PREDICTED: probable pectate lyase 8                110   4e-26   
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    110   4e-26   
ref|XP_009384552.1|  PREDICTED: probable pectate lyase 8                110   4e-26   
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                110   4e-26   
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                110   4e-26   
gb|ABR18471.1|  unknown                                                 110   4e-26   
emb|CDY48132.1|  BnaCnng15740D                                          110   4e-26   
ref|XP_009799817.1|  PREDICTED: probable pectate lyase 8                110   4e-26   
ref|XP_009112069.1|  PREDICTED: probable pectate lyase 22               110   4e-26   
ref|XP_004234780.1|  PREDICTED: probable pectate lyase P56              109   4e-26   
ref|XP_010531484.1|  PREDICTED: probable pectate lyase 5                109   4e-26   
ref|XP_009400922.1|  PREDICTED: probable pectate lyase 8 isoform X1     110   4e-26   
emb|CDY16732.1|  BnaA09g06500D                                          110   4e-26   
ref|XP_009400924.1|  PREDICTED: probable pectate lyase 8 isoform X2     110   4e-26   
ref|XP_003549832.1|  PREDICTED: probable pectate lyase 18 isoform 1     109   4e-26   
ref|XP_007049844.1|  Pectin lyase-like superfamily protein              110   4e-26   
ref|NP_001280201.1|  probable pectate lyase 18 precursor                109   4e-26   
ref|XP_008221954.1|  PREDICTED: probable pectate lyase 5                109   5e-26   
ref|XP_009150377.1|  PREDICTED: probable pectate lyase 22               109   5e-26   
emb|CDY41506.1|  BnaA06g22590D                                          109   5e-26   
ref|XP_007222794.1|  hypothetical protein PRUPE_ppa006665mg             109   5e-26   
ref|XP_007140561.1|  hypothetical protein PHAVU_008G123000g             110   5e-26   
ref|XP_010248740.1|  PREDICTED: probable pectate lyase 18               109   5e-26   
gb|KHN15224.1|  Putative pectate lyase 15                               108   5e-26   
ref|XP_011005067.1|  PREDICTED: probable pectate lyase P59              109   5e-26   
ref|XP_010105747.1|  putative pectate lyase P59                         109   5e-26   
gb|AAZ31564.1|  pectate lyase isoform 2                                 109   6e-26   
ref|XP_009599824.1|  PREDICTED: pectate lyase                           109   6e-26   
gb|ABR26682.1|  pectate lyase                                           109   6e-26   
emb|CDP13269.1|  unnamed protein product                                109   6e-26   
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                109   6e-26   
gb|AAZ31566.1|  pectate lyase isoform 4                                 109   6e-26   
gb|AAB71208.1|  pectate lyase                                           109   6e-26   
gb|AAK66160.1|  pectate lyase B                                         109   6e-26   
gb|AAZ31563.1|  pectate lyase isoform 1                                 109   6e-26   
gb|AEN70965.1|  pectate lyase                                           109   6e-26   
ref|XP_010528323.1|  PREDICTED: probable pectate lyase 19               109   7e-26   
ref|XP_004290232.1|  PREDICTED: probable pectate lyase 8-like           109   7e-26   
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18               109   7e-26   
ref|NP_001289258.1|  probable pectate lyase 18 precursor                109   7e-26   
emb|CAN76500.1|  hypothetical protein VITISV_004734                     108   7e-26   
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                108   7e-26   
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                109   8e-26   
ref|XP_009382167.1|  PREDICTED: probable pectate lyase 8                108   8e-26   
ref|XP_009757256.1|  PREDICTED: pectate lyase                           108   8e-26   
ref|XP_004242391.1|  PREDICTED: probable pectate lyase 8                108   9e-26   
gb|AEN70984.1|  pectate lyase                                           108   9e-26   
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like           108   9e-26   
gb|AEN70985.1|  pectate lyase                                           108   9e-26   
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     108   1e-25   
gb|EPS68938.1|  hypothetical protein M569_05827                         108   1e-25   
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         108   1e-25   
gb|ADB90477.1|  pectate lyase                                           108   1e-25   
gb|KHG19997.1|  hypothetical protein F383_02891                         108   1e-25   
ref|XP_009111860.1|  PREDICTED: probable pectate lyase 20               108   1e-25   
gb|ADB90478.1|  pectate lyase                                           108   1e-25   
ref|XP_009359258.1|  PREDICTED: probable pectate lyase 5                108   1e-25   
gb|ADB90479.1|  pectate lyase                                           108   1e-25   
gb|AEN70977.1|  pectate lyase                                           108   1e-25   
ref|XP_002887143.1|  pectate lyase family protein                       108   1e-25   
gb|EYU32621.1|  hypothetical protein MIMGU_mgv1a006198mg                108   1e-25   
emb|CDY56668.1|  BnaCnng30870D                                          108   1e-25   
gb|ADB90475.1|  pectate lyase                                           108   1e-25   
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           108   1e-25   
gb|EAY95384.1|  hypothetical protein OsI_17217                          110   1e-25   
gb|AAK54283.1|AC034258_1  putative pectate lyase                        108   1e-25   
gb|AEN70964.1|  pectate lyase                                           108   1e-25   
gb|AEN70963.1|  pectate lyase                                           108   1e-25   
emb|CDY19932.1|  BnaA09g03190D                                          108   1e-25   
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     108   1e-25   
gb|AEN70968.1|  pectate lyase                                           108   1e-25   
gb|AEN70981.1|  pectate lyase                                           108   1e-25   
gb|AAY85180.1|  pectate lyase                                           108   1e-25   
gb|AAM61584.1|  putative pectate lyase                                  108   1e-25   
gb|KHG07401.1|  putative pectate lyase P59                              108   1e-25   



>ref|XP_009599825.1| PREDICTED: probable pectate lyase P59 isoform X1 [Nicotiana tomentosiformis]
Length=445

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQ+IKNVIIHG+ +HDIV+GSGGM+RD VDH G+RT SDGDGISIFG+S++W+DH
Sbjct  198  GAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGISIFGASNIWIDH  257

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMR CYDG+IDA+E STAITISNGHFTDHN+VMLFGA+D S  D++MQI
Sbjct  258  VSMRKCYDGIIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQVMQI  307



>ref|XP_009599826.1| PREDICTED: probable pectate lyase P59 isoform X2 [Nicotiana tomentosiformis]
Length=444

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQ+IKNVIIHG+ +HDIV+GSGGM+RD VDH G+RT SDGDGISIFG+S++W+DH
Sbjct  197  GAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGISIFGASNIWIDH  256

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMR CYDG+IDA+E STAITISNGHFTDHN+VMLFGA+D S  D++MQI
Sbjct  257  VSMRKCYDGIIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQVMQI  306



>emb|CDP02198.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KNVIIHG+ +HDI QGSGG++RD VDH+G+RT SDGDGISIFGSS+VW+DH
Sbjct  225  GAGITIQFVKNVIIHGLHIHDIHQGSGGLVRDSVDHFGIRTMSDGDGISIFGSSNVWIDH  284

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  CYDGLIDA+EASTAITISN HFTDHN+VMLFGA+D   KD +MQI
Sbjct  285  VSMWKCYDGLIDAVEASTAITISNSHFTDHNEVMLFGASDSQSKDAVMQI  334



>ref|XP_006361835.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=447

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQ+IKNVIIHG+ +HDIV+G+GGM+RD VDH G+RT+SDGDGISIFG+S++W+DH
Sbjct  200  GAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGDGISIFGASNIWIDH  259

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM+ CYDGLIDA+E ST ITISNGHFTDHN+VMLFGA+D S  D++MQI
Sbjct  260  VSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQI  309



>ref|XP_004234779.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=449

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQ+IKNVIIHG+ +HDIV+G+GGM+RD VDH G+RT+SDGDGISIFG+S++W+DH
Sbjct  202  GAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGDGISIFGASNIWIDH  261

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM+ CYDGLIDA+E ST ITISNGHFTDHN+VMLFGA+D S  D++MQI
Sbjct  262  VSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQI  311



>sp|P15722.1|PLY59_SOLLC RecName: Full=Probable pectate lyase P59; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33523.1| P59 protein [Solanum lycopersicum]
Length=449

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQ+IKNVIIHG+ +HDIV+G+GGM+RD VDH G+RT+SDGDGISIFG+S +W+DH
Sbjct  202  GAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGDGISIFGASYIWIDH  261

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM+ CYDGLIDA+E ST ITISNGHFTDHN+VMLFGA+D S  D++MQI
Sbjct  262  VSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQI  311



>ref|XP_009779191.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQ+IKNVIIHG+ +HDIV+GSGGM+RD VDH G+RT SDGDGISIFG+S++W+DH
Sbjct  200  GAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGISIFGASNIWIDH  259

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM+ CYDG+IDA+E ST ITISNGHFTDHN+VMLFGA+D S  D++MQI
Sbjct  260  VSMKKCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQI  309



>gb|EPS66620.1| hypothetical protein M569_08154, partial [Genlisea aurea]
Length=451

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQF+ NVIIHG+ +HDIVQGSGGMIRD VDHYG RTRSDGDGISIFGS D+W+DH
Sbjct  201  GAGITLQFVSNVIIHGLHIHDIVQGSGGMIRDSVDHYGFRTRSDGDGISIFGSQDLWIDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMR CYDGLIDAI  ST ITISN HFTDHN+VMLFGA+D    D  MQ+
Sbjct  261  VSMRRCYDGLIDAIMGSTGITISNSHFTDHNEVMLFGASDGYSPDAKMQM  310



>ref|XP_007046218.1| Pectate lyase family protein, putative [Theobroma cacao]
 gb|EOY02050.1| Pectate lyase family protein, putative [Theobroma cacao]
Length=441

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF +N+IIHG+ +HDIVQGSGGMIRD VDHYG RT+SDGDG+S+FG++++W+DH
Sbjct  195  GAGITIQFARNIIIHGLHIHDIVQGSGGMIRDSVDHYGFRTKSDGDGVSLFGATNIWLDH  254

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NCYDGLIDAI+ STAITISN HFT+HN+VMLFGA+D   +D+ MQI
Sbjct  255  LSMYNCYDGLIDAIQGSTAITISNCHFTNHNEVMLFGASDSYSEDQKMQI  304



>ref|XP_010033216.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
Length=435

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF++NVIIH IR+HDIV   GG+IRD VDH G+RT SDGDGISIFGS+++W+DH
Sbjct  190  GAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHVGIRTMSDGDGISIFGSTNIWIDH  249

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM+ C DGLIDAIE STAITISNGH+T HNDVMLFGA+D  P+DKIMQ+
Sbjct  250  VSMKRCQDGLIDAIEGSTAITISNGHYTHHNDVMLFGASDLYPRDKIMQV  299



>ref|XP_002520133.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF42188.1| Pectate lyase precursor, putative [Ricinus communis]
Length=440

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF++NVIIHGIR+HDIV GSGG++RD VDHYG RT+SDGDGISIFGSS++W+DH
Sbjct  195  GAGLTLQFVQNVIIHGIRIHDIVSGSGGLVRDSVDHYGFRTKSDGDGISIFGSSNIWIDH  254

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDAI  ST+ITISN HFT+HN+VMLFGA+D    D IMQI
Sbjct  255  VSMSNCQDGLIDAIMGSTSITISNCHFTNHNEVMLFGASDGYSADTIMQI  304



>ref|XP_010317101.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=389

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA I +Q+ KNVIIHG+ +HDIV+GSGGM+RD VDH GLRT+SDGDGISI+GSS++W+DH
Sbjct  142  GASIMIQYTKNVIIHGLHIHDIVEGSGGMVRDAVDHIGLRTKSDGDGISIYGSSNIWIDH  201

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NCYDGLIDA+E ST ITISNGH+TDHN+VMLFGA+D S  D+ MQI
Sbjct  202  MSMENCYDGLIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSIDQKMQI  251



>ref|XP_007153840.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
 gb|ESW25834.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
Length=447

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QFI+NVIIHGI+V+DI    GGMIRD   HYGLRT+SDGDGISIFGSS++W+DH
Sbjct  201  GAGITVQFIRNVIIHGIKVYDIQVHGGGMIRDSETHYGLRTQSDGDGISIFGSSNIWIDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMRNCYDGLIDAI  STAITISN HFTDHN+ MLFGA+D   KDKIMQI
Sbjct  261  VSMRNCYDGLIDAIMGSTAITISNSHFTDHNEAMLFGASDSYDKDKIMQI  310



>ref|XP_009587689.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=447

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGI +Q+ KNVIIHG+ +HDIVQG+GGM+RD VDH GLRT SDGDGISIFG+S++W+DH
Sbjct  200  GAGIMIQYTKNVIIHGLHIHDIVQGNGGMVRDAVDHIGLRTMSDGDGISIFGASNIWIDH  259

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NCYDG+IDA+E ST ITISNGHFTDHN+VMLFGA+D S  D+ MQI
Sbjct  260  VSMWNCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQQMQI  309



>ref|XP_009789921.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGI +Q+ KNVIIHG+ +HDIVQG+GGM+RD VDH GLRT SDGDGISIFG+S++W+DH
Sbjct  200  GAGIMIQYTKNVIIHGLHIHDIVQGNGGMVRDAVDHIGLRTMSDGDGISIFGASNIWIDH  259

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NCYDG+IDA+E ST ITISNGHFTDHN+VMLFGA+D S  D+ MQI
Sbjct  260  VSMWNCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQQMQI  309



>ref|XP_004232242.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=446

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG  LQ++KNVIIHG+R+HDIV GSGGMIRD +DH G RT+SDGDGISIFGSS++WVDH
Sbjct  199  GAGFMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHVGQRTQSDGDGISIFGSSNIWVDH  258

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM +CYDGL+DAIE STA+TISN HFTDHN+VMLFGA+D S  D+ MQI
Sbjct  259  VSMWSCYDGLVDAIEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQI  308



>ref|XP_006338480.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=446

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG  LQ++KNVIIHG+R+HDIV GSGGMIRD +DH G RT+SDGDGISIFGSS++WVDH
Sbjct  199  GAGFMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHIGQRTQSDGDGISIFGSSNIWVDH  258

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM +CYDGL+DA+E STA+TISN HFTDHN+VMLFGA+D S  D+ MQI
Sbjct  259  VSMWSCYDGLVDAVEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQI  308



>ref|XP_009408830.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   145 bits (365),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+ NVI+H IR+HDI  G+GGMIRD  +HYGLRTRSDGDGISIFG+S++W+DH
Sbjct  193  GAGLTIQFVHNVIVHNIRIHDIKAGNGGMIRDSEEHYGLRTRSDGDGISIFGASNIWIDH  252

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDAIE STAITISN HFT HNDVMLFGA+D    D IMQI
Sbjct  253  VSMSNCMDGLIDAIEGSTAITISNSHFTQHNDVMLFGASDAFSGDAIMQI  302



>gb|KHN01171.1| Putative pectate lyase 3 [Glycine soja]
Length=433

 Score =   145 bits (365),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QFIKNVIIHGI++ +I  G+GG+IRD   HYG RT SDGDGISIFGSS+VW+DH
Sbjct  187  GAGITIQFIKNVIIHGIKIFNIQVGNGGLIRDSETHYGFRTYSDGDGISIFGSSNVWIDH  246

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMRNC DGLIDAI+ STAITISNGHFTDHN+VMLFGA+D    DKIMQI
Sbjct  247  VSMRNCKDGLIDAIQGSTAITISNGHFTDHNEVMLFGASDSYDGDKIMQI  296



>ref|XP_006573090.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=448

 Score =   145 bits (365),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QFIKNVIIHGI++ +I  G+GG+IRD   HYG RT SDGDGISIFGSS+VW+DH
Sbjct  202  GAGITIQFIKNVIIHGIKIFNIQVGNGGLIRDSETHYGFRTYSDGDGISIFGSSNVWIDH  261

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMRNC DGLIDAI+ STAITISNGHFTDHN+VMLFGA+D    DKIMQI
Sbjct  262  VSMRNCKDGLIDAIQGSTAITISNGHFTDHNEVMLFGASDSYDGDKIMQI  311



>gb|EYU36839.1| hypothetical protein MIMGU_mgv1a006379mg [Erythranthe guttata]
Length=446

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KN+IIHG+ +HDIV G GGMIRD VDHYG RTRSDGDGISI+G+ D+W+DH
Sbjct  198  GAGITIQFVKNIIIHGLLIHDIVPGDGGMIRDSVDHYGFRTRSDGDGISIYGAQDIWIDH  257

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDAI  ST ITISNGHFTDHN+ MLFGA+D   +D  MQI
Sbjct  258  VSMTNCSDGLIDAIMGSTGITISNGHFTDHNEAMLFGASDSHTQDVKMQI  307



>ref|XP_003530685.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=451

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KN+IIHGI+V DIV   GGMIRD   HYG RT+SDGDGISIFGSS+VW+DH
Sbjct  204  GAGITVQFVKNIIIHGIKVFDIVIREGGMIRDSETHYGFRTKSDGDGISIFGSSNVWIDH  263

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA+D    DKIMQI
Sbjct  264  VSMRNCSDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDSYSDDKIMQI  313



>ref|XP_002270089.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32015.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KNVIIHG+ +HDIV GSGG+IRD V+H+G R+RSDGDGISI+GSS VW+DH
Sbjct  193  GAGITIQFVKNVIIHGLHIHDIVSGSGGLIRDSVNHFGYRSRSDGDGISIYGSSHVWIDH  252

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
             SM NC DGLIDAI+ STAITISN HFT HN+VMLFGA+D +  D+IMQI
Sbjct  253  NSMSNCKDGLIDAIQGSTAITISNNHFTKHNEVMLFGASDSNSADEIMQI  302



>ref|XP_004135462.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
 gb|KGN51889.1| hypothetical protein Csa_5G604340 [Cucumis sativus]
Length=432

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQ+I+NVIIHG+R+H IV GSGGMIRD VDH GLRT SDGDGISIFGSS+VW+DH
Sbjct  186  GAGITLQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDH  245

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC+DGLIDAI  STAITISN HFT HN+VMLFGA+D   +D+IMQI
Sbjct  246  VSMSNCHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQI  295



>ref|XP_004155392.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=432

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQ+I+NVIIHG+R+H IV GSGGMIRD VDH GLRT SDGDGISIFGSS+VW+DH
Sbjct  186  GAGITLQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDH  245

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC+DGLIDAI  STAITISN HFT HN+VMLFGA+D   +D+IMQI
Sbjct  246  VSMSNCHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQI  295



>gb|KHN13490.1| Putative pectate lyase 3, partial [Glycine soja]
Length=364

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KN+IIHGI+V DIV   GGMIRD   HYG RT+SDGDGISIFGSS++W+DH
Sbjct  117  GAGITVQFVKNIIIHGIKVFDIVIREGGMIRDSETHYGFRTKSDGDGISIFGSSNIWIDH  176

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA+D    DKIMQI
Sbjct  177  VSMRNCSDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDSYSDDKIMQI  226



>ref|XP_004514773.1| PREDICTED: probable pectate lyase 3-like [Cicer arietinum]
Length=454

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KN+IIHGI++++I    GGMIRD   HYG RT+SDGDGISIFG+S+VW+DH
Sbjct  201  GAGITVQFVKNIIIHGIKIYNIKVKEGGMIRDSESHYGFRTKSDGDGISIFGASNVWIDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMRNC DGLIDAI  STAITISNGHFTDHN+VMLFGA+D    DKIMQI
Sbjct  261  VSMRNCTDGLIDAIMGSTAITISNGHFTDHNEVMLFGASDDYSDDKIMQI  310



>gb|EYU34111.1| hypothetical protein MIMGU_mgv1a006386mg [Erythranthe guttata]
Length=446

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KN+IIHGI +HDIV G+GG+IRD VDHYGLRTRSDGDGISI+G+ D+W+DH
Sbjct  198  GAGITIQFVKNIIIHGILIHDIVPGNGGLIRDSVDHYGLRTRSDGDGISIYGAQDIWIDH  257

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLIDAI  ST ITISNGHFTDHN+ MLFGA+D   +D  MQI
Sbjct  258  VSMTKCSDGLIDAIMGSTGITISNGHFTDHNEAMLFGASDSHTQDVKMQI  307



>ref|XP_011025954.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=441

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQF +NVIIHG+R+HDIV GSGG+IRD VDHYG RT+SDGDGISIFGSS++W+DH
Sbjct  194  GAGITLQFAQNVIIHGLRIHDIVSGSGGLIRDSVDHYGFRTKSDGDGISIFGSSNIWIDH  253

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLID I  S AITISN HFT HN+VMLFGA+D    D IMQI
Sbjct  254  VSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFGASDSYSGDSIMQI  303



>ref|XP_002311599.2| pectate lyase family protein [Populus trichocarpa]
 gb|EEE88966.2| pectate lyase family protein [Populus trichocarpa]
Length=441

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQF++NVIIHG+R+HDIV GSGG++RD VDHYG RT+SDGDGISIFGSS++W+DH
Sbjct  194  GAGITLQFVQNVIIHGLRIHDIVIGSGGLVRDSVDHYGFRTKSDGDGISIFGSSNIWIDH  253

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLID I  S AITISN HFT HN+VMLFGA+D    D IMQI
Sbjct  254  VSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFGASDSYSGDSIMQI  303



>ref|XP_010256490.1| PREDICTED: pectate lyase-like [Nelumbo nucifera]
Length=441

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KNVIIHG+ VHDIV GSGG+IRD VDHYGLRT+SDGDGIS+FG+++VW+DH
Sbjct  195  GAGITIQFVKNVIIHGLHVHDIVPGSGGLIRDSVDHYGLRTQSDGDGISLFGATNVWIDH  254

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLIDAI ++TA+T+SN HFT HN+VMLFGA+     D +MQI
Sbjct  255  ISMSNCKDGLIDAIMSTTAVTVSNCHFTHHNEVMLFGASGSYSGDAVMQI  304



>ref|XP_007157384.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
 gb|ESW29378.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
Length=448

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG T+QF+KNVIIHGI++ DI  G GG+IRD   HYGLRT+SDGDGISIFGSS +W+DH
Sbjct  202  GAGFTIQFVKNVIIHGIKIFDINAGQGGLIRDSESHYGLRTQSDGDGISIFGSSYIWIDH  261

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMRN  DGLIDAI+ STAITISN HFTDHN+VMLFGA+D   +DKIMQI
Sbjct  262  VSMRNARDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSHEEDKIMQI  311



>gb|EYU24412.1| hypothetical protein MIMGU_mgv1a011674mg [Erythranthe guttata]
Length=274

 Score =   139 bits (350),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+Q++ NV+IH IR+HDI  G+GG+IRD V+HYG R+RSDGD IS+FG+++VW+DH
Sbjct  29   GAGLTIQYVSNVVIHNIRIHDIKAGNGGLIRDSVNHYGYRSRSDGDAISMFGATNVWIDH  88

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS+  C DGLIDAIE STAITISN HFT HNDVMLFGA+D    D++MQI
Sbjct  89   VSLSKCVDGLIDAIEGSTAITISNSHFTHHNDVMLFGASDSYSGDQVMQI  138



>ref|XP_006357122.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=448

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA I +Q+ KNVIIHG+ +HDIV+G+GGM+RD VDH G RT+SDGDGISIFGSS++W+DH
Sbjct  201  GASIMIQYTKNVIIHGLHIHDIVEGNGGMVRDAVDHIGFRTKSDGDGISIFGSSNIWIDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NCYDG+IDA+E ST ITISNGH+TDHN+VMLFGA+D S  D+ MQI
Sbjct  261  MSMENCYDGIIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSIDQKMQI  310



>ref|XP_003613596.1| Pectate lyase [Medicago truncatula]
 gb|AES96554.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QFI+NVIIHGI+++DI+ GSGG++RD  DHYGLRT SDGDGISIFGSS +W+DH
Sbjct  203  GAGITIQFIENVIIHGIKIYDIMVGSGGLVRDSEDHYGLRTISDGDGISIFGSSHIWIDH  262

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA+D    D+ MQI
Sbjct  263  VSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDTYDGDQKMQI  312



>ref|XP_004490004.1| PREDICTED: probable pectate lyase 3-like isoform X2 [Cicer arietinum]
Length=376

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q+I+NVIIHGI+V DIV GSGG++RD  +HYGLRT SDGDGISIFGSS++W+DH
Sbjct  130  GAGITIQYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGISIFGSSNIWIDH  189

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA+D    D+ MQI
Sbjct  190  VSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQI  239



>gb|KEH19822.1| pectate lyase-like protein [Medicago truncatula]
Length=455

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 97/111 (87%), Gaps = 2/111 (2%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KNVIIHGI+++DI    GGMIRD   HYG RT+SDGDGISIFG+S+VW+DH
Sbjct  202  GAGITIQFVKNVIIHGIKIYDIQVRDGGMIRDSEAHYGFRTKSDGDGISIFGASNVWIDH  261

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA-NDFSPKDKIMQI  331
            VSMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA ND+S +DKIMQI
Sbjct  262  VSMRNCTDGLIDAIMGSTAITISNSHFTDHNEVMLFGASNDYS-EDKIMQI  311



>ref|XP_004490003.1| PREDICTED: probable pectate lyase 3-like isoform X1 [Cicer arietinum]
Length=450

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q+I+NVIIHGI+V DIV GSGG++RD  +HYGLRT SDGDGISIFGSS++W+DH
Sbjct  204  GAGITIQYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGISIFGSSNIWIDH  263

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA+D    D+ MQI
Sbjct  264  VSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQI  313



>ref|XP_009342871.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=454

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQF++NVIIHG+R+HD V GSGGMIRD + H G+RT+SDGDGISI+GSS++W+DH
Sbjct  208  GAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGDGISIYGSSNIWLDH  267

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQI
Sbjct  268  LSMWNCADGLIDAIQGSTAITISNCHFTRHNDVMLFGASDAFAGDAIMQI  317



>ref|XP_009761969.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=434

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G G+ LQFI NVII  +R+HD   G+GG+IRD VDHYG RT+SDGDGISIFGS++VW+DH
Sbjct  189  GGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVDHYGYRTKSDGDGISIFGSTNVWIDH  248

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDA+EASTAITISN HFT HN+VMLFGA+D S +D IMQI
Sbjct  249  VSMSNCQDGLIDAVEASTAITISNSHFTKHNEVMLFGASDSSSRDSIMQI  298



>ref|XP_008357758.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=459

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQF++NVIIHG+R+HD V GSGGMIRD + H G+RT+SDGDGISI+GSS++W+DH
Sbjct  213  GAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGDGISIYGSSNIWLDH  272

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQI
Sbjct  273  LSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFAGDAIMQI  322



>ref|XP_008365507.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=396

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQF++NVIIHG+R+HD V GSGGMIRD + H G+RT+SDGDGISI+GSS++W+DH
Sbjct  150  GAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGDGISIYGSSNIWLDH  209

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQI
Sbjct  210  LSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFAGDAIMQI  259



>ref|XP_009381244.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=423

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q++ N+IIH +R+HDI  G+GGMIRD   HYGLRTRSDGDGISIFG+S+VW+DH
Sbjct  178  GAGITIQYVDNIIIHNLRIHDIKAGNGGMIRDSEHHYGLRTRSDGDGISIFGASNVWIDH  237

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D +MQI
Sbjct  238  VSMSNCMDGLIDAIQGSTAITISNSHFTQHNDVMLFGASDAFSGDAVMQI  287



>ref|XP_010678579.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGI LQF+ NVIIH + +HDI  G GG IRD V H+G RT SDGDGISIFGS+++W+DH
Sbjct  197  GAGIMLQFVDNVIIHNVHIHDIKTGGGGFIRDSVSHFGFRTASDGDGISIFGSTNIWIDH  256

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDAIEASTAIT+SN HFTDHNDVMLFGA D S +D+IMQ+
Sbjct  257  VSMSNCMDGLIDAIEASTAITVSNCHFTDHNDVMLFGARDSSSQDEIMQV  306



>ref|XP_003613595.1| Pectate lyase [Medicago truncatula]
 gb|AES96553.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QFI+NVIIHGI++ DIV GSGG+IRDG DH+G RT SDGDGISIFGSS++W+DH
Sbjct  203  GAGITIQFIENVIIHGIKIFDIVVGSGGLIRDGQDHFGQRTMSDGDGISIFGSSNIWIDH  262

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMRNC DGL+DAI  STAITISN HFTDHN+VMLFGA+D    D+ MQI
Sbjct  263  VSMRNCRDGLVDAIMGSTAITISNSHFTDHNEVMLFGASDGYGGDEKMQI  312



>ref|XP_008446316.1| PREDICTED: probable pectate lyase P59 [Cucumis melo]
Length=432

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQ+++NVIIHG+R+H IV G+GGMIRD VDH GLRT SDGDGISIFGSS+VW+DH
Sbjct  186  GAGITLQYVRNVIIHGLRIHHIVVGNGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDH  245

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDAI  STAITISN HFT HN+VMLFGA+D    D+IMQ+
Sbjct  246  VSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSNDQIMQV  295



>ref|XP_004162547.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
Length=435

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+ NVIIH + +HDIV  SGGMIRD VDHYG RT+SDGDGISIFGSS VW+DH
Sbjct  187  GAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRTQSDGDGISIFGSSHVWIDH  246

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDAI  STAITISN HFT HN+VMLFGA+D   +D+IMQ+
Sbjct  247  VSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQV  296



>emb|CDP14850.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG TLQF+ N+IIH + +HDI  G+GGMIRD V+HYG+R+RSDGDGISI+GS+++W+DH
Sbjct  190  GAGFTLQFVHNIIIHNLHIHDIKSGNGGMIRDSVNHYGIRSRSDGDGISIYGSTNIWIDH  249

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLIDA++ASTAITISNGHFT HN+ MLFGA+D    D IMQI
Sbjct  250  ISMSNCNDGLIDAVQASTAITISNGHFTHHNEAMLFGASDSYSDDSIMQI  299



>ref|XP_010112093.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXC32626.1| putative pectate lyase 7 [Morus notabilis]
Length=437

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF +NVIIHG+ +HDIV   GGMIRD VDH+G RT +DGDGISIFGS+++W+DH
Sbjct  191  GAGITIQFARNVIIHGLHIHDIVASGGGMIRDSVDHFGFRTPADGDGISIFGSTNIWLDH  250

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    DKIMQ+
Sbjct  251  ISMSNCQDGLIDAIQGSTAITISNCHFTHHNDVMLFGASDSFEGDKIMQV  300



>ref|XP_004146792.1| PREDICTED: probable pectate lyase P59-like, partial [Cucumis 
sativus]
Length=442

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+ NVIIH + +HDIV  SGGMIRD VDHYG RT+SDGDGISIFGSS VW+DH
Sbjct  194  GAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRTQSDGDGISIFGSSHVWIDH  253

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDAI  STAITISN HFT HN+VMLFGA+D   +D+IMQ+
Sbjct  254  VSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQV  303



>ref|XP_011087217.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=436

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQ+I NVIIH IRVHDI  G+GGMIRD   HYG RTRSDGDGIS+FGS+++W+DH
Sbjct  190  GAGITLQYIHNVIIHNIRVHDIKTGNGGMIRDSATHYGFRTRSDGDGISLFGSTNIWIDH  249

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS+  C DGLIDAIEASTAITISN HF  HNDV+LFGA+D   +D IMQI
Sbjct  250  VSLSRCDDGLIDAIEASTAITISNCHFAHHNDVLLFGASDSRSEDHIMQI  299



>ref|XP_011098575.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=449

 Score =   140 bits (353),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQF+KNVIIHGI++++I  G GGMIRD VDHYGLRTRSDGDGISIFGS D+W+DH
Sbjct  201  GAGITLQFVKNVIIHGIKIYNISPGQGGMIRDAVDHYGLRTRSDGDGISIFGSQDIWIDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLID I  ST +T+SN HFTDHN+ MLFGA+D   +D  MQ+
Sbjct  261  VSMLNCADGLIDVIMGSTGVTVSNSHFTDHNEAMLFGASDSHTQDVKMQV  310



>ref|XP_008786760.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=467

 Score =   140 bits (353),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA I++QF++NVIIHG+ +HDI  G+GGMIRD + HYG RT+SDGDGISI+GSSD+W+DH
Sbjct  222  GAQISIQFVQNVIIHGLHIHDIKPGNGGMIRDSLRHYGFRTKSDGDGISIYGSSDIWIDH  281

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
             SMRNC DGLIDAIEASTAITISN HF  HNDV+LFGA+D + +D IMQ+
Sbjct  282  CSMRNCADGLIDAIEASTAITISNCHFARHNDVLLFGASDSNERDSIMQV  331



>gb|KCW52797.1| hypothetical protein EUGRSUZ_J02132 [Eucalyptus grandis]
Length=451

 Score =   140 bits (352),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 97/123 (79%), Gaps = 13/123 (11%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF++NVIIH IR+HDIV   GG+IRD VDH G+RT SDGDGISIFGS+++W+DH
Sbjct  193  GAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHVGIRTMSDGDGISIFGSTNIWIDH  252

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHND-------------VMLFGANDFSPKDKI  322
            VSM+ C DGLIDAIE STAITISNGH+T HND             VMLFGA+D  P+DKI
Sbjct  253  VSMKRCQDGLIDAIEGSTAITISNGHYTHHNDTLMFNLHPGTYVQVMLFGASDLYPRDKI  312

Query  323  MQI  331
            MQ+
Sbjct  313  MQV  315



>ref|XP_010066949.1| PREDICTED: pectate lyase [Eucalyptus grandis]
 gb|KCW65002.1| hypothetical protein EUGRSUZ_G02541 [Eucalyptus grandis]
Length=436

 Score =   140 bits (352),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQFI+NVIIHG+ +HDIV+GSGG+IRD  DH GLRT SDGDGISIFGSS +W+DH
Sbjct  190  GAGITLQFIRNVIIHGLHIHDIVRGSGGLIRDAHDHVGLRTASDGDGISIFGSSHLWIDH  249

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLIDAI+ STAITISN HFT HN+VMLFGA+D   +D+IMQI
Sbjct  250  VSMSACSDGLIDAIQGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQI  299



>ref|XP_008456459.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=434

 Score =   139 bits (351),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+ NVIIH + +HDI+  SGGMIRD VDHYG RT+SDGDGISIFGSS VW+DH
Sbjct  186  GAGLTIQFVNNVIIHNLHIHDIISKSGGMIRDSVDHYGFRTQSDGDGISIFGSSHVWIDH  245

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDAI  STAITISN HFT HN+VMLFGA+D   +D+IMQ+
Sbjct  246  VSMSNCEDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQV  295



>ref|XP_008341537.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=454

 Score =   140 bits (352),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQF++NVIIHG+ +HD V G+GGMIRD VDH G+RT SDGDGISI+GSS++W+DH
Sbjct  208  GAGITLQFVQNVIIHGLHIHDTVPGNGGMIRDSVDHIGIRTHSDGDGISIYGSSNIWLDH  267

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQI
Sbjct  268  LSMWNCADGLIDAIQGSTAITISNSHFTRHNDVMLFGASDGFSGDAIMQI  317



>ref|XP_009617495.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=451

 Score =   140 bits (352),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQ++KNVIIHG+ +HDIV G+GGM+   VDH G+RT+SDGDGISIFGSS++W+DH
Sbjct  204  GAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRTQSDGDGISIFGSSNIWIDH  263

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLIDA+E STAITISNGHFTDHN+VMLFGA+D S  D+ MQI
Sbjct  264  VSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQRMQI  313



>ref|XP_009615547.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=434

 Score =   139 bits (351),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G G+ LQFI NVII  +R+HD   G+GG+IRD V+HYG RT+SDGDGISIFGS++VW+DH
Sbjct  189  GGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVNHYGYRTKSDGDGISIFGSTNVWIDH  248

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDA+EASTAITISN HFT HN+VMLFGA+D S +D IMQI
Sbjct  249  VSMSNCQDGLIDAVEASTAITISNCHFTKHNEVMLFGASDSSSRDSIMQI  298



>ref|XP_009802165.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=451

 Score =   139 bits (351),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQ++KNVIIHG+ +HDIV G+GGM+   VDH G+RT+SDGDGISIFGSS++W+DH
Sbjct  204  GAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRTQSDGDGISIFGSSNIWIDH  263

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLIDA+E STAITISNGHFTDHN+VMLFGA+D S  D+ MQI
Sbjct  264  VSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQRMQI  313



>ref|XP_009598230.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=434

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA   LQFI NVIIHG+ +HDI  G+GG+IRD ++HYG R+RSDGDGISIFGS+++W+DH
Sbjct  189  GASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYGFRSRSDGDGISIFGSTNIWIDH  248

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDA++ASTAITISN HFT+HNDVMLFGA+D   +D I+QI
Sbjct  249  VSMSNCDDGLIDAVQASTAITISNSHFTNHNDVMLFGASDSYSEDSILQI  298



>ref|XP_009788285.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=434

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA   LQFI NVIIHG+ +HDI  G+GG+IRD ++HYG R+RSDGDGISIFGS+++W+DH
Sbjct  189  GASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYGFRSRSDGDGISIFGSTNIWIDH  248

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDA++ASTAITISN HFT+HNDVMLFGA+D   +D I+QI
Sbjct  249  VSMSNCDDGLIDAVQASTAITISNCHFTNHNDVMLFGASDSYSEDSILQI  298



>ref|XP_009369346.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=441

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G  ITLQF+KNVIIH + +HD   G+GGMIRD V+HYG RTRSDGDGIS++G+S+VW+DH
Sbjct  197  GGQITLQFVKNVIIHNLHIHDNKAGNGGMIRDSVNHYGQRTRSDGDGISMYGASNVWIDH  256

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS  NC DGLIDAI+ STAITISN HFT+HNDVMLFG++D + +D++MQI
Sbjct  257  VSASNCEDGLIDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQI  306



>ref|XP_008374522.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=441

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G  ITLQF+KNVIIH + +HD   G+GGMIRD V+HYG RTRSDGDGIS++G+S+VW+DH
Sbjct  197  GGQITLQFVKNVIIHNLHIHDNKAGNGGMIRDSVNHYGQRTRSDGDGISMYGASNVWIDH  256

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS  NC DGLIDAI+ STAITISN HFT+HNDVMLFG++D + +D++MQI
Sbjct  257  VSASNCEDGLIDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQI  306



>ref|XP_008230729.1| PREDICTED: pectate lyase [Prunus mume]
Length=452

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF++NVIIHG+ +HDIV GSGG IRD VDH+G RT+SDGDGISIFGSS VW+DH
Sbjct  206  GAGLTLQFVQNVIIHGLHIHDIVPGSGGTIRDSVDHFGTRTQSDGDGISIFGSSHVWLDH  265

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLID I+ STA+TISN HFT HNDV+LFGA+D    D IMQI
Sbjct  266  LSMWNCADGLIDVIQGSTAVTISNCHFTRHNDVLLFGASDSFAGDAIMQI  315



>ref|XP_006374492.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
 gb|ERP52289.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
Length=435

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQF+KNVIIHGI +HD   G+GGMIRD VDHYG R+RSDGDGISIFGS+D+W+DH
Sbjct  191  GAQITLQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDGDGISIFGSTDIWIDH  250

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +S+ NC DGLIDAI  S AITISN HFT HNDVMLFGA+D    D +MQI
Sbjct  251  ISLSNCEDGLIDAIMGSNAITISNCHFTKHNDVMLFGASDSYSGDSVMQI  300



>ref|XP_007215366.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
 gb|EMJ16565.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
Length=452

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQF++NVIIHG+ +HDIV GSGG IRD VDH+G RT+SDGDGISIFGSS +W+DH
Sbjct  206  GAGITLQFVQNVIIHGLHIHDIVPGSGGTIRDSVDHFGTRTQSDGDGISIFGSSHIWLDH  265

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLID I+ STAITISN HFT HNDV+LFGA+D    D IMQI
Sbjct  266  LSMWNCGDGLIDVIQGSTAITISNCHFTRHNDVLLFGASDSFAGDAIMQI  315



>gb|ACU23277.1| unknown [Glycine max]
Length=443

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+ NVIIHG+R+ DIV   GGMIRD  DHYGLRTRSDGD ISIFGS+++W+DH
Sbjct  198  GAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGDAISIFGSTNIWIDH  257

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS+ NC DGLID I+ STAITISN H T HNDV LFGA+D    DKIMQI
Sbjct  258  VSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDKIMQI  307



>ref|XP_003543726.1| PREDICTED: pectate lyase [Glycine max]
Length=443

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+ NVIIHG+R+ DIV   GGMIRD  DHYGLRTRSDGD ISIFGS+++W+DH
Sbjct  198  GAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGDAISIFGSTNIWIDH  257

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS+ NC DGLID I+ STAITISN H T HNDV LFGA+D    DKIMQI
Sbjct  258  VSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDKIMQI  307



>ref|XP_006354795.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=435

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA + LQ+I NVIIHG+ +HDI  G+GG+IRD ++HYG RTRSDGDGISIFGS+++W+DH
Sbjct  190  GASLMLQYINNVIIHGLHIHDIKSGNGGLIRDSINHYGFRTRSDGDGISIFGSTNIWIDH  249

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDA++ASTAITISN HFT HNDVMLFGA+D   +D I+QI
Sbjct  250  VSMSNCDDGLIDAVQASTAITISNCHFTHHNDVMLFGASDSYKQDAILQI  299



>gb|KHN13240.1| Putative pectate lyase 3 [Glycine soja]
Length=446

 Score =   137 bits (346),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+ NVIIHG+R+ DIV   GGMIRD  DHYGLRTRSDGD ISIFGS+++W+DH
Sbjct  201  GAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGDAISIFGSTNIWIDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS+ NC DGLID I+ STAITISN H T HNDV LFGA+D    DKIMQI
Sbjct  261  VSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDKIMQI  310



>ref|XP_008366366.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=479

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQF+ NVIIH + +HD   G+GGMIRD V+HYG RTRSDGDGIS++G+S+VW+DH
Sbjct  235  GAQITLQFVXNVIIHNLHIHDTKPGNGGMIRDSVNHYGQRTRSDGDGISMYGASNVWIDH  294

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS  NC DGL+DAI+ STAITISN HFT+HNDVMLFG++D + +D++MQI
Sbjct  295  VSGSNCADGLVDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQI  344



>ref|XP_002282500.3| PREDICTED: pectate lyase [Vitis vinifera]
Length=443

 Score =   137 bits (345),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G GIT+QF+KN+IIH + +HDIV   GGMIRD VDHYGLRT SDGDG+SIFGSS+VWVDH
Sbjct  197  GCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGSSNVWVDH  256

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGL+D I ASTAITISN HFT+HN+VMLFG ++    DKIMQ+
Sbjct  257  LSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQV  306



>emb|CBI22159.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   137 bits (345),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G GIT+QF+KN+IIH + +HDIV   GGMIRD VDHYGLRT SDGDG+SIFGSS+VWVDH
Sbjct  222  GCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGSSNVWVDH  281

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGL+D I ASTAITISN HFT+HN+VMLFG ++    DKIMQ+
Sbjct  282  LSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQV  331



>emb|CAN79927.1| hypothetical protein VITISV_042447 [Vitis vinifera]
Length=439

 Score =   137 bits (344),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G GIT+QF+KN+IIH + +HDIV   GGMIRD VDHYGLRT SDGDG+SIFGSS+VWVDH
Sbjct  193  GCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGSSNVWVDH  252

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGL+D I ASTAITISN HFT+HN+VMLFG ++    DKIMQ+
Sbjct  253  LSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQV  302



>gb|KHN08706.1| Putative pectate lyase 3 [Glycine soja]
Length=444

 Score =   137 bits (344),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QFIKNVIIHG+++ DI  G+GG+I D  +HYGLRT SDGDGISIFGSS++W+DH
Sbjct  198  GAGITIQFIKNVIIHGVKIFDIQVGNGGLIIDSENHYGLRTMSDGDGISIFGSSNIWIDH  257

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMR C DGLIDAI+ STAITISN HFTDHN+VMLFGA+D    D IMQI
Sbjct  258  VSMRKCKDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSYDGDTIMQI  307



>ref|XP_003519771.2| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=447

 Score =   137 bits (344),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QFIKNVIIHG+++ DI  G+GG+I D  +HYGLRT SDGDGISIFGSS++W+DH
Sbjct  201  GAGITIQFIKNVIIHGVKIFDIQVGNGGLIIDSENHYGLRTMSDGDGISIFGSSNIWIDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMR C DGLIDAI+ STAITISN HFTDHN+VMLFGA+D    D IMQI
Sbjct  261  VSMRKCKDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSYDGDTIMQI  310



>emb|CAN77957.1| hypothetical protein VITISV_021245 [Vitis vinifera]
Length=407

 Score =   136 bits (343),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF+ N+IIHG+ +HDI  G+GG+IRD   HYG RTRSDGDGISIFG++++W+DH
Sbjct  163  GAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSASHYGFRTRSDGDGISIFGATNIWIDH  222

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLIDAI ASTAITISN HFT HN+VMLFGA+D    D IMQI
Sbjct  223  ISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGASDGYSGDAIMQI  272



>ref|XP_011013803.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=419

 Score =   136 bits (343),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQF+KNVIIHGI +HD   G+GGMIRD VDHYG R+RSDGDGISIFGS+D+W+DH
Sbjct  175  GAQITLQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDGDGISIFGSTDIWIDH  234

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +S+ NC DGLIDA+  S AITISN HFT HNDVMLFGA+D    D +MQI
Sbjct  235  ISLSNCEDGLIDAVMGSNAITISNCHFTKHNDVMLFGASDGYSGDSVMQI  284



>ref|XP_002272638.2| PREDICTED: pectate lyase-like [Vitis vinifera]
Length=434

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF+ N+IIHG+ +HDI  G+GG+IRD   HYG RTRSDGDGISIFG++++W+DH
Sbjct  190  GAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSASHYGFRTRSDGDGISIFGATNIWIDH  249

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLIDAI ASTAITISN HFT HN+VMLFGA+D    D IMQI
Sbjct  250  ISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGASDGYSGDAIMQI  299



>gb|AAQ62997.1| oil palm polygalacturonase allergen PEST411 [Elaeis guineensis]
Length=447

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA IT+QF+ NVIIHG+ +HDI   +GGMIRD + H+GLRT+SDGDGISI+GSSDVW+DH
Sbjct  199  GAQITIQFVNNVIIHGLHIHDIKPSNGGMIRDSLHHFGLRTKSDGDGISIYGSSDVWIDH  258

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQ  328
             SMRNC DGLIDAIE STAITISN HFT HNDV+LFGA+D +  D IMQ
Sbjct  259  CSMRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNENDSIMQ  307



>ref|XP_009403112.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=437

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGI LQF+ NVIIHG+ +HDI  G+GGMIRD   H+GLRTRSDGDGISI+GSS++W+DH
Sbjct  192  GAGIMLQFVHNVIIHGLHIHDIKAGNGGMIRDSEHHFGLRTRSDGDGISIYGSSNIWIDH  251

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLID I+ STAITISN HFT HNDVMLFGA+D    D +MQI
Sbjct  252  VSMSNCMDGLIDVIQGSTAITISNSHFTKHNDVMLFGASDSYQGDAMMQI  301



>ref|XP_010925369.1| PREDICTED: pectate lyase [Elaeis guineensis]
Length=444

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA IT+QF+ NVIIHG+ +HDI   +GGMIRD + H+GLRT+SDGDGISI+GSSDVW+DH
Sbjct  199  GAQITIQFVNNVIIHGLHIHDIKPSNGGMIRDSLHHFGLRTKSDGDGISIYGSSDVWIDH  258

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQ  328
             SMRNC DGLIDAIE STAITISN HFT HNDV+LFGA+D +  D IMQ
Sbjct  259  CSMRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNENDSIMQ  307



>ref|XP_007037229.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY21730.1| Pectate lyase family protein [Theobroma cacao]
Length=434

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQ+I+NVIIHGI +   V+ +GGMIRD VDH+G RT+SDGDGISIFGS ++W+DH
Sbjct  190  GAQITLQYIQNVIIHGIHIRLSVEANGGMIRDSVDHFGFRTKSDGDGISIFGSHNIWIDH  249

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLID I+ASTAITISN HFTDHNDVMLFGA+D    DKIMQ+
Sbjct  250  VSMSRCSDGLIDVIQASTAITISNCHFTDHNDVMLFGASDSFSDDKIMQV  299



>ref|XP_009360393.1| PREDICTED: probable pectate lyase 3 [Pyrus x bretschneideri]
Length=452

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G GITLQF+KNVII  + +  IV   GGMIRD VDH GLRT+SDGDGIS+FG+S+VW+DH
Sbjct  207  GGGITLQFVKNVIITNLHIKMIVSKPGGMIRDSVDHMGLRTKSDGDGISLFGASNVWIDH  266

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLIDA+ ASTAITISN HFTDH+DVMLFGAN+   +DKIMQI
Sbjct  267  VSMSRCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQI  316



>gb|KHN45481.1| Putative pectate lyase 3 [Glycine soja]
Length=379

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+ NVIIHG+R+ +IV   GGMIRD  +H GLRT+SDGD ISIFG+S+VW+DH
Sbjct  194  GAGLTIQFVNNVIIHGVRIKNIVPKEGGMIRDSYNHVGLRTKSDGDAISIFGASNVWIDH  253

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS+ NC DGLID I+ STAITISN H T HNDVMLFGA+D    DKIMQI
Sbjct  254  VSLSNCADGLIDVIQGSTAITISNCHMTKHNDVMLFGASDSYSGDKIMQI  303



>ref|XP_006842121.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
 gb|ERN03796.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
Length=438

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q+ KNVIIHG+ +HDI  G+GGMIRD  +HYGLRT+SDGD ISIF SS VW+DH
Sbjct  193  GAGITIQYQKNVIIHGLHIHDIKAGNGGMIRDSPEHYGLRTKSDGDAISIFASSFVWIDH  252

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
             SM NC DGLIDAI  STAITISN HFT+HN+V L GA+D    DKIMQ+
Sbjct  253  NSMSNCMDGLIDAIMGSTAITISNNHFTNHNEVSLMGASDSFSDDKIMQV  302



>ref|XP_009389712.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=438

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+Q++ NVI+H + + DI  G+GGMIRD   HYGLRTRSDGDGISI+GSS++W+DH
Sbjct  192  GAGVTIQYVHNVIVHNLHIQDIKAGNGGMIRDSEHHYGLRTRSDGDGISIYGSSNIWIDH  251

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDAIE STAITISN HFT HN+ MLFGA+D    D IMQI
Sbjct  252  VSMSNCMDGLIDAIEGSTAITISNSHFTRHNEAMLFGASDAYSPDAIMQI  301



>ref|XP_008221660.1| PREDICTED: probable pectate lyase 3 [Prunus mume]
Length=443

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQF+KNVII  + +  IV   GGMIRD VDH G RTRSDGDGISIFGSS+VW+DH
Sbjct  198  GAGITLQFVKNVIITNLHIKRIVPKGGGMIRDSVDHLGQRTRSDGDGISIFGSSNVWIDH  257

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDAI  STAITISN HFT HNDVMLFGA++   +DKIMQI
Sbjct  258  VSMENCADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQI  307



>ref|XP_003554335.1| PREDICTED: pectate lyase-like [Glycine max]
Length=443

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+ NVIIHG+R+ +IV   GGMIRD  +H GLRT+SDGD ISIFG+S+VW+DH
Sbjct  198  GAGLTIQFVNNVIIHGVRIKNIVPKEGGMIRDSYNHVGLRTKSDGDAISIFGASNVWIDH  257

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS+ NC DGLID I+ STAITISN H T HNDVMLFGA+D    DKIMQI
Sbjct  258  VSLSNCADGLIDVIQGSTAITISNCHMTKHNDVMLFGASDSYSGDKIMQI  307



>ref|XP_004165454.1| PREDICTED: pectate lyase-like [Cucumis sativus]
 gb|KGN64253.1| hypothetical protein Csa_1G045510 [Cucumis sativus]
Length=439

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G  ITLQF+KN+IIH + +HDI  G+GGMIRD V HYG RTRSDGDGIS+FG+S VW+DH
Sbjct  195  GGQITLQFVKNIIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRSDGDGISMFGASRVWIDH  254

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDA+ ASTAITISN HFT HNDV+L GA++    D+IMQ+
Sbjct  255  VSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASNGYSNDQIMQV  304



>ref|XP_008389523.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 3 [Malus 
domestica]
Length=452

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G GITLQF+KNVI+  + +  IV  +GGMIRD VDH GLRT+SDGDGIS+FG+S+VW+DH
Sbjct  207  GGGITLQFVKNVILTNLHIKMIVSKTGGMIRDSVDHMGLRTKSDGDGISLFGASNVWIDH  266

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDA+ ASTAITISN HFTDH+DVMLFGAN+   +DKIMQI
Sbjct  267  MSMSRCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQI  316



>gb|ABK28696.1| unknown [Arabidopsis thaliana]
Length=473

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KNV+IHG+ +H I + SGGMIRD VDH+G+RTR+DGDG+SI+GSS++W+DH
Sbjct  225  GAGITMQFVKNVVIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDH  284

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+
Sbjct  285  ISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQV  334



>ref|NP_197015.4| putative pectate lyase 19 [Arabidopsis thaliana]
 gb|AED92118.1| putative pectate lyase 19 [Arabidopsis thaliana]
Length=472

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KNV+IHG+ +H I + SGGMIRD VDH+G+RTR+DGDG+SI+GSS++W+DH
Sbjct  225  GAGITMQFVKNVVIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDH  284

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+
Sbjct  285  ISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQV  334



>ref|XP_007227702.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
 gb|EMJ28901.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
Length=446

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQF+KNVII  + +  IV   GGMIRD VDH G RT+SDGDGISIFGSS+VW+DH
Sbjct  201  GAGITLQFVKNVIITNLHIKKIVPKQGGMIRDSVDHIGRRTKSDGDGISIFGSSNVWIDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDAI  STAITISN HFT HNDVMLFGA++   +DKIMQI
Sbjct  261  VSMENCADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQI  310



>ref|XP_004152537.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=434

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G  ITLQF+KN+IIH + +HDI  G+GGMIRD V HYG RTRSDGDGIS+FG+S VW+DH
Sbjct  195  GGQITLQFVKNIIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRSDGDGISMFGASRVWIDH  254

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDA+ ASTAITISN HFT HNDV+L GA++    D+IMQ+
Sbjct  255  VSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASNGYSNDQIMQV  304



>gb|EPS62426.1| hypothetical protein M569_12361, partial [Genlisea aurea]
Length=410

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQ++ NVI+H +R+HDI  GSGG IRD   H+G RT SDGD IS+FG++++W+DH
Sbjct  167  GAGITLQYVSNVILHNLRIHDIKPGSGGTIRDSPTHFGFRTPSDGDAISMFGATNIWIDH  226

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS   C DGLIDAI+ASTAITISN HF  HNDVML GA+D S +D+I+Q+
Sbjct  227  VSAARCSDGLIDAIQASTAITISNCHFAQHNDVMLLGASDKSSEDQILQV  276



>ref|XP_010527871.1| PREDICTED: probable pectate lyase 3 isoform X1 [Tarenaya hassleriana]
Length=709

 Score =   134 bits (338),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG TLQF+ NVIIH I + +IV G+GG+IRD   H+GLRTRSDGDGI+IFG+++VW+DH
Sbjct  458  GAGFTLQFVNNVIIHNIYIKNIVPGNGGLIRDSETHFGLRTRSDGDGINIFGATNVWIDH  517

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM +C DG+IDAI+ ST ITISN H TDH +VMLFG  D    DK MQI
Sbjct  518  VSMSHCSDGMIDAIQGSTGITISNCHLTDHQEVMLFGGTDKDVIDKKMQI  567



>ref|XP_008446067.1| PREDICTED: pectate lyase-like, partial [Cucumis melo]
Length=381

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G  ITLQF++N+IIH + +HDI  G+GG IRD V HYG RT+SDGDGIS+FGSS VW+DH
Sbjct  137  GGQITLQFVRNIIIHNLHIHDIKAGNGGFIRDSVSHYGYRTQSDGDGISMFGSSRVWIDH  196

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDA+ ASTAITISN HFT HNDV+L GA+D    DKIMQ+
Sbjct  197  VSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASDSYSNDKIMQV  246



>ref|XP_006579282.1| PREDICTED: probable pectate lyase P59-like [Glycine max]
Length=420

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQ++KN+IIHG+ +HDI + SGG+IRD +DHYG+R  SDGD IS+FGS+ VW+DH
Sbjct  126  GAQITLQYVKNIIIHGLHIHDIKKCSGGLIRDSMDHYGVRAMSDGDAISVFGSTYVWIDH  185

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS  NC DGLID + ASTA+TISN H T HNDV+LFGA+D    DKIMQ+
Sbjct  186  VSFTNCDDGLIDVVSASTAVTISNCHLTKHNDVLLFGASDSYSGDKIMQV  235



>emb|CDP02199.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG T+QF++N+IIH + +HD+   SGGMIRD VDH GLRT ++GDGISIFG+ DVW+DH
Sbjct  107  GAGFTIQFVRNIIIHNVHIHDVKTTSGGMIRDSVDHVGLRTANEGDGISIFGARDVWLDH  166

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDA++ASTAITISN HFTDH+ V+LFGA+D +  DK MQ+
Sbjct  167  LSMSKCSDGLIDAVQASTAITISNCHFTDHDKVLLFGASDVTEVDKNMQV  216



>gb|KDP45476.1| hypothetical protein JCGZ_09725 [Jatropha curcas]
Length=462

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+ N+IIHG+R+H I    GGMIRD VDH GLRT SDGDGISIFGS++VW+DH
Sbjct  216  GAGITIQFVSNIIIHGLRIHHICSTCGGMIRDSVDHVGLRTASDGDGISIFGSTNVWIDH  275

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDAI+ STAITISN HF++HND +L GA+D    D+ MQI
Sbjct  276  VSMSNCQDGLIDAIQGSTAITISNCHFSNHNDAILLGASDSFSGDQFMQI  325



>ref|XP_009126031.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
Length=481

 Score =   132 bits (331),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+++VIIHG+R+H I Q +GGMIRD  DH+G+RT++DGDGISI+GSS +W+DH
Sbjct  234  GAGITIQFVRHVIIHGLRIHHICQSNGGMIRDSTDHFGMRTKADGDGISIYGSSMIWLDH  293

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+
Sbjct  294  ISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNDNQGDKKMQV  343



>emb|CDX85564.1| BnaA02g02490D [Brassica napus]
Length=473

 Score =   132 bits (331),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+++VIIHG+R+H I Q +GGMIRD  DH+G+RT++DGDGISI+GSS +W+DH
Sbjct  226  GAGITIQFVRHVIIHGLRIHHICQSNGGMIRDSTDHFGMRTKADGDGISIYGSSMIWLDH  285

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+
Sbjct  286  ISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNDNQGDKKMQV  335



>gb|KHN08855.1| Putative pectate lyase P59 [Glycine soja]
Length=435

 Score =   131 bits (330),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQ++KN+IIHG+ +HDI + SGG+IRD +DHYG+R  SDGD IS+FGS+ VW+DH
Sbjct  192  GAQITLQYVKNIIIHGLHIHDIKKCSGGLIRDSMDHYGVRAMSDGDAISVFGSTYVWIDH  251

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS  NC DGLID + ASTA+TISN H T HNDV+LFGA+D    DKIMQ+
Sbjct  252  VSFTNCDDGLIDVVSASTAVTISNCHLTKHNDVLLFGASDSYSGDKIMQV  301



>gb|ACN96346.1| hypothetical protein, partial [Zea luxurians]
 gb|ACN96352.1| hypothetical protein, partial [Zea luxurians]
Length=262

 Score =   128 bits (322),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD  + SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  149  AQITLQNVQNVILHNLHIHDSKEHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  208

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  209  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  257



>ref|XP_010068708.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
 gb|KCW64557.1| hypothetical protein EUGRSUZ_G02162 [Eucalyptus grandis]
Length=435

 Score =   131 bits (330),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQF++NVIIHG+ +HD   G+GG+IRD ++HYG RT SDGDGIS+FG+++VW+DH
Sbjct  191  GAQITLQFVRNVIIHGLHIHDTHPGNGGLIRDSLEHYGFRTGSDGDGISLFGATNVWIDH  250

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM +CYDGLID I+ASTAITISN HFT HN+VMLFG +D    D  MQI
Sbjct  251  VSMSHCYDGLIDVIQASTAITISNCHFTRHNEVMLFGGSDTYSDDAHMQI  300



>gb|ACN96342.1| hypothetical protein, partial [Zea luxurians]
 gb|ACN96344.1| hypothetical protein, partial [Zea luxurians]
Length=262

 Score =   128 bits (322),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD  + SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  149  AQITLQNVQNVILHNLHIHDSKEHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  208

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  209  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  257



>gb|ACN96341.1| hypothetical protein, partial [Zea luxurians]
 gb|ACN96343.1| hypothetical protein, partial [Zea luxurians]
 gb|ACN96345.1| hypothetical protein, partial [Zea luxurians]
 gb|ACN96347.1| hypothetical protein, partial [Zea luxurians]
 gb|ACN96348.1| hypothetical protein, partial [Zea luxurians]
 gb|ACN96349.1| hypothetical protein, partial [Zea luxurians]
 gb|ACN96350.1| hypothetical protein, partial [Zea luxurians]
 gb|ACN96351.1| hypothetical protein, partial [Zea luxurians]
Length=262

 Score =   128 bits (322),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD  + SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  149  AQITLQNVQNVILHNLHIHDSKEHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  208

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  209  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  257



>ref|XP_011087066.1| PREDICTED: pectate lyase [Sesamum indicum]
Length=431

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQF+ NVIIH IR+HDI    GGMIRD VDH GLRTRSDGDGIS+F S+++W+DH
Sbjct  183  GAGITLQFVHNVIIHNIRIHDIHPAPGGMIRDAVDHIGLRTRSDGDGISVFNSNNIWIDH  242

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS+    DGLID IE STAITISN  F  HNDVML GA+D + KD IMQI
Sbjct  243  VSLSKGTDGLIDVIEGSTAITISNCKFNHHNDVMLLGAHDSTAKDSIMQI  292



>ref|XP_007137422.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
 gb|ESW09416.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
Length=439

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+ NVIIHGIRV +IV   GGMIRD  +H GLRTRSDGD IS+FG+S++W+DH
Sbjct  194  GAGLTMQFVNNVIIHGIRVKNIVSKEGGMIRDSYNHVGLRTRSDGDAISVFGASNIWIDH  253

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS+ N  DGLID I+ STAITISN H T HNDVMLFGA D    DKIMQI
Sbjct  254  VSLSNSDDGLIDVIQGSTAITISNCHMTRHNDVMLFGATDTYSGDKIMQI  303



>ref|XP_003621115.1| Pectate lyase [Medicago truncatula]
 gb|AES77333.1| pectate lyase P59-like protein [Medicago truncatula]
Length=451

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+ NVIIHG+R+ +I   +GG+IRD  DH G+RTRSDGD IS+FGSS++W+DH
Sbjct  205  GAGITMQFVNNVIIHGLRIKNIKAKNGGLIRDSFDHLGVRTRSDGDAISVFGSSNIWIDH  264

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +S+ NC DGL+D I+ STA+TISN H T HNDVMLFGA+D    DKIMQ+
Sbjct  265  ISLSNCEDGLVDVIQGSTAVTISNCHMTKHNDVMLFGASDTYQDDKIMQV  314



>ref|XP_010242445.1| PREDICTED: pectate lyase [Nelumbo nucifera]
Length=443

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QFIKNVIIH +  HDIV   GGMIRD V+H G RT SDGD ISIFGS++VW+DH
Sbjct  201  GAGITIQFIKNVIIHNLHFHDIVAREGGMIRDSVNHLGFRTASDGDAISIFGSTNVWIDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
             SM NC DGL+DAI  STAITISN H T HN+VMLFGA+D  P D  MQI
Sbjct  261  NSMSNCKDGLVDAIMGSTAITISNNHLTHHNEVMLFGASDSYPDDSKMQI  310



>ref|XP_008339935.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQF+KNVII  + +  IV   GG+IRD VDH GLRT+SDGDGIS+FG+S+VW+DH
Sbjct  207  GAGITLQFVKNVIITNLHIKMIVTKPGGLIRDSVDHIGLRTQSDGDGISLFGASNVWIDH  266

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLIDAI  STAITISN HFTDH++ MLFGAN+   +DKIMQI
Sbjct  267  VSMSRCADGLIDAIMGSTAITISNSHFTDHDEAMLFGANNAHTQDKIMQI  316



>ref|XP_006357289.1| PREDICTED: probable pectate lyase 3-like [Solanum tuberosum]
Length=459

 Score =   131 bits (329),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 71/110 (65%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF+ NVI+H IRVH I+   GGMIRD V H GLRT SDGD IS+FG++ +W+DH
Sbjct  213  GAGLTLQFVHNVIVHNIRVHHILSKDGGMIRDSVKHIGLRTVSDGDAISLFGANRIWIDH  272

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
             ++    DGL+DAI ASTAITISN  F  HNDVML GAND  P+DKIMQ+
Sbjct  273  CTLTKGADGLVDAIMASTAITISNCKFNHHNDVMLLGANDAFPQDKIMQV  322



>gb|ACN96380.1| hypothetical protein, partial [Tripsacum sp. JRI-2009]
Length=262

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD    SGGMIRD   HYGLRTRSDGDGIS+  SS+VW+DHV
Sbjct  149  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGISVLSSSNVWIDHV  208

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D++MQ+
Sbjct  209  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDRVMLFGASNDSPQDEVMQV  257



>ref|XP_004147462.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
 ref|XP_004163529.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
Length=431

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+++QF +NVIIHG+R+H ++   GGMIRD  +H GLRT SDGDGISIFGS+++W+DH
Sbjct  185  GAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGDGISIFGSTNIWLDH  244

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQ+
Sbjct  245  LSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQV  294



>ref|XP_004236194.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=435

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G G+ LQFI NVII  + +HD   G+GG+IRD V HYG R++SDGDGISIFGS++VW+DH
Sbjct  190  GGGLMLQFIHNVIISNLHIHDTKAGAGGLIRDSVSHYGYRSKSDGDGISIFGSTNVWIDH  249

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLIDA+E STAITISN HFT HNDVMLFGA+D +  D +MQI
Sbjct  250  ISMSNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQI  299



>ref|XP_006344502.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=435

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G G+ LQF+ NV+I  + +HD   GSGG+IRD V HYG R++SDGDGISIFGS++VW+DH
Sbjct  190  GGGLMLQFVHNVLISNLHIHDTKAGSGGLIRDSVSHYGYRSKSDGDGISIFGSTNVWIDH  249

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLIDA+E STAITISN HFT HNDVMLFGA+D +  D +MQI
Sbjct  250  ISMSNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQI  299



>ref|XP_008443432.1| PREDICTED: probable pectate lyase 19 [Cucumis melo]
Length=441

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+++QF +NVIIHG+R+H ++   GGMIRD  +H GLRT SDGDGISIFGSS++W+DH
Sbjct  195  GAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGDGISIFGSSNIWLDH  254

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQ+
Sbjct  255  LSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQV  304



>ref|XP_011097774.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=435

 Score =   130 bits (328),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 71/110 (65%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+ NVIIH I VH+IV  SGGMIRD + H GLRT++DGD ISI+ S+ VW+DH
Sbjct  186  GAGITIQFVHNVIIHNIWVHNIVPTSGGMIRDTMTHIGLRTQADGDAISIYSSNHVWIDH  245

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
             S+    DGLID IE STAITISN  F  HNDVML GA+D + KD IMQ+
Sbjct  246  CSLSKATDGLIDVIEGSTAITISNCKFNRHNDVMLLGAHDSNSKDAIMQV  295



>gb|KGN59593.1| hypothetical protein Csa_3G827350 [Cucumis sativus]
Length=441

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+++QF +NVIIHG+R+H ++   GGMIRD  +H GLRT SDGDGISIFGS+++W+DH
Sbjct  195  GAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGDGISIFGSTNIWLDH  254

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQ+
Sbjct  255  LSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQV  304



>ref|XP_004508770.1| PREDICTED: probable pectate lyase P59-like [Cicer arietinum]
Length=434

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA +TLQ++KN+IIHG+ +HDI +G GG+IRD V+HYG R+ SDGD IS+FGSS VW+DH
Sbjct  191  GAQMTLQYVKNIIIHGLHIHDIKKGGGGLIRDSVNHYGYRSSSDGDAISLFGSSHVWIDH  250

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +S+ NC DGLID +E STAITISN H T HNDVMLFGA+D    DK++Q+
Sbjct  251  ISLWNCDDGLIDVVEGSTAITISNCHMTRHNDVMLFGASDGYSGDKVLQV  300



>ref|XP_008339934.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQF+KNVII  + +  IV   GGMIRD VDH GLRT+SDGDGIS+FG+S+VW+DH
Sbjct  207  GAGITLQFVKNVIITNLHIKMIVPKPGGMIRDSVDHIGLRTQSDGDGISLFGASNVWIDH  266

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLIDA+  ST+ITISN HFTDH++ MLFGAN+   +DKIMQI
Sbjct  267  VSMSRCADGLIDAVMGSTSITISNSHFTDHDEAMLFGANNAHTQDKIMQI  316



>ref|XP_004951474.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=440

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G GIT+QF +NVIIHG+ VHD+    GG++RD   H G RT++DGDGIS+FG++DVW+DH
Sbjct  196  GGGITVQFARNVIIHGLHVHDVKHTDGGLMRDSPTHMGPRTKADGDGISLFGATDVWIDH  255

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLID +++ST +TISN HFT+HNDVMLFGA+D  P+D++MQI
Sbjct  256  ISMSNCEDGLIDVVQSSTGVTISNCHFTNHNDVMLFGASDSYPQDQVMQI  305



>ref|XP_007209148.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
 gb|EMJ10347.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
Length=440

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA I+LQF+KNVII  + +H+   G+GGMIRD ++H+G RTRSDGDGIS+FG+++VW+DH
Sbjct  196  GAQISLQFVKNVIITNLHIHNNKPGNGGMIRDSINHFGQRTRSDGDGISMFGATNVWIDH  255

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS+ NC DGLIDAI+ STAITISN H T+HNDVMLFG++D + +D++MQI
Sbjct  256  VSLSNCADGLIDAIQGSTAITISNCHLTNHNDVMLFGSSDSNSQDQVMQI  305



>gb|ACN96322.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96327.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96330.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96331.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96332.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96333.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96336.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96337.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96338.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96339.1| hypothetical protein, partial [Zea mays subsp. mays]
Length=278

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD    SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  165  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  224

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  225  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  273



>gb|ACN96356.1| hypothetical protein, partial [Zea mays subsp. mexicana]
Length=262

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD    SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  149  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  208

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  209  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  257



>gb|ACN96372.1| hypothetical protein, partial [Zea mays subsp. parviglumis]
 gb|ACN96376.1| hypothetical protein, partial [Zea mays subsp. parviglumis]
Length=262

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD    SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  149  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  208

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  209  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  257



>gb|ACN96354.1| hypothetical protein, partial [Zea mays subsp. mexicana]
Length=262

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD    SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  149  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  208

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  209  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  257



>gb|ACN96353.1| hypothetical protein, partial [Zea mays subsp. mexicana]
 gb|ACN96357.1| hypothetical protein, partial [Zea mays subsp. mexicana]
 gb|ACN96368.1| hypothetical protein, partial [Zea mays subsp. parviglumis]
Length=262

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD    SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  149  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  208

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  209  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  257



>gb|ACN96364.1| hypothetical protein, partial [Zea mays subsp. mexicana]
 gb|ACN96366.1| hypothetical protein, partial [Zea mays subsp. parviglumis]
 gb|ACN96367.1| hypothetical protein, partial [Zea mays subsp. parviglumis]
 gb|ACN96370.1| hypothetical protein, partial [Zea mays subsp. parviglumis]
 gb|ACN96374.1| hypothetical protein, partial [Zea mays subsp. parviglumis]
 gb|ACN96378.1| hypothetical protein, partial [Zea mays subsp. parviglumis]
Length=262

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD    SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  149  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  208

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  209  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  257



>gb|ACN96358.1| hypothetical protein, partial [Zea mays subsp. mexicana]
 gb|ACN96363.1| hypothetical protein, partial [Zea mays subsp. mexicana]
Length=262

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD    SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  149  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  208

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  209  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  257



>gb|ACN96379.1| hypothetical protein, partial [Zea mays subsp. parviglumis]
Length=262

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD    SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  149  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  208

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  209  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  257



>gb|ACN96360.1| hypothetical protein, partial [Zea mays subsp. mexicana]
 gb|ACN96365.1| hypothetical protein, partial [Zea mays subsp. mexicana]
 gb|ACN96375.1| hypothetical protein, partial [Zea mays subsp. parviglumis]
Length=262

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD    SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  149  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  208

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  209  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  257



>gb|ACN96359.1| hypothetical protein, partial [Zea mays subsp. mexicana]
 gb|ACN96361.1| hypothetical protein, partial [Zea mays subsp. mexicana]
 gb|ACN96371.1| hypothetical protein, partial [Zea mays subsp. parviglumis]
 gb|ACN96373.1| hypothetical protein, partial [Zea mays subsp. parviglumis]
 gb|ACN96377.1| hypothetical protein, partial [Zea mays subsp. parviglumis]
Length=262

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD    SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  149  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  208

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  209  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  257



>gb|ACN96320.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96321.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96323.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96325.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96329.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96334.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96335.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96340.1| hypothetical protein, partial [Zea mays subsp. mays]
Length=278

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD    SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  165  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  224

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  225  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  273



>gb|ACN96362.1| hypothetical protein, partial [Zea mays subsp. mexicana]
Length=262

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD    SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  149  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  208

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  209  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  257



>gb|ACN96319.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96324.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96326.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96328.1| hypothetical protein, partial [Zea mays subsp. mays]
Length=278

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD    SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  165  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  224

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  225  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  273



>gb|ACN96355.1| hypothetical protein, partial [Zea mays subsp. mexicana]
 gb|ACN96369.1| hypothetical protein, partial [Zea mays subsp. parviglumis]
Length=262

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD    SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  149  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  208

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  209  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  257



>ref|XP_010463548.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q++KN+IIHG+ VH IV  SGG+IRD +DH+G R ++DGDGISIFG++D+W+DH
Sbjct  226  GAGITMQYVKNIIIHGLHVHHIVTSSGGLIRDSIDHFGQRGQADGDGISIFGATDIWLDH  285

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA D +  DK MQ+
Sbjct  286  ISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQDHNQDDKKMQV  335



>ref|XP_009380431.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+K+VI+H + +HDI  G+GG IRD   H+G+RTRSDGDG+SIFG+S VWVDH
Sbjct  191  GAGLTIQFVKHVIVHNLHIHDIKPGAGGNIRDSEGHWGIRTRSDGDGVSIFGASHVWVDH  250

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLIDA++ASTAITISN H T HNDV+L GA+D S +D +MQ+
Sbjct  251  LSMSNCADGLIDAVKASTAITISNCHLTRHNDVILLGASDKSQEDAVMQV  300



>gb|ACF87417.1| unknown [Zea mays]
Length=444

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q  +NVIIH + VHD+    GG++RD   H G RTR+DGDGIS+F +++VW+DH
Sbjct  201  GAGITVQLAQNVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGDGISLFSATNVWIDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLID +++ST ITISN HFT+HNDVMLFGA+D  P+D+IMQI
Sbjct  261  ISMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSWPQDQIMQI  310



>ref|XP_008679844.1| PREDICTED: pectate lyase [Zea mays]
 gb|AFW66064.1| pectate lyase-like protein [Zea mays]
Length=444

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q  +NVIIH + VHD+    GG++RD   H G RTR+DGDGIS+F +++VW+DH
Sbjct  201  GAGITVQLAQNVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGDGISLFSATNVWIDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLID +++ST ITISN HFT+HNDVMLFGA+D  P+D+IMQI
Sbjct  261  ISMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSWPQDQIMQI  310



>ref|XP_002453531.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
 gb|EES06507.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
Length=445

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q  +NVIIH + VHD++   GG++RD   H G RT++DGDGIS+F +++VW+DH
Sbjct  201  GAGITVQLARNVIIHNLHVHDVLHSMGGLMRDSPTHVGSRTKADGDGISLFQATNVWIDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLID +++ST ITISN HFT+HNDVMLFGA+D  P+D++MQI
Sbjct  261  ISMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSYPQDQMMQI  310



>gb|KFK37588.1| hypothetical protein AALP_AA3G002600 [Arabis alpina]
Length=472

 Score =   129 bits (324),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q++ N+IIHG+ VH I++GSGGM+R+ VDH+G R ++DGDGISIFG++++W+DH
Sbjct  225  GAGITMQYVHNIIIHGLHVHHIIEGSGGMVRNSVDHFGFRGKADGDGISIFGATNIWLDH  284

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA+D +  DK MQ+
Sbjct  285  ISMSKCQDGLIDAIMGSTGITISNSHFTHHNDVMLLGAHDSNKDDKKMQV  334



>ref|XP_008239834.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=438

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA I+LQF+KNVII  + +H+   G+GG+IRD ++H+G RTRSDGDGIS++G+++VW+DH
Sbjct  194  GAQISLQFVKNVIITNLHIHNNKPGNGGLIRDSINHFGQRTRSDGDGISMYGATNVWIDH  253

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS+ NC DGLIDAI+ STAITISN H T+HNDVMLFG++D + +D++MQI
Sbjct  254  VSLSNCADGLIDAIQGSTAITISNCHLTNHNDVMLFGSSDSNSQDQVMQI  303



>ref|XP_007138209.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
 gb|ESW10203.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
Length=434

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA +T+QF+KN+IIHG+ +HDI   SGG+IRD + HYG+R  SDGDGIS+FGS+ +W+DH
Sbjct  191  GAQMTIQFVKNIIIHGLHIHDIQPISGGLIRDSMSHYGVRAMSDGDGISVFGSTHIWIDH  250

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLID + ASTA+TISN HF  HNDV+LFGA D   +DK+MQ+
Sbjct  251  VSMTNCSDGLIDVVSASTAVTISNCHFVKHNDVLLFGATDSFSRDKVMQV  300



>ref|XP_002270112.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32014.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF +NVIIHG+ +HDIV   GG+IRD V H+GLRTRSDGDGISIFGSS VW+DH
Sbjct  193  GAGITIQFARNVIIHGLHIHDIVSRPGGLIRDSVHHFGLRTRSDGDGISIFGSSHVWIDH  252

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
             SM  C DGL+DAI+ STAITISN HFT HN+ ML GA+D    D IMQ+
Sbjct  253  NSMSKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQV  302



>gb|AES91206.2| pectate lyase P59-like protein [Medicago truncatula]
Length=434

 Score =   129 bits (323),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQ++KN+IIHG+ +HD  + SGG IRD +DHYG R+ SDGD IS+FG+S VW+DH
Sbjct  191  GAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDGDAISMFGASHVWIDH  250

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGL+DA+  STAITISN H T HNDVMLFGAND    D+I QI
Sbjct  251  ISMWNCADGLVDAVAGSTAITISNCHMTRHNDVMLFGANDGFSGDQISQI  300



>emb|CAN69904.1| hypothetical protein VITISV_001006 [Vitis vinifera]
Length=443

 Score =   129 bits (323),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF +NVIIHG+ +HDIV   GG+IRD V H+GLRTRSDGDGISIFGSS VW+DH
Sbjct  193  GAGITIQFARNVIIHGLHIHDIVSHPGGLIRDSVHHFGLRTRSDGDGISIFGSSHVWIDH  252

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
             SM  C DGL+DAI+ STAITISN HFT HN+ ML GA+D    D IMQ+
Sbjct  253  NSMSKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQV  302



>gb|AAA86241.1| pectate lyase homolog [Medicago sativa]
Length=450

 Score =   129 bits (323),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+ NVIIHG+R+ +I   +GG+IRD  DH G+RTRSDGD IS+FGSS++W+DH
Sbjct  204  GAGITMQFVNNVIIHGLRIKNIKARNGGLIRDSFDHIGVRTRSDGDAISVFGSSNIWIDH  263

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +S+ +C DGL+D I+ STA+TISN H T HNDVMLFGA+D    DKIMQI
Sbjct  264  ISLSDCEDGLVDVIQGSTAVTISNCHMTKHNDVMLFGASDTYQDDKIMQI  313



>ref|XP_011086389.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=442

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQF+ NVIIH I +HDIV   GGMIRD VDH GLRT+SDGDGIS+FGS+++W+DH
Sbjct  194  GAGITLQFVHNVIIHNIWIHDIVPEPGGMIRDAVDHIGLRTQSDGDGISVFGSNNIWIDH  253

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS+    DGLID IE STA+TISN  F +HNDVML GA+D S KD IMQ+
Sbjct  254  VSLSKGTDGLIDVIEGSTAVTISNCKFNNHNDVMLLGAHDGSNKDSIMQV  303



>ref|XP_010513594.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q++ N+IIHG+ VH IV  SGG+IRD +DH+G R ++DGDGISIFG++++W+DH
Sbjct  226  GAGITMQYVHNIIIHGLHVHHIVSSSGGLIRDSIDHFGQRGQADGDGISIFGATNIWLDH  285

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA D +  DK MQ+
Sbjct  286  ISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQDHNQDDKKMQV  335



>ref|XP_006826355.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
 gb|ERM93592.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
Length=479

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA IT+Q++KNVIIHG+ +HD   G+GGMIRD  DH+G+RTRSDGDGISI+GS++VWVDH
Sbjct  237  GACITIQYVKNVIIHGLHIHDCKAGNGGMIRDSEDHFGIRTRSDGDGISIYGSTNVWVDH  296

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
             ++  C DGL+DAI  STAITISN HF+ H++V+L G +D  P DK+MQ+
Sbjct  297  NTLSKCQDGLVDAIMGSTAITISNNHFSKHDEVLLLGGSDLYPMDKVMQV  346



>ref|XP_009758350.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=445

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+ NVI+H IRVH I+  SGGMIRD +DH GLRT SDGD ISIFG++ +W+DH
Sbjct  199  GAGLTIQFVHNVIVHNIRVHHILSTSGGMIRDSIDHIGLRTVSDGDAISIFGANRIWIDH  258

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
             ++    DGLIDAI ASTAITISN  F  HNDVML GAND  P+DKIMQ+
Sbjct  259  CTLTKGADGLIDAIMASTAITISNCKFNHHNDVMLLGANDAFPQDKIMQV  308



>ref|XP_004301165.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=445

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 92/116 (79%), Gaps = 6/116 (5%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G  ITLQ+++N+II  I V D +  +GGMIRD ++HYGLRT SDGDGIS+FG+++VW+DH
Sbjct  195  GGQITLQYVRNIIISNIHVRDTIPKNGGMIRDSINHYGLRTESDGDGISLFGATNVWIDH  254

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHND------VMLFGANDFSPKDKIMQI  331
            VS  NC DGLID I+ASTAITISN HFTDHND      VMLFG++D + KD+IMQI
Sbjct  255  VSASNCADGLIDVIQASTAITISNSHFTDHNDVIINLSVMLFGSSDSNSKDEIMQI  310



>ref|XP_010485518.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q++ N+IIHG+ VH IV  SGG+IRD +DH+G R ++DGDGISIFG++++W+DH
Sbjct  226  GAGITMQYVHNIIIHGLHVHHIVTSSGGLIRDSIDHFGQRGQADGDGISIFGATNIWLDH  285

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA D +  DK MQ+
Sbjct  286  ISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQDHNQDDKKMQV  335



>ref|XP_009599232.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=445

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+ NVI+H IRVH I+  SGGMIRD +DH GLRT SDGD ISIFG++ +W+DH
Sbjct  199  GAGLTIQFVHNVIVHNIRVHHILSTSGGMIRDSIDHIGLRTVSDGDAISIFGANRIWIDH  258

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
             ++    DGLIDAI ASTAITISN  F  HNDVML GAND  P+DKIMQ+
Sbjct  259  CTLTKGADGLIDAIMASTAITISNCKFNHHNDVMLLGANDAFPQDKIMQV  308



>ref|XP_007151201.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
 gb|ESW23195.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
Length=441

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G G+T+QF+ NVIIHGIRV DIV   GG+IRD  +H G RTRSDGD IS+FG+S++W+DH
Sbjct  196  GGGLTMQFVNNVIIHGIRVKDIVPKEGGLIRDSYNHIGQRTRSDGDAISVFGASNIWIDH  255

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS+ N  DGLID I+ STAITISN H T HNDVMLFGA D    DKIMQI
Sbjct  256  VSLSNSADGLIDVIQGSTAITISNCHMTRHNDVMLFGAADSYTGDKIMQI  305



>ref|XP_011085780.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=447

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KNVIIH +++H IV+  GG+IRD   H GLRT+SDGDGISIFGS D+W+DH
Sbjct  202  GAGITIQFVKNVIIHNLKIHHIVEKDGGLIRDSASHTGLRTQSDGDGISIFGSQDIWIDH  261

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLID I+ ST ITISN HFTDH+  MLFG ND  P D+ MQI
Sbjct  262  VSMTRCADGLIDIIQGSTGITISNSHFTDHDHAMLFGGNDKYPGDEKMQI  311



>gb|EEE56553.1| hypothetical protein OsJ_05879 [Oryza sativa Japonica Group]
Length=410

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF +NVII  + VHD+    GG +RD   H G RTR+DGDGIS+F ++DVWVDH
Sbjct  166  GAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRADGDGISLFAATDVWVDH  225

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLID ++ ST +TISN HFT+HNDVMLFGA+D  P+DK+MQI
Sbjct  226  VSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQDKVMQI  275



>emb|CDY09356.1| BnaA02g26540D [Brassica napus]
Length=457

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG TLQF+KNVIIH I +  I +G GG+IRD  +H+GLRT SDGDGI+IFG++++W+DH
Sbjct  206  GAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLRTISDGDGINIFGATNIWIDH  265

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMRNC DG+IDAI  STAITISN HFTDH +VMLFGA +    DK MQI
Sbjct  266  VSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKNGDEFDKKMQI  315



>emb|CDY41679.1| BnaC02g34750D [Brassica napus]
Length=457

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG TLQF+KNVIIH I +  I +G GG+IRD  +H+GLRT SDGDGI+IFG++++W+DH
Sbjct  206  GAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLRTISDGDGINIFGATNIWIDH  265

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMRNC DG+IDAI  STAITISN HFTDH +VMLFGA +    DK MQI
Sbjct  266  VSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKNGDEFDKKMQI  315



>gb|EAY85003.1| hypothetical protein OsI_06363 [Oryza sativa Indica Group]
Length=439

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF +NVII  + VHD+    GG +RD   H G RTR+DGDGIS+F ++DVWVDH
Sbjct  195  GAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRADGDGISLFAATDVWVDH  254

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLID ++ ST +TISN HFT+HNDVMLFGA+D  P+DK+MQI
Sbjct  255  VSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQDKVMQI  304



>ref|XP_009129128.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=457

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG TLQF+KNVIIH I +  I +G GG+IRD  +H+GLRT SDGDGI+IFG++++W+DH
Sbjct  206  GAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLRTISDGDGINIFGATNIWIDH  265

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMRNC DG+IDAI  STAITISN HFTDH +VMLFGA +    DK MQI
Sbjct  266  VSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKNGDEFDKKMQI  315



>ref|XP_002892805.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69064.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQ++ NVIIH I V  IV G+GG+IRD  DH GLRT+SDGDGIS+FG++++W+DH
Sbjct  208  GAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSEDHIGLRTKSDGDGISLFGATNIWIDH  267

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK MQI
Sbjct  268  VSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQI  317



>ref|NP_001046281.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAD25039.1| putative pectate lyase precursor [Oryza sativa Japonica Group]
 dbj|BAF08195.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAG94880.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF +NVII  + VHD+    GG +RD   H G RTR+DGDGIS+F ++DVWVDH
Sbjct  202  GAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRADGDGISLFAATDVWVDH  261

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLID ++ ST +TISN HFT+HNDVMLFGA+D  P+DK+MQI
Sbjct  262  VSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQDKVMQI  311



>ref|XP_010476496.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF+ NVIIH I V  IV G+GG+IRD   H GLRT+SDGDGIS+FG++++W+DH
Sbjct  204  GAGLTLQFVNNVIIHNIYVKQIVTGNGGLIRDSEQHIGLRTKSDGDGISLFGATNIWIDH  263

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK MQI
Sbjct  264  VSMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQI  313



>gb|KFK33456.1| hypothetical protein AALP_AA5G015800 [Arabis alpina]
Length=460

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+KNVIIH I +  I + +GGMIRD  +H+GLRT SDGDGI+IFG+++VW+DH
Sbjct  209  GAGLTIQFVKNVIIHNIHMKFIERRAGGMIRDSENHFGLRTESDGDGINIFGATNVWIDH  268

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMRNC DG+IDAI  STAITISN HFTDH +VMLFGA +    DK MQI
Sbjct  269  VSMRNCSDGMIDAIMGSTAITISNCHFTDHEEVMLFGAKNGDVIDKKMQI  318



>gb|AAA16476.1| pectate lyase homolog [Zea mays]
 gb|AFW85884.1| hypothetical protein ZEAMMB73_308319 [Zea mays]
Length=438

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ ++NVI+H + +HD    SGGMIRD   HYGLRTRSDGDG+S+  SS+VW+DHV
Sbjct  194  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  253

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ SP+D +MQ+
Sbjct  254  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQV  302



>ref|XP_009148818.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G+G+TLQF+ NVIIH I +  IV  +GG+IRD   H GLRTRSDGDGI++FG+++VW+DH
Sbjct  207  GSGLTLQFVNNVIIHNIYIKQIVPANGGLIRDSEQHIGLRTRSDGDGINLFGATNVWIDH  266

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DG+IDAI  STA+T+SN HFTDH +VMLFGAND    DK MQI
Sbjct  267  VSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGANDKHEIDKKMQI  316



>ref|XP_004489168.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=444

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+ NVIIHG+ + +I   SGGMIRD  +H GLRTRSDGD +S+FGSS++W+DH
Sbjct  198  GAGITMQFVNNVIIHGLHIRNIKARSGGMIRDSYNHVGLRTRSDGDALSVFGSSNIWIDH  257

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +S+    DGLID I+ STAITISN H T HNDVMLFGA+D    DKIMQI
Sbjct  258  ISLSESEDGLIDVIQGSTAITISNCHMTKHNDVMLFGASDSYSDDKIMQI  307



>emb|CDY45254.1| BnaA06g09240D [Brassica napus]
Length=458

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G+G+TLQF+ NVIIH I +  IV  +GG+IRD   H GLRTRSDGDGI++FG+++VW+DH
Sbjct  207  GSGLTLQFVNNVIIHNIYIKQIVPANGGLIRDSEQHIGLRTRSDGDGINLFGATNVWIDH  266

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DG+IDAI  STA+T+SN HFTDH +VMLFGAND    DK MQI
Sbjct  267  VSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGANDKHEIDKKMQI  316



>emb|CAN69905.1| hypothetical protein VITISV_001007 [Vitis vinifera]
Length=358

 Score =   125 bits (313),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KNVIIHG+ +HDIV GSGG+IRD VDH+G R+RSDGDGISI+GSS VW+DH
Sbjct  193  GAGITIQFVKNVIIHGLHIHDIVSGSGGLIRDSVDHFGYRSRSDGDGISIYGSSHVWIDH  252

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDV  280
             SM NC DGLIDAI+ STAITISN HFT HN+V
Sbjct  253  NSMSNCKDGLIDAIQGSTAITISNNHFTKHNEV  285



>ref|XP_010670318.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   126 bits (316),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF  NVIIH I++HDIV  +GGMIRD  +H G+R   DGDGI++F SS++W+DH
Sbjct  205  GAGITIQFANNVIIHNIKIHDIVPSTGGMIRDTNNHVGIRGADDGDGINVFASSNIWLDH  264

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NC DGLID ++ASTAIT+SN HFT H+ V+LFGA+D  P D+IMQI
Sbjct  265  LSMWNCKDGLIDIVKASTAITLSNNHFTRHDHVLLFGADDKDPADEIMQI  314



>ref|XP_010496063.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF+ NVIIH I V  IV G+GG+IRD   H GLRT+SDGDGIS+FG++++W+DH
Sbjct  204  GAGLTLQFVNNVIIHNIYVKHIVTGNGGLIRDSEQHIGLRTKSDGDGISLFGATNIWIDH  263

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK MQI
Sbjct  264  VSMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQI  313



>gb|KFK43687.1| hypothetical protein AALP_AA1G160000 [Arabis alpina]
Length=460

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQ++ NVIIH I V  IV G+GG+IRD   H GLRT+SDGDGIS+FG+++VW+DH
Sbjct  209  GAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSEHHLGLRTKSDGDGISLFGATNVWIDH  268

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK MQI
Sbjct  269  VSMTRCADGMIDAIQGSTAVTISNSHFTDHQEVMLFGARDEDVIDKKMQI  318



>emb|CDY39314.1| BnaC05g10650D [Brassica napus]
Length=459

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G+G+TLQF+ NVI+H I +  IV  +GG+IRD   H GLRTRSDGDGI++FG+++VW+DH
Sbjct  208  GSGLTLQFVNNVIVHNIYIKQIVPANGGLIRDSEQHIGLRTRSDGDGINLFGATNVWIDH  267

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DG+IDAI  STA+T+SN HFTDH +VMLFGAND    DK MQI
Sbjct  268  VSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGANDKHEIDKKMQI  317



>ref|NP_172894.1| putative pectate lyase 3 [Arabidopsis thaliana]
 sp|Q9M9S2.1|PLY3_ARATH RecName: Full=Probable pectate lyase 3; AltName: Full=Pectate 
lyase A2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF43942.1|AC012188_19 Strong similarity to Pectate Lyase Precursor from Lilium longiflorum 
gi|730290 and contains a Pectate lyase PF|00544 domain. 
EST gb|AW004514 comes from this gene [Arabidopsis thaliana]
 gb|AAQ62871.1| At1g14420 [Arabidopsis thaliana]
 dbj|BAD43564.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43610.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43654.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43743.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43876.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43899.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29161.1| putative pectate lyase 3 [Arabidopsis thaliana]
Length=459

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF+ NVIIH I V  IV G+GG+IRD   H GLRT+SDGDGIS+FG++++W+DH
Sbjct  208  GAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEAHIGLRTKSDGDGISLFGATNIWIDH  267

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK MQI
Sbjct  268  VSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQI  317



>gb|AAB69759.1| putative pectate lyase [Arabidopsis thaliana]
Length=459

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF+ NVIIH I V  IV G+GG+IRD   H GLRT+SDGDGIS+ G++++W+DH
Sbjct  208  GAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEAHIGLRTKSDGDGISLIGATNIWIDH  267

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK MQI
Sbjct  268  VSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQI  317



>ref|XP_008221658.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=443

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA IT+QF+KNVII  I +  I    GGMIRD VDH+G RT+SDGDGISI+GSS++W+DH
Sbjct  198  GACITIQFVKNVIITNIHIKQIKAKEGGMIRDSVDHFGQRTKSDGDGISIYGSSNIWIDH  257

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLID I  ST ITISN HFT HN+VMLFGA++   +DK+MQI
Sbjct  258  VSMENCTDGLIDVIMGSTGITISNSHFTKHNEVMLFGASNSYTQDKMMQI  307



>ref|XP_007224275.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
 gb|EMJ25474.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
Length=443

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KNVII  + +  I    GG+IRD VDH+G RT+SDGDGISIFGSS++W+DH
Sbjct  198  GAGITIQFVKNVIITNLHIKQIKAKEGGIIRDSVDHFGQRTKSDGDGISIFGSSNIWIDH  257

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDAI  ST ITISN HFT HN+V+LFGA++   +DK+MQI
Sbjct  258  VSMENCTDGLIDAIMGSTGITISNCHFTKHNEVLLFGASNSYTQDKMMQI  307



>emb|CDX74293.1| BnaA03g27540D [Brassica napus]
Length=471

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q+++N+IIHG+ VH IV GSGGMIR+  DH+G R ++DGDGISIFG++++W+DH
Sbjct  224  GAGITMQYVRNIIIHGLHVHHIVPGSGGMIRNSNDHFGFRGQADGDGISIFGATNIWLDH  283

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+
Sbjct  284  ISMSKCQDGLIDAIMGSTGITISNSHFTHHNDVMLLGAQNDNHADKKMQV  333



>emb|CDX91953.1| BnaC03g32550D [Brassica napus]
Length=471

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q+++N+IIHG+ VH IV GSGGMIR+  DH+G R ++DGDGISIFG++++W+DH
Sbjct  224  GAGITMQYVRNIIIHGLHVHHIVPGSGGMIRNSNDHFGFRGQADGDGISIFGATNIWLDH  283

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+
Sbjct  284  ISMSKCQDGLIDAIMGSTGITISNSHFTHHNDVMLLGAQNDNHADKKMQV  333



>ref|NP_001056786.1| Os06g0145100 [Oryza sativa Japonica Group]
 dbj|BAD68408.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAD68763.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAF18700.1| Os06g0145100 [Oryza sativa Japonica Group]
 gb|EAZ35810.1| hypothetical protein OsJ_20102 [Oryza sativa Japonica Group]
Length=348

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQ +++VIIH + +H  V   GGMIRD   HYGLRTRSDGDGISI  SS++W+DH
Sbjct  106  GAQITLQGVQHVIIHNVHIHHSVPHGGGMIRDSKRHYGLRTRSDGDGISIMSSSNIWIDH  165

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDA+  STAITISNGHFT H+ VMLFGA++   +D++MQI
Sbjct  166  VSMSNCSDGLIDAVSGSTAITISNGHFTKHDHVMLFGASNSDAQDEVMQI  215



>ref|NP_001056781.1| Os06g0144200 [Oryza sativa Japonica Group]
 dbj|BAF18695.1| Os06g0144200 [Oryza sativa Japonica Group]
Length=450

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQ +++VIIH + +H  V   GGMIRD   HYGLRTRSDGDGISI  SS++W+DH
Sbjct  208  GAQITLQGVQHVIIHNVHIHHSVPHGGGMIRDSKRHYGLRTRSDGDGISIMSSSNIWIDH  267

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDA+  STAITISNGHFT H+ VMLFGA++   +D++MQI
Sbjct  268  VSMSNCSDGLIDAVSGSTAITISNGHFTKHDHVMLFGASNSDAQDEVMQI  317



>ref|XP_010523445.1| PREDICTED: probable pectate lyase 3 [Tarenaya hassleriana]
Length=464

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+ NVIIH I + DIV G+GG+IRD   H+GLRTRSDGDGI+IFG+++VW+DH
Sbjct  213  GAGLTVQFVNNVIIHNIYIKDIVPGNGGLIRDSETHFGLRTRSDGDGINIFGATNVWIDH  272

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM +C DG+IDAI+ ST ITISN H TDH +VMLFGA D    D  MQI
Sbjct  273  VSMAHCSDGMIDAIQGSTGITISNCHLTDHGEVMLFGATDKDEIDTKMQI  322



>gb|EAY99626.1| hypothetical protein OsI_21605 [Oryza sativa Indica Group]
Length=441

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQ +++VIIH + +H  V   GGMIRD   HYGLRTRSDGDGISI  SS++W+DH
Sbjct  196  GAQITLQGVQHVIIHNVHIHHSVPHGGGMIRDSKRHYGLRTRSDGDGISIMSSSNIWIDH  255

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDA+  STAITISNGHFT H+ VMLFGA++   +D++MQI
Sbjct  256  VSMSNCSDGLIDAVSGSTAITISNGHFTKHDHVMLFGASNSDAQDEVMQI  305



>emb|CDY53552.1| BnaA09g57110D [Brassica napus]
Length=495

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G G+TLQF+ NVII+ I V  I+ G+GG+IRD  +H GLRT+SDGDGIS+FG+++VW+DH
Sbjct  201  GVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGLRTKSDGDGISLFGATNVWIDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DG+IDAIE STA+TISN HFTDH +VMLFGA D    DK MQI
Sbjct  261  VSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDKNMQI  310



>dbj|BAD68402.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
Length=438

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQ +++VIIH + +H  V   GGMIRD   HYGLRTRSDGDGISI  SS++W+DH
Sbjct  196  GAQITLQGVQHVIIHNVHIHHSVPHGGGMIRDSKRHYGLRTRSDGDGISIMSSSNIWIDH  255

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLIDA+  STAITISNGHFT H+ VMLFGA++   +D++MQI
Sbjct  256  VSMSNCSDGLIDAVSGSTAITISNGHFTKHDHVMLFGASNSDAQDEVMQI  305



>ref|XP_009114192.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF+KNVIIH I +  IV G+GGMIRD   H+G RT SDGDGI+IFGS++VW+DH
Sbjct  208  GAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEHHFGHRTTSDGDGINIFGSTNVWIDH  267

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DG+ID I  STAITISN H TDHN+VMLFGA +    DK MQI
Sbjct  268  VSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREEDVVDKKMQI  317



>ref|XP_003571658.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=432

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+Q   NVIIH + VHDI    GGM+RD  DH G RTR+DGDGIS+F +++VW+DH
Sbjct  187  GAGLTVQNRSNVIIHNLHVHDIKHTDGGMVRDSPDHIGYRTRADGDGISLFTATNVWIDH  246

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +S   C DGL+D +++STAITISN H T HNDVMLFGA+D  P DKIMQ+
Sbjct  247  ISTSMCEDGLVDIVQSSTAITISNCHLTSHNDVMLFGASDSYPDDKIMQV  296



>emb|CDX81636.1| BnaC08g39650D [Brassica napus]
Length=484

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T QF+ NVII+ I V  I+ G+GG+IRD  +H GLRT+SDGDGIS+FG+++VW+DH
Sbjct  201  GAGLTQQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGLRTKSDGDGISLFGATNVWIDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DG+IDAIE STA+TISN HFTDH +VMLFGA D    DK MQI
Sbjct  261  VSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDKNMQI  310



>ref|XP_010683249.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QFIKNVIIHG+ +H I  G GG+IRD  +H+GLRTRSDGD ISIFG+S++W+DH
Sbjct  199  GAGITIQFIKNVIIHGLHIHQIYPGDGGLIRDSANHFGLRTRSDGDAISIFGASNIWIDH  258

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM    DGLID I+ STAITISN H TDHN+V LFGA +    D+ MQ+
Sbjct  259  VSMARGTDGLIDIIQGSTAITISNCHMTDHNEVFLFGATNDYTDDQKMQV  308



>emb|CDY04133.1| BnaA09g19110D [Brassica napus]
 gb|AIS67292.1| pectate lyase-like protein 9 [Brassica rapa subsp. chinensis]
Length=459

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF+KNVIIH I +  IV G+GGMIRD   H+G RT SDGDGI+IFGS++VW+DH
Sbjct  208  GAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEHHFGHRTTSDGDGINIFGSTNVWIDH  267

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DG+ID I  STAITISN H TDHN+VMLFGA +    DK MQI
Sbjct  268  VSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREEDVIDKKMQI  317



>ref|XP_009110541.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF+ NVIIH I V  +V  SGG+IRD   H GLRT SDGDGIS+FG+++VW+DH
Sbjct  207  GAGLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQHIGLRTVSDGDGISLFGATNVWIDH  266

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DG+IDAI  STAITISN HFTDH +VMLFGAND    DK MQI
Sbjct  267  VSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKMQI  316



>ref|XP_010320663.1| PREDICTED: probable pectate lyase 3 [Solanum lycopersicum]
Length=386

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G G+TLQF+ NVI+H IRVH I+  +GGMIRD V H GLRT SDGD IS+FG++ +W+DH
Sbjct  210  GGGLTLQFVHNVIVHNIRVHHILSKNGGMIRDSVKHIGLRTVSDGDAISLFGANRIWIDH  269

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
             ++    DGL+DAI ASTAITISN  F  HNDVML GAND  P+DKIMQ+
Sbjct  270  CTLTKGADGLLDAIMASTAITISNCKFNHHNDVMLLGANDAFPQDKIMQV  319



>emb|CDX96854.1| BnaA08g23970D [Brassica napus]
Length=458

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF+ NVIIH I V  +V  SGG+IRD   H GLRT SDGDGIS+FG+++VW+DH
Sbjct  207  GAGLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQHIGLRTVSDGDGISLFGATNVWIDH  266

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DG+IDAI  STAITISN HFTDH +VMLFGAND    DK MQI
Sbjct  267  VSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKMQI  316



>ref|XP_010527872.1| PREDICTED: probable pectate lyase 3 isoform X2 [Tarenaya hassleriana]
Length=461

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG TLQF+ NVIIH I + +IV G+GG+IRD   H+GLRTRSDGDGI+IFG+++VW+DH
Sbjct  210  GAGFTLQFVNNVIIHNIYIKNIVPGNGGLIRDSETHFGLRTRSDGDGINIFGATNVWIDH  269

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM +C DG+IDAI+ ST ITISN H TDH +VMLFG  D    DK MQI
Sbjct  270  VSMSHCSDGMIDAIQGSTGITISNCHLTDHQEVMLFGGTDKDVIDKKMQI  319



>ref|XP_006363934.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=439

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+ NVIIH IR+ +I+  +GGMIRD V+H GLRT SDGDGISIFGS+ +W+DH
Sbjct  192  GAGLTIQFVHNVIIHNIRIQNIISTNGGMIRDSVNHIGLRTVSDGDGISIFGSNHIWIDH  251

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
             ++  C DGL+DAI ASTAITISN  F  HNDVML GA D  P+D IMQ+
Sbjct  252  CTLSECTDGLVDAIMASTAITISNCKFNHHNDVMLLGATDAFPQDSIMQV  301



>gb|EAY99621.1| hypothetical protein OsI_21600 [Oryza sativa Indica Group]
Length=448

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA IT+Q + NVIIH + +H+ V  SGG+IRD + H+G+R  SDGDGIS+ GSS++W+DH
Sbjct  203  GAQITVQAVSNVIIHNLHIHNSVPRSGGLIRDSMHHFGIRGESDGDGISVMGSSNIWIDH  262

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLID  + STAITISN HFT H+ VMLFGA+D SPKDKIMQ+
Sbjct  263  VSMSNCSDGLIDITDGSTAITISNSHFTKHDHVMLFGASDDSPKDKIMQV  312



>ref|XP_006306515.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
 gb|EOA39413.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
Length=455

 Score =   124 bits (310),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+Q++ NVIIH I V  IV G+GG+IRD   H GLRT+SDGDGIS+FG++++W+DH
Sbjct  204  GAGLTMQYVNNVIIHSIYVKHIVPGNGGLIRDSEHHVGLRTKSDGDGISLFGATNIWIDH  263

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK MQI
Sbjct  264  VSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQI  313



>gb|KHG05193.1| hypothetical protein F383_30875 [Gossypium arboreum]
Length=385

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G GITLQF+ NVIIH I +H +V+ SGG+IRD  DHYG RT  DGDGISIFGSS +W+DH
Sbjct  138  GCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGYRTVGDGDGISIFGSSKIWLDH  197

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI+ STAITISN HFT H+ V+L GA+D   KD+ MQ+
Sbjct  198  ISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSKDQYMQV  247



>ref|NP_001056784.1| Os06g0144900 [Oryza sativa Japonica Group]
 dbj|BAD68407.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAD68762.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAF18698.1| Os06g0144900 [Oryza sativa Japonica Group]
 gb|EAZ35811.1| hypothetical protein OsJ_20103 [Oryza sativa Japonica Group]
 dbj|BAG91996.1| unnamed protein product [Oryza sativa Japonica Group]
Length=448

 Score =   123 bits (309),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA IT+Q + NVIIH + +H+ V  SGG+IRD + H+G+R  SDGDGIS+ GSS++W+DH
Sbjct  203  GAQITVQAVSNVIIHNLHIHNSVPRSGGLIRDSMHHFGIRGESDGDGISVMGSSNIWIDH  262

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGLID  + STAITISN HFT H+ VMLFGA D SPKDKIMQ+
Sbjct  263  VSMSNCSDGLIDITDGSTAITISNSHFTKHDHVMLFGARDDSPKDKIMQV  312



>emb|CDY68729.1| BnaCnng60280D [Brassica napus]
Length=458

 Score =   123 bits (309),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF+ NVIIH I +  +V  SGG+IRD   H GLRT SDGDGIS+FG+++VW+DH
Sbjct  207  GAGLTLQFVNNVIIHNIYIKHVVPKSGGLIRDSEQHIGLRTVSDGDGISLFGATNVWIDH  266

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DG+IDAI  STAITISN HFTDH +VMLFGAND    DK MQI
Sbjct  267  VSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKMQI  316



>dbj|BAH20311.1| AT3G01270 [Arabidopsis thaliana]
Length=365

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q++ N+IIHG+ VH IV+ SGG+IRD ++H+G R  +DGDGISIFG++++W+DH
Sbjct  118  GAGITMQYVHNIIIHGLHVHHIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDH  177

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+
Sbjct  178  ISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDKKMQV  227



>gb|KHG23093.1| hypothetical protein F383_29772 [Gossypium arboreum]
Length=385

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G GITLQF+ NVIIH I +H +V+ SGG+IRD  DHYG RT  DGDGISIFGSS +W+DH
Sbjct  138  GCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGFRTVGDGDGISIFGSSKIWLDH  197

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI+ STAITISN HFT H+ V+L GA+D   +D+ MQ+
Sbjct  198  ISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSRDQFMQV  247



>ref|XP_009117903.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=452

 Score =   123 bits (309),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G G+TLQF+ NVII+ I V  I+ G+GG+IRD  +H G+RT+SDGDGIS+FG+++VW+DH
Sbjct  201  GVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGIRTKSDGDGISLFGATNVWIDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DG+IDAIE STA+TISN HFTDH +VMLFGA D    DK MQI
Sbjct  261  VSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDKNMQI  310



>emb|CDY17432.1| BnaC09g21050D [Brassica napus]
Length=459

 Score =   123 bits (309),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF+KNVIIH I +  I+ G+GGMIRD   H+G RT SDGDGI+IFGS++VW+DH
Sbjct  208  GAGLTLQFVKNVIIHNIHIKTIIPGNGGMIRDSEHHFGHRTTSDGDGINIFGSTNVWIDH  267

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DG+ID I  STAITISN H TDHN+VMLFGA +    DK MQI
Sbjct  268  VSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREEDVIDKKMQI  317



>gb|AAM60924.1| putative pectate lyase [Arabidopsis thaliana]
Length=475

 Score =   123 bits (309),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q++ N+IIHG+ VH IV+ SGG+IRD ++H+G R  +DGDGISIFG++++W+DH
Sbjct  228  GAGITMQYVHNIIIHGLHVHHIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDH  287

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+
Sbjct  288  ISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDKKMQV  337



>ref|NP_186776.1| putative pectate lyase 7 [Arabidopsis thaliana]
 sp|Q9SRH4.1|PLY7_ARATH RecName: Full=Probable pectate lyase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF03499.1|AC010676_9 putative pectate lyase [Arabidopsis thaliana]
 gb|AAF26147.1|AC008261_4 putative pectate lyase [Arabidopsis thaliana]
 gb|ABI93918.1| At3g01270 [Arabidopsis thaliana]
 gb|AEE73631.1| putative pectate lyase 7 [Arabidopsis thaliana]
Length=475

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q++ N+IIHG+ VH IV+ SGG+IRD ++H+G R  +DGDGISIFG++++W+DH
Sbjct  228  GAGITMQYVHNIIIHGLHVHHIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDH  287

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+
Sbjct  288  ISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDKKMQV  337



>gb|KEH24975.1| pectate lyase P59-like protein [Medicago truncatula]
Length=453

 Score =   123 bits (308),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+ NVIIHG+ + +I    GG+IRD  DH G RTRSDGD ISI+GSS++W+DH
Sbjct  207  GAGITMQFVNNVIIHGLHIQNIKAKPGGLIRDSFDHTGQRTRSDGDAISIYGSSNIWIDH  266

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +S+  C DGL+D I+ ST ITISN H T HNDVMLFGA+D    DK+MQI
Sbjct  267  LSLSECEDGLVDIIQGSTGITISNCHMTKHNDVMLFGASDSYTGDKLMQI  316



>ref|XP_006655782.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=351

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQ +++VI+H + +H      GGMIRD   HYG RTRSDGDGIS+  SS+VW+DH
Sbjct  106  GAQITLQGVQHVIVHNVHIHHSAPHGGGMIRDSKRHYGRRTRSDGDGISVMSSSNVWIDH  165

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM NC DGL+D +  STAITISNGHFT H+ VMLFGA++  P+D++MQI
Sbjct  166  VSMSNCSDGLVDVVSGSTAITISNGHFTKHDHVMLFGASNSDPQDRVMQI  215



>ref|XP_010683248.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF++N+IIHGI+  +IV   GG+IRD + H+GLRT SDGD ISIFGS  +W+DH
Sbjct  200  GAGITIQFVENIIIHGIKFRNIVPRPGGLIRDSLTHFGLRTPSDGDAISIFGSHHIWIDH  259

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
             S   CYDGLID I+ STAITISN H TDH+ V LFGA+D   +D+ MQI
Sbjct  260  CSFSRCYDGLIDVIKGSTAITISNCHMTDHDKVFLFGASDQHSEDRKMQI  309



>ref|XP_007032453.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY03379.1| Pectate lyase family protein [Theobroma cacao]
Length=454

 Score =   122 bits (307),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 74/110 (67%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGITLQF+ NVIIH + +H I + SGG+IRD VDHYG RT  DGDGISIFGS+++W+DH
Sbjct  207  GAGITLQFVDNVIIHNLHIHHIRKSSGGLIRDSVDHYGFRTVGDGDGISIFGSTNIWLDH  266

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI+ STAITISN HFT HNDV+L GA+D   +DK+MQ+
Sbjct  267  LSMSECEDGLIDAIQGSTAITISNCHFTHHNDVILLGASDSYSRDKLMQV  316



>ref|XP_006656188.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=446

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA +T+Q   NVIIH I VHDIV G GGMIRD  +H+G RT+SDGDGI+IFGS++VW+DH
Sbjct  201  GAQVTVQNSNNVIIHNIHVHDIVLGKGGMIRDSPEHFGFRTQSDGDGITIFGSTNVWLDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +S+ NC DGLID I  ST +TISN H T+HNDVMLFG++D   +D+IMQI
Sbjct  261  LSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFGSSDSFSEDQIMQI  310



>ref|XP_009134622.1| PREDICTED: probable pectate lyase 7 [Brassica rapa]
Length=471

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q+++N+IIHG+ VH IV GSGGMIR+  DH+G R ++DGDGIS+FG++++W+DH
Sbjct  224  GAGITMQYVRNIIIHGLHVHHIVPGSGGMIRNSNDHFGFRGQADGDGISLFGATNIWLDH  283

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  S  IT+SN HFT HNDVML GA + +  DK MQ+
Sbjct  284  ISMSKCQDGLIDAIMGSPGITLSNSHFTHHNDVMLLGAQNDNHADKKMQV  333



>ref|XP_006292606.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
 gb|EOA25504.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
Length=455

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF++NVIIH I +  I +G+GG+IRD   H+GLRT SDGDGI+IFG+++VW+DH
Sbjct  204  GAGLTLQFVRNVIIHNIYIKQIKKGAGGLIRDSEHHFGLRTVSDGDGINIFGATNVWIDH  263

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM +C DG+IDAI  STAITISN HFTDH++VMLFG  +    DK MQI
Sbjct  264  VSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGTNKDVIDKKMQI  313



>ref|XP_004298448.1| PREDICTED: probable pectate lyase 3-like [Fragaria vesca subsp. 
vesca]
Length=443

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G GITLQ++ NVII  I+V DI    GGM+RD  DH GLRTRSDGDGIS+F +S++W+DH
Sbjct  198  GGGITLQYVNNVIITNIKVKDIQSLPGGMLRDAEDHVGLRTRSDGDGISLFSASNIWIDH  257

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM    DGLID I  STA+TISNGHFTDHN+ MLFGA +   +DK MQI
Sbjct  258  VSMARTADGLIDCIMGSTAVTISNGHFTDHNEAMLFGAKNTHTQDKNMQI  307



>ref|XP_006477525.1| PREDICTED: pectate lyase-like [Citrus sinensis]
Length=437

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA IT+QF+KN+IIHG+ +     G GGMIRD V HYG R+ SDGDGIS+FG+S +W+DH
Sbjct  193  GAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHYGFRSSSDGDGISMFGASHIWIDH  252

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLIDA+  STAIT+SN HFT  + VML GA+D  P+D IMQ+
Sbjct  253  VSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDGHPQDSIMQV  302



>ref|XP_010425041.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQ+++NVIIH I +  I +G GG+IRD   H+GLRT SDGDGISIFG+++VW+DH
Sbjct  202  GAGLTLQYVRNVIIHNIYIKQIKKGPGGLIRDSEHHFGLRTMSDGDGISIFGATNVWIDH  261

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM +C DG+IDAI  STAITISN HFTDH++VMLFG  +    DK MQI
Sbjct  262  VSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDKKMQI  311



>ref|XP_004489374.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=447

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G GIT+QF+ NVIIHG+ + +I    G MIRD  +H G RTRSDGD +SIFGSS++W+DH
Sbjct  201  GGGITMQFVNNVIIHGLHISNIKSKPGAMIRDSYNHVGQRTRSDGDALSIFGSSNIWIDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VS+  C DGLID I+ STAITISN H T HNDVMLFGA+D    DK+MQI
Sbjct  261  VSLSQCEDGLIDVIQGSTAITISNCHMTKHNDVMLFGASDTYNGDKLMQI  310



>ref|XP_010502279.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQ+++NVIIH I +  I +G GG+IRD   H+GLRT SDGDGI+IFG+++VW+DH
Sbjct  202  GAGLTLQYVRNVIIHNIYIKQIKRGPGGLIRDSEHHFGLRTMSDGDGINIFGATNVWIDH  261

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM +C DG+IDAI  STAITISN HFTDH++VMLFG  +    DK MQI
Sbjct  262  VSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDKKMQI  311



>ref|XP_010514040.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQ+++NVIIH I +  I +G GG+IRD   H+GLRT SDGDGISIFG++++W+DH
Sbjct  202  GAGLTLQYVRNVIIHNIYIKQIKKGPGGLIRDSEHHFGLRTMSDGDGISIFGATNIWIDH  261

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM +C DG+IDAI  STAITISN HFTDH++VMLFG  +    DK MQI
Sbjct  262  VSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDKKMQI  311



>ref|XP_004228388.1| PREDICTED: pectate lyase [Solanum lycopersicum]
Length=439

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+ +QF+ NVIIH IR+ +I+  +GGMIRD ++H GLRT SDGDGISIFGS+ +W+DH
Sbjct  192  GAGLMIQFVHNVIIHNIRIQNIISTNGGMIRDSINHIGLRTVSDGDGISIFGSNHIWIDH  251

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
             ++  C DGLIDAI ASTAITISN  F  HNDVML GA D  P+D IMQ+
Sbjct  252  CTLSECTDGLIDAIMASTAITISNCKFNYHNDVMLLGATDAFPQDAIMQV  301



>ref|XP_003563707.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=448

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA +T+Q+  NVIIH I ++D++ G GGMIRD   H+G RT+SDGDG+++FGS+ VW+DH
Sbjct  203  GAQVTVQYAHNVIIHNIHINDLIVGKGGMIRDSPAHFGFRTQSDGDGVNVFGSTSVWLDH  262

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +S+  C DGLID I  ST +TISN H T+HNDVMLFG++D +PKD IMQI
Sbjct  263  LSLATCQDGLIDVIAESTGVTISNCHLTNHNDVMLFGSSDSNPKDVIMQI  312



>ref|XP_003609009.1| Pectate lyase [Medicago truncatula]
Length=445

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 87/121 (72%), Gaps = 11/121 (9%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQ++KN+IIHG+ +HD  + SGG IRD +DHYG R+ SDGD IS+FG+S VW+DH
Sbjct  191  GAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDGDAISMFGASHVWIDH  250

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHND-----------VMLFGANDFSPKDKIMQ  328
            +SM NC DGL+DA+  STAITISN H T HND           VMLFGAND    D+I Q
Sbjct  251  ISMWNCADGLVDAVAGSTAITISNCHMTRHNDVINNISSTYSFVMLFGANDGFSGDQISQ  310

Query  329  I  331
            I
Sbjct  311  I  311



>ref|XP_002437815.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
 gb|EER89182.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
Length=444

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA +TLQ + +VI+H + +HD V  SGGMIRD   H G+RTRSDGDGIS+  SS+VW+DH
Sbjct  199  GAQVTLQSVHDVILHNLHIHDAVAHSGGMIRDSKRHTGMRTRSDGDGISVLSSSNVWIDH  258

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLID +  STAIT+SN HFT H+ VMLFGA++ +P+D++MQI
Sbjct  259  VSMSRCADGLIDVVNGSTAITVSNSHFTHHDHVMLFGASNDNPQDEVMQI  308



>ref|XP_006439649.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
 gb|ESR52889.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
Length=437

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA IT+QF+KN+IIHG+ +     G GGMIRD V H+G R+ SDGDGIS+FG+S +W+DH
Sbjct  193  GAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHHGFRSSSDGDGISMFGASHIWIDH  252

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLIDA+  STAIT+SN HFT  + VML GA+D  P+D IMQ+
Sbjct  253  VSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDSHPQDSIMQV  302



>ref|XP_002436463.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
 gb|EER87830.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
Length=465

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQ ++NVI+H + +HD     GG+IRD   H+GLR  SDGDG+S+ GSSD+W+DH
Sbjct  220  GAQITLQNVRNVILHNLHIHDAAPRGGGVIRDSKHHWGLRGESDGDGVSVMGSSDIWIDH  279

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMR+C DGL+D ++ STA+TISNGHFT H+ VMLFGA+D + KDK MQ+
Sbjct  280  VSMRSCADGLVDVVDGSTAVTISNGHFTRHDHVMLFGASDAAVKDKAMQV  329



>ref|XP_007139601.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
 gb|ESW11595.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
Length=444

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            G+G+T+QF+ NVIIHG+R+ +I    GG IRD  +H G+RT++DGD ISIFGSS++W+DH
Sbjct  198  GSGLTMQFVNNVIIHGLRLQNIKSTPGGTIRDSWNHVGIRTKADGDAISIFGSSNIWIDH  257

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +S+ +C DGL+D I+ ST ITISN H T HNDVMLFGA+D    DKIMQ+
Sbjct  258  LSLSDCEDGLVDIIQGSTGITISNCHMTKHNDVMLFGASDTFTGDKIMQV  307



>gb|KDO76053.1| hypothetical protein CISIN_1g013757mg [Citrus sinensis]
Length=437

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA IT+QF+KN+IIHG+ +     G GGMIRD V H+G R+ SDGDGIS+FG+S +W+DH
Sbjct  193  GAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHHGFRSSSDGDGISMFGASHIWIDH  252

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLIDA+  STAIT+SN HFT  + VML GA+D  P+D IMQ+
Sbjct  253  VSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDGHPQDSIMQV  302



>gb|EMS65801.1| hypothetical protein TRIUR3_32637 [Triticum urartu]
Length=273

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA +TLQ +++VIIH + +H  V  SGGMIRD   HYG RTRSDGDG+SI  SS VW+DH
Sbjct  28   GAQMTLQGVRHVIIHNVHIHHSVPHSGGMIRDSKHHYGRRTRSDGDGVSILSSSSVWIDH  87

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM +C DGLID +  STAIT+SN HFT H+ VMLFGA++   +D++MQ+
Sbjct  88   VSMSSCADGLIDVVSGSTAITVSNSHFTKHDHVMLFGASNTEEQDRMMQV  137



>gb|KFK25747.1| hypothetical protein AALP_AA8G154300 [Arabis alpina]
Length=504

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF++NVIIHG+ +H I + SGGMIRD VDHYG+RTR+DGDG+SI+GSS++W+DH
Sbjct  257  GAGITMQFVRNVIIHGLHIHHISESSGGMIRDSVDHYGMRTRADGDGLSIYGSSNIWLDH  316

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + + +DK MQ+
Sbjct  317  ISMSKCQDGLIDAICGSTGITISNSHFTHHNDVMLLGAQNTNEEDKKMQV  366



>ref|NP_178375.1| putative pectate lyase 6 [Arabidopsis thaliana]
 sp|O64510.1|PLY6_ARATH RecName: Full=Probable pectate lyase 6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC05350.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAO64162.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAV34776.1| At2g02720 [Arabidopsis thaliana]
 gb|AEC05615.1| putative pectate lyase 6 [Arabidopsis thaliana]
Length=455

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+TLQF++NVIIH I +  I +G+GG+I D   H+GLRT SDGDGI+IFG+++VW+DH
Sbjct  204  GAGLTLQFVRNVIIHNIHIKQIKRGAGGLIIDSEQHFGLRTVSDGDGINIFGATNVWIDH  263

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM +C DG+IDAI  STAITISN HFTDH++VMLFG  +    DK MQI
Sbjct  264  VSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGTNKDVIDKKMQI  313



>gb|EMS45831.1| Pectate lyase [Triticum urartu]
Length=540

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA +T+Q+  NVIIH I V+D++ G GG IRD   H G RT+SDGDG+S+FGS+DVW+DH
Sbjct  201  GAQVTVQYAHNVIIHNIHVNDLIVGKGGRIRDSPQHAGFRTQSDGDGVSVFGSTDVWLDH  260

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +S+  C DGLID I+ ST +TISN H T+HNDVMLFG++D +PKD+IMQI
Sbjct  261  LSLATCQDGLIDVIDQSTGVTISNCHLTNHNDVMLFGSSDSNPKDEIMQI  310



>ref|XP_010322971.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=302

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA + LQ+I NVIIHG+ +HDI  G+GG+IRD ++HYG RT+SDGDGISI+GS+++W+DH
Sbjct  209  GASLMLQYINNVIIHGLHIHDIKAGNGGLIRDSINHYGFRTKSDGDGISIYGSTNIWIDH  268

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDV  280
            VSM NC DGLIDA++ASTAITISN HFT HNDV
Sbjct  269  VSMSNCDDGLIDAVQASTAITISNCHFTHHNDV  301



>gb|KGN47799.1| hypothetical protein Csa_6G404140 [Cucumis sativus]
Length=415

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAG+T+QF+ NVIIH + +HDIV  SGGMIRD VDHYG RT+SDGDGISIFGSS VW+DH
Sbjct  187  GAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRTQSDGDGISIFGSSHVWIDH  246

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHND  277
            VSM NC DGLIDAI  STAITISN HFT HN+
Sbjct  247  VSMSNCQDGLIDAIMGSTAITISNCHFTHHNE  278



>ref|XP_004302354.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF++NVIIHGI +HDIV   GG+IRD +DH GLR +SDGDGI++FGSS +W+DH
Sbjct  199  GAGITIQFVENVIIHGIHIHDIVSVGGGLIRDSLDHIGLRGQSDGDGITVFGSSHIWLDH  258

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM NCYDGL D ++ STAITISN HFT HNDVMLFGAND   +D+IMQI
Sbjct  259  LSMWNCYDGLTDVVQGSTAITISNCHFTRHNDVMLFGANDLYERDQIMQI  308



>gb|AGT16685.1| pectate lyase precursor [Saccharum hybrid cultivar R570]
Length=326

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQ + NVI+H + +HD V   GG+IRD   H G+R  SDGDGIS+ GSSD+W+DH
Sbjct  81   GAQITLQNVHNVILHNLHIHDAVPRGGGVIRDSKHHSGVRGESDGDGISVMGSSDIWIDH  140

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSMR+C DGL+D ++ STA+TISNGHFT H+ VMLFGA+D + KDK+MQ+
Sbjct  141  VSMRSCADGLVDVVDGSTAVTISNGHFTKHDHVMLFGASDSAVKDKLMQV  190



>ref|XP_006286712.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
 gb|EOA19610.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
Length=512

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF++NVIIHG+ +H I + SGGMIRD VDH+G+RTR+DGDGISI+GSS +W+DH
Sbjct  265  GAGITMQFVRNVIIHGLHIHHIFESSGGMIRDSVDHFGMRTRADGDGISIYGSSKIWLDH  324

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+
Sbjct  325  ISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNTNEADKHMQV  374



>ref|XP_004964534.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=438

 Score =   117 bits (294),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA ITLQ + +VIIH + +H     SGG+IRD   HYGLRTRSDGDGIS+  SS+VW+DH
Sbjct  193  GAQITLQSVSHVIIHNVHIHHSAPHSGGIIRDSKRHYGLRTRSDGDGISVLSSSNVWIDH  252

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            VSM  C DGLID +  ST IT+SN HFT H+ VMLFGA++ +P+D++MQ+
Sbjct  253  VSMYRCSDGLIDVVNGSTGITVSNSHFTKHDHVMLFGASNDNPQDRMMQV  302



>ref|XP_010453638.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=490

 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KNVIIHG+ +H I + SGGMIRD VDH+G+RTR+DGDG+SI+GSS++W+DH
Sbjct  243  GAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDH  302

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+
Sbjct  303  ISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQV  352



>ref|XP_010420163.1| PREDICTED: probable pectate lyase 19 isoform X1 [Camelina sativa]
Length=499

 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KNVIIHG+ +H I + SGGMIRD VDH+G+RTR+DGDG+SI+GSS++W+DH
Sbjct  252  GAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDH  311

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+
Sbjct  312  ISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQV  361



>dbj|BAK06965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   117 bits (294),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GA +T+Q+  NVIIH I V+D++ G GG IRD   H G RT+SDGDG+S+FGS++VW+DH
Sbjct  199  GAQVTVQYSHNVIIHNIHVNDLIVGKGGRIRDSPQHAGFRTQSDGDGVSVFGSTNVWLDH  258

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +S+  C DGLID I  +T +TISN H T+HNDVMLFG++D +PKD+IMQ+
Sbjct  259  LSLATCQDGLIDVIAEATGVTISNCHLTNHNDVMLFGSSDSNPKDQIMQV  308



>ref|XP_002871648.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47907.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KNVIIHG+ +H I + SGGMIRD VDH+G+RTR+DGDG+SI+GSS++W+DH
Sbjct  225  GAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDH  284

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+
Sbjct  285  ISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQV  334



>ref|XP_010420164.1| PREDICTED: probable pectate lyase 19 isoform X2 [Camelina sativa]
Length=472

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+QF+KNVIIHG+ +H I + SGGMIRD VDH+G+RTR+DGDG+SI+GSS++W+DH
Sbjct  225  GAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDH  284

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+
Sbjct  285  ISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQV  334



>gb|KHG08055.1| putative pectate lyase P59 [Gossypium arboreum]
 gb|KHG08558.1| putative pectate lyase P59 [Gossypium arboreum]
Length=440

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    GAGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDH  181
            GAGIT+Q+++NVIIHG+ +H IV G+GGMIRD V+HYG RT+SDGDGIS+FG+++VW+DH
Sbjct  194  GAGITIQYVRNVIIHGLHIHHIVPGNGGMIRDSVNHYGFRTKSDGDGISLFGATNVWLDH  253

Query  182  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            +SM  C DGLIDAI+ STAITISN HFT H+ VMLFGAND    D+ MQI
Sbjct  254  LSMYKCRDGLIDAIQGSTAITISNCHFTHHDQVMLFGANDNHKMDEKMQI  303



>gb|AGT16687.1| pectate lyase [Saccharum hybrid cultivar R570]
Length=441

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    AGITLQFIKNVIIHGIRVHDIVQGSGGMIRDGVDHYGLRTRsdgdgisifgssdVWVDHV  184
            A ITLQ + +VI+H + +HD    SGGMIRD   H GLRTRSDGDGIS+  SS+VW+DHV
Sbjct  197  AQITLQNVHDVILHNLHIHDAKAHSGGMIRDSKRHTGLRTRSDGDGISVLSSSNVWIDHV  256

Query  185  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDFSPKDKIMQI  331
            SM +C DGLID +  STAIT+SN HFT H+ VMLFGA++ +P+D++MQI
Sbjct  257  SMSSCADGLIDVVNGSTAITVSNSHFTRHDHVMLFGASNDNPQDEVMQI  305



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 532108045568