BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14595_g1_i1 len=696 path=[942:0-695]

Length=696
                                                                      Score     E

ref|XP_004234779.1|  PREDICTED: probable pectate lyase P59              253   6e-78   
gb|AAB69758.1|  putative pectate lyase Nt59                             246   2e-77   Nicotiana tabacum [American tobacco]
sp|P15722.1|PLY59_SOLLC  RecName: Full=Probable pectate lyase P59...    251   4e-77   Solanum lycopersicum
ref|XP_006361835.1|  PREDICTED: probable pectate lyase P59-like         250   9e-77   
ref|XP_009587689.1|  PREDICTED: probable pectate lyase P59              249   1e-76   
ref|XP_009789921.1|  PREDICTED: probable pectate lyase P59              248   4e-76   
ref|XP_009779191.1|  PREDICTED: probable pectate lyase P59              246   4e-75   
ref|XP_009599826.1|  PREDICTED: probable pectate lyase P59 isofor...    244   9e-75   
ref|XP_009599825.1|  PREDICTED: probable pectate lyase P59 isofor...    244   1e-74   
ref|XP_011098575.1|  PREDICTED: probable pectate lyase P59              242   1e-73   
ref|XP_007032453.1|  Pectate lyase family protein                       237   9e-72   
ref|XP_009617495.1|  PREDICTED: probable pectate lyase P59              236   4e-71   
gb|KHG16093.1|  hypothetical protein F383_07683                         235   5e-71   
ref|XP_006338480.1|  PREDICTED: probable pectate lyase P59-like         234   1e-70   
ref|XP_006357122.1|  PREDICTED: probable pectate lyase P59-like         234   2e-70   
ref|XP_004232242.1|  PREDICTED: probable pectate lyase P59              233   2e-70   
ref|XP_010256490.1|  PREDICTED: pectate lyase-like                      233   3e-70   
ref|XP_010066949.1|  PREDICTED: pectate lyase                           232   7e-70   
gb|KCW52797.1|  hypothetical protein EUGRSUZ_J02132                     232   9e-70   
ref|XP_009802165.1|  PREDICTED: probable pectate lyase P59              231   3e-69   
ref|XP_010033216.1|  PREDICTED: pectate lyase-like                      230   3e-69   
ref|XP_011025954.1|  PREDICTED: probable pectate lyase P59              227   5e-68   
ref|XP_010242445.1|  PREDICTED: pectate lyase                           227   6e-68   
ref|XP_011005067.1|  PREDICTED: probable pectate lyase P59              226   1e-67   
ref|XP_007046218.1|  Pectate lyase family protein, putative             226   2e-67   
ref|XP_002323835.1|  hypothetical protein POPTR_0017s11450g             225   3e-67   Populus trichocarpa [western balsam poplar]
ref|XP_010112093.1|  putative pectate lyase 7                           224   4e-67   
gb|KHN13652.1|  Pectate lyase                                           224   6e-67   
ref|XP_003552513.1|  PREDICTED: pectate lyase-like                      224   7e-67   
gb|EPS66620.1|  hypothetical protein M569_08154                         224   8e-67   
ref|XP_008357758.1|  PREDICTED: pectate lyase-like                      224   1e-66   
ref|XP_011085777.1|  PREDICTED: probable pectate lyase P59              222   4e-66   
emb|CDP14850.1|  unnamed protein product                                221   6e-66   
ref|XP_002311599.2|  pectate lyase family protein                       221   7e-66   Populus trichocarpa [western balsam poplar]
emb|CDP02198.1|  unnamed protein product                                222   1e-65   
ref|XP_004152537.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    220   2e-65   
ref|XP_011085780.1|  PREDICTED: probable pectate lyase P59              220   2e-65   
gb|EYU34111.1|  hypothetical protein MIMGU_mgv1a006386mg                220   3e-65   
ref|XP_004165454.1|  PREDICTED: pectate lyase-like                      220   3e-65   
emb|CAN79927.1|  hypothetical protein VITISV_042447                     219   4e-65   Vitis vinifera
ref|XP_002282500.3|  PREDICTED: pectate lyase                           219   4e-65   Vitis vinifera
ref|XP_009342871.1|  PREDICTED: pectate lyase-like                      219   5e-65   
ref|XP_002270089.1|  PREDICTED: pectate lyase                           219   5e-65   Vitis vinifera
emb|CAN69905.1|  hypothetical protein VITISV_001007                     217   6e-65   Vitis vinifera
gb|KHG08055.1|  putative pectate lyase P59                              219   7e-65   
emb|CBI22159.3|  unnamed protein product                                219   8e-65   
ref|XP_008341537.1|  PREDICTED: pectate lyase-like                      218   2e-64   
gb|KHG07401.1|  putative pectate lyase P59                              217   4e-64   
gb|KGN59593.1|  hypothetical protein Csa_3G827350                       216   6e-64   
ref|XP_004147462.1|  PREDICTED: probable pectate lyase 7-like           216   1e-63   
gb|EYU36839.1|  hypothetical protein MIMGU_mgv1a006379mg                215   2e-63   
ref|XP_008443432.1|  PREDICTED: probable pectate lyase 19               215   2e-63   
ref|XP_002520133.1|  Pectate lyase precursor, putative                  215   3e-63   Ricinus communis
ref|XP_011087217.1|  PREDICTED: pectate lyase-like                      213   1e-62   
ref|XP_002306040.1|  hypothetical protein POPTR_0004s12300g             211   4e-62   Populus trichocarpa [western balsam poplar]
ref|XP_011009454.1|  PREDICTED: pectate lyase-like                      212   5e-62   
ref|XP_009369346.1|  PREDICTED: pectate lyase-like                      211   5e-62   
ref|XP_002270112.1|  PREDICTED: pectate lyase                           211   1e-61   Vitis vinifera
ref|XP_007037229.1|  Pectate lyase family protein                       211   1e-61   
emb|CAN69904.1|  hypothetical protein VITISV_001006                     211   1e-61   Vitis vinifera
ref|XP_010096345.1|  putative pectate lyase 7                           209   2e-61   
ref|XP_006374492.1|  hypothetical protein POPTR_0015s07590g             209   3e-61   
ref|XP_007139601.1|  hypothetical protein PHAVU_008G043600g             208   7e-61   
gb|KHN08855.1|  Putative pectate lyase P59                              208   1e-60   
ref|XP_008374522.1|  PREDICTED: pectate lyase-like                      208   1e-60   
ref|XP_006477525.1|  PREDICTED: pectate lyase-like                      206   4e-60   
gb|KDO76053.1|  hypothetical protein CISIN_1g013757mg                   205   1e-59   
ref|XP_006439649.1|  hypothetical protein CICLE_v10020193mg             205   1e-59   
ref|XP_007227702.1|  hypothetical protein PRUPE_ppa005744mg             204   2e-59   
ref|XP_011098576.1|  PREDICTED: probable pectate lyase P56              205   3e-59   
ref|XP_010527872.1|  PREDICTED: probable pectate lyase 3 isoform X2     204   3e-59   
ref|XP_011013803.1|  PREDICTED: pectate lyase-like                      203   4e-59   
ref|XP_010105747.1|  putative pectate lyase P59                         202   1e-58   
ref|XP_007209148.1|  hypothetical protein PRUPE_ppa005859mg             202   1e-58   
ref|XP_006306515.1|  hypothetical protein CARUB_v10012514mg             202   2e-58   
gb|KDP45476.1|  hypothetical protein JCGZ_09725                         202   2e-58   
ref|XP_002517472.1|  pectate lyase, putative                            202   2e-58   Ricinus communis
ref|XP_008239834.1|  PREDICTED: pectate lyase-like                      201   3e-58   
ref|XP_010322971.1|  PREDICTED: probable pectate lyase P59              197   3e-58   
ref|XP_010523445.1|  PREDICTED: probable pectate lyase 3                202   4e-58   
ref|XP_006484673.1|  PREDICTED: probable pectate lyase 19-like          201   6e-58   
ref|XP_002511525.1|  Pectate lyase precursor, putative                  201   6e-58   Ricinus communis
ref|XP_010496063.1|  PREDICTED: probable pectate lyase 3                201   6e-58   
ref|XP_007138209.1|  hypothetical protein PHAVU_009G189800g             200   7e-58   
gb|KDO49230.1|  hypothetical protein CISIN_1g036607mg                   200   7e-58   
ref|XP_010476496.1|  PREDICTED: probable pectate lyase 3                201   1e-57   
gb|AES91206.2|  pectate lyase P59-like protein                          199   2e-57   
ref|XP_003609009.1|  Pectate lyase                                      199   2e-57   
gb|EYU22437.1|  hypothetical protein MIMGU_mgv1a006496mg                199   2e-57   
gb|KFK33456.1|  hypothetical protein AALP_AA5G015800                    199   3e-57   
ref|XP_010068708.1|  PREDICTED: pectate lyase-like                      199   3e-57   
ref|XP_003530685.1|  PREDICTED: probable pectate lyase 3-like           199   5e-57   
ref|XP_003554335.1|  PREDICTED: pectate lyase-like                      198   6e-57   
ref|XP_004489374.1|  PREDICTED: pectate lyase-like                      198   6e-57   
ref|XP_004508770.1|  PREDICTED: probable pectate lyase P59-like         198   7e-57   
ref|XP_006482544.1|  PREDICTED: probable pectate lyase 19-like          197   8e-57   
ref|XP_006431087.1|  hypothetical protein CICLE_v10011762mg             197   8e-57   
ref|XP_006842121.1|  hypothetical protein AMTR_s00078p00106380          197   8e-57   
ref|XP_009381244.1|  PREDICTED: pectate lyase-like                      197   9e-57   
emb|CBI15265.3|  unnamed protein product                                196   1e-56   
ref|XP_006428983.1|  hypothetical protein CICLE_v10013750mg             197   1e-56   
ref|XP_006480843.1|  PREDICTED: probable pectate lyase 19-like          197   1e-56   
ref|XP_002272638.2|  PREDICTED: pectate lyase-like                      196   3e-56   Vitis vinifera
ref|XP_009403112.1|  PREDICTED: pectate lyase-like                      196   4e-56   
ref|NP_172894.1|  putative pectate lyase 3                              196   5e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAB69759.1|  putative pectate lyase                                  196   5e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892805.1|  hypothetical protein ARALYDRAFT_471616             196   5e-56   
ref|XP_008446316.1|  PREDICTED: probable pectate lyase P59              195   7e-56   
ref|XP_003543726.1|  PREDICTED: pectate lyase                           195   1e-55   
ref|XP_010514040.1|  PREDICTED: probable pectate lyase 6                195   1e-55   
ref|XP_004135462.1|  PREDICTED: probable pectate lyase P59-like         195   1e-55   
gb|KGN47799.1|  hypothetical protein Csa_6G404140                       194   1e-55   
ref|XP_004155392.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    194   1e-55   
ref|XP_010915114.1|  PREDICTED: LOW QUALITY PROTEIN: pectate lyas...    194   2e-55   
ref|XP_010425041.1|  PREDICTED: probable pectate lyase 6                194   2e-55   
gb|AAQ62996.1|  oil palm polygalacturonase allergen PEST361             194   2e-55   Elaeis guineensis
ref|XP_004146792.1|  PREDICTED: probable pectate lyase P59-like         194   2e-55   
ref|XP_002871648.1|  pectate lyase family protein                       195   2e-55   
ref|XP_006292606.1|  hypothetical protein CARUB_v10018855mg             194   3e-55   
ref|XP_010502279.1|  PREDICTED: probable pectate lyase 6                194   4e-55   
ref|XP_004162547.1|  PREDICTED: probable pectate lyase P59-like         193   4e-55   
gb|ACU23277.1|  unknown                                                 193   4e-55   Glycine max [soybeans]
ref|XP_006354795.1|  PREDICTED: pectate lyase-like                      192   6e-55   
ref|XP_008389523.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    193   7e-55   
ref|XP_009615547.1|  PREDICTED: probable pectate lyase P59              192   7e-55   
ref|NP_178375.1|  putative pectate lyase 6                              193   7e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011086389.1|  PREDICTED: pectate lyase-like                      192   7e-55   
ref|XP_010683249.1|  PREDICTED: pectate lyase-like                      192   8e-55   
ref|XP_006437462.1|  hypothetical protein CICLE_v10031653mg             192   8e-55   
emb|CDP00293.1|  unnamed protein product                                192   1e-54   
ref|XP_009129128.1|  PREDICTED: probable pectate lyase 6                192   2e-54   
ref|XP_010528323.1|  PREDICTED: probable pectate lyase 19               192   2e-54   
emb|CDY09356.1|  BnaA02g26540D                                          192   2e-54   
ref|XP_004489168.1|  PREDICTED: pectate lyase-like                      191   3e-54   
ref|XP_008456459.1|  PREDICTED: pectate lyase-like                      191   4e-54   
ref|XP_010550068.1|  PREDICTED: probable pectate lyase 19               191   5e-54   
emb|CDY41679.1|  BnaC02g34750D                                          191   5e-54   
ref|XP_009117903.1|  PREDICTED: probable pectate lyase 3                191   6e-54   
gb|EPS73633.1|  hypothetical protein M569_01123                         190   7e-54   
gb|KEH24975.1|  pectate lyase P59-like protein                          190   7e-54   
ref|XP_008339935.1|  PREDICTED: probable pectate lyase 3                190   8e-54   
ref|XP_009788285.1|  PREDICTED: pectate lyase-like                      189   9e-54   
ref|XP_006482669.1|  PREDICTED: probable pectate lyase 9-like           184   1e-53   
emb|CDY45254.1|  BnaA06g09240D                                          190   1e-53   
ref|XP_010485518.1|  PREDICTED: probable pectate lyase 7                190   2e-53   
emb|CDY45202.1|  BnaA06g34060D                                          189   2e-53   
ref|NP_001057945.1|  Os06g0583900                                       189   2e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006299938.1|  hypothetical protein CARUB_v10016149mg             189   2e-53   
ref|XP_010463548.1|  PREDICTED: probable pectate lyase 7                189   2e-53   
ref|NP_197015.4|  putative pectate lyase 19                             189   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004490003.1|  PREDICTED: probable pectate lyase 3-like iso...    189   3e-53   
sp|Q9LFP5.1|PLY19_ARATH  RecName: Full=Probable pectate lyase 19;...    189   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101245.1|  PREDICTED: probable pectate lyase 6                189   3e-53   
gb|ABK28696.1|  unknown                                                 189   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009389712.1|  PREDICTED: pectate lyase-like                      188   3e-53   
emb|CDY04133.1|  BnaA09g19110D                                          188   4e-53   
ref|XP_009114192.1|  PREDICTED: probable pectate lyase 6                188   4e-53   
ref|XP_010513594.1|  PREDICTED: probable pectate lyase 7                189   4e-53   
ref|XP_009148818.1|  PREDICTED: probable pectate lyase 3                188   5e-53   
ref|XP_009360393.1|  PREDICTED: probable pectate lyase 3                188   5e-53   
emb|CDY39314.1|  BnaC05g10650D                                          188   6e-53   
emb|CDY17432.1|  BnaC09g21050D                                          188   6e-53   
ref|XP_009761969.1|  PREDICTED: probable pectate lyase P59              187   7e-53   
ref|XP_010420164.1|  PREDICTED: probable pectate lyase 19 isoform X2    188   8e-53   
ref|XP_009598230.1|  PREDICTED: pectate lyase-like                      187   9e-53   
ref|XP_008339934.1|  PREDICTED: probable pectate lyase 3                187   9e-53   
emb|CDY53552.1|  BnaA09g57110D                                          188   1e-52   
emb|CDY03043.1|  BnaC07g21840D                                          187   1e-52   
gb|KFK43687.1|  hypothetical protein AALP_AA1G160000                    187   2e-52   
ref|XP_007137422.1|  hypothetical protein PHAVU_009G125800g             186   2e-52   
ref|XP_002875142.1|  pectate lyase family protein                       186   2e-52   
ref|XP_009408830.1|  PREDICTED: pectate lyase-like                      186   2e-52   
emb|CDX81636.1|  BnaC08g39650D                                          187   2e-52   
dbj|BAK06965.1|  predicted protein                                      186   2e-52   
ref|XP_010317101.1|  PREDICTED: probable pectate lyase P59              185   2e-52   
ref|XP_007224275.1|  hypothetical protein PRUPE_ppa019055mg             186   3e-52   
ref|XP_010320663.1|  PREDICTED: probable pectate lyase 3                184   3e-52   
gb|AAM60924.1|  putative pectate lyase                                  186   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006363934.1|  PREDICTED: pectate lyase-like                      186   3e-52   
ref|NP_186776.1|  putative pectate lyase 7                              186   4e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009110541.1|  PREDICTED: probable pectate lyase 3                186   5e-52   
ref|XP_004951474.1|  PREDICTED: pectate lyase-like                      185   6e-52   
ref|XP_004514773.1|  PREDICTED: probable pectate lyase 3-like           185   6e-52   
ref|XP_008221660.1|  PREDICTED: probable pectate lyase 3                184   1e-51   
emb|CDX96854.1|  BnaA08g23970D                                          184   2e-51   
ref|XP_007153840.1|  hypothetical protein PHAVU_003G069100g             184   2e-51   
ref|XP_004228388.1|  PREDICTED: pectate lyase                           184   2e-51   
emb|CDY68729.1|  BnaCnng60280D                                          184   2e-51   
ref|XP_006826355.1|  hypothetical protein AMTR_s00004p00123190          184   2e-51   
ref|XP_009758350.1|  PREDICTED: pectate lyase-like                      183   2e-51   
ref|XP_008793504.1|  PREDICTED: pectate lyase-like                      183   3e-51   
gb|AAQ62997.1|  oil palm polygalacturonase allergen PEST411             183   3e-51   Elaeis guineensis
emb|CDX70590.1|  BnaC03g06740D                                          184   3e-51   
ref|XP_010678579.1|  PREDICTED: pectate lyase-like                      183   3e-51   
ref|XP_010453638.1|  PREDICTED: probable pectate lyase 19               184   4e-51   
ref|XP_003613596.1|  Pectate lyase                                      183   4e-51   
ref|XP_010925369.1|  PREDICTED: pectate lyase                           183   4e-51   
ref|XP_009599232.1|  PREDICTED: pectate lyase-like                      183   4e-51   
ref|XP_010670318.1|  PREDICTED: pectate lyase-like                      182   5e-51   
ref|XP_006357121.1|  PREDICTED: pectate lyase-like                      181   1e-50   
ref|XP_006656188.1|  PREDICTED: pectate lyase-like                      182   1e-50   
ref|XP_008221658.1|  PREDICTED: pectate lyase-like                      181   1e-50   
ref|XP_006357289.1|  PREDICTED: probable pectate lyase 3-like           182   1e-50   
ref|XP_002453531.1|  hypothetical protein SORBIDRAFT_04g007450          181   2e-50   Sorghum bicolor [broomcorn]
gb|AFW87059.1|  pectate lyase                                           181   2e-50   
ref|XP_002437204.1|  hypothetical protein SORBIDRAFT_10g022830          181   2e-50   Sorghum bicolor [broomcorn]
ref|XP_006344502.1|  PREDICTED: probable pectate lyase P59-like         181   2e-50   
gb|KHN13240.1|  Putative pectate lyase 3                                181   2e-50   
ref|XP_007215366.1|  hypothetical protein PRUPE_ppa005602mg             181   2e-50   
ref|XP_004490004.1|  PREDICTED: probable pectate lyase 3-like iso...    179   2e-50   
ref|XP_008230729.1|  PREDICTED: pectate lyase                           181   2e-50   
emb|CDX85564.1|  BnaA02g02490D                                          181   2e-50   
ref|NP_001150723.1|  pectate lyase precursor                            181   3e-50   Zea mays [maize]
gb|EYU28712.1|  hypothetical protein MIMGU_mgv1a006498mg                180   3e-50   
ref|XP_010492335.1|  PREDICTED: probable pectate lyase 19               181   4e-50   
ref|XP_008446067.1|  PREDICTED: pectate lyase-like                      179   4e-50   
ref|XP_003563707.1|  PREDICTED: pectate lyase-like                      180   6e-50   
ref|XP_009131435.1|  PREDICTED: probable pectate lyase 19               180   7e-50   
ref|XP_002882189.1|  pectate lyase family protein                       180   1e-49   
ref|XP_008679844.1|  PREDICTED: pectate lyase                           179   1e-49   
emb|CDY63769.1|  BnaCnng42620D                                          179   1e-49   
ref|XP_003519771.2|  PREDICTED: probable pectate lyase 3-like           179   2e-49   
gb|KHN08706.1|  Putative pectate lyase 3                                179   2e-49   
emb|CDY28691.1|  BnaCnng05770D                                          179   2e-49   
ref|XP_004236194.1|  PREDICTED: probable pectate lyase P59              178   2e-49   
ref|XP_007151201.1|  hypothetical protein PHAVU_004G026400g             178   2e-49   
gb|KFK37588.1|  hypothetical protein AALP_AA3G002600                    179   2e-49   
ref|XP_004233352.1|  PREDICTED: pectate lyase-like                      177   2e-49   
ref|XP_008786760.1|  PREDICTED: pectate lyase-like                      179   2e-49   
ref|XP_004302354.1|  PREDICTED: probable pectate lyase P59-like         178   3e-49   
ref|XP_006579282.1|  PREDICTED: probable pectate lyase P59-like         177   4e-49   
gb|ACF87417.1|  unknown                                                 177   4e-49   Zea mays [maize]
gb|KHG23093.1|  hypothetical protein F383_29772                         176   4e-49   
ref|XP_010420163.1|  PREDICTED: probable pectate lyase 19 isoform X1    178   7e-49   
ref|XP_004966014.1|  PREDICTED: pectate lyase-like                      178   7e-49   
ref|XP_008365507.1|  PREDICTED: pectate lyase-like                      176   9e-49   
gb|KHG05193.1|  hypothetical protein F383_30875                         175   9e-49   
ref|XP_009757256.1|  PREDICTED: pectate lyase                           176   9e-49   
ref|XP_009126031.1|  PREDICTED: probable pectate lyase 19               177   1e-48   
emb|CDY66593.1|  BnaCnng51570D                                          177   1e-48   
ref|XP_009125036.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    176   2e-48   
ref|XP_002436463.1|  hypothetical protein SORBIDRAFT_10g003080          176   2e-48   Sorghum bicolor [broomcorn]
ref|XP_006573090.1|  PREDICTED: probable pectate lyase 3-like           176   2e-48   
ref|XP_009121613.1|  PREDICTED: probable pectate lyase 19               176   4e-48   
emb|CDX91953.1|  BnaC03g32550D                                          175   4e-48   
emb|CDX74293.1|  BnaA03g27540D                                          175   5e-48   
ref|XP_009134622.1|  PREDICTED: probable pectate lyase 7                175   6e-48   
ref|NP_001046281.1|  Os02g0214400                                       174   9e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010420165.1|  PREDICTED: probable pectate lyase 19 isoform X3    175   9e-48   
gb|KHN45481.1|  Putative pectate lyase 3                                172   1e-47   
ref|XP_010551866.1|  PREDICTED: probable pectate lyase 19               174   1e-47   
gb|KHN01171.1|  Putative pectate lyase 3                                173   1e-47   
ref|XP_008366366.1|  PREDICTED: pectate lyase-like                      174   2e-47   
ref|XP_009587688.1|  PREDICTED: pectate lyase-like                      172   2e-47   
ref|XP_011071024.1|  PREDICTED: pectate lyase-like                      172   4e-47   
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               172   6e-47   
ref|XP_003601872.1|  Pectate lyase                                      172   6e-47   
ref|XP_009380431.1|  PREDICTED: pectate lyase-like                      171   1e-46   
ref|XP_009789922.1|  PREDICTED: pectate lyase-like                      170   1e-46   
gb|EAY85003.1|  hypothetical protein OsI_06363                          171   2e-46   Oryza sativa Indica Group [Indian rice]
gb|KHN13490.1|  Putative pectate lyase 3                                168   2e-46   
ref|XP_011087066.1|  PREDICTED: pectate lyase                           170   3e-46   
gb|KEH19822.1|  pectate lyase-like protein                              170   3e-46   
ref|XP_002297822.1|  pectate lyase family protein                       170   3e-46   Populus trichocarpa [western balsam poplar]
ref|XP_004301165.1|  PREDICTED: probable pectate lyase P59-like         170   3e-46   
gb|KDO40644.1|  hypothetical protein CISIN_1g015623mg                   169   4e-46   
gb|AFW76465.1|  hypothetical protein ZEAMMB73_776134                    169   4e-46   
ref|XP_010527871.1|  PREDICTED: probable pectate lyase 3 isoform X1     172   4e-46   
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    170   5e-46   
ref|XP_006447221.1|  hypothetical protein CICLE_v10015474mg             169   5e-46   
ref|XP_004142504.1|  PREDICTED: probable pectate lyase 13-like          169   5e-46   
gb|ACN96322.1|  hypothetical protein                                    165   6e-46   Zea mays subsp. mays [corn]
ref|XP_009627245.1|  PREDICTED: pectate lyase-like                      169   6e-46   
sp|P40973.1|PLY_LILLO  RecName: Full=Pectate lyase; Flags: Precursor    169   7e-46   Lilium longiflorum [Easter lily]
ref|XP_004298448.1|  PREDICTED: probable pectate lyase 3-like           169   7e-46   
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                      168   7e-46   
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    169   8e-46   
ref|XP_002518146.1|  Pectate lyase precursor, putative                  167   8e-46   Ricinus communis
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           169   8e-46   
ref|XP_008360481.1|  PREDICTED: probable pectate lyase 8                169   8e-46   
ref|XP_006495480.1|  PREDICTED: probable pectate lyase 19-like          162   8e-46   
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          169   9e-46   
ref|XP_010448519.1|  PREDICTED: probable pectate lyase 18               168   9e-46   
ref|XP_008391438.1|  PREDICTED: probable pectate lyase 8                169   9e-46   
ref|XP_010433725.1|  PREDICTED: probable pectate lyase 18               168   9e-46   
ref|XP_009362042.1|  PREDICTED: probable pectate lyase 8                169   9e-46   
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    169   9e-46   
ref|XP_008367255.1|  PREDICTED: probable pectate lyase 1                168   9e-46   
gb|ACN96319.1|  hypothetical protein                                    164   1e-45   
ref|XP_006360328.1|  PREDICTED: probable pectate lyase 15-like          169   1e-45   
ref|XP_007037817.1|  Pectate lyase family protein isoform 3             164   1e-45   
ref|XP_004173516.1|  PREDICTED: probable pectate lyase 12-like          167   1e-45   
gb|ACN96320.1|  hypothetical protein                                    164   1e-45   
ref|XP_011002172.1|  PREDICTED: probable pectate lyase 8                168   1e-45   
gb|KGN52235.1|  hypothetical protein Csa_5G622520                       169   2e-45   
gb|AAK66161.1|  pectate lyase                                           166   2e-45   
ref|XP_009593549.1|  PREDICTED: probable pectate lyase 8                167   2e-45   
ref|XP_004247823.1|  PREDICTED: probable pectate lyase 8                167   2e-45   
ref|XP_010106682.1|  hypothetical protein L484_004616                   166   3e-45   
ref|XP_006283843.1|  hypothetical protein CARUB_v10004942mg             167   3e-45   
gb|ABR18032.1|  unknown                                                 162   3e-45   
ref|XP_008446817.1|  PREDICTED: probable pectate lyase 18               168   3e-45   
ref|XP_009797403.1|  PREDICTED: pectate lyase-like                      167   3e-45   
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like          167   4e-45   
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             167   4e-45   
gb|KHG06252.1|  hypothetical protein F383_10745                         167   4e-45   
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    167   4e-45   
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         167   4e-45   
gb|KEH35002.1|  pectate lyase family protein                            163   4e-45   
gb|KHG30349.1|  hypothetical protein F383_15991                         167   5e-45   
ref|XP_003571658.1|  PREDICTED: pectate lyase-like                      166   5e-45   
gb|KDO55843.1|  hypothetical protein CISIN_1g010437mg                   165   5e-45   
ref|XP_010111662.1|  hypothetical protein L484_017690                   166   6e-45   
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          166   7e-45   
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             166   7e-45   
ref|XP_010103507.1|  hypothetical protein L484_017015                   166   7e-45   
gb|KDO72488.1|  hypothetical protein CISIN_1g039754mg                   158   7e-45   
gb|AES72123.2|  pectate lyase family protein                            166   8e-45   
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     166   8e-45   
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              166   8e-45   
emb|CDY08948.1|  BnaC08g11780D                                          165   8e-45   
ref|XP_009406385.1|  PREDICTED: probable pectate lyase 18               165   8e-45   
gb|EPS68938.1|  hypothetical protein M569_05827                         165   8e-45   
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                165   8e-45   
gb|KFK29019.1|  hypothetical protein AALP_AA7G078200                    165   9e-45   
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     164   9e-45   
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           166   9e-45   
ref|XP_002515037.1|  Pectate lyase precursor, putative                  165   1e-44   
emb|CDP02199.1|  unnamed protein product                                164   1e-44   
emb|CDX92652.1|  BnaC07g39100D                                          165   1e-44   
ref|XP_007157384.1|  hypothetical protein PHAVU_002G065800g             166   1e-44   
ref|XP_004304685.1|  PREDICTED: pectate lyase-like                      165   1e-44   
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     166   1e-44   
gb|ABR18471.1|  unknown                                                 166   1e-44   
dbj|BAI94495.1|  pectate lyase                                          165   1e-44   
ref|XP_011005597.1|  PREDICTED: probable pectate lyase 18               165   1e-44   
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     166   1e-44   
ref|XP_002304700.1|  pectate lyase family protein                       166   1e-44   
ref|XP_004299169.1|  PREDICTED: probable pectate lyase 18-like          165   1e-44   
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                165   1e-44   
ref|XP_009138507.1|  PREDICTED: probable pectate lyase 18               165   1e-44   
gb|KDP46367.1|  hypothetical protein JCGZ_10207                         165   1e-44   
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8                166   1e-44   
emb|CDY11033.1|  BnaA03g46920D                                          165   1e-44   
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     165   1e-44   
ref|XP_003613595.1|  Pectate lyase                                      166   1e-44   
ref|XP_002322215.1|  pectate lyase 22 precursor family protein          165   1e-44   
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           166   1e-44   
ref|XP_008340139.1|  PREDICTED: probable pectate lyase 5                164   1e-44   
gb|AAM12784.1|  putative pectate-lyase                                  162   2e-44   
ref|XP_002318694.1|  pectate lyase 22 precursor family protein          164   2e-44   
gb|AAN60248.1|  unknown                                                 159   2e-44   
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    164   2e-44   
ref|XP_011040439.1|  PREDICTED: probable pectate lyase 18               164   2e-44   
ref|XP_002437815.1|  hypothetical protein SORBIDRAFT_10g003090          165   2e-44   
ref|XP_010481247.1|  PREDICTED: uncharacterized protein LOC104760096    165   2e-44   
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                165   2e-44   
emb|CDY34310.1|  BnaA01g14130D                                          164   2e-44   
emb|CDY18738.1|  BnaC08g08780D                                          166   2e-44   
gb|AEN70981.1|  pectate lyase                                           164   2e-44   
emb|CDY01846.1|  BnaC06g28860D                                          164   2e-44   
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like           164   2e-44   
emb|CDY03419.1|  BnaC01g16630D                                          164   2e-44   
ref|XP_003551943.1|  PREDICTED: probable pectate lyase 5-like           164   3e-44   
ref|XP_004134015.1|  PREDICTED: probable pectate lyase 15-like          165   3e-44   
ref|XP_008458848.1|  PREDICTED: pectate lyase-like                      164   3e-44   
emb|CDP15081.1|  unnamed protein product                                164   3e-44   
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                165   3e-44   
emb|CDY24847.1|  BnaA08g14630D                                          164   3e-44   
ref|XP_006420566.1|  hypothetical protein CICLE_v10004783mg             165   3e-44   
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                164   3e-44   
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    164   3e-44   
ref|XP_007209185.1|  hypothetical protein PRUPE_ppa006392mg             164   3e-44   
gb|KDP30994.1|  hypothetical protein JCGZ_11370                         164   4e-44   
gb|KHG22990.1|  hypothetical protein F383_28754                         164   4e-44   
ref|XP_008233253.1|  PREDICTED: probable pectate lyase 5                165   4e-44   
ref|XP_009105327.1|  PREDICTED: probable pectate lyase 5                164   4e-44   
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                164   4e-44   
emb|CDY56220.1|  BnaAnng14170D                                          164   4e-44   
ref|XP_009628975.1|  PREDICTED: probable pectate lyase 18               164   4e-44   
ref|XP_009775177.1|  PREDICTED: probable pectate lyase 8                164   4e-44   
gb|AEN70964.1|  pectate lyase                                           164   4e-44   
gb|AEN70963.1|  pectate lyase                                           164   4e-44   
gb|KHG19997.1|  hypothetical protein F383_02891                         164   4e-44   
gb|ADB90476.1|  pectate lyase                                           164   4e-44   
gb|ADB90475.1|  pectate lyase                                           164   4e-44   
gb|AEN70968.1|  pectate lyase                                           164   4e-44   
gb|AEN70965.1|  pectate lyase                                           164   4e-44   
gb|ADB90478.1|  pectate lyase                                           163   4e-44   
gb|ABR17791.1|  unknown                                                 164   4e-44   
gb|KDO69410.1|  hypothetical protein CISIN_1g015569mg                   160   5e-44   
ref|XP_004502358.1|  PREDICTED: probable pectate lyase 5-like           163   5e-44   
gb|AGT16687.1|  pectate lyase                                           164   5e-44   
ref|XP_002867644.1|  pectate lyase family protein                       163   5e-44   
gb|AEN70977.1|  pectate lyase                                           163   5e-44   
gb|ADB90477.1|  pectate lyase                                           163   5e-44   
gb|AEN70985.1|  pectate lyase                                           163   5e-44   
gb|ACN96379.1|  hypothetical protein                                    160   5e-44   
gb|ADB90479.1|  pectate lyase                                           163   5e-44   
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like          163   5e-44   
ref|NP_001280201.1|  probable pectate lyase 18 precursor                163   5e-44   
emb|CAA63496.1|  pectate lyase                                          163   5e-44   
gb|ACB12931.1|  pectate lyase 1-27                                      164   5e-44   
ref|XP_007220650.1|  hypothetical protein PRUPE_ppa003600mg             166   6e-44   
gb|ACN96380.1|  hypothetical protein                                    159   6e-44   
ref|XP_008230481.1|  PREDICTED: pectate lyase-like                      163   6e-44   
ref|XP_009359518.1|  PREDICTED: probable pectate lyase 18               163   6e-44   
ref|XP_007137977.1|  hypothetical protein PHAVU_009G170500g             163   6e-44   
ref|XP_009340844.1|  PREDICTED: pectate lyase-like                      163   6e-44   
gb|AAA16476.1|  pectate lyase homolog                                   164   6e-44   
emb|CAA22985.1|  putative pectate lyase                                 163   6e-44   
ref|XP_009109237.1|  PREDICTED: probable pectate lyase 18               163   6e-44   
ref|XP_002866540.1|  pectate lyase                                      163   7e-44   
ref|XP_004156698.1|  PREDICTED: putative pectate lyase 11-like          163   7e-44   
ref|XP_004142773.1|  PREDICTED: putative pectate lyase 11-like          163   7e-44   
ref|NP_567707.1|  putative pectate lyase 18                             163   7e-44   
gb|AAK25850.1|AF360140_1  putative pectate lyase                        163   8e-44   
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               164   8e-44   
emb|CDO99404.1|  unnamed protein product                                164   8e-44   
gb|ACN96359.1|  hypothetical protein                                    159   8e-44   
ref|XP_006591479.1|  PREDICTED: probable pectate lyase 5-like           162   8e-44   
ref|NP_001150425.1|  LOC100284055 precursor                             164   8e-44   
ref|XP_003638513.1|  Pectate lyase                                      162   8e-44   
ref|XP_004173339.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    163   9e-44   
gb|AAL06861.1|  At1g04680/T1G11_6                                       161   9e-44   
ref|XP_006420567.1|  hypothetical protein CICLE_v10004783mg             164   9e-44   
gb|ACN96372.1|  hypothetical protein                                    159   9e-44   
gb|AAY85180.1|  pectate lyase                                           162   9e-44   
gb|AAF19195.1|AF206319_1  pectate lyase 1                               162   9e-44   
ref|XP_010415362.1|  PREDICTED: probable pectate lyase 5                162   1e-43   
ref|XP_009762540.1|  PREDICTED: probable pectate lyase 18               162   1e-43   
gb|ACN96360.1|  hypothetical protein                                    159   1e-43   
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             163   1e-43   
gb|ACN96354.1|  hypothetical protein                                    159   1e-43   
gb|ACJ83349.1|  unknown                                                 157   1e-43   
ref|NP_001289258.1|  probable pectate lyase 18 precursor                162   1e-43   
ref|XP_006653139.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    164   1e-43   
dbj|BAF43573.1|  pectate lyase                                          163   1e-43   
ref|XP_008456538.1|  PREDICTED: probable pectate lyase 12               164   1e-43   
gb|KDO49831.1|  hypothetical protein CISIN_1g044170mg                   161   1e-43   
gb|KHG22755.1|  hypothetical protein F383_29653                         162   1e-43   
ref|XP_006854398.1|  hypothetical protein AMTR_s00039p00189000          163   1e-43   
gb|AEN70984.1|  pectate lyase                                           162   1e-43   
gb|ACN96364.1|  hypothetical protein                                    159   1e-43   
gb|ACN96353.1|  hypothetical protein                                    159   1e-43   
ref|XP_010243215.1|  PREDICTED: probable pectate lyase 18               164   1e-43   
gb|ACN96362.1|  hypothetical protein                                    159   1e-43   
ref|XP_010531484.1|  PREDICTED: probable pectate lyase 5                162   1e-43   
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18               162   1e-43   
gb|ACN96358.1|  hypothetical protein                                    159   1e-43   
ref|XP_004150371.1|  PREDICTED: probable pectate lyase 12-like          164   1e-43   
gb|EYU43815.1|  hypothetical protein MIMGU_mgv1a006554mg                163   1e-43   
emb|CDY41506.1|  BnaA06g22590D                                          162   1e-43   
ref|XP_009359258.1|  PREDICTED: probable pectate lyase 5                162   1e-43   
gb|ACN96355.1|  hypothetical protein                                    158   1e-43   
gb|KDO69409.1|  hypothetical protein CISIN_1g015569mg                   160   1e-43   
gb|KDP26717.1|  hypothetical protein JCGZ_17875                         162   1e-43   
ref|XP_010536660.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    162   2e-43   
ref|XP_010511733.1|  PREDICTED: probable pectate lyase 5                162   2e-43   
ref|XP_010695977.1|  PREDICTED: probable pectate lyase 18               162   2e-43   
ref|XP_010267234.1|  PREDICTED: probable pectate lyase 5                164   2e-43   
emb|CDP16631.1|  unnamed protein product                                162   2e-43   
ref|XP_007215475.1|  hypothetical protein PRUPE_ppa006569mg             162   2e-43   
gb|AFZ78654.1|  pectate lyase                                           162   2e-43   
ref|XP_010470701.1|  PREDICTED: probable pectate lyase 5                162   2e-43   
ref|XP_006852264.1|  hypothetical protein AMTR_s00049p00173370          162   2e-43   
ref|XP_002870357.1|  pectate lyase family protein                       163   2e-43   
emb|CAN78491.1|  hypothetical protein VITISV_004934                     162   2e-43   
emb|CBI33346.3|  unnamed protein product                                162   2e-43   
gb|ACN96356.1|  hypothetical protein                                    158   2e-43   
gb|EYU32621.1|  hypothetical protein MIMGU_mgv1a006198mg                162   2e-43   
ref|XP_009614673.1|  PREDICTED: probable pectate lyase 13 isoform X2    163   2e-43   
ref|XP_009150377.1|  PREDICTED: probable pectate lyase 22               162   2e-43   
gb|ACN96341.1|  hypothetical protein                                    158   2e-43   
gb|AAG28907.1|AC008113_23  F12A21.12                                    161   2e-43   
gb|KDO82122.1|  hypothetical protein CISIN_1g015702mg                   159   2e-43   
ref|XP_004242391.1|  PREDICTED: probable pectate lyase 8                162   2e-43   
ref|XP_008389758.1|  PREDICTED: probable pectate lyase 5                161   2e-43   
ref|XP_009614672.1|  PREDICTED: probable pectate lyase 13 isoform X1    163   2e-43   
ref|XP_008350945.1|  PREDICTED: probable pectate lyase 5                161   2e-43   
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                162   2e-43   
ref|XP_011097759.1|  PREDICTED: probable pectate lyase 22               161   2e-43   
dbj|BAF43572.1|  pectate lyase                                          161   3e-43   
gb|KFK41187.1|  hypothetical protein AALP_AA2G097000                    161   3e-43   
ref|NP_564906.1|  putative pectate lyase 5                              161   3e-43   
ref|NP_001280839.1|  probable pectate lyase 18 precursor                161   3e-43   
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                162   3e-43   
gb|ABR17766.1|  unknown                                                 162   3e-43   
ref|XP_011010949.1|  PREDICTED: pectate lyase-like                      161   3e-43   
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           161   3e-43   
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                161   3e-43   
ref|XP_002314576.1|  pectate lyase 5 precursor family protein           161   3e-43   
ref|XP_004236303.1|  PREDICTED: probable pectate lyase 18               161   3e-43   
ref|XP_011097774.1|  PREDICTED: pectate lyase-like                      162   3e-43   
ref|XP_010033351.1|  PREDICTED: pectate lyase-like                      161   3e-43   
ref|XP_002285639.2|  PREDICTED: probable pectate lyase 8                162   3e-43   
ref|XP_008439105.1|  PREDICTED: probable pectate lyase 22               161   3e-43   
ref|XP_009761365.1|  PREDICTED: probable pectate lyase 13 isoform X1    162   3e-43   
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     161   3e-43   
gb|AAM65103.1|  putative pectate lyase                                  161   3e-43   



>ref|XP_004234779.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=449

 Score =   253 bits (646),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 155/214 (72%), Gaps = 11/214 (5%)
 Frame = -3

Query  634  MAGFNINCFCMFL-VTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAA  458
            M G  I    +FL +TFA I+PS+  HI  +DEVW++R  EA E+A K +EP P NV+ A
Sbjct  1    MGGPKIKYSFLFLCITFATIIPSLMAHIGHYDEVWRRRAEEAKEYARKIYEPHPENVTLA  60

Query  457  FNDEVHKTLLESKNEPDRKKFVNGS--DDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNW  284
            FN ++  T+ E K        V G+  + TRR L  +K Y GPC  TNPID+CWRC PNW
Sbjct  61   FNQKLRDTMKELKK-------VKGTHNNSTRRGLGTKK-YTGPCMVTNPIDKCWRCDPNW  112

Query  283  ANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPSNPKPGTLRHAVIQKKPLWIIFSR  104
            A+NR++LADC MGFG KAIGGK G  YVV D+SDD ++PKPGTLRHAVIQK+PLWIIF R
Sbjct  113  ADNRKKLADCAMGFGSKAIGGKDGEFYVVTDNSDDYNDPKPGTLRHAVIQKEPLWIIFKR  172

Query  103  DMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             MNIRL+QE+IMQSDKTID RG  VH++ GAGIT
Sbjct  173  GMNIRLHQEMIMQSDKTIDARGVNVHITKGAGIT  206



>gb|AAB69758.1| putative pectate lyase Nt59 [Nicotiana tabacum]
Length=274

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 146/203 (72%), Gaps = 10/203 (5%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            F    + FA I+P +  HI ++DEVW++R  EA E+A + +EP+P NV+ AFN +V  ++
Sbjct  10   FFFLFIIFATIIPCLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRDSM  69

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
                     K+    ++ TRR L  +K Y GPC  TNPIDRCWRC PNWA+NR+RLADC 
Sbjct  70   ---------KEVTVSNNSTRRGLGTKK-YKGPCMVTNPIDRCWRCDPNWADNRKRLADCA  119

Query  250  MGFGRKAIGGKHGVLYVVNDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELI  71
            MGFG KA GGK G +Y+V D+SDD + PKPGTLR+AVIQK+PLWIIF R M IRL+QELI
Sbjct  120  MGFGSKATGGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQELI  179

Query  70   MQSDKTIDGRGFQVHVSGGAGIT  2
            MQSDKTID RG  VH++ GAGIT
Sbjct  180  MQSDKTIDARGANVHIAKGAGIT  202



>sp|P15722.1|PLY59_SOLLC RecName: Full=Probable pectate lyase P59; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33523.1| P59 protein [Solanum lycopersicum]
Length=449

 Score =   251 bits (641),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 154/214 (72%), Gaps = 11/214 (5%)
 Frame = -3

Query  634  MAGFNINCFCMFL-VTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAA  458
            M G  I    +FL +TFA I+PS+  HI  +DEVW++R  EA E+A   +EP P NV+ A
Sbjct  1    MGGPKIKYSFLFLCITFATIIPSLMAHIGHYDEVWRRRAEEAKEYARNIYEPHPENVTLA  60

Query  457  FNDEVHKTLLESKNEPDRKKFVNGS--DDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNW  284
            FN ++  T+ E K        V G+  + TRR L  +K Y GPC  TNPID+CWRC PNW
Sbjct  61   FNQKLRDTMKELKK-------VKGTHNNSTRRGLGTKK-YTGPCMVTNPIDKCWRCDPNW  112

Query  283  ANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPSNPKPGTLRHAVIQKKPLWIIFSR  104
            A+NR++LADC MGFG KAIGGK G  YVV D+SDD ++PKPGTLRHAVIQK+PLWIIF R
Sbjct  113  ADNRKKLADCAMGFGSKAIGGKDGEFYVVTDNSDDYNDPKPGTLRHAVIQKEPLWIIFKR  172

Query  103  DMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             MNIRL+QE+IMQSDKTID RG  VH++ GAGIT
Sbjct  173  GMNIRLHQEMIMQSDKTIDARGVNVHITKGAGIT  206



>ref|XP_006361835.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=447

 Score =   250 bits (638),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 153/212 (72%), Gaps = 9/212 (4%)
 Frame = -3

Query  634  MAGFNINCFCMFL-VTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAA  458
            M G  I    +FL +TFA I+PS+  HI  +DEVW++R  EA E+A + +E  P NV+ A
Sbjct  1    MGGPKIKYTFLFLCITFATIIPSLMAHIGHYDEVWRRRAEEAKEYARQIYERHPENVTLA  60

Query  457  FNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWAN  278
            FN ++  T+ E K        V G++ TRR L  +K Y GPC  TNPIDRCWRC PNWA+
Sbjct  61   FNQKLRNTMKELKE-------VKGTNSTRRGLGTKK-YCGPCIVTNPIDRCWRCDPNWAD  112

Query  277  NRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRDM  98
            NR+RLADC MGFG K  GGK+G  YVV D+SDD ++PKPGTLR+AVIQK+PLWIIF R M
Sbjct  113  NRKRLADCAMGFGSKVTGGKNGEFYVVTDNSDDYNDPKPGTLRYAVIQKEPLWIIFKRGM  172

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            NIRL+QE+IMQSDKTID RG  VH++ GAGIT
Sbjct  173  NIRLHQEMIMQSDKTIDARGVNVHITKGAGIT  204



>ref|XP_009587689.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=447

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 148/202 (73%), Gaps = 9/202 (4%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            F +F + FA I+PS   HI E+DEVW++R  EA + AL+T+E +P NV+ AFN +V   +
Sbjct  11   FVLFFI-FAAIIPSFLAHIGEFDEVWRRRAEEARKVALQTYESEPENVTLAFNKQVRDAM  69

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
             E          V   +DTRR+L  +K Y GPC  TNPID+CWRC PNWA+NR++LADC 
Sbjct  70   KELSE-------VIPKNDTRRELGTKK-YTGPCMVTNPIDKCWRCDPNWADNRKKLADCA  121

Query  250  MGFGRKAIGGKHGVLYVVNDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELI  71
            MGFG KA GGK G  YVVND SDD ++PKPGTLRHAVIQK+PLWIIF R M IRL+QELI
Sbjct  122  MGFGSKATGGKAGRFYVVNDPSDDYTDPKPGTLRHAVIQKEPLWIIFDRGMTIRLHQELI  181

Query  70   MQSDKTIDGRGFQVHVSGGAGI  5
            MQSDKTID RG  VH+SGGAGI
Sbjct  182  MQSDKTIDARGANVHISGGAGI  203



>ref|XP_009789921.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   248 bits (634),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 151/212 (71%), Gaps = 13/212 (6%)
 Frame = -3

Query  640  KIMAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSA  461
            K+M  F    F +F + F  I+PS   HI E+DEVW++R  EA + AL+T+E +P NV+ 
Sbjct  5    KVMHSF----FVLFFI-FTAIIPSFLAHIGEFDEVWRRRAEEARKVALQTYESEPENVTL  59

Query  460  AFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWA  281
            AFN +V   + E          V   +DTRR+L  +K Y GPC  TNPID+CWRC PNWA
Sbjct  60   AFNKQVRDAMKELSE-------VIPKNDTRRELGTKK-YTGPCMVTNPIDKCWRCDPNWA  111

Query  280  NNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRD  101
            +NR++LADC MGFG KA GGK G  YVVND SDD ++PKPGTLRHAVIQK+PLWIIF R 
Sbjct  112  DNRKKLADCAMGFGSKATGGKAGRFYVVNDSSDDYTDPKPGTLRHAVIQKEPLWIIFDRG  171

Query  100  MNIRLNQELIMQSDKTIDGRGFQVHVSGGAGI  5
            M IRL+QELIMQSDKTID RG  VH++GGAGI
Sbjct  172  MTIRLHQELIMQSDKTIDARGANVHIAGGAGI  203



>ref|XP_009779191.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 147/203 (72%), Gaps = 8/203 (4%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            F    + FA I+ ++  HI ++DEVW++R  EA E+A + +EP+P NV+ AFN +V  T+
Sbjct  10   FFFLFIIFATIIRNLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRDTM  69

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
             E +        V  S+ TRR L  +K Y GPC  TNPIDRCWRC PNWA+NR+RLADC 
Sbjct  70   KELRQ-------VTVSNSTRRGLGTKK-YKGPCMVTNPIDRCWRCDPNWADNRKRLADCA  121

Query  250  MGFGRKAIGGKHGVLYVVNDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELI  71
            MGFG KA GGK G +Y+V D+SDD + PKPGTLR+AVIQK+PLWIIF R M IRL+QE+I
Sbjct  122  MGFGYKATGGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQEMI  181

Query  70   MQSDKTIDGRGFQVHVSGGAGIT  2
            MQSDKTID RG  VH++ GAGIT
Sbjct  182  MQSDKTIDARGANVHIAKGAGIT  204



>ref|XP_009599826.1| PREDICTED: probable pectate lyase P59 isoform X2 [Nicotiana tomentosiformis]
Length=444

 Score =   244 bits (624),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 145/203 (71%), Gaps = 11/203 (5%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            F    + FA I+P +  HI ++DEVW++R  EA E+A + +EP+P NV+ AFN +V    
Sbjct  10   FFFLFIIFATIIPCLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVR---  66

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
                   D K+    ++ TRR L  +K Y GPC  TNPIDRCWRC PNWA+NR+RLADC 
Sbjct  67   -------DMKEVTVSNNSTRRGLGTKK-YKGPCMVTNPIDRCWRCDPNWADNRKRLADCA  118

Query  250  MGFGRKAIGGKHGVLYVVNDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELI  71
            MGFG KA GGK G +Y+V D+SDD + PKPGTLR+AVIQK+PLWIIF R M IRL+QELI
Sbjct  119  MGFGSKATGGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQELI  178

Query  70   MQSDKTIDGRGFQVHVSGGAGIT  2
            MQSDKTID RG  VH++ GAGIT
Sbjct  179  MQSDKTIDARGANVHIAKGAGIT  201



>ref|XP_009599825.1| PREDICTED: probable pectate lyase P59 isoform X1 [Nicotiana tomentosiformis]
Length=445

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 146/203 (72%), Gaps = 10/203 (5%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            F    + FA I+P +  HI ++DEVW++R  EA E+A + +EP+P NV+ AFN +V  ++
Sbjct  10   FFFLFIIFATIIPCLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRDSM  69

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
                     K+    ++ TRR L  +K Y GPC  TNPIDRCWRC PNWA+NR+RLADC 
Sbjct  70   ---------KEVTVSNNSTRRGLGTKK-YKGPCMVTNPIDRCWRCDPNWADNRKRLADCA  119

Query  250  MGFGRKAIGGKHGVLYVVNDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELI  71
            MGFG KA GGK G +Y+V D+SDD + PKPGTLR+AVIQK+PLWIIF R M IRL+QELI
Sbjct  120  MGFGSKATGGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQELI  179

Query  70   MQSDKTIDGRGFQVHVSGGAGIT  2
            MQSDKTID RG  VH++ GAGIT
Sbjct  180  MQSDKTIDARGANVHIAKGAGIT  202



>ref|XP_011098575.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=449

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 147/204 (72%), Gaps = 10/204 (5%)
 Frame = -3

Query  607  CMFLVTFAIILP-SISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
             +FL  FA  LP ++  HIAE+DEVWQ+R  EAW   L+++EP P+ + +  N  VH+ L
Sbjct  10   VLFLFAFASTLPGAVRAHIAEFDEVWQRRAEEAWNRTLESYEPAPAKIVSHLNLNVHRAL  69

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
             E K E          + TRRQL+H   Y+GPC  TNPIDRCWRCQ NWA NR RLADC 
Sbjct  70   KEVKEEE------LSLNSTRRQLSH--GYDGPCRVTNPIDRCWRCQANWAQNRFRLADCV  121

Query  250  MGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
            +GFG KA GGK+G +YVV D SD D  NPKPGTLRHAVIQK+PLWIIF RDM IRL+QEL
Sbjct  122  LGFGYKAKGGKNGKIYVVTDPSDNDMVNPKPGTLRHAVIQKEPLWIIFQRDMLIRLSQEL  181

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            I+QSDKTIDGRG +V ++ GAGIT
Sbjct  182  IVQSDKTIDGRGARVLIANGAGIT  205



>ref|XP_007032453.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY03379.1| Pectate lyase family protein [Theobroma cacao]
Length=454

 Score =   237 bits (605),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 151/203 (74%), Gaps = 2/203 (1%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +FL +FA ++PS+   IAE+DEVW+QR  +AW++AL+ +EP P NV++  N  V+K LL+
Sbjct  9    VFLFSFAALIPSLWADIAEFDEVWKQRAEQAWKNALEAYEPMPENVTSNLNYNVNKALLK  68

Query  424  SKNEPDRKKFVNGSDDTRRQL-AHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGM  248
             +    R      ++ TRR L  + K Y GPC ATNPIDRCWRC+ NWA NR++LA+C +
Sbjct  69   GRANKTRAFEGVTTNSTRRNLRGNHKKYIGPCMATNPIDRCWRCRKNWARNRKQLANCVL  128

Query  247  GFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELI  71
            GFG K  GGK G  Y+V D+SDD   NP+PGTLRHAVIQK+PLWIIF+ DMNI+L+QELI
Sbjct  129  GFGHKTEGGKQGGYYLVTDNSDDNVLNPRPGTLRHAVIQKEPLWIIFAHDMNIKLSQELI  188

Query  70   MQSDKTIDGRGFQVHVSGGAGIT  2
            +QS KTIDGRG  VH++ GAGIT
Sbjct  189  VQSKKTIDGRGANVHIAYGAGIT  211



>ref|XP_009617495.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=451

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 153/207 (74%), Gaps = 6/207 (3%)
 Frame = -3

Query  619  INCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVH  440
            IN       TF  I+PS++GHI ++DEVW++R  EA E ALK +EPDP NV+ AF  +  
Sbjct  7    INLSLFLFSTFLAIIPSLNGHIGDFDEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQTK  66

Query  439  KTLLESKNEPDRKKFVNGSDDTRRQL-AHRKPYNGPCNATNPIDRCWRCQPNWANNRRRL  263
            +++ E K   + KK    ++DTRR+L    K Y GPC  TNPIDRCWRCQ NWA+NR+RL
Sbjct  67   ESMKELK---EVKKL--ATNDTRRELRGFHKNYAGPCLVTNPIDRCWRCQGNWADNRKRL  121

Query  262  ADCGMGFGRKAIGGKHGVLYVVNDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLN  83
            ADC +GFG+   GGK G  YVV D SDD SNPKPGTLRHAVIQK+PLWIIF++ MNIRL+
Sbjct  122  ADCALGFGKGTTGGKAGRFYVVTDSSDDSSNPKPGTLRHAVIQKEPLWIIFAKSMNIRLH  181

Query  82   QELIMQSDKTIDGRGFQVHVSGGAGIT  2
            QELIMQSDKTIDGRG  VH++ GAGIT
Sbjct  182  QELIMQSDKTIDGRGVNVHIAYGAGIT  208



>gb|KHG16093.1| hypothetical protein F383_07683 [Gossypium arboreum]
Length=454

 Score =   235 bits (600),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 152/205 (74%), Gaps = 6/205 (3%)
 Frame = -3

Query  604  MFLVTFAIILPSI---SGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKT  434
            +FL +FA ++P++    G+IA++D+VW++R  +AW++ L  +EP P NV++ FN+ VHK 
Sbjct  9    VFLFSFATLIPTLWGGGGNIADFDDVWKRRADQAWKNTLAAYEPSPENVTSKFNENVHKA  68

Query  433  LLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADC  254
            L+   N+ ++ K + GS+D R      K Y GPC ATNPIDRCWRC+P+WA NR+RL  C
Sbjct  69   LVA--NKSNKTKDLEGSEDRRNLRGKHKKYTGPCMATNPIDRCWRCRPDWAENRKRLTQC  126

Query  253  GMGFGRKAIGGKHGVLYVVNDHSDD-PSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQE  77
             +GFG +  GG+ G  Y V D+SDD P NPKPGTLR AVIQK+PLWIIF+ DM+I+L++E
Sbjct  127  VIGFGHRTEGGEKGKYYEVTDNSDDDPVNPKPGTLRFAVIQKRPLWIIFAHDMHIKLSRE  186

Query  76   LIMQSDKTIDGRGFQVHVSGGAGIT  2
            LI+QS KTIDGRG  VH++ GAGIT
Sbjct  187  LIVQSKKTIDGRGANVHIAHGAGIT  211



>ref|XP_006338480.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=446

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 142/190 (75%), Gaps = 7/190 (4%)
 Frame = -3

Query  571  SISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFV  392
            +I+GHI E+DEVW++R  EA E A+K ++PDP NV+ AF  +  + L E K   + K  +
Sbjct  19   AINGHIGEFDEVWRRRAQEADEWAIKAYKPDPINVTLAFAKQTGQALKEIK---EAKLAI  75

Query  391  NGSDDTRRQL-AHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKH  215
            NG   TRR+L    K YNGPC  TNPIDRCWRCQPNWA+NR+RLADC MGF +   GGK 
Sbjct  76   NG---TRRELKGGGKKYNGPCLVTNPIDRCWRCQPNWADNRKRLADCAMGFAKGTTGGKA  132

Query  214  GVLYVVNDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGF  35
            G +YVV D SDD S+PKPGTLR+ VIQK+PLWIIF++ M IRL+QELI+QSDKTIDGRG 
Sbjct  133  GEIYVVTDSSDDTSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRGV  192

Query  34   QVHVSGGAGI  5
             VH++ GAG 
Sbjct  193  NVHIANGAGF  202



>ref|XP_006357122.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=448

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 146/204 (72%), Gaps = 9/204 (4%)
 Frame = -3

Query  616  NCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHK  437
            + F +F V F  I+P+ + HI ++DEVW++R  EA +  ++T+E +P+N++ AFN +   
Sbjct  10   SLFVLFFV-FGAIIPAFNAHIGDFDEVWRRRAEEAMKFTIQTYESEPANITLAFNQKTRD  68

Query  436  TLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLAD  257
            ++ E          V   ++TRR+L  +K Y GPC  TNPID+CWRC PNWA+NR++L +
Sbjct  69   SVKELSA-------VVSKNETRRELGTKK-YEGPCTVTNPIDKCWRCDPNWADNRKKLVE  120

Query  256  CGMGFGRKAIGGKHGVLYVVNDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQE  77
            C MGFG K  GG+ G  YVV+D SDD + PKPGTLRHAVIQK+PLWIIF R+M I+L+QE
Sbjct  121  CSMGFGYKTTGGRDGKYYVVSDSSDDYTTPKPGTLRHAVIQKEPLWIIFDRNMKIKLHQE  180

Query  76   LIMQSDKTIDGRGFQVHVSGGAGI  5
            LIMQ DKTIDGRG  VH++GGA I
Sbjct  181  LIMQGDKTIDGRGATVHITGGASI  204



>ref|XP_004232242.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=446

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 142/189 (75%), Gaps = 7/189 (4%)
 Frame = -3

Query  568  ISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVN  389
            I+GHI E+DEVW++R  EA E A+K ++PDP NV+ AF  E  + L E K   + K  VN
Sbjct  20   INGHIGEFDEVWRRRAQEADEWAIKAYKPDPINVTLAFAKETGQALKEIK---EAKLAVN  76

Query  388  GSDDTRRQL-AHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHG  212
            G   TRR+L    K Y+GPC+ TNPIDRCWRCQP+WA+NR+RLADC MGF +   GGK G
Sbjct  77   G---TRRELKGGGKKYDGPCSVTNPIDRCWRCQPDWADNRKRLADCAMGFAKGTTGGKAG  133

Query  211  VLYVVNDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQ  32
             +YVV D SDD S+PKPGTLR+ VIQK+PLWIIF++ M IRL+QELI+QSDKTIDGRG  
Sbjct  134  EIYVVTDSSDDTSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRGVN  193

Query  31   VHVSGGAGI  5
            VH++ GAG 
Sbjct  194  VHIANGAGF  202



>ref|XP_010256490.1| PREDICTED: pectate lyase-like [Nelumbo nucifera]
Length=441

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 142/206 (69%), Gaps = 17/206 (8%)
 Frame = -3

Query  610  FCMFLVTF--AIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHK  437
              +FL+ F  A+I P++  HIAE+DEVWQ+R  EA ++A+  + P+P  V    N  VH 
Sbjct  8    LSLFLLAFNLAVITPTLRAHIAEFDEVWQKRAEEAKKNAMDAYHPNPDEVINHLNMNVHL  67

Query  436  TLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLAD  257
             + ES             + TRR L   KPY GPC ATNPIDRCWRCQ NW+ NR++LAD
Sbjct  68   AMQES-------------NGTRRSLK-TKPYGGPCLATNPIDRCWRCQKNWSRNRKKLAD  113

Query  256  CGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQ  80
            C +GFGRK IGGK G  YVV D SD D  NPKPGTLRHAVIQK+PLWIIF+RDM IRLNQ
Sbjct  114  CVVGFGRKTIGGKLGKFYVVTDGSDNDMLNPKPGTLRHAVIQKEPLWIIFARDMVIRLNQ  173

Query  79   ELIMQSDKTIDGRGFQVHVSGGAGIT  2
            EL+M  DKTID RG  VHV+ GAGIT
Sbjct  174  ELLMAGDKTIDARGANVHVAYGAGIT  199



>ref|XP_010066949.1| PREDICTED: pectate lyase [Eucalyptus grandis]
 gb|KCW65002.1| hypothetical protein EUGRSUZ_G02541 [Eucalyptus grandis]
Length=436

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 141/205 (69%), Gaps = 17/205 (8%)
 Frame = -3

Query  613  CFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKT  434
            CF +F  +FA+++PS+  +I E+DE W +R  EA + ALK ++P P  V++ FN +V K 
Sbjct  6    CFFLFFSSFAVLVPSLQANIEEFDEYWAKRAEEAQKDALKAYDPHPETVTSLFNAKVDKA  65

Query  433  LLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADC  254
                         V G++ TRRQL   K Y GPC ATNPIDRCWRC  NWA NR+RLA+C
Sbjct  66   -------------VRGNNSTRRQL---KKYKGPCLATNPIDRCWRCNRNWARNRKRLANC  109

Query  253  GMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQE  77
             +GFGRK  GGK G  YVV D SD D  NPKPGTLRHAV+QK PLWIIF+  M IRLNQE
Sbjct  110  VLGFGRKTRGGKRGWFYVVTDSSDNDMVNPKPGTLRHAVVQKGPLWIIFAGSMVIRLNQE  169

Query  76   LIMQSDKTIDGRGFQVHVSGGAGIT  2
            LIM SDKTID RG  VH++ GAGIT
Sbjct  170  LIMTSDKTIDARGANVHIAYGAGIT  194



>gb|KCW52797.1| hypothetical protein EUGRSUZ_J02132 [Eucalyptus grandis]
Length=451

 Score =   232 bits (591),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 147/212 (69%), Gaps = 16/212 (8%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            MA   +  F + L + A+++PS+  HI E+DE WQ+R  EA + AL+ F P+P NV+A F
Sbjct  1    MAAMKLVGFILAL-SLAVLVPSLEAHIKEFDEYWQKRAEEASQAALEAFNPEPENVTAQF  59

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANN  275
            N  V+K L             +G++ TRRQL H   Y+GPC ATNPIDRCWRC+ NWA +
Sbjct  60   NANVNKVL-------------DGNNSTRRQL-HMHKYSGPCLATNPIDRCWRCRKNWAKD  105

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDM  98
            R+RLA C +GFGRK  GG  G  YVV D SD D  NPKPGTLRHAVIQK+PLWIIF+R M
Sbjct  106  RKRLAKCVLGFGRKTTGGLKGKYYVVYDCSDNDVVNPKPGTLRHAVIQKRPLWIIFARSM  165

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             IRLNQEL++ S KTIDGRG  VH++ GAGIT
Sbjct  166  VIRLNQELMVASHKTIDGRGANVHIAFGAGIT  197



>ref|XP_009802165.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=451

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 150/209 (72%), Gaps = 10/209 (5%)
 Frame = -3

Query  619  INCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVH  440
            IN       TF  I+PS++GHI  +DEVW++R  EA E ALK +EPDP NV+ AF  +  
Sbjct  7    INLSLFLFSTFLAIIPSLNGHIGNFDEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQTR  66

Query  439  KTLLESKNEPDRKKFVN--GSDDTRRQL-AHRKPYNGPCNATNPIDRCWRCQPNWANNRR  269
            +++ E K        VN   +++TRR+L    K Y GPC  TNPIDRCWRCQ NWA+NR+
Sbjct  67   ESMKELKE-------VNKLSTNETRRELRGFHKIYAGPCLVTNPIDRCWRCQGNWADNRK  119

Query  268  RLADCGMGFGRKAIGGKHGVLYVVNDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRDMNIR  89
            RLADC MGFG+   GGK G  YVV D SDD SNPKPGTLRHAVIQK+PLWIIF++ M IR
Sbjct  120  RLADCAMGFGKGTTGGKAGQFYVVTDSSDDSSNPKPGTLRHAVIQKEPLWIIFAKSMTIR  179

Query  88   LNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            L+QELIMQSDKTIDGRG  VH++ GAGIT
Sbjct  180  LHQELIMQSDKTIDGRGVNVHIAYGAGIT  208



>ref|XP_010033216.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
Length=435

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 143/202 (71%), Gaps = 15/202 (7%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +  ++ A+++PS+  HI E+DE WQ+R  EA + AL+ F P+P NV+A FN  V+K L  
Sbjct  7    ILALSLAVLVPSLEAHIKEFDEYWQKRAEEASQAALEAFNPEPENVTAQFNANVNKVL--  64

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                       +G++ TRRQL H   Y+GPC ATNPIDRCWRC+ NWA +R+RLA C +G
Sbjct  65   -----------DGNNSTRRQL-HMHKYSGPCLATNPIDRCWRCRKNWAKDRKRLAKCVLG  112

Query  244  FGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FGRK  GG  G  YVV D SD D  NPKPGTLRHAVIQK+PLWIIF+R M IRLNQEL++
Sbjct  113  FGRKTTGGLKGKYYVVYDCSDNDVVNPKPGTLRHAVIQKRPLWIIFARSMVIRLNQELMV  172

Query  67   QSDKTIDGRGFQVHVSGGAGIT  2
             S KTIDGRG  VH++ GAGIT
Sbjct  173  ASHKTIDGRGANVHIAFGAGIT  194



>ref|XP_011025954.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=441

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 145/204 (71%), Gaps = 16/204 (8%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            F    V+ A+ +P++ GHI E+DE W+++  EA + A + F PDP NV++ FN +V+K L
Sbjct  10   FFSLFVSLAVFVPTLQGHIGEFDEYWKKKADEARKAAQEAFYPDPLNVTSQFNFQVNKVL  69

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
             E+             + TRR L  ++   G C ATNPIDRCWRC PNWA++R++LADC 
Sbjct  70   TET-------------NSTRRSLVRKR--GGRCIATNPIDRCWRCDPNWASHRQKLADCV  114

Query  250  MGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
            +GFG K +GGK+G +YVV D SD D  NPKPGTLRHAVIQK+PLWIIFS  M IRLNQEL
Sbjct  115  LGFGHKTVGGKYGKIYVVTDASDNDMLNPKPGTLRHAVIQKEPLWIIFSGSMVIRLNQEL  174

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            ++ S+KTID RGF+VH++ GAGIT
Sbjct  175  MVASNKTIDSRGFKVHIAYGAGIT  198



>ref|XP_010242445.1| PREDICTED: pectate lyase [Nelumbo nucifera]
Length=443

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 136/196 (69%), Gaps = 11/196 (6%)
 Frame = -3

Query  586  AIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPD  407
            A I+P++  HI ++DEVWQ+R  EA  +AL+ + PDP  V   FN  VH    E ++   
Sbjct  20   AAIIPTLRAHIGDFDEVWQKRAEEAKSNALEAYHPDPDEVINHFNHHVHLATAEVRS---  76

Query  406  RKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAI  227
                  G+  TRR L + K Y GPC ATNPIDRCWRC+  W  NR++LADC +GFGRK +
Sbjct  77   ------GNSSTRRSLRN-KEYKGPCMATNPIDRCWRCRSKWGKNRKKLADCVLGFGRKTV  129

Query  226  GGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTI  50
            GGK+G  YVV D SDD   NPKPGTLRHAVIQ +PLWIIF  DM IRL QELIM SDKT+
Sbjct  130  GGKYGKFYVVTDGSDDDMENPKPGTLRHAVIQTEPLWIIFEHDMIIRLKQELIMTSDKTL  189

Query  49   DGRGFQVHVSGGAGIT  2
            DGRG +VH++ GAGIT
Sbjct  190  DGRGARVHIAYGAGIT  205



>ref|XP_011005067.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=452

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 148/203 (73%), Gaps = 2/203 (1%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +F +T A ++P++   IA +DEVWQ+R  EA +  L ++ P+P + +  FN EV+ TL++
Sbjct  9    IFAITLATLIPALLADIAFFDEVWQKRAEEAKKVTLNSYVPNPEDATDDFNFEVNNTLVD  68

Query  424  SKNEPDRKKFVNGSDDTRRQLAH-RKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGM  248
              ++ +   F   ++ TRR L   +K Y GPC  TNPID+CWRC+ NWA NR+RLA C +
Sbjct  69   FDDDGNDAGFELLANSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRKRLAKCAL  128

Query  247  GFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELI  71
            GFGR+A GG  G +YVV ++SDD   NPKPGTLRHAVIQK+PLWIIFS++MNIRL++ELI
Sbjct  129  GFGRRATGGLKGRVYVVTENSDDDVMNPKPGTLRHAVIQKEPLWIIFSKNMNIRLSKELI  188

Query  70   MQSDKTIDGRGFQVHVSGGAGIT  2
            M S KTIDGRG  +H++ GAGIT
Sbjct  189  MTSHKTIDGRGHHIHIAYGAGIT  211



>ref|XP_007046218.1| Pectate lyase family protein, putative [Theobroma cacao]
 gb|EOY02050.1| Pectate lyase family protein, putative [Theobroma cacao]
Length=441

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 137/196 (70%), Gaps = 15/196 (8%)
 Frame = -3

Query  586  AIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPD  407
             +I+P++  HIAE+D+ W+QR+ EA EH  K + P+P  V+  FN  V +TL+       
Sbjct  18   VVIIPTLHAHIAEYDDYWRQREAEAKEHFNKAYNPNPEEVTQHFNHHVARTLM-------  70

Query  406  RKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAI  227
                  G + TRR L  ++   GPC ATNPID+CWRC PNW  NR+RLADC +GFGR  I
Sbjct  71   ------GFNSTRRSLRGKR-RTGPCQATNPIDQCWRCDPNWHRNRKRLADCSLGFGRGTI  123

Query  226  GGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTI  50
            GGK+G  Y+V D SD D  NPKPGTLRHAVIQK+PLWIIF+R M I+LNQELIM SDKTI
Sbjct  124  GGKNGRYYIVTDPSDNDMVNPKPGTLRHAVIQKRPLWIIFARSMIIKLNQELIMTSDKTI  183

Query  49   DGRGFQVHVSGGAGIT  2
            D RG  VHV+ GAGIT
Sbjct  184  DARGANVHVAYGAGIT  199



>ref|XP_002323835.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
 gb|EEF03968.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
Length=452

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 146/203 (72%), Gaps = 2/203 (1%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +F +T A ++P +   IA +DEVWQ+R  EA +  L ++ P+P + +  FN EV+ TL++
Sbjct  9    IFAITLATLIPGLLADIAFFDEVWQKRAEEAKKVTLNSYIPNPEDATDDFNFEVNNTLVD  68

Query  424  SKNEPDRKKFVNGSDDTRRQLAH-RKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGM  248
              ++ +   F   ++ TRR L   +K Y GPC  TNPID+CWRC+ NWA NR+RLA C +
Sbjct  69   FDDDRNDAGFELHANSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRKRLAKCAL  128

Query  247  GFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELI  71
            GFGR+A GG  G +YVV ++SDD   NPKPGTLRHAVIQK PLWIIFS++MNIRL++ELI
Sbjct  129  GFGRRATGGLKGRVYVVTENSDDDVMNPKPGTLRHAVIQKGPLWIIFSKNMNIRLSKELI  188

Query  70   MQSDKTIDGRGFQVHVSGGAGIT  2
            M S KTIDGRG  +H++ GAGIT
Sbjct  189  MTSHKTIDGRGHHIHIAYGAGIT  211



>ref|XP_010112093.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXC32626.1| putative pectate lyase 7 [Morus notabilis]
Length=437

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 145/202 (72%), Gaps = 17/202 (8%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +FL+ F +++PS+  +I ++DE WQQR  EA + AL+ ++P+P  V+ +FN+EV      
Sbjct  10   VFLIGFVVLIPSLQANIGDFDESWQQRAEEAHKAALEAYDPNPEEVTDSFNEEV------  63

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                    K ++GS+ TRR+L   + Y+GPC ATNPIDRCWRC+ NWA+NR+RLA C +G
Sbjct  64   -------DKVIDGSNSTRREL---RRYSGPCAATNPIDRCWRCRSNWASNRKRLARCVLG  113

Query  244  FGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FGRK  GG+ G  YVV D SD D  NP+PGTLRHAVIQK+PLWIIF+  M IRL+QEL++
Sbjct  114  FGRKTTGGRSGRYYVVTDPSDNDVQNPRPGTLRHAVIQKQPLWIIFAHSMIIRLSQELLI  173

Query  67   QSDKTIDGRGFQVHVSGGAGIT  2
             S KTID RG  +H++ GAGIT
Sbjct  174  TSHKTIDARGANIHIANGAGIT  195



>gb|KHN13652.1| Pectate lyase [Glycine soja]
Length=440

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 145/212 (68%), Gaps = 15/212 (7%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            MAG       +FLV FAI +P +   IAE+D+  + +  EA E AL+++EPDP NV+A F
Sbjct  1    MAGSASKVTFIFLVAFAISIPCLEAGIAEFDDFLKAQADEAHEIALRSYEPDPINVTAEF  60

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANN  275
            N  VH+ L+E  N            DTRR+L  ++ Y GPC ATNPIDRCWRC+ +WA +
Sbjct  61   NIHVHRALMEESN------------DTRREL--KQKYRGPCLATNPIDRCWRCRKDWAQD  106

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHSDD-PSNPKPGTLRHAVIQKKPLWIIFSRDM  98
            R RLA CG GFGR+A+GG HG +YVV D SDD P NP+PGTLR+ V+Q++PLWIIF++ M
Sbjct  107  RYRLASCGKGFGRRAVGGLHGKIYVVTDSSDDEPINPRPGTLRYGVLQREPLWIIFAQSM  166

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             I L  EL++ SDKTIDGRG  V + GGAG+ 
Sbjct  167  VITLKFELLISSDKTIDGRGANVVIKGGAGLA  198



>ref|XP_003552513.1| PREDICTED: pectate lyase-like [Glycine max]
Length=440

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 145/212 (68%), Gaps = 15/212 (7%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            MAG       +FLV FAI +P +   IAE+D+  + +  EA E AL+++EPDP NV+A F
Sbjct  1    MAGSASKVTFIFLVAFAISIPCLEAGIAEFDDFLKAQADEAHEIALRSYEPDPINVTAEF  60

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANN  275
            N  VH+ L+E  N            DTRR+L  ++ Y GPC ATNPIDRCWRC+ +WA +
Sbjct  61   NIHVHRALMEESN------------DTRREL--KQKYRGPCLATNPIDRCWRCRKDWAQD  106

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHSDD-PSNPKPGTLRHAVIQKKPLWIIFSRDM  98
            R RLA CG GFGR+A+GG HG +YVV D SDD P NP+PGTLR+ V+Q++PLWIIF++ M
Sbjct  107  RYRLASCGKGFGRRAVGGLHGKIYVVTDSSDDEPINPRPGTLRYGVLQREPLWIIFAQSM  166

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             I L  EL++ SDKTIDGRG  V + GGAG+ 
Sbjct  167  VITLKFELLISSDKTIDGRGANVVIKGGAGLA  198



>gb|EPS66620.1| hypothetical protein M569_08154, partial [Genlisea aurea]
Length=451

 Score =   224 bits (571),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 143/207 (69%), Gaps = 8/207 (4%)
 Frame = -3

Query  610  FCMFLVTFAI---ILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVH  440
            F + L   AI   ++P+    IAE+D+ W++R+ EAW   L ++EP+P+ +    N   H
Sbjct  3    FALALSVVAISSCLVPTSDARIAEYDDFWKKRRAEAWNRTLLSYEPNPAKIVTHLNLHSH  62

Query  439  KTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLA  260
            + LL   N  D    V   + TRR L  R+ YNGPC  TNPIDRCWRC+ +WA NR RLA
Sbjct  63   R-LLHELNATDHFHLVG--NHTRRSLRGRR-YNGPCTVTNPIDRCWRCRSDWATNRFRLA  118

Query  259  DCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLN  83
            DCG+GFG KA GGK+G +YVV D SD D  NPKPGTLRHAVIQ  PLWI+F+R M IRL+
Sbjct  119  DCGLGFGYKAKGGKNGPIYVVTDSSDNDMVNPKPGTLRHAVIQPGPLWIVFARSMVIRLS  178

Query  82   QELIMQSDKTIDGRGFQVHVSGGAGIT  2
            QEL++ SDKTIDGRG +VHV+ GAGIT
Sbjct  179  QELLVTSDKTIDGRGARVHVAYGAGIT  205



>ref|XP_008357758.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=459

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 146/211 (69%), Gaps = 13/211 (6%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISG-------HIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFN  452
              +F+++F +++PS+         +IA +D VWQ+R ++A + ALK ++P+P  V+  FN
Sbjct  12   LVLFMISFCMLVPSLKAETANDTLNIANFDAVWQERAMKAQKAALKAYQPNPEQVTEDFN  71

Query  451  DEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNR  272
            + V +T++E   E D+    +  + TRR L   K Y GPC ATNPIDRCWRC+ NWANNR
Sbjct  72   ESVEQTVVEEDLEDDQ----SAGNSTRRNL-RGKXYKGPCKATNPIDRCWRCRANWANNR  126

Query  271  RRLADCGMGFGRKAIGGKHGVLYVVNDHSDD-PSNPKPGTLRHAVIQKKPLWIIFSRDMN  95
            ++LA C  GFGRK  GGK G  Y+V D SDD   +PKPGTLRHAVIQ +PLWIIF+R M 
Sbjct  127  KKLASCVKGFGRKTRGGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMV  186

Query  94   IRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IRL+QELI+ S KTID RG  VH++ GAGIT
Sbjct  187  IRLSQELIVTSHKTIDARGANVHIAHGAGIT  217



>ref|XP_011085777.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=446

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 138/212 (65%), Gaps = 8/212 (4%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            M G  +N   +     A ILP +  +IAE+DEVW++R  EA+   L+ +EPDP  V   F
Sbjct  1    MEGTKVNWLPILFFVVASILPVLRANIAEYDEVWRRRAAEAYNRTLQAYEPDPLKVVMHF  60

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANN  275
            N+ VH+ + ES         +   + TRR+L   K Y GPC  TNPID CWRC PNW  N
Sbjct  61   NENVHRHIKESGGVD-----MMMLNSTRRRLG--KKYRGPCKVTNPIDACWRCDPNWHLN  113

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDM  98
            R +LADC +GFGRKA GGK G +YVV D SDD    PKPGTLRHAVIQ++PLWI F R M
Sbjct  114  RFKLADCSLGFGRKATGGKGGRIYVVTDPSDDDILTPKPGTLRHAVIQEEPLWITFKRSM  173

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             I L QELIM SDKTIDGRG +V ++ GAGIT
Sbjct  174  VITLAQELIMTSDKTIDGRGVKVQIAHGAGIT  205



>emb|CDP14850.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 143/203 (70%), Gaps = 19/203 (9%)
 Frame = -3

Query  601  FLVTFAII--LPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLL  428
             ++ FA+I  + +I  HIAE+DEVWQ+R  EA + A + + P+P NV++ FN+EVH++  
Sbjct  8    LILAFALIALVYTIEAHIAEFDEVWQKRAEEAKKAARQAYHPNPENVTSHFNEEVHRS--  65

Query  427  ESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGM  248
                       ++G +  RR L     YNGPC ATNPID+CWRCQ NW  NR +LADC +
Sbjct  66   -----------IDGHNSRRRDL---HKYNGPCTATNPIDQCWRCQKNWRKNRMKLADCAL  111

Query  247  GFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELI  71
            GFGR A GGK G +Y V D SD D  NPKPGTLRHA+IQ +PLW+IF+++M IRL+QELI
Sbjct  112  GFGRHATGGKGGRIYKVTDPSDNDLVNPKPGTLRHALIQPEPLWVIFTKNMVIRLSQELI  171

Query  70   MQSDKTIDGRGFQVHVSGGAGIT  2
            M S+KTIDGRG QVH++ GAG T
Sbjct  172  MTSNKTIDGRGVQVHIAYGAGFT  194



>ref|XP_002311599.2| pectate lyase family protein [Populus trichocarpa]
 gb|EEE88966.2| pectate lyase family protein [Populus trichocarpa]
Length=441

 Score =   221 bits (564),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 142/204 (70%), Gaps = 16/204 (8%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            F    V+ A  +P++ GHI E+DE W+++  EA + A + F PDP NV+  FN +V+K +
Sbjct  10   FFSLFVSLAAFVPTLQGHIGEFDEYWKKKADEALKAAQEAFYPDPMNVTNQFNFQVNKVM  69

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
             E+             + TRR L  ++   G C ATNPIDRCWRC PNWA++R++LADC 
Sbjct  70   TET-------------NSTRRSLVSKR--GGRCMATNPIDRCWRCDPNWASHRQKLADCV  114

Query  250  MGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
            +GFG K +GGK+G +YVV D SD D  NPKPGTLRHAVIQK+PLWIIFS  M IRLNQEL
Sbjct  115  LGFGHKTVGGKYGKIYVVTDASDNDMLNPKPGTLRHAVIQKEPLWIIFSGSMVIRLNQEL  174

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            ++ S+KTID RG +VH++ GAGIT
Sbjct  175  MVASNKTIDSRGAKVHIAYGAGIT  198



>emb|CDP02198.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 140/221 (63%), Gaps = 20/221 (9%)
 Frame = -3

Query  607  CMFLVTFAII----LPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVH  440
            C+FL  F I+    L +  G  +  +E W+ R  EAW H LK +E +P  V  AFN +  
Sbjct  10   CVFLCAFTIVVVPTLITAQGSGSAEEEYWRIRAEEAWNHTLKAYEANPHTVIGAFNKQAS  69

Query  439  KTLLESKNEPDRKK--------------FVNGSDDTRRQLAHRKPYNGPCNATNPIDRCW  302
            +  +  K      K              F++  + TRR+L  +K + G C ATNPIDRCW
Sbjct  70   ENEMPGKTAAQDDKLTKLNLPPCCHTQQFLSEKNSTRRELRGKK-WGGGCLATNPIDRCW  128

Query  301  RCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKP  125
            RCQPNWA+NR+RLADC +GFGR   GGK+G  YVV D SDD    PKPGTLRHAVIQK+P
Sbjct  129  RCQPNWADNRKRLADCVVGFGRGTTGGKNGAFYVVTDSSDDSILAPKPGTLRHAVIQKEP  188

Query  124  LWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            LWIIF RDM IRL QELIMQ DKTIDGRG  VH++ GAGIT
Sbjct  189  LWIIFERDMVIRLTQELIMQGDKTIDGRGVSVHIAYGAGIT  229



>ref|XP_004152537.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=434

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 140/202 (69%), Gaps = 17/202 (8%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            + +  F +I P++  +IA++DEVWQ+R IEA + + + +EP P   +  FN +VH++L  
Sbjct  14   LMIFGFVMIFPTLKANIADFDEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHRSL--  71

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                       +G ++TRR L   + Y GPC ATNPIDRCWRC  NWA NR++LADC +G
Sbjct  72   -----------DGGNNTRRHL---RKYTGPCLATNPIDRCWRCDRNWARNRKKLADCALG  117

Query  244  FGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FGR+  GGK G +YVV D SD D  NPKPGTLRHAVIQ++PLWIIF+ DM IRL++ELI+
Sbjct  118  FGRRTTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIV  177

Query  67   QSDKTIDGRGFQVHVSGGAGIT  2
              DKT+DGRG  VH++ G  IT
Sbjct  178  TDDKTLDGRGANVHIANGGQIT  199



>ref|XP_011085780.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=447

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 138/212 (65%), Gaps = 7/212 (3%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            M G  +N   +  + FA ILP +   IAE+DEVW++R  EA+   ++ + PDP  V   F
Sbjct  1    MEGTKLNWLLISFLAFASILPLLRADIAEYDEVWRRRAAEAYNRTVQAYHPDPLKVVMHF  60

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANN  275
            N  V+K + ES    D    V   + TRR L   K Y GPC  TNPID CWRC P W  N
Sbjct  61   NKHVNKHVEESGGLDD----VMMLNTTRRHLG--KAYKGPCKVTNPIDACWRCNPKWHLN  114

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFSRDM  98
            R RLADCGMGFG KA GGK G +Y+V D SDD   NPKPGTLRHAVIQ++PLWI F R+M
Sbjct  115  RFRLADCGMGFGSKATGGKGGRIYMVTDKSDDDVLNPKPGTLRHAVIQEEPLWITFRRNM  174

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             I+L QEL++ SDKTIDGRG  V ++ GAGIT
Sbjct  175  VIKLKQELMVTSDKTIDGRGAIVQIAYGAGIT  206



>gb|EYU34111.1| hypothetical protein MIMGU_mgv1a006386mg [Erythranthe guttata]
Length=446

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 148/205 (72%), Gaps = 11/205 (5%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
                L+ FA  LPSIS + A++D+ W +R ++AW + L+++E  P+ + +  N       
Sbjct  7    LLFLLIAFASALPSISANFADFDDYWLKRSVQAWNNTLQSYESHPAKIVSHLN-------  59

Query  430  LESKNEPDRKKFVN-GSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADC  254
            L SK      K +N  S+ +RRQLAH   Y GPC ATNPIDRCWRCQ NWA+NR RLADC
Sbjct  60   LHSKRALKEIKDINLVSNSSRRQLAH--GYEGPCMATNPIDRCWRCQANWADNRFRLADC  117

Query  253  GMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQE  77
            G+GFG KA GGK G +YVVND SD D  NPKPGTLRHAVIQ +PLWIIFSR M IRL+QE
Sbjct  118  GLGFGYKAKGGKGGRIYVVNDSSDGDMVNPKPGTLRHAVIQTEPLWIIFSRSMVIRLSQE  177

Query  76   LIMQSDKTIDGRGFQVHVSGGAGIT  2
            LIMQSDKTIDGRG +VH++GGAGIT
Sbjct  178  LIMQSDKTIDGRGVRVHITGGAGIT  202



>ref|XP_004165454.1| PREDICTED: pectate lyase-like [Cucumis sativus]
 gb|KGN64253.1| hypothetical protein Csa_1G045510 [Cucumis sativus]
Length=439

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 140/202 (69%), Gaps = 17/202 (8%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            + +  F +I P++  +IA++DEVWQ+R IEA + + + +EP P   +  FN +VH++L  
Sbjct  14   LMIFGFVMIFPTLKANIADFDEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHRSL--  71

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                       +G ++TRR   H + Y GPC ATNPIDRCWRC  NWA NR++LADC +G
Sbjct  72   -----------DGGNNTRR---HLRKYTGPCLATNPIDRCWRCDRNWARNRKKLADCALG  117

Query  244  FGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FGR+  GGK G +YVV D SD D  NPKPGTLRHAVIQ++PLWIIF+ DM IRL++ELI+
Sbjct  118  FGRRTTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIV  177

Query  67   QSDKTIDGRGFQVHVSGGAGIT  2
              DKT+DGRG  VH++ G  IT
Sbjct  178  TDDKTLDGRGANVHIANGGQIT  199



>emb|CAN79927.1| hypothetical protein VITISV_042447 [Vitis vinifera]
Length=439

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 136/195 (70%), Gaps = 17/195 (9%)
 Frame = -3

Query  583  IILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDR  404
            ++ PSI  HI E+DEVWQ+R  EA + AL+ ++P+P  V+  FN  V K++         
Sbjct  19   VLAPSIRAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSM---------  69

Query  403  KKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIG  224
                 G++ TRR L   +  NGPC ATNPIDRCWRC+ +WA NR++LADC +GFGR+  G
Sbjct  70   ----QGTNTTRRNL---RSNNGPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTG  122

Query  223  GKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTID  47
            GK G  YVV D SD D  +PKPGTLRHAVIQK+PLWIIF+RDM IRL QELIM  +KTID
Sbjct  123  GKDGEFYVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTID  182

Query  46   GRGFQVHVSGGAGIT  2
            GRG  VH++ G GIT
Sbjct  183  GRGANVHIAYGCGIT  197



>ref|XP_002282500.3| PREDICTED: pectate lyase [Vitis vinifera]
Length=443

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 136/195 (70%), Gaps = 17/195 (9%)
 Frame = -3

Query  583  IILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDR  404
            ++ PSI  HI E+DEVWQ+R  EA + AL+ ++P+P  V+  FN  V K++         
Sbjct  23   VLAPSIRAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSM---------  73

Query  403  KKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIG  224
                 G++ TRR L   +  NGPC ATNPIDRCWRC+ +WA NR++LADC +GFGR+  G
Sbjct  74   ----QGTNTTRRNL---RSNNGPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTG  126

Query  223  GKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTID  47
            GK G  YVV D SD D  +PKPGTLRHAVIQK+PLWIIF+RDM IRL QELIM  +KTID
Sbjct  127  GKDGEFYVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTID  186

Query  46   GRGFQVHVSGGAGIT  2
            GRG  VH++ G GIT
Sbjct  187  GRGANVHIAYGCGIT  201



>ref|XP_009342871.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=454

 Score =   219 bits (559),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 147/212 (69%), Gaps = 15/212 (7%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISG-------HIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFN  452
              +F+++F +++PS+         +IA +D VWQ+R ++A + ALK ++P+P  V+  FN
Sbjct  7    LVLFMISFCMLVPSLKAETANDTLNIANFDAVWQERGMKAQKAALKAYQPNPEQVTEDFN  66

Query  451  DEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYN-GPCNATNPIDRCWRCQPNWANN  275
            + V +T++E   E D+    +  + TRR L  R  +N GPC ATNPIDRCWRC+ NWANN
Sbjct  67   ESVEQTVVEEDLEDDQ----SAGNSTRRHL--RGKHNKGPCKATNPIDRCWRCRANWANN  120

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHSDD-PSNPKPGTLRHAVIQKKPLWIIFSRDM  98
            R++LA C  GFGRK  GGK G  Y+V D SDD   +PKPGTLRHAVIQ +PLWIIF+R M
Sbjct  121  RKKLASCVKGFGRKTRGGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSM  180

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             IRL+QELI+ S KTID RG  VH++ GAGIT
Sbjct  181  VIRLSQELIVTSHKTIDARGANVHIAHGAGIT  212



>ref|XP_002270089.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32015.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   219 bits (558),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 134/196 (68%), Gaps = 17/196 (9%)
 Frame = -3

Query  586  AIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPD  407
            A+I P+I  HIAE+D+ W++R+ EA + AL+ F P P  V+  FN  V   L        
Sbjct  18   AVIAPTIRAHIAEYDDYWKEREEEAKKAALEAFHPTPQEVNDHFNLHVEDEL--------  69

Query  406  RKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAI  227
                  GS+ TRR L   K   GPC ATNPIDRCWRC+PNWA+ R+RLADC +GFGR  +
Sbjct  70   -----TGSNGTRRSLRVNK---GPCKATNPIDRCWRCRPNWASQRKRLADCVLGFGRNTV  121

Query  226  GGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTI  50
            GGK+G  Y V D SD D  NPK GTLRHAVIQ +PLWI+F+R M IRLNQELIM SDKTI
Sbjct  122  GGKYGKYYFVTDPSDNDMVNPKKGTLRHAVIQPRPLWIVFARSMIIRLNQELIMTSDKTI  181

Query  49   DGRGFQVHVSGGAGIT  2
            DGRG  VH++ GAGIT
Sbjct  182  DGRGVNVHIAYGAGIT  197



>emb|CAN69905.1| hypothetical protein VITISV_001007 [Vitis vinifera]
Length=358

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 134/196 (68%), Gaps = 17/196 (9%)
 Frame = -3

Query  586  AIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPD  407
            A+I P+I  +IAE+D+ W++R+ EA + AL+ F P P  V+  FN  V   L        
Sbjct  18   AVIAPTIRANIAEYDDYWKEREEEAKKAALEAFHPTPQEVNDHFNLHVEDEL--------  69

Query  406  RKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAI  227
                  GS+ TRR L   K   GPC ATNPIDRCWRC+PNWA+ R+RLADC +GFGR  +
Sbjct  70   -----TGSNGTRRSLRVNK---GPCKATNPIDRCWRCRPNWASQRKRLADCVLGFGRNTV  121

Query  226  GGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTI  50
            GGK+G  Y V D SD D  NPK GTLRHAVIQ +PLWI+F+R M IRLNQELIM SDKTI
Sbjct  122  GGKYGKYYFVTDPSDNDMVNPKKGTLRHAVIQPRPLWIVFARSMIIRLNQELIMTSDKTI  181

Query  49   DGRGFQVHVSGGAGIT  2
            DGRG  VH++ GAGIT
Sbjct  182  DGRGVNVHIAYGAGIT  197



>gb|KHG08055.1| putative pectate lyase P59 [Gossypium arboreum]
 gb|KHG08558.1| putative pectate lyase P59 [Gossypium arboreum]
Length=440

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 138/204 (68%), Gaps = 15/204 (7%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            F + L  FA I+P++ GHI E+DE W+QR++EA E+  + + P+P  V+   N  V ++L
Sbjct  9    FKLLLFLFAAIIPALQGHIGEYDENWKQRELEAKENTEQAYNPNPEEVTQHVNHLVSRSL  68

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
            +             G + TRR L  RK   GPC+ TNPID+CWRC  NW  NR+RLADC 
Sbjct  69   M-------------GLNSTRRHLRARKK-GGPCDPTNPIDQCWRCDRNWEKNRQRLADCA  114

Query  250  MGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
            +GF R  IGGK+G +YVV D SDD   NPKPGTLRHAVIQK+PLWIIF+R M IRL +EL
Sbjct  115  IGFARGTIGGKYGRIYVVTDPSDDDLLNPKPGTLRHAVIQKEPLWIIFARAMIIRLKEEL  174

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            IM  +KTID RG  VHV+ GAGIT
Sbjct  175  IMSGNKTIDARGANVHVAYGAGIT  198



>emb|CBI22159.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 136/195 (70%), Gaps = 17/195 (9%)
 Frame = -3

Query  583  IILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDR  404
            ++ PSI  HI E+DEVWQ+R  EA + AL+ ++P+P  V+  FN  V K++         
Sbjct  48   VLAPSIRAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSM---------  98

Query  403  KKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIG  224
                 G++ TRR L   +  NGPC ATNPIDRCWRC+ +WA NR++LADC +GFGR+  G
Sbjct  99   ----QGTNTTRRNL---RSNNGPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTG  151

Query  223  GKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTID  47
            GK G  YVV D SD D  +PKPGTLRHAVIQK+PLWIIF+RDM IRL QELIM  +KTID
Sbjct  152  GKDGEFYVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTID  211

Query  46   GRGFQVHVSGGAGIT  2
            GRG  VH++ G GIT
Sbjct  212  GRGANVHIAYGCGIT  226



>ref|XP_008341537.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=454

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 141/211 (67%), Gaps = 13/211 (6%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISG-------HIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFN  452
              + +++F +++PS+         +IAE+D VWQQR ++A + ALK ++P+P  V+  FN
Sbjct  7    LALLMISFCMLVPSLKAETQNDTLNIAEFDSVWQQRALKAQKAALKAYQPNPEQVTEDFN  66

Query  451  DEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNR  272
            + V  T++E  ++        G+   R  L  R  Y GPC ATNPIDRCWRCQ NWA+NR
Sbjct  67   ESVEMTIIEDDHD---DDHAAGNSTGRHLLGKR--YTGPCKATNPIDRCWRCQANWADNR  121

Query  271  RRLADCGMGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMN  95
            + LA C  GFGRK  GGK G  Y+V D SDD   +PKPGTLRHAVIQK+PLWIIF+R M 
Sbjct  122  KHLASCVKGFGRKTRGGKKGAYYIVTDSSDDNIHDPKPGTLRHAVIQKQPLWIIFARSMV  181

Query  94   IRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IRL QELI+ S KTID RG  VH++ GAGIT
Sbjct  182  IRLTQELIVTSHKTIDARGANVHIAHGAGIT  212



>gb|KHG07401.1| putative pectate lyase P59 [Gossypium arboreum]
Length=442

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 140/213 (66%), Gaps = 15/213 (7%)
 Frame = -3

Query  634  MAGFNINCFCM--FLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSA  461
            MAG     F +  + +   +I+PS+  HIAE+D+ W++R+++A E+  K + P+P  V+ 
Sbjct  1    MAGVGNRSFSLILYFLCLGVIIPSLEAHIAEYDDYWRERELQAKENLEKAYNPNPEEVTQ  60

Query  460  AFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWA  281
             FND V + L+  +           ++ TRR L  RK   GPC ATNPID+CWRC  NW 
Sbjct  61   HFNDHVARILMGFR-----------TNSTRRMLKKRK--GGPCEATNPIDQCWRCDRNWE  107

Query  280  NNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRD  101
             NR++LADC +GFGR   GGK G +YVV D +DD  NP  GTLRHAVIQ +PLWI F+R 
Sbjct  108  KNRKKLADCALGFGRGTTGGKDGPIYVVTDPTDDVLNPSRGTLRHAVIQNRPLWITFARG  167

Query  100  MNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            M IRL +EL+M S+KTIDGRG  VH++ GAGIT
Sbjct  168  MIIRLKEELLMTSNKTIDGRGANVHIAYGAGIT  200



>gb|KGN59593.1| hypothetical protein Csa_3G827350 [Cucumis sativus]
Length=441

 Score =   216 bits (551),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 143/213 (67%), Gaps = 15/213 (7%)
 Frame = -3

Query  637  IMAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAA  458
            +M G  I    M LV+ A+++P++   IAE+D+   Q+  EA + +L+ F PDP NV+  
Sbjct  1    MMTGCKIKV-VMVLVSMAVLMPTLRAGIAEFDDFLLQKSEEAKQASLEAFHPDPMNVTDH  59

Query  457  FNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWAN  278
            FN  VH  L          + + GS+ TRR L+    YNGPC ATNPIDRCWRC PNWA 
Sbjct  60   FNQHVHLAL----------EGIEGSNSTRRSLS---KYNGPCLATNPIDRCWRCDPNWAK  106

Query  277  NRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRD  101
            NR++LA C +GFGRK  GGK G +YVV D SD D  NP+PGTLR+  +QKKPLWIIF+R 
Sbjct  107  NRKKLAKCVLGFGRKTTGGKKGRIYVVTDPSDNDVINPRPGTLRYGALQKKPLWIIFARS  166

Query  100  MNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            M IRL++EL++ S KTID RG  VH++ GAG++
Sbjct  167  MIIRLSKELMITSHKTIDARGANVHIAYGAGLS  199



>ref|XP_004147462.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
 ref|XP_004163529.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
Length=431

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 139/202 (69%), Gaps = 14/202 (7%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            M LV+ A+++P++   IAE+D+   Q+  EA + +L+ F PDP NV+  FN  VH  L  
Sbjct  1    MVLVSMAVLMPTLRAGIAEFDDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVHLAL--  58

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                    + + GS+ TRR L+    YNGPC ATNPIDRCWRC PNWA NR++LA C +G
Sbjct  59   --------EGIEGSNSTRRSLS---KYNGPCLATNPIDRCWRCDPNWAKNRKKLAKCVLG  107

Query  244  FGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FGRK  GGK G +YVV D SD D  NP+PGTLR+  +QKKPLWIIF+R M IRL++EL++
Sbjct  108  FGRKTTGGKKGRIYVVTDPSDNDVINPRPGTLRYGALQKKPLWIIFARSMIIRLSKELMI  167

Query  67   QSDKTIDGRGFQVHVSGGAGIT  2
             S KTID RG  VH++ GAG++
Sbjct  168  TSHKTIDARGANVHIAYGAGLS  189



>gb|EYU36839.1| hypothetical protein MIMGU_mgv1a006379mg [Erythranthe guttata]
Length=446

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 149/203 (73%), Gaps = 10/203 (5%)
 Frame = -3

Query  604  MFL-VTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLL  428
            +FL + FA  LPSIS +  + DE W +R ++AW + L+++EP P+ + +  N    + L 
Sbjct  8    LFLSIAFAYALPSISANFLDSDEYWVKRSVQAWNNTLESYEPHPAKIVSHLNLHSTRALE  67

Query  427  ESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGM  248
            E K+     + V  S+ +RR LAH   Y+GPC ATNPIDRCWRCQ NWA+NR RLADCG+
Sbjct  68   EIKD----LELV--SNSSRRHLAH--GYDGPCMATNPIDRCWRCQANWADNRFRLADCGL  119

Query  247  GFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELI  71
            GFG KA GGK G +YVVND SD D  NP PGTLRHAVIQ +PLWIIFSR M IRL+QELI
Sbjct  120  GFGYKAKGGKGGRIYVVNDSSDSDMVNPIPGTLRHAVIQTEPLWIIFSRSMVIRLSQELI  179

Query  70   MQSDKTIDGRGFQVHVSGGAGIT  2
            MQSDKTIDGRG +VH++GGAGIT
Sbjct  180  MQSDKTIDGRGVRVHITGGAGIT  202



>ref|XP_008443432.1| PREDICTED: probable pectate lyase 19 [Cucumis melo]
Length=441

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 143/213 (67%), Gaps = 15/213 (7%)
 Frame = -3

Query  637  IMAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAA  458
            ++AG  I    M LV+ A+++P++   IAE+D+   Q+  EA + +L+ F PDP NV+  
Sbjct  1    MVAGCKIKLL-MVLVSMAVLMPTLRAGIAEFDDYLLQKAEEAKQASLEAFHPDPMNVTDH  59

Query  457  FNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWAN  278
            FN  VH  L          + + GS+ TRR LA    Y GPC ATNPIDRCWRC PNWA 
Sbjct  60   FNQHVHLAL----------EGIEGSNSTRRSLA---KYKGPCLATNPIDRCWRCDPNWAK  106

Query  277  NRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRD  101
            NR++LA C +GFGRK  GGK G +YVV D SD D  NPKPGTLR+  +QK+PLWIIF+R 
Sbjct  107  NRKKLAKCVLGFGRKTTGGKKGRIYVVTDPSDNDVVNPKPGTLRYGALQKRPLWIIFARS  166

Query  100  MNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            M IRL++EL++ S KTID RG  VH++ GAG++
Sbjct  167  MIIRLSKELMVTSHKTIDARGSNVHIAYGAGLS  199



>ref|XP_002520133.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF42188.1| Pectate lyase precursor, putative [Ricinus communis]
Length=440

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 138/204 (68%), Gaps = 16/204 (8%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            F +F  +FA+I P++  +I ++DE W+Q+   A E A +++ P+P NVS   N +V+K  
Sbjct  11   FVLF-ASFAVIFPTLHANIGDFDEYWKQKADIAREAAYRSYNPNPFNVSNQLNYQVNKA-  68

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
                        V+G++ TRR L  RK   GPC ATNPIDRCWRC P WA NR+RL +C 
Sbjct  69   ------------VSGTNSTRRNLMRRKG-GGPCKATNPIDRCWRCDPKWALNRKRLVECV  115

Query  250  MGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
            +GFG    GGK G  Y+V D SD D  NPKPGTLRHAVIQ +PLWIIF+R M IRLNQEL
Sbjct  116  LGFGHSTTGGKDGKFYIVTDPSDNDMVNPKPGTLRHAVIQNEPLWIIFARSMIIRLNQEL  175

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            ++ S+KTID RG  VH++GGAG+T
Sbjct  176  MISSNKTIDARGANVHIAGGAGLT  199



>ref|XP_011087217.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=436

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 139/202 (69%), Gaps = 17/202 (8%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +FL++  ++  +++G+I   D VWQ+R+  A + A + ++P+P  V    N+ VHK+   
Sbjct  9    VFLISLFVVFTTVAGNIGVHDAVWQERREAAKKAARQAYQPNPGEVLDHLNENVHKS---  65

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                      V GS++ RR L+    Y G C ATNPID+CWRCQPNWANNR++L DC +G
Sbjct  66   ----------VEGSNNQRRGLS---KYKGSCLATNPIDQCWRCQPNWANNRKKLVDCALG  112

Query  244  FGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FGR   GGK G +YVV D SD D  +PK GTLRHAVIQ +PLWIIF  +MNIRL++ELIM
Sbjct  113  FGRHTTGGKAGKMYVVTDPSDSDLVSPKKGTLRHAVIQPEPLWIIFKNNMNIRLSEELIM  172

Query  67   QSDKTIDGRGFQVHVSGGAGIT  2
             S+KTIDGRG QVH++ GAGIT
Sbjct  173  TSNKTIDGRGAQVHIANGAGIT  194



>ref|XP_002306040.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
 gb|EEE86551.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
Length=432

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 134/203 (66%), Gaps = 22/203 (11%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +F+ T A ++PS+   I  +D+VWQ+R  +A +  L+ + PDP   + AFN EV      
Sbjct  9    IFVFTLATLIPSLLADIGIFDDVWQKRAQDAKKMTLEAYVPDPEEATDAFNVEV------  62

Query  424  SKNEPDRKKFVNGSDDTRRQLAH-RKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGM  248
                          ++TRR L   RK Y GPC  TNPIDRCWRCQ NWA NR++LA C +
Sbjct  63   --------------NNTRRNLRQGRKKYAGPCQVTNPIDRCWRCQRNWAKNRKQLAKCAL  108

Query  247  GFGRKAIGGKHGVLYVVNDHSDD-PSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELI  71
            GFGR+  GG  G +YVV D SD+    PKPGTLRHAVIQK+PLWIIFS++MNI+L++ELI
Sbjct  109  GFGRRTTGGMAGRIYVVTDSSDNNVMKPKPGTLRHAVIQKEPLWIIFSKNMNIKLSKELI  168

Query  70   MQSDKTIDGRGFQVHVSGGAGIT  2
            M S KTIDGRG  VH+S G GIT
Sbjct  169  MSSHKTIDGRGHHVHISYGGGIT  191



>ref|XP_011009454.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=474

 Score =   212 bits (540),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 141/225 (63%), Gaps = 24/225 (11%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +F+ T A ++PS+   +  +D+VW++R  EA +  L+ + PDP   + AFN EV+K  L 
Sbjct  9    IFVFTLATLIPSLLADLGIFDDVWRKRAEEAKKMTLEAYVPDPEEATDAFNVEVNKYSLA  68

Query  424  SKNEP----------------------DRKKFVNGSDDTRRQLAH-RKPYNGPCNATNPI  314
              +                        +   F   ++ TRR L   RK Y GPC  TNPI
Sbjct  69   KNSSSLYGAFGSTNITNLDLDDIDDNDNDADFEQFANSTRRNLRQGRKKYAGPCQVTNPI  128

Query  313  DRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDD-PSNPKPGTLRHAVI  137
            DRCWRCQ NWA NR++LA C +GFGR+  GG  G +YVV D SD+    PKPGTLRHAVI
Sbjct  129  DRCWRCQRNWAKNRKQLAKCALGFGRRTTGGMAGRIYVVTDSSDNNVMKPKPGTLRHAVI  188

Query  136  QKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            QK+PLWIIFS++MNI+L++ELIM S KTIDGRG  VH+S GAGIT
Sbjct  189  QKEPLWIIFSKNMNIKLSKELIMSSHKTIDGRGHHVHISYGAGIT  233



>ref|XP_009369346.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=441

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 138/212 (65%), Gaps = 17/212 (8%)
 Frame = -3

Query  631  AGFNINCFCMFLVTFAIILP-SISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            A + +N F + +   AI +P +++ +IA +DE WQ R  EA + A K +  +P+ V+ +F
Sbjct  5    AAYKLNVFILCIFIVAITIPATVTANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTGSF  64

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANN  275
            N EVH T              +  ++TRR L  ++ Y GPC ATNPIDRCWRC PNW  N
Sbjct  65   NKEVHNTF-------------DSMNNTRRNL--KEKYKGPCLATNPIDRCWRCDPNWETN  109

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDM  98
            R++LADC  GFG K  GGK G +YVV D+SD D  NPKPGTLRHAVIQ  PLWIIF+ DM
Sbjct  110  RKKLADCAQGFGHKTTGGKAGEIYVVTDNSDNDLVNPKPGTLRHAVIQTGPLWIIFAHDM  169

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             I+L++EL++ SDKTID RG  VH+  G  IT
Sbjct  170  KIKLSEELMVTSDKTIDARGANVHIQDGGQIT  201



>ref|XP_002270112.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32014.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 132/192 (69%), Gaps = 17/192 (9%)
 Frame = -3

Query  574  PSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKF  395
            P+I  HIAE+D+ W+ R+ EA   A+  F+P P +V+  FN  V K++            
Sbjct  22   PTIRAHIAEYDDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEKSIF-----------  70

Query  394  VNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKH  215
              G + TRR L   K   GPC ATNPIDRCWRC+ NWA +RRRLADC +GFGR+ +GGKH
Sbjct  71   --GKNGTRRNL---KVNKGPCKATNPIDRCWRCRRNWAMDRRRLADCVLGFGRRTVGGKH  125

Query  214  GVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRG  38
            G LY+V D SD D  NPKPGTLR+AVIQ +PLWI+F R M I+L QEL++ SDKTIDGRG
Sbjct  126  GRLYIVTDPSDNDMLNPKPGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKTIDGRG  185

Query  37   FQVHVSGGAGIT  2
              VH++ GAGIT
Sbjct  186  VNVHIAYGAGIT  197



>ref|XP_007037229.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY21730.1| Pectate lyase family protein [Theobroma cacao]
Length=434

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 128/192 (67%), Gaps = 17/192 (9%)
 Frame = -3

Query  574  PSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKF  395
            P +  +I E+DEVWQ+R  EA + AL+ +EP+P  V+   N E  K L            
Sbjct  19   PIVKANIGEFDEVWQKRAEEAKKAALRAYEPNPEKVTDNLNKETGKAL------------  66

Query  394  VNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKH  215
              GS+ TRR L     Y GPC ATNPIDRCWRC P+WA NR++LA C +GFGR+  GGK 
Sbjct  67   -KGSNSTRRNLGR---YRGPCLATNPIDRCWRCDPHWAENRKKLATCVLGFGRRTTGGKD  122

Query  214  GVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRG  38
            G  YVV D SD D  NPKPGT+RHAVIQK+PLWIIF+ DM IRLN+ELIM SDKTIDGRG
Sbjct  123  GRFYVVTDPSDNDMINPKPGTIRHAVIQKEPLWIIFAHDMVIRLNEELIMTSDKTIDGRG  182

Query  37   FQVHVSGGAGIT  2
              VH   GA IT
Sbjct  183  ANVHFFRGAQIT  194



>emb|CAN69904.1| hypothetical protein VITISV_001006 [Vitis vinifera]
Length=443

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 132/192 (69%), Gaps = 17/192 (9%)
 Frame = -3

Query  574  PSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKF  395
            P+I  HIAE+D+ W+ R+ EA   A+  F+P P +V+  FN  V K++            
Sbjct  22   PTIRAHIAEYDDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEKSIF-----------  70

Query  394  VNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKH  215
              G + TRR L   K   GPC ATNPIDRCWRC+ NWA +RRRLADC +GFGR+ +GGKH
Sbjct  71   --GKNGTRRNL---KVNKGPCKATNPIDRCWRCRRNWAMDRRRLADCVLGFGRRTVGGKH  125

Query  214  GVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRG  38
            G LY+V D SD D  NPKPGTLR+AVIQ +PLWI+F R M I+L QEL++ SDKTIDGRG
Sbjct  126  GRLYIVTDPSDNDMLNPKPGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKTIDGRG  185

Query  37   FQVHVSGGAGIT  2
              VH++ GAGIT
Sbjct  186  VNVHIAYGAGIT  197



>ref|XP_010096345.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXB63820.1| putative pectate lyase 7 [Morus notabilis]
Length=399

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 126/188 (67%), Gaps = 15/188 (8%)
 Frame = -3

Query  559  HIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSD  380
            HIAE+D+ W+ R  EA + AL+ + P P  V+   N +V + L    N            
Sbjct  5    HIAEFDDYWKSRAEEARKDALQAYSPHPHEVTDQLNYDVQEALTAKNN------------  52

Query  379  DTRRQLAHRK-PYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLY  203
             TRRQL  RK    GPC ATNPIDRCWRC PNWANNR+RLADC +GFGR  +GGK G  Y
Sbjct  53   -TRRQLRGRKNKKGGPCMATNPIDRCWRCDPNWANNRKRLADCTLGFGRNTVGGKFGPYY  111

Query  202  VVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVH  26
            +V D SD D  NPKPGTLRHAVIQKKPLWIIF+R M IRL++ELIM  DKTID RG  V 
Sbjct  112  IVTDPSDTDLINPKPGTLRHAVIQKKPLWIIFARSMIIRLSEELIMTGDKTIDARGANVR  171

Query  25   VSGGAGIT  2
            ++ GAGIT
Sbjct  172  IAYGAGIT  179



>ref|XP_006374492.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
 gb|ERP52289.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
Length=435

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 134/204 (66%), Gaps = 19/204 (9%)
 Frame = -3

Query  604  MFLVTFAIIL--PSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            M LV FA+ +   ++   IA +DE W++R  EA E + + +EP+P+ V+  FNDEVHK+L
Sbjct  8    MLLVFFALAMQTSTLKAGIANFDEYWKKRAEEAKEASREAYEPNPAKVTKHFNDEVHKSL  67

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
                          G + TRR L   K   GPC ATNPIDRCWRC  NWA NR++L  C 
Sbjct  68   -------------EGGNSTRRNLGKNK---GPCLATNPIDRCWRCDKNWAKNRKKLGGCA  111

Query  250  MGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
            +GFGRK IGGKHG  Y V D SD D  NPK GTLR+ VIQ KPLWIIF+ DM IRL++EL
Sbjct  112  LGFGRKTIGGKHGKYYRVTDPSDNDMVNPKAGTLRYGVIQDKPLWIIFAHDMVIRLSEEL  171

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            ++ S+KTIDGRG  VH+  GA IT
Sbjct  172  MVASNKTIDGRGVNVHIYNGAQIT  195



>ref|XP_007139601.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
 gb|ESW11595.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
Length=444

 Score =   208 bits (530),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 138/212 (65%), Gaps = 11/212 (5%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            M G +     + LV FAI +P + G I E+D+  + + +EA E AL+++ PDP N++   
Sbjct  1    MVGSSSKVSIIILVAFAITIPCLEGGIGEFDDFLKGQALEAHEIALESYVPDPVNMTDDL  60

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANN  275
            N  VH  L E         F   S+ TRR+L  ++ Y GPC A NPIDRCWRC+  WA N
Sbjct  61   NINVHGALTEV--------FKEESNHTRREL--KQKYGGPCLALNPIDRCWRCKKGWAKN  110

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHS-DDPSNPKPGTLRHAVIQKKPLWIIFSRDM  98
            R +LA C  GFGRKA GG  G +Y+VND S DDP NPKPGTLR  V+QK+PLWIIF+R M
Sbjct  111  RFKLAHCAKGFGRKATGGLEGKMYIVNDPSDDDPINPKPGTLRFGVLQKEPLWIIFARSM  170

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             I+LN EL++ SDKTIDGRG  V +  G+G+T
Sbjct  171  IIKLNYELLISSDKTIDGRGANVMIKDGSGLT  202



>gb|KHN08855.1| Putative pectate lyase P59 [Glycine soja]
Length=435

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 135/204 (66%), Gaps = 16/204 (8%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
               F V    I P+++ +I  +D VW +R  EA E A + ++P+P  V+A FN  V + +
Sbjct  8    LLFFYVICLAIFPTLNANIGHFDHVWHRRLKEAREAAKQAYKPNPMKVTAEFNTHVIRAM  67

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
                          GS+++RR L+++  Y+GPC ATNPID+CWRC PNW  NR+RLADC 
Sbjct  68   -------------RGSNNSRRGLSNQ--YDGPCKATNPIDKCWRCDPNWEKNRKRLADCA  112

Query  250  MGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
            +GFG    GGK G +YVVND SD D  NPKPGTLRHA IQ++PLWIIF R+MNI+L+ EL
Sbjct  113  LGFGHGTTGGKDGKIYVVNDSSDNDLVNPKPGTLRHAAIQREPLWIIFDRNMNIKLHAEL  172

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            ++  +KTID RG  VH+S GA IT
Sbjct  173  MLTDNKTIDARGANVHISEGAQIT  196



>ref|XP_008374522.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=441

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 137/212 (65%), Gaps = 17/212 (8%)
 Frame = -3

Query  631  AGFNINCFCMFLVTFAIILP-SISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            A + +  F + +   AI +P +++ +IA +DE WQ R  EA + A K +  +P+ V+ +F
Sbjct  5    AAYKLFVFILCIFIVAITIPATVTANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTGSF  64

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANN  275
            N EVH T              +  ++TRR L  ++ Y GPC ATNPIDRCWRC PNW  N
Sbjct  65   NKEVHNTF-------------DSMNNTRRNL--KEKYKGPCVATNPIDRCWRCDPNWETN  109

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDM  98
            R++LADC  GFG K  GGK G +YVV D+SD D  NPKPGTLRHAVIQ  PLWIIF+ DM
Sbjct  110  RKKLADCAKGFGHKTTGGKAGEIYVVTDNSDNDLVNPKPGTLRHAVIQTGPLWIIFAHDM  169

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             I+L++EL++ SDKTID RG  VH+  G  IT
Sbjct  170  KIKLSEELMVTSDKTIDARGANVHIQDGGQIT  201



>ref|XP_006477525.1| PREDICTED: pectate lyase-like [Citrus sinensis]
Length=437

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 131/202 (65%), Gaps = 15/202 (7%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            + L   A I P +  +I ++DEVWQ+R   A  HAL+ + P+P  V ++FN  VH     
Sbjct  10   LTLFGLASISPILKANIHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMM---  66

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                     F NG + TRR L  R PY G C ATNPID+CWRC  NWANNR+RLADC  G
Sbjct  67   ---------FENG-NSTRRYLRGR-PYTGRCAATNPIDQCWRCDRNWANNRKRLADCAQG  115

Query  244  FGRKAIGGKHGVLYVV-NDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FGR  IGGK+G  YVV N   DD  NPKPGTLRHAVIQ++PLWI F+ DM IRL++EL++
Sbjct  116  FGRGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSEELLI  175

Query  67   QSDKTIDGRGFQVHVSGGAGIT  2
             SDKTID RG  V +  GA IT
Sbjct  176  TSDKTIDARGSNVQIYNGAQIT  197



>gb|KDO76053.1| hypothetical protein CISIN_1g013757mg [Citrus sinensis]
Length=437

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 130/202 (64%), Gaps = 15/202 (7%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            + L   A I P +  +  ++DEVWQ+R   A  HAL+ + P+P  V ++FN  VH     
Sbjct  10   LTLFGLASISPILKANTHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMM---  66

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                     F NGS  TRR L  R PY G C ATNPID+CWRC  NWANNR+RLADC  G
Sbjct  67   ---------FENGSS-TRRYLRGR-PYTGRCAATNPIDQCWRCDRNWANNRKRLADCAQG  115

Query  244  FGRKAIGGKHGVLYVV-NDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FGR  IGGK+G  YVV N   DD  NPKPGTLRHAVIQ++PLWI F+ DM IRL++EL++
Sbjct  116  FGRGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSEELLI  175

Query  67   QSDKTIDGRGFQVHVSGGAGIT  2
             SDKTID RG  V +  GA IT
Sbjct  176  TSDKTIDARGSNVQIYNGAQIT  197



>ref|XP_006439649.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
 gb|ESR52889.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
Length=437

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 130/202 (64%), Gaps = 15/202 (7%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            + L   A I P +  +  ++DEVWQ+R   A  HAL+ + P+P  V ++FN  VH     
Sbjct  10   LTLFGLASISPILKANTHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMM---  66

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                     F NGS  TRR L  R PY G C ATNPID+CWRC  NWANNR+RLADC  G
Sbjct  67   ---------FENGSS-TRRYLRGR-PYTGRCAATNPIDQCWRCDRNWANNRKRLADCAQG  115

Query  244  FGRKAIGGKHGVLYVV-NDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FGR  IGGK+G  YVV N   DD  NPKPGTLRHAVIQ++PLWI F+ DM IRL++EL++
Sbjct  116  FGRGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSEELLI  175

Query  67   QSDKTIDGRGFQVHVSGGAGIT  2
             SDKTID RG  V +  GA IT
Sbjct  176  TSDKTIDARGSNVQIYNGAQIT  197



>ref|XP_007227702.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
 gb|EMJ28901.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
Length=446

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 125/185 (68%), Gaps = 14/185 (8%)
 Frame = -3

Query  553  AEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDT  374
             + D  W+QR  EA + A+++FE DP  V+  FN  V + L++           NG   T
Sbjct  34   VQLDIYWKQRAEEAKKEAMQSFETDPEQVTEEFNSNVGELLMKQ----------NG---T  80

Query  373  RRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVN  194
            RR L   K YNGPC ATNP+D CWRC  NWA NR+RLADC  GFG+K  GGK G +YVV 
Sbjct  81   RRHLRGNKKYNGPCMATNPMDACWRCDKNWAKNRKRLADCVQGFGKKTTGGKAGPIYVVT  140

Query  193  DHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSG  17
            D SD D  NPKPGTLRHAVIQK PLWIIF+R+M IRL QEL++ SDKTIDGRG  V++  
Sbjct  141  DPSDLDLVNPKPGTLRHAVIQKGPLWIIFARNMVIRLQQELLVTSDKTIDGRGANVNIHN  200

Query  16   GAGIT  2
            GAGIT
Sbjct  201  GAGIT  205



>ref|XP_011098576.1| PREDICTED: probable pectate lyase P56 [Sesamum indicum]
Length=465

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 136/217 (63%), Gaps = 14/217 (6%)
 Frame = -3

Query  640  KIMA-GFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVS  464
            KIM   F+I    +F ++ A I  S + +    D  WQ+R   A    L+ + P+P  + 
Sbjct  16   KIMEKNFSITFLFLFFISAAFIPTSGANYTDSHDVYWQERAALARARILQAYNPNPEAIV  75

Query  463  AAFNDEVHKTLLESKNEPDRKKFVNGS--DDTRRQLAHRKPYNGPCNATNPIDRCWRCQP  290
              FN +  + L  S+        VN +  + TRR L  +  Y GPC ATNPIDRCWRC P
Sbjct  76   TDFNQKTKEALEHSQ--------VNRAPHNGTRRNLGRK--YMGPCVATNPIDRCWRCNP  125

Query  289  NWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWII  113
            NWA NR++LADC  GFG  A GGK G +YVV D SD D  NPKPGTLRHAVIQ  PLWII
Sbjct  126  NWALNRQKLADCAQGFGAAATGGKFGPIYVVRDPSDNDMMNPKPGTLRHAVIQPGPLWII  185

Query  112  FSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            FS  MNI+LNQELIM SDKTIDGRG  + ++GGAG+T
Sbjct  186  FSHSMNIKLNQELIMTSDKTIDGRGALIQITGGAGLT  222



>ref|XP_010527872.1| PREDICTED: probable pectate lyase 3 isoform X2 [Tarenaya hassleriana]
Length=461

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 138/210 (66%), Gaps = 8/210 (4%)
 Frame = -3

Query  610  FCMFLVTFAI---ILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVH  440
            F   ++ FAI      S+ GH+A +DE W QR+ +A    L+ ++P+P NV+  FN  V+
Sbjct  6    FVKLVILFAISSWASSSVRGHVAVFDEYWTQRQDKALRQTLRFYDPNPFNVTDHFNYHVN  65

Query  439  KTL---LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRR  269
              +   +++ N   R++ +     +R Q   R+   G C A NPIDRCWRC P W+ NR+
Sbjct  66   LAVEETMKTGNNGTRRELLQ-VGQSRGQHPKRRNLGGKCVAYNPIDRCWRCDPGWSKNRK  124

Query  268  RLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFSRDMNI  92
            +LADC +GFGRK  GGK G  YVV D SDD   NPK GTLRHAV +++PLWI+F++ M I
Sbjct  125  KLADCALGFGRKTTGGKAGPYYVVTDASDDDLLNPKAGTLRHAVTREEPLWIVFAKSMVI  184

Query  91   RLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            +L QELIM SDKTIDGRG +VH++GGAG T
Sbjct  185  KLQQELIMTSDKTIDGRGVRVHITGGAGFT  214



>ref|XP_011013803.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=419

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 127/191 (66%), Gaps = 17/191 (9%)
 Frame = -3

Query  571  SISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFV  392
            ++   IA +DE W++R  EA E + + +EP+P  V+  FNDEVHK+L             
Sbjct  5    TLKAGIANFDEYWKKRAEEAKEASREAYEPNPEKVAKHFNDEVHKSL-------------  51

Query  391  NGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHG  212
             G + TRR L     Y GPC ATNPIDRCWRC  NWA NR++L  C +GFGRK IGGK+G
Sbjct  52   EGGNSTRRNLG---KYKGPCLATNPIDRCWRCDKNWAKNRKKLGGCALGFGRKTIGGKNG  108

Query  211  VLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGF  35
              Y V D SD D  NPKPGTLR+ VIQ KPLWIIF+ DM IRL++EL++ S+KTIDGRG 
Sbjct  109  KYYRVTDPSDNDMVNPKPGTLRYGVIQDKPLWIIFAHDMVIRLSEELMVASNKTIDGRGV  168

Query  34   QVHVSGGAGIT  2
             VH+  GA IT
Sbjct  169  NVHIYNGAQIT  179



>ref|XP_010105747.1| putative pectate lyase P59 [Morus notabilis]
 gb|EXC05967.1| putative pectate lyase P59 [Morus notabilis]
Length=421

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 125/188 (66%), Gaps = 15/188 (8%)
 Frame = -3

Query  559  HIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSD  380
            HIAE+D+ W+ R  +A + AL+ + P P  V+   N +V + L                +
Sbjct  5    HIAEFDDYWKSRAEQAQKDALQAYHPHPEEVTNQLNYDVEEALTVK-------------N  51

Query  379  DTRRQLAHRK-PYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLY  203
             TRR L  +K    GPC ATNPIDRCWRC PNWA+NR+RLADC  GFGR ++GGK G  Y
Sbjct  52   STRRVLRGKKNKKGGPCMATNPIDRCWRCDPNWASNRKRLADCARGFGRNSVGGKFGRYY  111

Query  202  VVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVH  26
            VV D SD D  NPKPGTLRHAVIQK PLWIIF+R M IRL++ELIM  DKTIDGRG  V 
Sbjct  112  VVTDSSDTDLVNPKPGTLRHAVIQKAPLWIIFARSMIIRLSEELIMTGDKTIDGRGANVR  171

Query  25   VSGGAGIT  2
            ++ GAGIT
Sbjct  172  IAYGAGIT  179



>ref|XP_007209148.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
 gb|EMJ10347.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
Length=440

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 140/210 (67%), Gaps = 19/210 (9%)
 Frame = -3

Query  625  FNINCFCMFLVTFAIILPS-ISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFND  449
             N+   C+F++  AI +P+ +  +IA++DE WQQR  EA + A + +  DP  V+  FN 
Sbjct  8    LNVVILCVFVI--AITIPTTVRANIADFDEHWQQRAAEAKKAAHEAYHDDPIAVTEHFNK  65

Query  448  EVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRR  269
            +V  T              + +++TRR L  +  Y GPC ATNPIDRCWRC PNW  NR+
Sbjct  66   QVLDTF-------------DYANNTRRNLNQK--YKGPCMATNPIDRCWRCDPNWEKNRK  110

Query  268  RLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNI  92
            RLADC +GFGRKA GGK G +YVV D++D D  NPKPGTLRHAVIQ  PLWIIF+RDM I
Sbjct  111  RLADCALGFGRKATGGKLGPIYVVTDNTDADLVNPKPGTLRHAVIQNGPLWIIFARDMRI  170

Query  91   RLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            +L +EL++ SDKTID RG  VH+  GA I+
Sbjct  171  KLTEELLVASDKTIDARGANVHILDGAQIS  200



>ref|XP_006306515.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
 gb|EOA39413.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
Length=455

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 141/218 (65%), Gaps = 17/218 (8%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            MA   +N    FL   AI+ P +  H+A +D  W QR+ +A +  + +++P+P NV+   
Sbjct  1    MAAVFLNLGVFFLSLLAIVAPQVKAHVAVFDSYWTQRQSDALKRTMGSYDPNPLNVTNHL  60

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQL-----AHRK-PYNGPCNATNPIDRCWRCQ  293
            N  V+  +  +++           +DTRR+L      HRK   +G C A NPID+CWRC 
Sbjct  61   NYHVNLAVDAAES----------FNDTRRELTQVRSGHRKLKRSGKCLAYNPIDKCWRCD  110

Query  292  PNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWI  116
             NWANNR++LADC +GFGRK  GGK G +YVVND SD D  NPKPGTLR+AV +  PLWI
Sbjct  111  RNWANNRKKLADCVLGFGRKTTGGKDGPIYVVNDASDNDLVNPKPGTLRYAVTRDGPLWI  170

Query  115  IFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IF+R M I+L QEL++ SDKTIDGRG +V++  GAG+T
Sbjct  171  IFARSMIIKLQQELMIASDKTIDGRGAKVYIMEGAGLT  208



>gb|KDP45476.1| hypothetical protein JCGZ_09725 [Jatropha curcas]
Length=462

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 146/212 (69%), Gaps = 11/212 (5%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVH-----  440
            MF+  F  I P++   + ++D+VWQ+R  EA ++ ++ ++PDP  V+A  N++V+     
Sbjct  9    MFVFWFGFITPNLMADMKKYDKVWQERSEEARKNMMEAYDPDPIAVTAEVNEQVNHQIDG  68

Query  439  --KTLLESKNEPDRKKFVNGSD--DTRRQLAHRK-PYNGPCNATNPIDRCWRCQPNWANN  275
              KT     +      F  G++  +TRR L  +K  YNGPC A NPID+CWRC+ NW  +
Sbjct  69   NAKTNSTINHTKGTNNFETGAEANNTRRSLKQKKQKYNGPCQANNPIDKCWRCRKNWVKD  128

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDM  98
            R+RLA C +GFGR+  GGK G +YVV D+SD D   PKPGTLRHAVIQK+PLWIIF+ DM
Sbjct  129  RQRLASCALGFGRRTTGGKGGKIYVVTDNSDHDCVEPKPGTLRHAVIQKEPLWIIFACDM  188

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            NI+L+QELIM  +KTIDGRGF VH+S GAGIT
Sbjct  189  NIKLSQELIMAHNKTIDGRGFNVHISHGAGIT  220



>ref|XP_002517472.1| pectate lyase, putative [Ricinus communis]
 gb|EEF45014.1| pectate lyase, putative [Ricinus communis]
Length=431

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/242 (43%), Positives = 146/242 (60%), Gaps = 41/242 (17%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHK----  437
            +F++ FA I+P ++  I  +DEVW++R  EA ++ +  +  +P  V+  FN++ ++    
Sbjct  9    IFVLAFASIIPILNADIGYYDEVWKKRAEEAKKNMMDAYVANPLEVTTEFNNQTNEGKEK  68

Query  436  --TLLESKNEPDR---------------------------------KKFVNGSDDTRRQL  362
              T+   K E +                                  K+F   ++ TRR L
Sbjct  69   NGTVGSGKGEVNTTSSFSEAENTNDDNNEENEDDNDEWNETKGNFTKEFEKETNSTRRNL  128

Query  361  AH-RKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHS  185
               ++ Y GPC+ TNPIDRCWRC+ NWA NR+RLA C +GFGR+  GGK G  YVV D++
Sbjct  129  RQGKRLYKGPCHTTNPIDRCWRCRKNWAKNRKRLARCALGFGRRTTGGKAGKFYVVTDNT  188

Query  184  D-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAG  8
            D +  +PKPGTLRHAVIQK PLWI F+RDMNI+L +ELI+ +DKTIDGRG  VH++ GAG
Sbjct  189  DANVVDPKPGTLRHAVIQKAPLWIYFARDMNIKLQKELIINNDKTIDGRGANVHIAYGAG  248

Query  7    IT  2
            IT
Sbjct  249  IT  250



>ref|XP_008239834.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=438

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 135/209 (65%), Gaps = 17/209 (8%)
 Frame = -3

Query  625  FNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDE  446
             N+   C+F VT   I  ++  +IA++DE WQQR  EA + A + +  DP  V+  FN +
Sbjct  6    LNVVILCVF-VTAITIPTTVRANIADFDEHWQQRAAEAKKAAHEAYHDDPIAVTEHFNKQ  64

Query  445  VHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRR  266
            V  T   + N             TRR L  +  Y GPC ATNPIDRCWRC PNW  NR+R
Sbjct  65   VLDTFDYANN-------------TRRNLNQK--YKGPCMATNPIDRCWRCDPNWEKNRKR  109

Query  265  LADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIR  89
            LADC +GFGRKA GGK G +YVV D++D D  NPKPGTLRHAVIQ  PLWIIF+RDM I+
Sbjct  110  LADCALGFGRKATGGKLGPIYVVTDNTDADLVNPKPGTLRHAVIQNGPLWIIFARDMRIK  169

Query  88   LNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            L +EL++ SDKTID RG  VH+  GA I+
Sbjct  170  LTEELLVASDKTIDARGANVHILDGAQIS  198



>ref|XP_010322971.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=302

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 133/206 (65%), Gaps = 10/206 (5%)
 Frame = -3

Query  601  FLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLES  422
            F V    +  SI  +I E+DEVW+ R  +A ++A +++ P+P  V+A FN  VH+ +   
Sbjct  10   FFVILCTLFFSIEANIGEFDEVWRTRATQANKNAKESYNPNPEKVAANFNKHVHRQVFSW  69

Query  421  KNEPDRKKFV------NGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLA  260
             ++P     +       GS+ TRR L     YNGPC ATNPIDRCWRC P+WA NR++LA
Sbjct  70   YSQPSHFHLILICRSEEGSNSTRRDL---HKYNGPCVATNPIDRCWRCDPHWAKNRQKLA  126

Query  259  DCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLN  83
            DC +GFG    GGK G +Y V D  D D  NPK GTLRHAVIQ  PLWIIF+  M I+LN
Sbjct  127  DCVLGFGHHTTGGKGGKIYEVTDPGDTDMVNPKQGTLRHAVIQPGPLWIIFAHHMVIKLN  186

Query  82   QELIMQSDKTIDGRGFQVHVSGGAGI  5
            QELIM  DKTID RG QVH++GGA +
Sbjct  187  QELIMTGDKTIDARGQQVHITGGASL  212



>ref|XP_010523445.1| PREDICTED: probable pectate lyase 3 [Tarenaya hassleriana]
Length=464

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 134/212 (63%), Gaps = 18/212 (8%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
             C    + + +   +  H+A +DE W QR+  A    L+ ++P+P NV+  FN  V+  +
Sbjct  15   LCFLFSSISDVAQPVKAHVAVFDEYWTQRQAHALRQTLRFYDPNPFNVTDHFNHHVNLAV  74

Query  430  LESKNEPDRKKFVNGSDDTRRQL-------AHRKPYN-GPCNATNPIDRCWRCQPNWANN  275
             E+            S+ TRR+L        H K  N G C A NPIDRCWRCQPNWA +
Sbjct  75   EEA---------TEASNGTRRELWQVGSGGKHLKRRNTGKCVAYNPIDRCWRCQPNWAKD  125

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDM  98
            R++LADC +GFGR+  GGK G  YVV D SD D  NP+PGTLRHAV + +PLWI+F R M
Sbjct  126  RKKLADCVLGFGRRTTGGKAGRYYVVTDASDTDLINPRPGTLRHAVTRDEPLWIVFERSM  185

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             IRL QELI+ S+KTIDGRG +VH++GGAG+T
Sbjct  186  VIRLAQELIITSNKTIDGRGVRVHITGGAGLT  217



>ref|XP_006484673.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   201 bits (510),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 134/204 (66%), Gaps = 23/204 (11%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +FL +FA ++P +S HIAE +EVW++R  EA +   + ++P+P  V+   N +V      
Sbjct  9    IFLFSFATLMPCLSAHIAEVNEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQ-----  63

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYN---GPCNATNPIDRCWRCQPNWANNRRRLADC  254
                          D +++ +A R   N   G C ATNPID+CWRC+ NWA +R+ LA C
Sbjct  64   --------------DLSKQAIAKRGLLNAESGQCEATNPIDKCWRCKENWAEDRQALAGC  109

Query  253  GMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQE  77
             +GFG KA GGK G +Y V D SD D  NPK GTLRHAVIQK+PLWIIF++DMNI+L QE
Sbjct  110  ALGFGSKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQE  169

Query  76   LIMQSDKTIDGRGFQVHVSGGAGI  5
            LI+Q  KTIDGRG +VH++ GAGI
Sbjct  170  LIVQGSKTIDGRGAKVHIANGAGI  193



>ref|XP_002511525.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF52127.1| Pectate lyase precursor, putative [Ricinus communis]
Length=433

 Score =   201 bits (510),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 131/202 (65%), Gaps = 17/202 (8%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            + ++ FA I+P++  +IA +D+VWQQR  EA   AL+ + P+P ++   FN EV K+L  
Sbjct  9    LLVIAFATIIPTLKANIAHFDKVWQQRAKEASHAALQAYHPNPEDIVNHFNKEVAKSL--  66

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                       N    T  QL+  K    PC+ATNPIDRCWRC  NWA+NR++LA C +G
Sbjct  67   -----------NDFSSTSSQLSQHKR---PCHATNPIDRCWRCDANWASNRKKLAGCALG  112

Query  244  FGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FGR   GGK G  YVV D SDD   NP+ GTLR+ VIQ +PLWI F+ DM I L+QELI+
Sbjct  113  FGRMTTGGKDGDYYVVTDPSDDDLVNPREGTLRYGVIQDRPLWITFAGDMVITLSQELII  172

Query  67   QSDKTIDGRGFQVHVSGGAGIT  2
             S+KTIDGRG  VH+S GA IT
Sbjct  173  NSNKTIDGRGANVHISCGAQIT  194



>ref|XP_010496063.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   201 bits (511),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 137/218 (63%), Gaps = 17/218 (8%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            MA   +     FL   AI+ P +  H+A +D  W QRK +A +    +++P+P NV+  F
Sbjct  1    MAAAFLTLGGFFLSLLAIVAPQVGAHVAVFDSYWMQRKSDALKQTFGSYDPNPLNVTNHF  60

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKP------YNGPCNATNPIDRCWRCQ  293
            N  V+  +       D  + +N   DTRR+L   +       + G C A NPID+CWRC 
Sbjct  61   NYHVNLAV-------DATESIN---DTRRELTQVRSRRKLQKHGGKCVAYNPIDKCWRCD  110

Query  292  PNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWI  116
             NWANNR++LADC +GFGRK  GGK G +YVV D SD D  NPKPGTLR+AV +  PLWI
Sbjct  111  RNWANNRKKLADCALGFGRKTTGGKDGPIYVVTDASDNDLINPKPGTLRYAVTRDGPLWI  170

Query  115  IFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IF+R M I+L QEL++ SDKTIDGRG +V++  GAG+T
Sbjct  171  IFARSMIIKLQQELMITSDKTIDGRGARVYIMEGAGLT  208



>ref|XP_007138209.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
 gb|ESW10203.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
Length=434

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 129/204 (63%), Gaps = 17/204 (8%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
               F V F  ILP++  +I ++D VW +R  EA E A + ++P+P  V+A FN  V + +
Sbjct  8    LLFFYVIFLAILPTLQANIGQFDHVWHRRLKEAREAAKQAYKPNPMKVTAEFNTHVMRAM  67

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
                          GS+ TRR L  +   N  C A NPID+CWRC P+W  NR++LADC 
Sbjct  68   -------------KGSNSTRRGLGKK---NDECEAANPIDKCWRCDPDWEKNRKKLADCA  111

Query  250  MGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
            +GFG    GGK G +YVV D+SD D  NPKPGTLRHAVIQ +PLWIIFSR+MNIRL  EL
Sbjct  112  IGFGHGTTGGKDGKIYVVGDNSDKDLVNPKPGTLRHAVIQTEPLWIIFSRNMNIRLTAEL  171

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            ++  +KTID RG  VH+  GA +T
Sbjct  172  LITDNKTIDARGANVHILDGAQMT  195



>gb|KDO49230.1| hypothetical protein CISIN_1g036607mg [Citrus sinensis]
Length=436

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 134/204 (66%), Gaps = 23/204 (11%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +FL +FA ++P +S HIAE +EVW++R  EA +   + ++P+P  V+   N +V      
Sbjct  9    IFLFSFATLMPCLSAHIAEVNEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQ-----  63

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYN---GPCNATNPIDRCWRCQPNWANNRRRLADC  254
                          D +++ +A R   N   G C ATNPID+CWRC+ NWA +R+ LA C
Sbjct  64   --------------DLSKQAIAKRGLLNAESGQCAATNPIDKCWRCKENWAEDRQALAGC  109

Query  253  GMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQE  77
             +GFG KA GGK G +Y V D SD D  NPK GTLRHAVIQK+PLWIIF++DMNI+L QE
Sbjct  110  ALGFGSKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQE  169

Query  76   LIMQSDKTIDGRGFQVHVSGGAGI  5
            LI+Q  KTIDGRG +VH++ GAGI
Sbjct  170  LIVQGSKTIDGRGAKVHIANGAGI  193



>ref|XP_010476496.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 137/218 (63%), Gaps = 17/218 (8%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            MA   +     FL   AI+ P +  H+A +D  W QRK +A +    +++P+P NV+  F
Sbjct  1    MAAAFLTLGGFFLSLLAIVAPQVGAHVAVFDSYWMQRKTDALKQTFGSYDPNPLNVTNHF  60

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKP------YNGPCNATNPIDRCWRCQ  293
            N  V+  +       D  + +N   DTRR+L   +       + G C A NPID+CWRC 
Sbjct  61   NYHVNLAV-------DATESIN---DTRRELTQVRSRRKLQKHGGKCVAYNPIDKCWRCD  110

Query  292  PNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWI  116
             NWANNR++LA+C +GFGRK  GGK G +YVV D SD D  NPKPGTLR+AV +  PLWI
Sbjct  111  RNWANNRKKLAECALGFGRKTTGGKDGPIYVVTDASDNDLINPKPGTLRYAVTRDGPLWI  170

Query  115  IFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IF+R M I+L QEL++ SDKTIDGRG +V++  GAG+T
Sbjct  171  IFARSMIIKLQQELMITSDKTIDGRGARVYIMEGAGLT  208



>gb|AES91206.2| pectate lyase P59-like protein [Medicago truncatula]
Length=434

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 129/203 (64%), Gaps = 20/203 (10%)
 Frame = -3

Query  607  CMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLL  428
            C+F   F  I+P    +I  +D+ WQ R  +A + A + ++P+P  +++  N  VHK L 
Sbjct  12   CVF---FLAIVPIFEANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVHKAL-  67

Query  427  ESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGM  248
                        +GS+ TRR+LA    Y GPC+ATNPID CWRC PNW  NR++LADC +
Sbjct  68   ------------SGSNSTRRELA---KYKGPCSATNPIDSCWRCDPNWEKNRKKLADCVL  112

Query  247  GFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELI  71
            GFG    GGK G +YVV D SD D   PKPGTLR A IQK+PLWIIF  +MNI+L  EL+
Sbjct  113  GFGHGTTGGKAGKIYVVTDSSDNDLVTPKPGTLRFAAIQKEPLWIIFKHNMNIKLKAELL  172

Query  70   MQSDKTIDGRGFQVHVSGGAGIT  2
            + SDKTID RG  VH+S GA IT
Sbjct  173  LTSDKTIDARGANVHISEGAQIT  195



>ref|XP_003609009.1| Pectate lyase [Medicago truncatula]
Length=445

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 129/203 (64%), Gaps = 20/203 (10%)
 Frame = -3

Query  607  CMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLL  428
            C+F   F  I+P    +I  +D+ WQ R  +A + A + ++P+P  +++  N  VHK L 
Sbjct  12   CVF---FLAIVPIFEANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVHKAL-  67

Query  427  ESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGM  248
                        +GS+ TRR+LA    Y GPC+ATNPID CWRC PNW  NR++LADC +
Sbjct  68   ------------SGSNSTRRELA---KYKGPCSATNPIDSCWRCDPNWEKNRKKLADCVL  112

Query  247  GFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELI  71
            GFG    GGK G +YVV D SD D   PKPGTLR A IQK+PLWIIF  +MNI+L  EL+
Sbjct  113  GFGHGTTGGKAGKIYVVTDSSDNDLVTPKPGTLRFAAIQKEPLWIIFKHNMNIKLKAELL  172

Query  70   MQSDKTIDGRGFQVHVSGGAGIT  2
            + SDKTID RG  VH+S GA IT
Sbjct  173  LTSDKTIDARGANVHISEGAQIT  195



>gb|EYU22437.1| hypothetical protein MIMGU_mgv1a006496mg [Erythranthe guttata]
Length=442

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 128/204 (63%), Gaps = 19/204 (9%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            FC+ L   A+ LP      A  DE  Q++  EA++ +L+ + P P  ++  FN+ V +TL
Sbjct  13   FCIALA-LAVTLPRAHAQNATMDEYLQKKAEEAYQESLQAYNPHPEELTEEFNELVGETL  71

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
            +             G + TRRQL       G C ATNPIDRCWRC  NWA NR++LADC 
Sbjct  72   I-------------GQNATRRQLKQ----TGECMATNPIDRCWRCDRNWAKNRKKLADCA  114

Query  250  MGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
             GFG +  GGK G  Y+V D SD D  +PKPGTLRHAVIQ +PLWIIF+  M IRL QEL
Sbjct  115  RGFGHQTTGGKKGRYYLVTDPSDNDMDHPKPGTLRHAVIQTEPLWIIFAHSMVIRLKQEL  174

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            I  SDKT+DGRG QVH++ GAG+T
Sbjct  175  IFTSDKTVDGRGVQVHIAYGAGLT  198



>gb|KFK33456.1| hypothetical protein AALP_AA5G015800 [Arabis alpina]
Length=460

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 137/221 (62%), Gaps = 20/221 (9%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFA--IILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSA  461
            +A  N+  + +  V+ A  II PS+  HIA +DE W QR+ EA    L+++EPDP NV+ 
Sbjct  3    VAYLNLGTYVLAFVSLALAIIAPSVQAHIAVYDEYWTQRQTEALRRTLESYEPDPLNVTD  62

Query  460  AFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQL-------AHRKPYNGPCNATNPIDRCW  302
             FN   H  L     E      VNG   TRR+L          K   G   + N ID+CW
Sbjct  63   HFN--YHSALAMETTEA-----VNG---TRRELRVVGGGRKTIKKRGGRFQSLNAIDKCW  112

Query  301  RCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKP  125
            R   NWA NR++LADC +GFGRK  GGK G +Y V D SD D  NP+PGTLRHAV + +P
Sbjct  113  RGDKNWAKNRKKLADCVLGFGRKTTGGKAGPIYEVTDASDNDVMNPRPGTLRHAVTRDRP  172

Query  124  LWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            LWIIF++ M I+L QELI+ +DKTIDGRG  VH++GGAG+T
Sbjct  173  LWIIFAKSMVIKLQQELIITNDKTIDGRGVSVHITGGAGLT  213



>ref|XP_010068708.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
 gb|KCW64557.1| hypothetical protein EUGRSUZ_G02162 [Eucalyptus grandis]
Length=435

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 132/197 (67%), Gaps = 17/197 (9%)
 Frame = -3

Query  589  FAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEP  410
             A+ +P +  +IA++DEVWQ+R  EA +  +K +EPDP+ V+  FN  VH+ +  S N  
Sbjct  15   LAVAVPVLRANIADFDEVWQKRAEEAKKATIKAYEPDPAKVAEDFNHRVHEDMQRSNN--  72

Query  409  DRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKA  230
                       TRR L   K   G C ATNPIDRCWRC+ +WA++R+RLA+C +GFGR  
Sbjct  73   -----------TRRSLKRTK---GGCLATNPIDRCWRCRKDWASHRKRLANCALGFGRGT  118

Query  229  IGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKT  53
             GGK G +Y V D SDD   NPKPGTLRHAVIQ +PLWIIF+ +M IRL++ELI+  +KT
Sbjct  119  TGGKAGKIYKVTDPSDDNLMNPKPGTLRHAVIQPEPLWIIFAHNMVIRLSEELIVTDNKT  178

Query  52   IDGRGFQVHVSGGAGIT  2
            IDGRG  VH+  GA IT
Sbjct  179  IDGRGANVHICDGAQIT  195



>ref|XP_003530685.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=451

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 131/219 (60%), Gaps = 27/219 (12%)
 Frame = -3

Query  616  NC--FCMFLVTFAIILPSISG-----------HIAEWDEVWQQRKIEAWEHALKTFEPDP  476
            NC  +   L++ AI +P+++            H+ E+D  WQ+R   A   +   +  DP
Sbjct  3    NCQQYYFLLLSLAIFIPTLNANSLEKDEYWQSHVYEFDSYWQERAKAAKVDSQAAYFEDP  62

Query  475  SNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRC  296
             +VS+ F   V +  +             G  D RR L  +   +GPC ATNPIDRCWRC
Sbjct  63   YSVSSNFTSSVSELTI-------------GKKDLRRNLKGKYRGDGPCIATNPIDRCWRC  109

Query  295  QPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLW  119
             PNWANNR++LADC  GFGR  +GGK G  YVV D SDD   NPKPGTLRHAV +  PLW
Sbjct  110  DPNWANNRQKLADCVQGFGRNTVGGKGGPFYVVTDPSDDDMVNPKPGTLRHAVTRDGPLW  169

Query  118  IIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IIF+R M I L QELIM S+KTIDGRG  V+++ GAGIT
Sbjct  170  IIFARSMFITLQQELIMNSNKTIDGRGVDVYIAKGAGIT  208



>ref|XP_003554335.1| PREDICTED: pectate lyase-like [Glycine max]
Length=443

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 134/215 (62%), Gaps = 17/215 (8%)
 Frame = -3

Query  640  KIMAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSA  461
            +IM G         LVTFAI++P +   IAE+D+  + +  EA + AL+ + P P +V+ 
Sbjct  3    RIMVGSATKVAFNLLVTFAIVIPCLEAGIAEFDDFLKAQADEAQKIALEAYVPVPEDVTD  62

Query  460  AFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGP-CNATNPIDRCWRCQPNW  284
              N  VH +L  S               TRR+L  RK  +G  C A+NPID CWRC  NW
Sbjct  63   ELNFHVHLSLENS---------------TRRELRQRKGRSGKKCVASNPIDTCWRCNKNW  107

Query  283  ANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFS  107
            AN+R RLA CG GFGR+A GG  G +YVV D+SDD   NPKPGT+RHAV Q+ PLWIIF 
Sbjct  108  ANDRYRLAKCGKGFGRRATGGLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQRGPLWIIFQ  167

Query  106  RDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            R M I+LNQEL++ SDKTIDGRG  V    GAG+T
Sbjct  168  RSMMIKLNQELMISSDKTIDGRGANVVFRDGAGLT  202



>ref|XP_004489374.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=447

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 131/218 (60%), Gaps = 14/218 (6%)
 Frame = -3

Query  652  ISVAKIMAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPS  473
            + + KIM   +     + LVTF I +P +   IAE+D+  + +  EA + AL ++ P P 
Sbjct  1    MGMGKIMVESSTKIALILLVTFTITIPCLEAGIAEFDDFLRAQAEEAHKLALASYVPIPG  60

Query  472  NVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQ  293
            +V+   N  VH  L              G++DTRR+L  +      C ATNPID CWRCQ
Sbjct  61   DVAHDLNFHVHLAL-------------EGANDTRRELKQKHAAGEACEATNPIDSCWRCQ  107

Query  292  PNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWI  116
             +WAN+R +LA C  GFGR+A GG  G +YVV D SD D  NPKPGTLR+  +QK PLWI
Sbjct  108  KDWANDRFKLAKCSKGFGRRATGGLGGPIYVVTDESDNDMQNPKPGTLRYGAVQKGPLWI  167

Query  115  IFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             F R M IRLNQEL++ SDKTIDGRG  V +  G GIT
Sbjct  168  TFQRSMIIRLNQELLVSSDKTIDGRGANVQIRDGGGIT  205



>ref|XP_004508770.1| PREDICTED: probable pectate lyase P59-like [Cicer arietinum]
Length=434

 Score =   198 bits (503),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 128/205 (62%), Gaps = 20/205 (10%)
 Frame = -3

Query  613  CFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKT  434
            CFC+F   +  + P++   IA   + WQ R  EA + A K ++P+P +++  FN  V K+
Sbjct  10   CFCVF---YLALFPTLRASIAHDAQFWQTRAREAKQAAQKAYKPNPHDIALTFNKHVDKS  66

Query  433  LLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADC  254
                            S+ TRR L+    Y GPC ATNPID+CWRC PNW  NR++LA+C
Sbjct  67   F-------------KSSNGTRRGLS---KYTGPCLATNPIDKCWRCDPNWEKNRKKLANC  110

Query  253  GMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQE  77
             +GFG    GGK+G +YVV D SD D  NPKPGTLRHAVIQ +PLWIIF   MNI+L+ E
Sbjct  111  ALGFGHGTTGGKNGKIYVVTDSSDHDLINPKPGTLRHAVIQNEPLWIIFKHSMNIKLSSE  170

Query  76   LIMQSDKTIDGRGFQVHVSGGAGIT  2
            LI   +KTID RG  VH+S GA +T
Sbjct  171  LIFTDNKTIDARGANVHISNGAQMT  195



>ref|XP_006482544.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=435

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 133/201 (66%), Gaps = 18/201 (9%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +FL +F I++P +S  IAE DEVW++R  EA +   + ++PDP  V++  N +V      
Sbjct  9    IFLFSFIILIPCLSA-IAEADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNMKVQDL---  64

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
            SK    R+  +N               +G C ATNPID+CWRC+ NWA +R+ LA C +G
Sbjct  65   SKQTAARRGLLNAE-------------SGQCEATNPIDKCWRCKENWAEDRQALAGCALG  111

Query  244  FGRKAIGGKHGVLYVVNDHSDD-PSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FG KA GGK G +Y V D SD+   NPK GTLRHAVIQK+PLWIIF++DMNI+L QEL++
Sbjct  112  FGSKATGGKGGKIYEVTDSSDNNMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELVV  171

Query  67   QSDKTIDGRGFQVHVSGGAGI  5
            Q +KTIDGRG  VH++ GAGI
Sbjct  172  QGNKTIDGRGANVHIANGAGI  192



>ref|XP_006431087.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 ref|XP_006431088.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
 gb|ESR44327.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 gb|ESR44328.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
Length=435

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 133/201 (66%), Gaps = 18/201 (9%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +FL +F I++P +S  IAE DEVW++R  EA +   + ++PDP  V++  N +V      
Sbjct  9    IFLFSFIILIPCLSA-IAEADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNMKVQDL---  64

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
            SK    R+  +N               +G C ATNPID+CWRC+ NWA +R+ LA C +G
Sbjct  65   SKQTAARRGLLNAE-------------SGQCEATNPIDKCWRCKENWAEDRQALAGCALG  111

Query  244  FGRKAIGGKHGVLYVVNDHSDD-PSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FG KA GGK G +Y V D SD+   NPK GTLRHAVIQK+PLWIIF++DMNI+L QEL++
Sbjct  112  FGSKATGGKGGKIYEVTDSSDNNMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELVV  171

Query  67   QSDKTIDGRGFQVHVSGGAGI  5
            Q +KTIDGRG  VH++ GAGI
Sbjct  172  QGNKTIDGRGANVHIANGAGI  192



>ref|XP_006842121.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
 gb|ERN03796.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
Length=438

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 125/202 (62%), Gaps = 18/202 (9%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            + L + +  +P    HIA++DE WQ R   A + AL+ +  +P NV+   N  VHK L  
Sbjct  13   LVLASSSFTVPKAEAHIADFDETWQNRSAIARQVALEAYVHEPHNVTDHVNHMVHKAL--  70

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                          + TRR L     Y G C ATNPIDRCWRCQ NWA +R+RLA C +G
Sbjct  71   ------------EGNSTRRHLG---KYTGACMATNPIDRCWRCQRNWARDRKRLAKCALG  115

Query  244  FGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FGRK  GG  G  YVV D SD+  ++PKPGTLRHAVIQ +PLWI F  DM IRL +EL++
Sbjct  116  FGRKTTGGLKGRFYVVTDASDESLTDPKPGTLRHAVIQDRPLWITFKHDMIIRLTEELLV  175

Query  67   QSDKTIDGRGFQVHVSGGAGIT  2
             S KTIDGRG  VH++ GAGIT
Sbjct  176  NSHKTIDGRGTNVHIAYGAGIT  197



>ref|XP_009381244.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=423

 Score =   197 bits (501),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 127/189 (67%), Gaps = 15/189 (8%)
 Frame = -3

Query  565  SGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNG  386
            + HIAE+DE WQ+++  A  +    + P+P +V+  FND V K L +             
Sbjct  8    NAHIAEFDEYWQKKEAMARANVQNAYNPNPESVTKHFNDAVLKDLEK-------------  54

Query  385  SDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVL  206
             ++TRR L  ++ Y+GPC ATNPIDRCWRCQ NWA++R+RLA C  GFGR   GGK+G  
Sbjct  55   -NNTRRGLRGKRRYDGPCMATNPIDRCWRCQENWAHHRKRLATCAKGFGRHVTGGKNGDF  113

Query  205  YVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQV  29
            YVV D SD D  NP+ GTLR+ VIQ +PLWI+F+RDM IRL +ELI+ S+KTIDGRG  V
Sbjct  114  YVVTDPSDLDLVNPRKGTLRYGVIQDRPLWIVFARDMVIRLTEELIVNSNKTIDGRGVDV  173

Query  28   HVSGGAGIT  2
             +  GAGIT
Sbjct  174  QIMNGAGIT  182



>emb|CBI15265.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 142/207 (69%), Gaps = 17/207 (8%)
 Frame = -3

Query  619  INCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVH  440
            +N   + L+ F +I+P+++ +I ++DEVWQ R  EA + AL+ + P P  V+  FN +VH
Sbjct  4    VNMRLVILIPFLVIVPAVTANIGDFDEVWQTRAEEARKAALQAYNPHPEKVTDNFNKKVH  63

Query  439  KTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLA  260
            K+              + ++ TRR L+    ++G C ATNPIDRCWRC+ +WA+NR +LA
Sbjct  64   KSF-------------DSTNHTRRNLS---KFSGLCMATNPIDRCWRCRSDWASNRMKLA  107

Query  259  DCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLN  83
            DC +GFG+K  GGK G +YVV D SD D  NPKPGTLRHA IQ++PLWIIF+  M IRLN
Sbjct  108  DCVLGFGQKTTGGKGGKIYVVTDPSDNDMVNPKPGTLRHAAIQEEPLWIIFAHSMAIRLN  167

Query  82   QELIMQSDKTIDGRGFQVHVSGGAGIT  2
            +ELIM S+KTID RG  VH++ GAG+T
Sbjct  168  EELIMTSNKTIDARGANVHIANGAGLT  194



>ref|XP_006428983.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
 gb|ESR42223.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
Length=438

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 130/201 (65%), Gaps = 17/201 (8%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
             FL +FA ++P +S +I+E DEVW++R  EA +   + ++P+P  +++  N +V      
Sbjct  11   FFLFSFAALIPCLSANISEVDEVWRRRAEEAMQTTEQYYDPNPVAIASHLNMKVQDL---  67

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
            SK    R+  +N               +G C ATNPID CWRC+ NWA NR+ LA C +G
Sbjct  68   SKQTAARRGLLNAE-------------SGQCEATNPIDNCWRCKENWAENRQALAGCALG  114

Query  244  FGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FG KA GGK G +Y V D SD D  NPK GTLRHAVIQK+PLWIIF++DMNI+L QELI+
Sbjct  115  FGIKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIV  174

Query  67   QSDKTIDGRGFQVHVSGGAGI  5
            Q  KTIDGRG  VH++ GAG 
Sbjct  175  QGKKTIDGRGANVHIANGAGF  195



>ref|XP_006480843.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 130/201 (65%), Gaps = 17/201 (8%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
             FL +FA ++P +S +I+E DEVW++R  EA +   + ++P+P  +++  N +V      
Sbjct  9    FFLFSFAALIPCLSANISEVDEVWRRRAEEAMQTTEQYYDPNPVAIASHLNMKVQDL---  65

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
            SK    R+  +N               +G C ATNPID CWRC+ NWA NR+ LA C +G
Sbjct  66   SKQTAARRGLLNAE-------------SGQCEATNPIDNCWRCKENWAENRQALAGCALG  112

Query  244  FGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FG KA GGK G +Y V D SD D  NPK GTLRHAVIQK+PLWIIF++DMNI+L QELI+
Sbjct  113  FGIKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIV  172

Query  67   QSDKTIDGRGFQVHVSGGAGI  5
            Q  KTIDGRG  VH++ GAG 
Sbjct  173  QGKKTIDGRGANVHIANGAGF  193



>ref|XP_002272638.2| PREDICTED: pectate lyase-like [Vitis vinifera]
Length=434

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 142/207 (69%), Gaps = 17/207 (8%)
 Frame = -3

Query  619  INCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVH  440
            +N   + L+ F +I+P+++ +I ++DEVWQ R  EA + AL+ + P P  V+  FN +VH
Sbjct  4    VNMRLVILIPFLVIVPAVTANIGDFDEVWQTRAEEARKAALQAYNPHPEKVTDNFNKKVH  63

Query  439  KTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLA  260
            K+              + ++ TRR L+    ++G C ATNPIDRCWRC+ +WA+NR +LA
Sbjct  64   KSF-------------DSTNHTRRNLS---KFSGLCMATNPIDRCWRCRSDWASNRMKLA  107

Query  259  DCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLN  83
            DC +GFG+K  GGK G +YVV D SD D  NPKPGTLRHA IQ++PLWIIF+  M IRLN
Sbjct  108  DCVLGFGQKTTGGKGGKIYVVTDPSDNDMVNPKPGTLRHAAIQEEPLWIIFAHSMAIRLN  167

Query  82   QELIMQSDKTIDGRGFQVHVSGGAGIT  2
            +ELIM S+KTID RG  VH++ GAG+T
Sbjct  168  EELIMTSNKTIDARGANVHIANGAGLT  194



>ref|XP_009403112.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=437

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 124/186 (67%), Gaps = 15/186 (8%)
 Frame = -3

Query  559  HIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSD  380
            HI ++DE WQ++   A + A  ++ PDP +V+ +FN+ V K L                +
Sbjct  24   HIGDFDEYWQKKAEAARDRAQGSYNPDPESVTQSFNEAVSKDLE--------------GN  69

Query  379  DTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYV  200
             TRR L  +  +NGPC ATNPIDRCWRC+ +W  NR+RLA C  GFGR  IGGK+G LYV
Sbjct  70   VTRRSLRGKHKFNGPCVATNPIDRCWRCKKDWMQNRKRLAKCAKGFGRHTIGGKNGDLYV  129

Query  199  VNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHV  23
            V D SD D  +PK GTLR+ VIQ +PLWI+F+ DM IRLN+EL++ SDKTID RG  VH+
Sbjct  130  VTDASDNDLISPKKGTLRYGVIQDRPLWIVFASDMIIRLNEELLVTSDKTIDARGSNVHI  189

Query  22   SGGAGI  5
             GGAGI
Sbjct  190  MGGAGI  195



>ref|NP_172894.1| putative pectate lyase 3 [Arabidopsis thaliana]
 sp|Q9M9S2.1|PLY3_ARATH RecName: Full=Probable pectate lyase 3; AltName: Full=Pectate 
lyase A2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF43942.1|AC012188_19 Strong similarity to Pectate Lyase Precursor from Lilium longiflorum 
gi|730290 and contains a Pectate lyase PF|00544 domain. 
EST gb|AW004514 comes from this gene [Arabidopsis thaliana]
 gb|AAQ62871.1| At1g14420 [Arabidopsis thaliana]
 dbj|BAD43564.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43610.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43654.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43743.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43876.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43899.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29161.1| putative pectate lyase 3 [Arabidopsis thaliana]
Length=459

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 136/211 (64%), Gaps = 17/211 (8%)
 Frame = -3

Query  613  CFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKT  434
             F  F    AI+ P + G++A +D  W QR+ +A +  + +++P P NV+  FN  V+  
Sbjct  12   VFVFFSSFLAIVAPQVRGNVAVFDSYWTQRQSDALKQTIGSYDPHPLNVTNHFNYHVNIA  71

Query  433  LLESKNEPDRKKFVNGSDDTRRQLAH----RKPY--NGPCNATNPIDRCWRCQPNWANNR  272
            +  S++           +DTRR+L      RK +  +G C A NPID CWRC  NWANNR
Sbjct  72   VDASESR----------NDTRRELTQVRSGRKTHKSSGKCLAYNPIDNCWRCDRNWANNR  121

Query  271  RRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMN  95
            ++LADC +GFGR+  GGK G +YVV D SD D  NPKPGTLRHAV +  PLWIIF+R M 
Sbjct  122  KKLADCVLGFGRRTTGGKDGPIYVVKDASDNDLINPKPGTLRHAVTRDGPLWIIFARSMI  181

Query  94   IRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            I+L QEL++ SDKTIDGRG +V++  GAG+T
Sbjct  182  IKLQQELMITSDKTIDGRGARVYIMEGAGLT  212



>gb|AAB69759.1| putative pectate lyase [Arabidopsis thaliana]
Length=459

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 136/211 (64%), Gaps = 17/211 (8%)
 Frame = -3

Query  613  CFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKT  434
             F  F    AI+ P + G++A +D  W QR+ +A +  + +++P P NV+  FN  V+  
Sbjct  12   VFVFFSSFLAIVAPQVRGNVAVFDSYWTQRQSDALKQTIGSYDPHPLNVTNHFNYHVNIA  71

Query  433  LLESKNEPDRKKFVNGSDDTRRQLAH----RKPY--NGPCNATNPIDRCWRCQPNWANNR  272
            +  S++           +DTRR+L      RK +  +G C A NPID CWRC  NWANNR
Sbjct  72   VDASESR----------NDTRRELTQVRSGRKTHKSSGKCLAYNPIDNCWRCDRNWANNR  121

Query  271  RRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMN  95
            ++LADC +GFGR+  GGK G +YVV D SD D  NPKPGTLRHAV +  PLWIIF+R M 
Sbjct  122  KKLADCVLGFGRRTTGGKDGPIYVVKDASDNDLINPKPGTLRHAVTRDGPLWIIFARSMI  181

Query  94   IRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            I+L QEL++ SDKTIDGRG +V++  GAG+T
Sbjct  182  IKLQQELMITSDKTIDGRGARVYIMEGAGLT  212



>ref|XP_002892805.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69064.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 139/222 (63%), Gaps = 17/222 (8%)
 Frame = -3

Query  646  VAKIMAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNV  467
            +A +        F  F    AI+ P +  ++A +D  W QR+ +A +  + +++P+P NV
Sbjct  1    MAAVFLNLGGYVFVFFSSFLAIVAPQVRANVAVFDSYWTQRQSDALKQTMGSYDPNPINV  60

Query  466  SAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAH------RKPYNGPCNATNPIDRC  305
            +  FN  V+  +  S++          ++DTRR+L         K ++G C A NPID+C
Sbjct  61   TNHFNYHVNIAVDVSES----------NNDTRRELTQVRSGRKTKKHSGKCLAYNPIDKC  110

Query  304  WRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKK  128
            WRC  NWA NR++LADC +GFGR+  GGK G +YVV D SDD   NPKPGTLRHAV +  
Sbjct  111  WRCDRNWAKNRKKLADCVLGFGRRTTGGKDGPIYVVKDASDDDLINPKPGTLRHAVTRNG  170

Query  127  PLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            PLWIIF+R M I+L QEL++ SDKTIDGRG +V++  GAG+T
Sbjct  171  PLWIIFARSMIIKLQQELMITSDKTIDGRGARVYIMEGAGLT  212



>ref|XP_008446316.1| PREDICTED: probable pectate lyase P59 [Cucumis melo]
Length=432

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 126/186 (68%), Gaps = 17/186 (9%)
 Frame = -3

Query  556  IAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDD  377
            I ++D+ W+ R  EA + A   +EP+P  ++ + N EV + L             +GS+ 
Sbjct  21   IGDFDDYWKARAAEAEQAAADAYEPNPETIADSLNAEVGQAL-------------SGSNS  67

Query  376  TRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVV  197
            TRR L   K Y GPC ATNPIDRCWRC PNWA NR++LADC +GFGRK IGGK G  YVV
Sbjct  68   TRRNL---KKYTGPCRATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTIGGKLGPYYVV  124

Query  196  NDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVS  20
            ND SD D  NPKPGTLRHAVIQK PLWI FS +M IRL QELI+ SDKTID RG  V ++
Sbjct  125  NDSSDSDLMNPKPGTLRHAVIQKGPLWITFSTNMAIRLTQELIVTSDKTIDARGANVQIA  184

Query  19   GGAGIT  2
             GAGIT
Sbjct  185  YGAGIT  190



>ref|XP_003543726.1| PREDICTED: pectate lyase [Glycine max]
Length=443

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 131/217 (60%), Gaps = 17/217 (8%)
 Frame = -3

Query  646  VAKIMAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNV  467
            + +IM G         L TFAI++P +   IAE+D+  + +  EA + AL ++ P+P +V
Sbjct  1    MERIMVGSATKVAFTLLATFAIVIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDV  60

Query  466  SAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNG-PCNATNPIDRCWRCQP  290
            +   N  VH  L  S               TRR+L  RK   G  C A+NPID CWRC  
Sbjct  61   AHELNFHVHMALENS---------------TRRELRQRKLRGGGKCQASNPIDACWRCNK  105

Query  289  NWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWII  113
            +WAN+R RLA CG GFGR+A GG  G +YVV D+SDD   NPKPGT+RHAV QK PLWII
Sbjct  106  DWANDRFRLAKCGKGFGRRATGGLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQKGPLWII  165

Query  112  FSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            F   M I L QEL++ SDKTIDGRG  V   GGAG+T
Sbjct  166  FGHSMIISLRQELMISSDKTIDGRGANVQFRGGAGLT  202



>ref|XP_010514040.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 137/212 (65%), Gaps = 13/212 (6%)
 Frame = -3

Query  622  NINCFCMFLVTF--AIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFND  449
            N+  + +  V+   A+++P++  H+AE+DE W QR+ EA    L++++P+P NV+  FN 
Sbjct  3    NLGSYVIVFVSLSLAVVVPTVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNY  62

Query  448  EVHKTLLES--KNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANN  275
                 +  +   NE  R        D R+  + +K   G   + N ID+CWR   NW  N
Sbjct  63   HAALAMETTGIANETRR--------DLRQVKSGKKRRGGRYESLNAIDKCWRGDKNWDKN  114

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDM  98
            R++LADC +GFGRK  GGK+G +YVV D SD D  NPKPGTLRHAV + +PLWIIF+R M
Sbjct  115  RKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTLRHAVTRDRPLWIIFARHM  174

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             I+L QELI+ +DKTIDGRG  V+++GGAG+T
Sbjct  175  IIKLQQELIITNDKTIDGRGVSVYITGGAGLT  206



>ref|XP_004135462.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
 gb|KGN51889.1| hypothetical protein Csa_5G604340 [Cucumis sativus]
Length=432

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 123/186 (66%), Gaps = 17/186 (9%)
 Frame = -3

Query  556  IAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDD  377
            I ++D+ W+ R   A + A   ++PDP  V+ + N E+                 +G + 
Sbjct  21   IGDFDDYWKARAAAAEKAAADAYDPDPETVANSVNAEIAHA-------------SSGRNS  67

Query  376  TRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVV  197
            TRR L   K Y GPC ATNPIDRCWRC PNWA NR++LADC +GFGRK  GGK G  YVV
Sbjct  68   TRRNL---KKYAGPCLATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTTGGKLGPYYVV  124

Query  196  NDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVS  20
            ND SD D  NPKPGTLRHAVIQK PLWIIFS +M IRL+QELIM SDKTID RG  V ++
Sbjct  125  NDSSDSDLMNPKPGTLRHAVIQKGPLWIIFSTNMAIRLSQELIMTSDKTIDARGANVQIA  184

Query  19   GGAGIT  2
             GAGIT
Sbjct  185  YGAGIT  190



>gb|KGN47799.1| hypothetical protein Csa_6G404140 [Cucumis sativus]
Length=415

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 118/182 (65%), Gaps = 16/182 (9%)
 Frame = -3

Query  544  DEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQ  365
            DE WQ R  EA + A   F  +P  V+   N  V +T+L             G + TRR 
Sbjct  25   DEYWQTRATEAKKVAQGAFNANPEIVTDTLNAAVSRTML-------------GHNSTRRS  71

Query  364  LAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHS  185
            L  RK Y GPC ATNPIDRCWRC  NWA NRR+LA+C +GFG + IGGK G +YVV D S
Sbjct  72   L--RKKYRGPCLATNPIDRCWRCDRNWAKNRRKLAECPLGFGHQTIGGKRGPIYVVTDAS  129

Query  184  DDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAG  8
            DD   NPKPGTLRH VIQK PLWIIF R M IRL+QEL++ S KTID RG  VH++ GAG
Sbjct  130  DDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQELMISSHKTIDARGANVHIAFGAG  189

Query  7    IT  2
            +T
Sbjct  190  LT  191



>ref|XP_004155392.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=432

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 123/186 (66%), Gaps = 17/186 (9%)
 Frame = -3

Query  556  IAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDD  377
            I ++D+ W+ R   A + A   ++PDP  V+ + N E+                 +G + 
Sbjct  21   IGDFDDYWKARAAAAEKAAADAYDPDPETVANSVNAEIAHA-------------SSGRNS  67

Query  376  TRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVV  197
            TRR L   K Y GPC ATNPIDRCWRC PNWA NR++LADC +GFGRK  GGK G  YVV
Sbjct  68   TRRNL---KKYAGPCLATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTTGGKLGPYYVV  124

Query  196  NDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVS  20
            ND SD D  NPKPGTLRHAVIQK PLWIIFS +M IRL+QELIM SDKTID RG  V ++
Sbjct  125  NDSSDSDLMNPKPGTLRHAVIQKGPLWIIFSXNMAIRLSQELIMTSDKTIDARGANVQIA  184

Query  19   GGAGIT  2
             GAGIT
Sbjct  185  YGAGIT  190



>ref|XP_010915114.1| PREDICTED: LOW QUALITY PROTEIN: pectate lyase-like [Elaeis guineensis]
Length=444

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 125/190 (66%), Gaps = 15/190 (8%)
 Frame = -3

Query  562  GHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGS  383
             +I E+D+ WQ++  EA   +   + PDP  V+  FN  VH  L E++N           
Sbjct  26   ANIVEFDDHWQKKAEEALARSRAAYNPDPEGVTHDFNKAVHLALSEARNS----------  75

Query  382  DDTRRQL--AHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGV  209
              TRR L   HR  + GPC ATNPIDRCWRCQ NW N+R++LA C  GFGR AIGGK+G 
Sbjct  76   --TRRTLRSVHRNKFKGPCVATNPIDRCWRCQKNWINHRKKLATCAKGFGRNAIGGKNGD  133

Query  208  LYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQ  32
             YVV D SDD   NPK GTLR  VIQ +PLWIIF+RDM IRL++EL++ S+KTIDGRG  
Sbjct  134  FYVVTDPSDDDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGAN  193

Query  31   VHVSGGAGIT  2
            VH++ GA IT
Sbjct  194  VHIAFGAQIT  203



>ref|XP_010425041.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 139/214 (65%), Gaps = 17/214 (8%)
 Frame = -3

Query  622  NINCFCMFLVTF--AIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFND  449
            N+  + +  V+   A+++PS+  H+AE+DE W QR+ EA    L++++P+P NV+  FN 
Sbjct  3    NLGSYVIVFVSLSLAVVVPSVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFN-  61

Query  448  EVHKTLLESKNEPDRKKFVNGSDDTRRQL----AHRKPYNGPCNATNPIDRCWRCQPNWA  281
              H  L          +    S++TRR L    + +K   G   + N ID+CWR   NW 
Sbjct  62   -YHAALA--------METTGISNETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGNKNWD  112

Query  280  NNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSR  104
             NR++LADC +GFGRK  GGK+G +YVV D SD D  NPKPGTLR+AV + +PLWIIF+R
Sbjct  113  KNRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTLRYAVTRDRPLWIIFAR  172

Query  103  DMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             M I+L QELI+ +DKTIDGRG  V+++GGAG+T
Sbjct  173  HMIIKLQQELIITNDKTIDGRGVSVYITGGAGLT  206



>gb|AAQ62996.1| oil palm polygalacturonase allergen PEST361 [Elaeis guineensis]
Length=447

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 125/190 (66%), Gaps = 15/190 (8%)
 Frame = -3

Query  562  GHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGS  383
             +I E+D+ WQ++  EA   +   + PDP  V+  FN  VH  L E++N           
Sbjct  26   ANIVEFDDHWQKKAEEALARSRAAYNPDPEAVTHDFNKAVHLALSEARNS----------  75

Query  382  DDTRRQL--AHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGV  209
              TRR L   HR  + GPC ATNPIDRCWRCQ NW N+R++LA C  GFGR AIGGK+G 
Sbjct  76   --TRRTLRSVHRNKFKGPCVATNPIDRCWRCQKNWINHRKKLATCAKGFGRNAIGGKNGD  133

Query  208  LYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQ  32
             YVV D SDD   NPK GTLR  VIQ +PLWIIF+RDM IRL++EL++ S+KTIDGRG  
Sbjct  134  FYVVTDPSDDDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGAN  193

Query  31   VHVSGGAGIT  2
            VH++ GA IT
Sbjct  194  VHIAFGAQIT  203



>ref|XP_004146792.1| PREDICTED: probable pectate lyase P59-like, partial [Cucumis 
sativus]
Length=442

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 126/204 (62%), Gaps = 16/204 (8%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            F   L   +++   ++    + DE WQ R  EA + A   F  +P  V+   N  V +T+
Sbjct  10   FFSSLFVCSLLFFVVANANVDEDEYWQTRATEAKKVAQGAFNANPEIVTDTLNAAVSRTM  69

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
            L             G + TRR L  RK Y GPC ATNPIDRCWRC  NWA NRR+LA+C 
Sbjct  70   L-------------GHNSTRRSL--RKKYRGPCLATNPIDRCWRCDRNWAKNRRKLAECP  114

Query  250  MGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
            +GFG + IGGK G +YVV D SDD   NPKPGTLRH VIQK PLWIIF R M IRL+QEL
Sbjct  115  LGFGHQTIGGKRGPIYVVTDASDDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQEL  174

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            ++ S KTID RG  VH++ GAG+T
Sbjct  175  MISSHKTIDARGANVHIAFGAGLT  198



>ref|XP_002871648.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47907.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 134/220 (61%), Gaps = 19/220 (9%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKT---  434
            MF+   A+++P+I G+I+E DE W QR  EA E  L+ +  DP  +   F++  +     
Sbjct  10   MFMFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  433  LLESKNEPDRK----------KFVNGSDDTRRQLAHR-----KPYNGPCNATNPIDRCWR  299
            +  ++ E D K             + ++ TRR L  +         GPC A+NPID+CWR
Sbjct  70   VTTTEEEGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWR  129

Query  298  CQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDH-SDDPSNPKPGTLRHAVIQKKPL  122
            C+ +WA  R+RL  C  GFG +  GGK G +YVV  +  DD  NPKPGTLRHAVIQK+PL
Sbjct  130  CRSDWAKRRKRLTRCVRGFGHRTTGGKRGRIYVVTSNLDDDMVNPKPGTLRHAVIQKEPL  189

Query  121  WIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            WIIF  DM+IRLNQEL++ S KTID RG  VHV+ GAGIT
Sbjct  190  WIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGIT  229



>ref|XP_006292606.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
 gb|EOA25504.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
Length=455

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 137/218 (63%), Gaps = 17/218 (8%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            M       F    ++ A+++PS+  HIA  DE W QR+ EA +  L+ ++P+P NV+  F
Sbjct  1    MVNLGSYVFVFVSLSLAVVVPSVQAHIAVHDEYWTQRQTEALQQTLEAYDPEPLNVTDHF  60

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQL-----AHRKPYNGP-CNATNPIDRCWRCQ  293
            N +    ++ +         VN   +TRR+L      ++KP  G    + N ID+CWR  
Sbjct  61   NHQAALAMVPTG-------IVN---ETRRELRQVGRGNKKPRRGRRYESLNAIDKCWRGD  110

Query  292  PNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWI  116
             NW  NR++LADC +GFGRK  GGK+G  YVV D SD D  NPKPGTLR+AV + +PLWI
Sbjct  111  KNWDKNRKKLADCVLGFGRKTTGGKNGPFYVVTDPSDTDLMNPKPGTLRYAVTRDRPLWI  170

Query  115  IFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IF+R M I+L QELI+ +DKTIDGRG  VH++GGAG+T
Sbjct  171  IFARSMIIKLQQELIITNDKTIDGRGANVHITGGAGLT  208



>ref|XP_010502279.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 136/210 (65%), Gaps = 9/210 (4%)
 Frame = -3

Query  622  NINCFCMFLVTF--AIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFND  449
            N+  + +  V+   A+ +PS+  H+AE+DE W QR+ EA    L++++P+P NV+  FN 
Sbjct  3    NLGSYVIVFVSLSLAVAVPSVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNY  62

Query  448  EVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRR  269
                 +  +    + ++      D R+  + +K   G   + N ID+CWR   NW  NR+
Sbjct  63   HAALAMETTGTANETRR------DLRQVKSGKKRRGGRYESLNAIDKCWRGDKNWDKNRK  116

Query  268  RLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNI  92
            +LADC +GFGRK  GGK+G +YVV D SD D  +PKPGTLRHAV + +PLWIIF+R M I
Sbjct  117  KLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLDPKPGTLRHAVTRDRPLWIIFARHMII  176

Query  91   RLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            +L QELI+ +DKTIDGRG  V+++GGAG+T
Sbjct  177  KLQQELIITNDKTIDGRGVSVYITGGAGLT  206



>ref|XP_004162547.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
Length=435

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 118/182 (65%), Gaps = 16/182 (9%)
 Frame = -3

Query  544  DEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQ  365
            DE W+ R  EA + A   F  +P  V+   N  V +T+L             G + TRR 
Sbjct  25   DEYWETRATEAKKVAQGAFNANPEIVTDTLNAAVSRTML-------------GHNSTRRS  71

Query  364  LAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHS  185
            L  RK Y GPC ATNPIDRCWRC  NWA NRR+LA+C +GFG + IGGK G +YVV D S
Sbjct  72   L--RKKYRGPCLATNPIDRCWRCDRNWAKNRRKLAECPLGFGHQTIGGKRGPIYVVTDAS  129

Query  184  DDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAG  8
            DD   NPKPGTLRH VIQK PLWIIF R M IRL+QEL++ S KTID RG  VH++ GAG
Sbjct  130  DDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQELMISSHKTIDARGANVHIAFGAG  189

Query  7    IT  2
            +T
Sbjct  190  LT  191



>gb|ACU23277.1| unknown [Glycine max]
Length=443

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 130/217 (60%), Gaps = 17/217 (8%)
 Frame = -3

Query  646  VAKIMAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNV  467
            + +IM G         L TFAI++P +   IAE+D+  + +  EA + AL ++ P+P +V
Sbjct  1    MERIMVGSATKVAFTLLATFAIVIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDV  60

Query  466  SAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNG-PCNATNPIDRCWRCQP  290
            +   N  VH  L  S               TRR+L  RK   G  C A+NPID CWRC  
Sbjct  61   AHELNFHVHMALENS---------------TRRELRQRKLRGGGKCQASNPIDACWRCNK  105

Query  289  NWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWII  113
            +WAN+R RLA CG GFGR+A GG  G +Y V D+SDD   NPKPGT+RHAV QK PLWII
Sbjct  106  DWANDRFRLAKCGKGFGRRATGGLGGPIYAVTDNSDDDMVNPKPGTIRHAVTQKGPLWII  165

Query  112  FSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            F   M I L QEL++ SDKTIDGRG  V   GGAG+T
Sbjct  166  FGHSMIISLRQELMISSDKTIDGRGANVQFRGGAGLT  202



>ref|XP_006354795.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=435

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 130/200 (65%), Gaps = 17/200 (9%)
 Frame = -3

Query  601  FLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLES  422
            F V    ++ SI  +I E+DEVW+ R  +A ++A +++ P P  V+A  N  VH++    
Sbjct  10   FFVILCTLVFSIEANIGEFDEVWRTRATQANKNAKESYNPHPEKVAANLNKHVHRS----  65

Query  421  KNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGF  242
                       GS+ TRR L     YNGPC ATNPIDRCWRC P+WA NR++LADC +GF
Sbjct  66   ---------EEGSNSTRRDL---HKYNGPCVATNPIDRCWRCDPHWAKNRQKLADCVLGF  113

Query  241  GRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQ  65
            G    GGK G +Y+V D  D D  NPKPGTLRHAVIQ  PLWIIF+  M I+LNQELIM 
Sbjct  114  GHHTTGGKGGKIYIVTDPGDNDMVNPKPGTLRHAVIQPGPLWIIFAHHMVIKLNQELIMT  173

Query  64   SDKTIDGRGFQVHVSGGAGI  5
             DKTID RG QVH++GGA +
Sbjct  174  GDKTIDARGQQVHITGGASL  193



>ref|XP_008389523.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 3 [Malus 
domestica]
Length=452

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 121/186 (65%), Gaps = 14/186 (8%)
 Frame = -3

Query  556  IAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDD  377
            + + D  W++R  EA + A++++  +P  V+  FN  V + LL  +N             
Sbjct  39   VLDLDAYWKERAQEALKEAMESYHKNPEQVTEEFNTGVAE-LLSKENT------------  85

Query  376  TRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVV  197
            TRR L   K YNGPC ATNPID CWRC PNWA+NR+++  C  GFG+KA GGK G +YVV
Sbjct  86   TRRNLRGNKGYNGPCMATNPIDACWRCDPNWADNRKKIVGCAQGFGKKATGGKDGPIYVV  145

Query  196  NDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVS  20
               +DD   NPKPGTLRHAVIQK PLWIIF+R M IRL QEL++ SDKTIDGRG  V + 
Sbjct  146  TVGTDDDVQNPKPGTLRHAVIQKGPLWIIFARSMVIRLQQELMVTSDKTIDGRGANVVIE  205

Query  19   GGAGIT  2
             G GIT
Sbjct  206  EGGGIT  211



>ref|XP_009615547.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=434

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 136/201 (68%), Gaps = 17/201 (8%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +FL    +++ SI  HI E+DEVW++R  +A + A   + P+P  V+   N++V K    
Sbjct  8    LFLFVMFVLVLSIEAHIGEFDEVWRKRAQQAKKAARHAYHPNPKIVADHLNNQVDKA---  64

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                      V GS+  RR L HR  YNG C ATNPID+CWRC PNWA NR +LADC +G
Sbjct  65   ----------VRGSNSRRRDL-HR--YNGQCKATNPIDQCWRCDPNWARNRMKLADCVLG  111

Query  244  FGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FGRK  GGK G  YVV D+SD D  NPKPGTLRHAVIQ +PLWIIF+++M IRLN+ELIM
Sbjct  112  FGRKTTGGKGGKSYVVTDNSDNDLVNPKPGTLRHAVIQPQPLWIIFAKNMVIRLNEELIM  171

Query  67   QSDKTIDGRGFQVHVSGGAGI  5
             S+KTID RG QVH++ G G+
Sbjct  172  TSNKTIDARGKQVHIAHGGGL  192



>ref|NP_178375.1| putative pectate lyase 6 [Arabidopsis thaliana]
 sp|O64510.1|PLY6_ARATH RecName: Full=Probable pectate lyase 6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC05350.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAO64162.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAV34776.1| At2g02720 [Arabidopsis thaliana]
 gb|AEC05615.1| putative pectate lyase 6 [Arabidopsis thaliana]
Length=455

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 134/216 (62%), Gaps = 13/216 (6%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            M       F    ++  +++PS+  HIAE+DE W QR+  A    L++++P+P NV+  F
Sbjct  1    MVNLGSYVFVFVALSLTVVVPSVQAHIAEYDEYWTQRQTNALRETLESYDPNPENVTDHF  60

Query  454  NDE----VHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPN  287
            N      +  T + ++   D ++   G   TRR         G   + N ID+CWR   N
Sbjct  61   NYHAALAMETTGIVNETRRDLRQVGRGKKTTRR--------GGRFESLNAIDKCWRGDKN  112

Query  286  WANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIF  110
            W  NR++LADC +GFGRK  GGK+G +YVV D SD D   PKPGT+RHAV + +PLWIIF
Sbjct  113  WDKNRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLKPKPGTIRHAVTRDRPLWIIF  172

Query  109  SRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            +R M I+L QELI+ +DKTIDGRG +++++GGAG+T
Sbjct  173  ARSMIIKLQQELIITNDKTIDGRGAKIYITGGAGLT  208



>ref|XP_011086389.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=442

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 125/202 (62%), Gaps = 20/202 (10%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            + +++F ++LP     IA++DE  ++R   + E + K F P+P  ++   ND+V +TL  
Sbjct  16   IIILSFVLLLPKSGAAIAKYDEYLKKRAQASLEESRKAFNPNPEELADDLNDQVSETLT-  74

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                              R+   R    G C ATNPIDRCWRC PNW  NR++LA+C  G
Sbjct  75   ------------------REGGKRNLRQGGCKATNPIDRCWRCDPNWDKNRKQLAECARG  116

Query  244  FGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FG +A GGK G  YVV D SD D   PKPGTLRHAVIQ +PLWIIF R+M I L +ELI 
Sbjct  117  FGHRATGGKSGRYYVVTDPSDNDMDKPKPGTLRHAVIQPQPLWIIFGRNMVITLKEELIF  176

Query  67   QSDKTIDGRGFQVHVSGGAGIT  2
             SDKT+DGRG +VH++ GAGIT
Sbjct  177  ASDKTVDGRGAEVHIAYGAGIT  198



>ref|XP_010683249.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 136/191 (71%), Gaps = 12/191 (6%)
 Frame = -3

Query  571  SISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFV  392
            +++ +IAE+DE W +R++EA ++  + + P+P NV+  FN +VH   L ++N    KK  
Sbjct  24   TLNANIAEFDEYWHKRRLEAVKYFEEAYHPEPYNVTNHFNHQVH---LHARN---MKKL-  76

Query  391  NGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHG  212
               + TRR L   K + GPC ATNPID CWRCQPNWA NR+RLADC +GFG+   GGK G
Sbjct  77   ---NSTRRGLL-GKGHIGPCVATNPIDACWRCQPNWAENRKRLADCAIGFGKGTTGGKDG  132

Query  211  VLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGF  35
             +YVV D SD D  NPKPGTLRHAVIQ +PLWIIF+R MNIRL QELIM  DKTID RG 
Sbjct  133  RIYVVTDSSDNDMQNPKPGTLRHAVIQTEPLWIIFARSMNIRLTQELIMTGDKTIDARGA  192

Query  34   QVHVSGGAGIT  2
             VH++ GAGIT
Sbjct  193  NVHIAHGAGIT  203



>ref|XP_006437462.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
 gb|ESR50702.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
Length=419

 Score =   192 bits (488),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 127/195 (65%), Gaps = 23/195 (12%)
 Frame = -3

Query  577  LPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKK  398
            +P +S HIAE DEVW++R  EA +   + ++P+P  V+   N +V               
Sbjct  1    MPCLSAHIAEVDEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQ--------------  46

Query  397  FVNGSDDTRRQLAHRKPYN---GPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAI  227
                 D +++ +A R   N   G C ATNPID+CWRC+ NWA +R+ LA C +GFG KA 
Sbjct  47   -----DLSKQAIAKRGLLNAESGQCEATNPIDKCWRCKENWAEDRQALAGCALGFGSKAT  101

Query  226  GGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTI  50
            GGK G +Y V D SD D  NPK GTLRHAVIQK+PLWIIF++DMNI+L QELI+Q  KTI
Sbjct  102  GGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQGSKTI  161

Query  49   DGRGFQVHVSGGAGI  5
            DGRG +VH++ GAGI
Sbjct  162  DGRGAKVHIANGAGI  176



>emb|CDP00293.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 124/187 (66%), Gaps = 19/187 (10%)
 Frame = -3

Query  559  HIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSD  380
            HI E+D+  ++R  +A + +L+ + PDP  V+  F  +V K L              G +
Sbjct  35   HIGEFDDFLRKRAEDALQASLRAYNPDPEAVTDNFTRQVGKML-------------EGGN  81

Query  379  DTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYV  200
            +TRRQL       G C ATNPIDRCWRC PNWA NR+RLA C  GFGR+  GG HG  YV
Sbjct  82   ETRRQLKA-----GGCVATNPIDRCWRCDPNWAKNRKRLAKCARGFGRQTKGGMHGKYYV  136

Query  199  VNDHSDD-PSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHV  23
            V D SDD   +P+PGTLRHAVIQ++PLWIIF   M I+LNQEL++ SDKTIDGRG +VH+
Sbjct  137  VVDPSDDNVQDPEPGTLRHAVIQQEPLWIIFDTSMVIKLNQELLINSDKTIDGRGVEVHI  196

Query  22   SGGAGIT  2
            + GAG++
Sbjct  197  AYGAGLS  203



>ref|XP_009129128.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=457

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 135/218 (62%), Gaps = 17/218 (8%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTF--AIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSA  461
             A  N+  + +  V+   AI+ PS+  HIA +D+ W QR+  A    ++++EP+P NV+ 
Sbjct  3    FAYLNLGSYVIVFVSLSIAIVAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTN  62

Query  460  AFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQL----AHRKPYNGPCNATNPIDRCWRCQ  293
             FN   H  L       D        + TRR+L    A +K   G   + N IDRCWR  
Sbjct  63   HFN--YHAALAMETTGAD--------NGTRRELGQVKAGQKARGGRFKSLNAIDRCWRGD  112

Query  292  PNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWI  116
             NWA NR++LADC +GFG K  GGK+G +YVV D SDD   +PKPGTLRHAV + +PLWI
Sbjct  113  KNWAKNRKKLADCVLGFGLKTTGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWI  172

Query  115  IFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IF+R M I+L QEL++ +DKTIDGRG  V+++GGAG T
Sbjct  173  IFARTMVIKLQQELMITNDKTIDGRGVSVYITGGAGFT  210



>ref|XP_010528323.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=458

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 132/212 (62%), Gaps = 9/212 (4%)
 Frame = -3

Query  619  INCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF--NDE  446
            I C+ +FLV F   +P++ G I E+D+  ++++ EA E AL+ ++P+       F  ND 
Sbjct  7    IACY-VFLVCFVSQIPNLRGKIGEYDDYLRKQEAEAQEQALRAYDPEFDQTVKKFDHNDP  65

Query  445  VHKTLLESKNEPDRKKFVNGSDDTRRQLAHR---KPYNGPCNATNPIDRCWRCQPNWANN  275
             H+    S     R      +  TRR L  R   K   GPC ATNP+D+CWRCQ +WA N
Sbjct  66   SHQNATISIKGGYRPN--KNTTSTRRSLRGRGNWKKIAGPCKATNPVDKCWRCQADWAQN  123

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDM  98
            R+RL  C  GFG K  GG  G  Y V D SDD   NPKPGT+RHAVIQK PLWIIF+R M
Sbjct  124  RKRLVSCVRGFGHKTTGGFSGKFYKVTDPSDDDMQNPKPGTIRHAVIQKVPLWIIFARSM  183

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            +IRL QEL++ S+KTID RG  VH++ GAGIT
Sbjct  184  HIRLKQELMITSNKTIDARGANVHIAFGAGIT  215



>emb|CDY09356.1| BnaA02g26540D [Brassica napus]
Length=457

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 135/217 (62%), Gaps = 17/217 (8%)
 Frame = -3

Query  631  AGFNINCFCMFLVTF--AIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAA  458
            A  N+  + +  V+   AI+ PS+  HIA +D+ W QR+  A    ++++EP+P NV+  
Sbjct  4    AYLNLGSYVIVFVSLSIAIVAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNH  63

Query  457  FNDEVHKTLLESKNEPDRKKFVNGSDDTRRQL----AHRKPYNGPCNATNPIDRCWRCQP  290
            FN   H  L       D        + TRR+L    A +K   G   + N IDRCWR   
Sbjct  64   FN--YHAALAMETTGAD--------NGTRRELGQVKAGQKARGGRFKSLNAIDRCWRGDK  113

Query  289  NWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWII  113
            NWA NR++LADC +GFG K  GGK+G +YVV D SDD   +PKPGTLRHAV + +PLWII
Sbjct  114  NWAKNRKKLADCVLGFGLKTTGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWII  173

Query  112  FSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            F+R M I+L QEL++ +DKTIDGRG  V+++GGAG T
Sbjct  174  FARTMVIKLQQELMITNDKTIDGRGVSVYITGGAGFT  210



>ref|XP_004489168.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=444

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 135/214 (63%), Gaps = 15/214 (7%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            MAG       + L+  AI +P +   IAE+D+  +++   A + ALK++ P+P N++   
Sbjct  1    MAGITRKITFIVLI-LAITIPCLEAGIAEFDDYLKEQADLARQIALKSYVPNPENITTEL  59

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNG--PCNATNPIDRCWRCQPNWA  281
            N  V+  + E+            S+ TRR+L  R+ + G   C ++NPID CWRC+ +WA
Sbjct  60   NLHVNMAMEEAY-----------SNSTRRELRQRQKHGGSSACMSSNPIDNCWRCKKDWA  108

Query  280  NNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSR  104
             NR++LA CG GFGRKA+GG  G  YVV D SD D   PK GTLR+  +QK PLWIIF+R
Sbjct  109  QNRQQLAQCGKGFGRKAVGGLGGKFYVVTDESDNDLVTPKFGTLRYGAVQKGPLWIIFAR  168

Query  103  DMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             M IRLNQEL++ SDKTIDGRG  VH+  GAGIT
Sbjct  169  SMIIRLNQELLVSSDKTIDGRGANVHIRDGAGIT  202



>ref|XP_008456459.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=434

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 129/212 (61%), Gaps = 23/212 (11%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            MAGF+    C  L  F +   ++     + DE W  R  EA + A   F P+P  V+   
Sbjct  1    MAGFSTLFVCSLLF-FVVANANV-----DEDEYWNTRATEAKKVAKSAFNPNPEIVTDNL  54

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANN  275
            N  V + ++             G + TRR L   K Y GPC ATNPIDRCWRC  NWA N
Sbjct  55   NAAVSRAMV-------------GRNSTRRSL---KKYRGPCLATNPIDRCWRCDRNWAKN  98

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDM  98
            R++LA+C +GFG + IGGK G +YVV D SDD   NPKPGTLR+ VIQK PLWIIF R M
Sbjct  99   RKKLAECPLGFGHQTIGGKRGPIYVVTDASDDDLVNPKPGTLRYGVIQKGPLWIIFGRSM  158

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             IRL+QEL++ SDKTID RG  VH++ GAG+T
Sbjct  159  IIRLSQELMISSDKTIDARGANVHIAFGAGLT  190



>ref|XP_010550068.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=469

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 138/215 (64%), Gaps = 16/215 (7%)
 Frame = -3

Query  598  LVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVH--KTLLE  425
            +V  A ++P+I  +IAE DE WQQR  EA +H+L  +  DP  +   F++  +   T +E
Sbjct  12   VVCIASLIPAIRSNIAELDEYWQQRSEEAEKHSLAAYHSDPFEIVDHFHERHYDNSTDIE  71

Query  424  SKNEPDRKK-----FVNGSDDTRRQLAHR--------KPYNGPCNATNPIDRCWRCQPNW  284
            ++ + D+++      + GS ++ R+                GPC+A+NPID+CWRC P+W
Sbjct  72   TERQDDQEEEDSIAMLTGSINSTRRSLRGGRRGRGKWSKLKGPCSASNPIDKCWRCMPDW  131

Query  283  ANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFS  107
            A  R++LADC  GFG K  GGK G +YVV  + D D  NP+PGTLRHAVIQK+PLWIIF 
Sbjct  132  ARRRQKLADCVRGFGYKTTGGKLGRIYVVTSNLDNDLINPRPGTLRHAVIQKEPLWIIFK  191

Query  106  RDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             DMNIRL QEL++ S KTID RG  VH++ GAGIT
Sbjct  192  NDMNIRLQQELMINSHKTIDARGANVHIAYGAGIT  226



>emb|CDY41679.1| BnaC02g34750D [Brassica napus]
Length=457

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 136/218 (62%), Gaps = 17/218 (8%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTF--AIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSA  461
             A  N+  + +  V+   AI+ PS+  HIA +D+ W QR+  A    ++++EP+P NV+ 
Sbjct  3    FAYLNLGSYVIVFVSLSIAIVAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTN  62

Query  460  AFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQL----AHRKPYNGPCNATNPIDRCWRCQ  293
             FN   H  L       D     NG    RR+L    A +K   G   + N IDRCWR  
Sbjct  63   HFN--YHAALAMETTGAD-----NGP---RRELGQVKAGQKTRGGRFRSLNAIDRCWRGD  112

Query  292  PNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWI  116
             NWA NR++LADC +GFG K IGGK+G +YVV D SDD   +PKPGTLRHAV + +PLWI
Sbjct  113  KNWAKNRKKLADCVLGFGLKTIGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWI  172

Query  115  IFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IF+R M I+L QEL++ +DKTIDGRG  V+++GGAG T
Sbjct  173  IFARTMVIKLQQELMITNDKTIDGRGVSVYITGGAGFT  210



>ref|XP_009117903.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=452

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 136/213 (64%), Gaps = 14/213 (7%)
 Frame = -3

Query  631  AGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFN  452
            A  NI  + +  +  AI++P +  ++A +D  W QR+ +A +  + +++P+P NV+   N
Sbjct  4    AFLNIGGYTLVFL-LAILVPHVQSNVAVFDNYWTQRQGDALKQTIASYDPNPLNVTDHLN  62

Query  451  DEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPY--NGPCNATNPIDRCWRCQPNWAN  278
               H  L     E         +++TRR+L  RK    +G C A NPID+CWRC PNW  
Sbjct  63   --YHVALAVDATE--------STNNTRRELIGRKTQEGSGKCIAYNPIDKCWRCDPNWEK  112

Query  277  NRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRD  101
            NR++LA+C +GFGRK  GGK G +YVVND SDD   NPKPGTLRHAV +  PLWIIF+  
Sbjct  113  NRKKLAECVLGFGRKTTGGKDGPIYVVNDSSDDDLVNPKPGTLRHAVTRDGPLWIIFANS  172

Query  100  MNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            M I+L QEL++ S+KTIDGRG +V++  G G+T
Sbjct  173  MVIKLQQELMITSNKTIDGRGAKVYIMEGVGLT  205



>gb|EPS73633.1| hypothetical protein M569_01123, partial [Genlisea aurea]
Length=455

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 131/204 (64%), Gaps = 19/204 (9%)
 Frame = -3

Query  604  MFLVTFAIILPSISG--HIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            + L+ F  I+ S +G  + A+ DE  + R  EA   +LK ++ +P +V+  FN  V  +L
Sbjct  1    LSLLLFLFIVGSSAGDEYGAQLDEYMKSRAEEARRESLKAYKDNPEDVAEQFNQLVSDSL  60

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
            +             G++ TRR L   +   G C ATNPIDRCWRC  +WA NR++LADC 
Sbjct  61   I-------------GANSTRRDL---RGVGGGCRATNPIDRCWRCDNDWAKNRKKLADCV  104

Query  250  MGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
             GFG    GGK+G  Y+V D SD D +NPKPGTLRHAVIQK+PLWIIF+  M IRLNQEL
Sbjct  105  RGFGHDTTGGKNGRYYLVTDPSDNDMANPKPGTLRHAVIQKEPLWIIFAHSMIIRLNQEL  164

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            I  S KTIDGRG QVH++ GAG+T
Sbjct  165  IFTSHKTIDGRGVQVHIANGAGLT  188



>gb|KEH24975.1| pectate lyase P59-like protein [Medicago truncatula]
Length=453

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 137/223 (61%), Gaps = 18/223 (8%)
 Frame = -3

Query  652  ISVAKIMAGFNINCFCMFLVTFAIILPSI-SGHI---AEWDEVWQQRKIEAWEHALKTFE  485
            + + KIM   +     + LVTFAI +P + + H+   AE D+  + R  EA + A++T+ 
Sbjct  1    MGMEKIMVESSTKIAFILLVTFAITIPCLEAAHVLSPAEIDDFVKARAEEAHKVAVETYV  60

Query  484  PDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHR-KPYNGPCNATNPIDR  308
            P P  V+   N  VH ++   +N            +TRR++  + K ++GPC ATNPID 
Sbjct  61   PIPEGVAHDLNVAVHMSMEAEEN------------NTRREMRQKGKKHDGPCEATNPIDS  108

Query  307  CWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQK  131
            CWRC+ +WA NR +LA C  GFGRK  GG  G +YVV D SD D  NPKPGTLR   +QK
Sbjct  109  CWRCKADWAANRFQLAKCSKGFGRKTTGGLGGPIYVVTDESDNDMVNPKPGTLRFGAVQK  168

Query  130  KPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             PLWI F+R M IRLNQEL++ SDKTIDGRG  V +  GAGIT
Sbjct  169  GPLWITFARSMVIRLNQELMVSSDKTIDGRGANVQIRDGAGIT  211



>ref|XP_008339935.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   190 bits (483),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 122/193 (63%), Gaps = 14/193 (7%)
 Frame = -3

Query  577  LPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKK  398
            +P+    + + D  W++R  EA + A++++  +P  V+  FN EV K L+  +N      
Sbjct  32   VPNEDTLVLDLDAYWKERAEEAEKVAMESYNKNPEKVTEEFNTEVGK-LMSKENT-----  85

Query  397  FVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGK  218
                   TRR L   K Y GPC ATNP+D CWRC PNWANNR+++  C  GFG+K  GGK
Sbjct  86   -------TRRNLRGNKAYTGPCMATNPMDACWRCDPNWANNRKKIVGCAQGFGKKTTGGK  138

Query  217  HGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGR  41
             G  YVV   +DD   NPKPGTLRHAVIQK PLWIIF++ M IRL QEL++ SDKTID R
Sbjct  139  DGPFYVVTMGTDDDVQNPKPGTLRHAVIQKGPLWIIFTKSMVIRLQQELMVTSDKTIDAR  198

Query  40   GFQVHVSGGAGIT  2
            G  V +  GAGIT
Sbjct  199  GANVVIEEGAGIT  211



>ref|XP_009788285.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=434

 Score =   189 bits (481),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 128/201 (64%), Gaps = 18/201 (9%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +F V+  ++L SI  +I+E+DEVWQ R  +A + A  ++ P P  V+   N  VH +   
Sbjct  9    IFFVSVTLVL-SIEANISEFDEVWQTRATQAKKTAQDSYNPHPETVADNLNKHVHTS---  64

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                        GS+ TRR L     YNGPC +TNPIDRCWRC PNWA  R +LADC +G
Sbjct  65   ----------EEGSNSTRRDL---HKYNGPCMSTNPIDRCWRCDPNWAKTRMKLADCVLG  111

Query  244  FGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FG    GGK G +YVV D SDD   NPKPGTLRHAVIQ +PLWIIF   M IRLNQELIM
Sbjct  112  FGHHTTGGKGGKIYVVTDPSDDDMVNPKPGTLRHAVIQPEPLWIIFKHHMVIRLNQELIM  171

Query  67   QSDKTIDGRGFQVHVSGGAGI  5
             S+KTID RG QVH++ GA  
Sbjct  172  TSNKTIDARGQQVHIAFGASF  192



>ref|XP_006482669.1| PREDICTED: probable pectate lyase 9-like [Citrus sinensis]
Length=255

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 131/201 (65%), Gaps = 18/201 (9%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +FL +F I++P +S  IAE DEVW++R  EA +   + ++PDP  V++  N +V      
Sbjct  9    IFLFSFIILIPCLSA-IAEADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNMKV------  61

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                   +++VN + +T+        Y GPC ATNP+DRCWRC  +WAN R +LAD   G
Sbjct  62   -------QEYVNNNTNTKNPSGK---YWGPCQATNPVDRCWRCWKDWANYRPKLADFVPG  111

Query  244  FGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FG K  GG+ G +Y+V D SD D +N KPGTL HAVIQ  PLWIIF+RD++I+L+QELIM
Sbjct  112  FGHKITGGQKGSIYIVTDSSDNDLTNSKPGTLCHAVIQNGPLWIIFARDLHIKLSQELIM  171

Query  67   QSDKTIDGRGFQVHVSGGAGI  5
             SDKTID RG  VH++ G  I
Sbjct  172  TSDKTIDARGADVHIAYGGRI  192



>emb|CDY45254.1| BnaA06g09240D [Brassica napus]
Length=458

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 133/209 (64%), Gaps = 16/209 (8%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            F   L +FA + P +  +IA +D+ W QR+ +A +  L +F+P P NV+   N  V   L
Sbjct  13   FVFLLSSFATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHVALAL  72

Query  430  LESKNEPDRKKFVNGSDDTRRQLAH----RKPYN-GPCNATNPIDRCWRCQPNWANNRRR  266
                   D  + +N    TRR+L+     RK  N G C A NPID+CWRC  +W  NR++
Sbjct  73   -------DTTESIN---STRRELSQARRGRKMQNRGKCVAHNPIDKCWRCDRDWEKNRKK  122

Query  265  LADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFSRDMNIR  89
            LA C +GFGR+  GGK G +YVV D SDD   +P+PGTLRHAV +  PLWIIF+R M I+
Sbjct  123  LAVCALGFGRRTTGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFARSMVIK  182

Query  88   LNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            L QEL+M SDKTIDGRG +V++ GG+G+T
Sbjct  183  LQQELMMTSDKTIDGRGARVYIMGGSGLT  211



>ref|XP_010485518.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 135/219 (62%), Gaps = 20/219 (9%)
 Frame = -3

Query  598  LVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHK------  437
            ++  A ++P+I  ++AE DE W  +  EA +H L  + PDP ++   F++  +       
Sbjct  12   VICIASLIPTIRANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVE  71

Query  436  -----TLLESKNEPDRKKFVNG-SDDTRRQLAHRK-------PYNGPCNATNPIDRCWRC  296
                 T ++S  + D  +  +  ++ TRR L+ ++          GPC A+NPID+CWRC
Sbjct  72   GTEEDTAVDSAEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCWRC  131

Query  295  QPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVND-HSDDPSNPKPGTLRHAVIQKKPLW  119
            QP+WA  R+RL  C  GFG +  GGK G +YVV     DD  NP+PGTLRHAVIQK+PLW
Sbjct  132  QPDWAKRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKEPLW  191

Query  118  IIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IIF  DM+IRL+QEL++ S KTID RG  VH++ GAGIT
Sbjct  192  IIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGIT  230



>emb|CDY45202.1| BnaA06g34060D [Brassica napus]
Length=459

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 132/219 (60%), Gaps = 15/219 (7%)
 Frame = -3

Query  634  MAGFNIN----CFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNV  467
            MA  ++N     F    ++ A++ PS+ GH+A +DE W QR+ +A    +K+++P+P NV
Sbjct  1    MASAHLNLGSYVFAFVSLSLAVVAPSVQGHVAVYDEYWTQRQTDALRETIKSYDPNPFNV  60

Query  466  SAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPC---NATNPIDRCWRC  296
            +  FN   H  L       D     NG+    RQ+   +         ++ N ID+CWR 
Sbjct  61   TDHFN--YHAALAMETTGAD-----NGTRRELRQVRRGRKTRRRGGRHHSLNAIDKCWRG  113

Query  295  QPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLW  119
              NW  NR++LADC +GFGRK  GGK G  YVV D SD D  NPKPGTLRHAV + +PLW
Sbjct  114  DKNWHKNRKKLADCVLGFGRKTTGGKKGQFYVVTDASDHDLINPKPGTLRHAVTRDRPLW  173

Query  118  IIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IIF R M I+L QELI+  DKTIDGRG  VH+ GGAG+T
Sbjct  174  IIFGRSMIIKLQQELIITHDKTIDGRGANVHIMGGAGLT  212



>ref|NP_001057945.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAD68734.1| putative pectate lyase [Oryza sativa Japonica Group]
 dbj|BAF19859.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAG93046.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80871.1| hypothetical protein OsI_23497 [Oryza sativa Indica Group]
Length=448

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/221 (45%), Positives = 137/221 (62%), Gaps = 20/221 (9%)
 Frame = -3

Query  655  IISVAKIMAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDP  476
            +I  +K+ A  ++  + +FL+  A    +   +I E+DE WQ+RK+ A   A  T++ DP
Sbjct  4    LIRWSKLPAAGSLVLYAVFLLLSAA--ATSEANIGEYDEYWQKRKLMADAAAEATYKRDP  61

Query  475  SNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLA--HRKPYNGPCNATNPIDRCW  302
              V+ +FN  VH++  ES                RR+LA   RK + GPC ATNPIDRCW
Sbjct  62   FEVTNSFNRAVHRSEEESG---------------RRELAMTKRKKFAGPCKATNPIDRCW  106

Query  301  RCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKP  125
            RC+ +W  +R+RLA C  GFGR   GG  G  Y+V D +DD   NP+PGTLR  VIQ +P
Sbjct  107  RCRADWVTDRKRLARCAQGFGRNTTGGLAGKFYLVTDGTDDDVENPRPGTLRWGVIQDEP  166

Query  124  LWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            LWIIF++DM I L +E+++ SDKTIDGRG QV ++ GA +T
Sbjct  167  LWIIFAKDMIINLKEEMMINSDKTIDGRGAQVRITNGAQVT  207



>ref|XP_006299938.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
 gb|EOA32836.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
Length=472

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 135/218 (62%), Gaps = 19/218 (9%)
 Frame = -3

Query  598  LVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFND-------EVH  440
            ++  A  +P+I  ++ E DE W  +  EA +H L  + PDP ++   F++       +V 
Sbjct  12   VICIASFIPTIRANVPETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVE  71

Query  439  KT----LLESKNEPDRKKFVNGSDDTRRQLAHRK-------PYNGPCNATNPIDRCWRCQ  293
            +T     ++S  E D +   + ++ TRR L+ ++          GPC A+NPID+CWRCQ
Sbjct  72   ETEEDKAVDSAEEEDIEMISSPTNSTRRSLSGKRRGRGKWSKLRGPCTASNPIDKCWRCQ  131

Query  292  PNWANNRRRLADCGMGFGRKAIGGKHGVLYVVND-HSDDPSNPKPGTLRHAVIQKKPLWI  116
            P+WA  R++L  C  GFG K  GGK G +YVV     DD  NP+PGTLRHAVIQK+PLWI
Sbjct  132  PDWAKRRKKLVHCVRGFGYKVTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKEPLWI  191

Query  115  IFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IF  DM+IRL+QEL++ S KTID RG  VH++ GAGIT
Sbjct  192  IFKHDMSIRLSQELMIASHKTIDARGSNVHIAYGAGIT  229



>ref|XP_010463548.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 132/219 (60%), Gaps = 20/219 (9%)
 Frame = -3

Query  598  LVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESK  419
            ++  A ++P+I  ++AE DE W  +  EA +H L  + PDP ++   F++  +    + +
Sbjct  12   VICIASLIPTIRANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVE  71

Query  418  NEPDRKKFVNGSDD------------TRRQLAHRK-------PYNGPCNATNPIDRCWRC  296
               + K   +  D+            TRR L+ ++          GPC A+NPID+CWRC
Sbjct  72   GTEEDKAVDSAEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCWRC  131

Query  295  QPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVND-HSDDPSNPKPGTLRHAVIQKKPLW  119
            QP+WA  R+RL  C  GFG +  GGK G +YVV     DD  NP+PGTLRHAVIQK+PLW
Sbjct  132  QPDWARRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKEPLW  191

Query  118  IIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IIF  DM+IRL+QEL++ S KTID RG  VH++ GAGIT
Sbjct  192  IIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGIT  230



>ref|NP_197015.4| putative pectate lyase 19 [Arabidopsis thaliana]
 gb|AED92118.1| putative pectate lyase 19 [Arabidopsis thaliana]
Length=472

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 132/220 (60%), Gaps = 19/220 (9%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVH--KTL  431
            MF    A+++P+I G+I+E DE W QR  EA E  L+ +  DP  +   F++  +   T 
Sbjct  10   MFTFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  430  LESKNEPDRKK-----------FVNGSDDTRRQLAHR-----KPYNGPCNATNPIDRCWR  299
            + +  E    K             + ++ TRR L  +         GPC A+NPID+CWR
Sbjct  70   VTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWR  129

Query  298  CQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPL  122
            C+ +WA  R++L  C  GFG +  GGK G +YVV  + D D  NPKPGTLRHAVIQK+PL
Sbjct  130  CRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPL  189

Query  121  WIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            WIIF  DM+IRLNQEL++ S KTID RG  VHV+ GAGIT
Sbjct  190  WIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGIT  229



>ref|XP_004490003.1| PREDICTED: probable pectate lyase 3-like isoform X1 [Cicer arietinum]
Length=450

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 115/182 (63%), Gaps = 15/182 (8%)
 Frame = -3

Query  544  DEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQ  365
            D  W+++   A +   + + PDP  VS      + + ++             G    RR 
Sbjct  41   DSYWKEKAEIAAKANEEAYTPDPYAVSGNLTSTISEMII-------------GGKKGRRN  87

Query  364  LAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHS  185
            L  RK   GPC ATNPIDRCWRC PNWANNR++LADC  GFGRK  GGK G  YVV D S
Sbjct  88   LRGRKT-AGPCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKAGPFYVVTDPS  146

Query  184  D-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAG  8
            D D  NP+PGTLRHAV +  PLWIIF+R MNIRLNQELIM SDKTIDGRG  + ++ GAG
Sbjct  147  DSDMVNPRPGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGRGADIVIANGAG  206

Query  7    IT  2
            IT
Sbjct  207  IT  208



>sp|Q9LFP5.1|PLY19_ARATH RecName: Full=Probable pectate lyase 19; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC01830.1| pectate lyase-like protein [Arabidopsis thaliana]
Length=472

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 132/220 (60%), Gaps = 19/220 (9%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVH--KTL  431
            MF    A+++P+I G+I+E DE W QR  EA E  L+ +  DP  +   F++  +   T 
Sbjct  10   MFTFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  430  LESKNEPDRKK-----------FVNGSDDTRRQLAHR-----KPYNGPCNATNPIDRCWR  299
            + +  E    K             + ++ TRR L  +         GPC A+NPID+CWR
Sbjct  70   VTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWR  129

Query  298  CQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPL  122
            C+ +WA  R++L  C  GFG +  GGK G +YVV  + D D  NPKPGTLRHAVIQK+PL
Sbjct  130  CRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPL  189

Query  121  WIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            WIIF  DM+IRLNQEL++ S KTID RG  VHV+ GAGIT
Sbjct  190  WIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGIT  229



>ref|XP_009101245.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 132/219 (60%), Gaps = 15/219 (7%)
 Frame = -3

Query  634  MAGFNIN----CFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNV  467
            MA  ++N     F    ++ A++ PS+ GH+A +DE W QR+ +A    +K+++P+P NV
Sbjct  1    MASAHLNLGSYVFAFVSLSLAVVAPSVQGHVAVYDEYWTQRQTDALRETIKSYDPNPFNV  60

Query  466  SAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPC---NATNPIDRCWRC  296
            +  FN   H  L       D     NG+    RQ+   +         ++ N ID+CWR 
Sbjct  61   TDHFNH--HAALAMETTGAD-----NGTRRELRQVRRGRKTRRRGGRHHSLNAIDKCWRG  113

Query  295  QPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLW  119
              NW  NR++LADC +GFGRK  GGK G  YVV D SD D  NPKPGTLRHAV + +PLW
Sbjct  114  DKNWHKNRKKLADCVLGFGRKTTGGKKGQFYVVTDASDHDLINPKPGTLRHAVTRDRPLW  173

Query  118  IIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IIF R M I+L QELI+  DKTIDGRG  VH+ GGAG+T
Sbjct  174  IIFGRSMIIKLQQELIITHDKTIDGRGANVHIMGGAGLT  212



>gb|ABK28696.1| unknown [Arabidopsis thaliana]
Length=473

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 132/220 (60%), Gaps = 19/220 (9%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVH--KTL  431
            MF    A+++P+I G+I+E DE W QR  EA E  L+ +  DP  +   F++  +   T 
Sbjct  10   MFTFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  430  LESKNEPDRKK-----------FVNGSDDTRRQLAHR-----KPYNGPCNATNPIDRCWR  299
            + +  E    K             + ++ TRR L  +         GPC A+NPID+CWR
Sbjct  70   VTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWR  129

Query  298  CQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPL  122
            C+ +WA  R++L  C  GFG +  GGK G +YVV  + D D  NPKPGTLRHAVIQK+PL
Sbjct  130  CRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPL  189

Query  121  WIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            WIIF  DM+IRLNQEL++ S KTID RG  VHV+ GAGIT
Sbjct  190  WIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGIT  229



>ref|XP_009389712.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=438

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 126/202 (62%), Gaps = 15/202 (7%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
             F + F       + HIA++DE WQ++   A   A  ++ PDP +V+  FN+ V++    
Sbjct  9    FFSLVFLASAAFANAHIADFDEYWQKKAEVAQSKARNSYNPDPESVTRHFNEAVYEDAQ-  67

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                         ++ TRR L  +K  +GPC ATNPIDRCWRC  NW ++R++LA C  G
Sbjct  68   -------------TNVTRRGLRGQKRSHGPCLATNPIDRCWRCNENWIHHRKQLATCAKG  114

Query  244  FGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FGR  IGGK+G  YVV D SDD   NPK GTLR+ VIQ +PLWI+F+ DM IRL +ELI+
Sbjct  115  FGRHTIGGKNGKFYVVTDASDDDLVNPKKGTLRYGVIQDRPLWIVFAHDMVIRLTEELIV  174

Query  67   QSDKTIDGRGFQVHVSGGAGIT  2
             S KTIDGRG  V + GGAG+T
Sbjct  175  NSYKTIDGRGANVQIMGGAGVT  196



>emb|CDY04133.1| BnaA09g19110D [Brassica napus]
 gb|AIS67292.1| pectate lyase-like protein 9 [Brassica rapa subsp. chinensis]
Length=459

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 135/224 (60%), Gaps = 19/224 (8%)
 Frame = -3

Query  652  ISVAKIMAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPS  473
            ++VA +  G ++  F    +  A++ PSI  H+A +DE W QR+  A    +++++P+P 
Sbjct  1    MAVAYLNLGSHV--FAFLSLCLAVVAPSIQAHVAVFDEYWTQRQAAALRQTIESYDPNPF  58

Query  472  NVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAH------RKPYNGPCNATNPID  311
            NV+   N   H  L       D        + TRR+L         K   G  ++ N ID
Sbjct  59   NVTDHLN--YHAALAMETTGAD--------NGTRRELGQVGGGRKTKRRGGRYHSLNAID  108

Query  310  RCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQ  134
            +CWR   NW  NR++LADC +GFGRK  GGK G +YVV D SDD   NPKPGTLR+AV +
Sbjct  109  KCWRGHRNWHKNRKKLADCVLGFGRKTTGGKKGPMYVVTDASDDDLMNPKPGTLRYAVTR  168

Query  133  KKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             +PLWIIF R M I+L QELI+ SDKTIDGRG  +H++GGAG+T
Sbjct  169  DRPLWIIFGRSMIIKLQQELIINSDKTIDGRGANIHITGGAGLT  212



>ref|XP_009114192.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 135/224 (60%), Gaps = 19/224 (8%)
 Frame = -3

Query  652  ISVAKIMAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPS  473
            ++VA +  G ++  F    +  A++ PSI  H+A +DE W QR+  A    +++++P+P 
Sbjct  1    MAVAYLNLGSHV--FAFLSLCLAVVAPSIQAHVAVFDEYWTQRQAAALRQTIESYDPNPF  58

Query  472  NVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAH------RKPYNGPCNATNPID  311
            NV+   N   H  L       D        + TRR+L         K   G  ++ N ID
Sbjct  59   NVTDHLN--YHAALAMETTGAD--------NGTRRELGQVGGGRKTKRRGGRYHSLNAID  108

Query  310  RCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQ  134
            +CWR   NW  NR++LADC +GFGRK  GGK G +YVV D SDD   NPKPGTLR+AV +
Sbjct  109  KCWRGHRNWHKNRKKLADCVLGFGRKTTGGKKGPMYVVTDASDDDLMNPKPGTLRYAVTR  168

Query  133  KKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             +PLWIIF R M I+L QELI+ SDKTIDGRG  +H++GGAG+T
Sbjct  169  DRPLWIIFGRSMIIKLQQELIINSDKTIDGRGANIHITGGAGLT  212



>ref|XP_010513594.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 135/219 (62%), Gaps = 20/219 (9%)
 Frame = -3

Query  598  LVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFND----------  449
            ++  A ++P+I  ++AE DE W  +  EA +H L  + PDP ++   F++          
Sbjct  12   VICIASLIPTILANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVE  71

Query  448  --EVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRK-------PYNGPCNATNPIDRCWRC  296
              E  K +  +++E   +   + ++ TRR L+ ++          GPC A+NPID+CWRC
Sbjct  72   GTEEDKAVDSTEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCWRC  131

Query  295  QPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVND-HSDDPSNPKPGTLRHAVIQKKPLW  119
            QP+WA  R+RL  C  GFG +  GGK G +YVV     DD  NP+PGTLRHAVIQK+PLW
Sbjct  132  QPDWARRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKEPLW  191

Query  118  IIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IIF  DM+IRL+QEL++ S KTID RG  VH++ GAGIT
Sbjct  192  IIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGIT  230



>ref|XP_009148818.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 133/209 (64%), Gaps = 16/209 (8%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            F   L + A + P +  +IA +D+ W QR+ +A +  L +F+P P NV+   N  V   L
Sbjct  13   FVFLLSSLATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHVALAL  72

Query  430  LESKNEPDRKKFVNGSDDTRRQLAH----RKPYN-GPCNATNPIDRCWRCQPNWANNRRR  266
              +++          ++ TRR+L+     RK  N G C A NPID+CWRC  +W  NR++
Sbjct  73   DTTES----------TNSTRRELSQARRGRKMQNRGKCVAHNPIDKCWRCDRDWEKNRKK  122

Query  265  LADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFSRDMNIR  89
            LA C +GFGR+  GGK G +YVV D SDD   +P+PGTLRHAV +  PLWIIF+R M I+
Sbjct  123  LAVCALGFGRRTTGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFARSMVIK  182

Query  88   LNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            L QEL+M SDKTIDGRG +V++ GG+G+T
Sbjct  183  LQQELMMTSDKTIDGRGARVYIMGGSGLT  211



>ref|XP_009360393.1| PREDICTED: probable pectate lyase 3 [Pyrus x bretschneideri]
Length=452

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 119/186 (64%), Gaps = 14/186 (8%)
 Frame = -3

Query  556  IAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDD  377
            + + D  W++R  EA + A++++  +P   +  F+  V + LL  +N             
Sbjct  39   VLDLDAYWKERAQEALKEAMESYHKNPEQAAEEFHTGVAE-LLSKENT------------  85

Query  376  TRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVV  197
            TRR L   K YNGPC ATNPID CWRC  NWANNR+++  C  GFG+KA GGK G +YVV
Sbjct  86   TRRNLRGNKGYNGPCMATNPIDACWRCDANWANNRKKIVGCAQGFGKKATGGKDGPIYVV  145

Query  196  NDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVS  20
               +D D  NPKPGTLRHAVIQK PLWIIF+R M IRL QEL++ SDKTIDGRG  V + 
Sbjct  146  TVGTDNDVQNPKPGTLRHAVIQKGPLWIIFARSMVIRLEQELMVTSDKTIDGRGANVVIE  205

Query  19   GGAGIT  2
             G GIT
Sbjct  206  EGGGIT  211



>emb|CDY39314.1| BnaC05g10650D [Brassica napus]
Length=459

 Score =   188 bits (477),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 132/211 (63%), Gaps = 17/211 (8%)
 Frame = -3

Query  613  CFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKT  434
             F  FL + A + P +  +IA +D+ W QR+ +A +  L +F+P P NV+   N  V   
Sbjct  12   VFVFFLSSLATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHVALA  71

Query  433  LLESKNEPDRKKFVNGSDDTRRQLAH----RKPYN--GPCNATNPIDRCWRCQPNWANNR  272
            L       D    +N    TRR+L+     RK  N  G C A NPID+CWRC  +W  NR
Sbjct  72   L-------DTTGSIN---STRRELSQARRGRKMQNRRGKCVAHNPIDKCWRCDRDWEKNR  121

Query  271  RRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFSRDMN  95
            ++LA C +GFGR+  GGK G +YVV D SDD   +P+PGTLRHAV +  PLWIIF+R M 
Sbjct  122  KKLAVCALGFGRRTSGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFARSMV  181

Query  94   IRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            I+L QEL+M SDKTIDGRG +V++ GG+G+T
Sbjct  182  IKLQQELMMTSDKTIDGRGARVYIMGGSGLT  212



>emb|CDY17432.1| BnaC09g21050D [Brassica napus]
Length=459

 Score =   188 bits (477),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 130/215 (60%), Gaps = 17/215 (8%)
 Frame = -3

Query  625  FNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDE  446
            F  + F    +  A++ PS+  H+A +DE W QR+ +A    +++++P+P NV+   N  
Sbjct  8    FGSHVFAFLSLCLAVVAPSVQAHVAVFDEYWTQRQSDALRQTIESYDPNPFNVTDHLN--  65

Query  445  VHKTLLESKNEPDRKKFVNGSDDTRRQLAH------RKPYNGPCNATNPIDRCWRCQPNW  284
             H  L       D        + TRR+L         K   G  ++ N ID+CWR   NW
Sbjct  66   YHAALAMETTGAD--------NGTRRKLGQVGDGRKTKRRGGRYHSLNAIDKCWRGHRNW  117

Query  283  ANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFS  107
              NR++LADC +GFGRK  GGK G +YVV D +DD   NPKPGTLR+AV + +PLWIIF 
Sbjct  118  HKNRKKLADCVLGFGRKTTGGKKGPIYVVTDAADDDLMNPKPGTLRYAVTRDRPLWIIFG  177

Query  106  RDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            R M I+L QELI+ SDKTIDGRG  VH++GGAG+T
Sbjct  178  RSMIIKLQQELIINSDKTIDGRGANVHITGGAGLT  212



>ref|XP_009761969.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=434

 Score =   187 bits (475),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 137/201 (68%), Gaps = 17/201 (8%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +FL    +++ SI  HI E+DEVW++R  +A + A   + P+P  V+   N++V K    
Sbjct  8    LFLFVMVVLVLSIEAHIGEFDEVWRKRAEKAKKAARHAYHPNPKIVADHLNNQVDKA---  64

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                      V GS+  RR L HR  YNG C ATNPID+CWRC PNWA NR +LADC +G
Sbjct  65   ----------VRGSNSRRRDL-HR--YNGQCKATNPIDQCWRCDPNWARNRMKLADCVLG  111

Query  244  FGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FGRK  GGK G +YVV D+SD D  NPKPGTLRHAVIQ +PLWIIF+++M IRLN+ELIM
Sbjct  112  FGRKTTGGKGGKIYVVTDNSDSDLVNPKPGTLRHAVIQPQPLWIIFAKNMVIRLNEELIM  171

Query  67   QSDKTIDGRGFQVHVSGGAGI  5
             S+KTID RG QVH++ G G+
Sbjct  172  TSNKTIDARGKQVHIAHGGGL  192



>ref|XP_010420164.1| PREDICTED: probable pectate lyase 19 isoform X2 [Camelina sativa]
Length=472

 Score =   188 bits (477),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 99/220 (45%), Positives = 132/220 (60%), Gaps = 19/220 (9%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            MF+   A ++P+I G+I+E DE W +R  EA E  L+ +  DP  +   F++  +    +
Sbjct  10   MFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  424  -SKNEPDR------------KKFVNGSDDTRRQLAHR-----KPYNGPCNATNPIDRCWR  299
             ++ E D             K   N +  TRR L  +         GPC A+NPID+CWR
Sbjct  70   ATETEEDGGAKPEEEEEEGIKMVGNSTKSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWR  129

Query  298  CQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPL  122
            C+ NWA  R++L  C  GFG +  GGK G +YVV  + D D  NPKPGTLRHAVIQK+PL
Sbjct  130  CRTNWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPL  189

Query  121  WIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            WIIF  DM+IRL+QEL++ S KTID RG  VH++ GAGIT
Sbjct  190  WIIFKNDMSIRLSQELLINSHKTIDARGANVHIAHGAGIT  229



>ref|XP_009598230.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=434

 Score =   187 bits (475),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 128/201 (64%), Gaps = 18/201 (9%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            +F V   ++L SI  +I+E+DEVWQ R  +A + A  ++ P P  V+   N  VHK    
Sbjct  9    IFFVLVTLVL-SIEANISEFDEVWQTRATQAKKTAQDSYNPHPETVADNLNKHVHK----  63

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                     +  GS+ TRR L     Y+GPC +TNPIDRCWRC PNW  NR +LADC +G
Sbjct  64   ---------WEEGSNSTRRDL---HKYDGPCMSTNPIDRCWRCDPNWVKNRMKLADCVLG  111

Query  244  FGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FG    GGK G +YVV D SDD   NPKPGTLRHAVIQ +PLWIIF   M IRLNQELIM
Sbjct  112  FGHHTTGGKGGKIYVVTDPSDDDMVNPKPGTLRHAVIQPEPLWIIFKHHMVIRLNQELIM  171

Query  67   QSDKTIDGRGFQVHVSGGAGI  5
             S+KTID RG +VH++ GA  
Sbjct  172  TSNKTIDARGQKVHIAFGASF  192



>ref|XP_008339934.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   187 bits (476),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 123/193 (64%), Gaps = 14/193 (7%)
 Frame = -3

Query  577  LPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKK  398
            +P+    + + D  W+QR  EA + AL+++  +P  V+  FN+EV K +L+         
Sbjct  32   VPNEDTQVLDLDAYWKQRAEEAEKEALESYNKNPEQVTEEFNNEVGKLMLKE--------  83

Query  397  FVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGK  218
                 + TRR L   K Y GPC ATNPID CWRC P WANNR+++  C  GFG+KA GGK
Sbjct  84   -----NTTRRNLRGNKAYKGPCMATNPIDACWRCDPYWANNRKKIVGCAQGFGKKATGGK  138

Query  217  HGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGR  41
             G  YVV   +DD   NPKPGTLRHAVIQK PLWIIF++ M IRL QEL++ SDKTID R
Sbjct  139  DGPFYVVTMGTDDDVQNPKPGTLRHAVIQKGPLWIIFAKSMVIRLQQELMVTSDKTIDAR  198

Query  40   GFQVHVSGGAGIT  2
            G  V +  GAGIT
Sbjct  199  GANVVIEEGAGIT  211



>emb|CDY53552.1| BnaA09g57110D [Brassica napus]
Length=495

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 131/203 (65%), Gaps = 13/203 (6%)
 Frame = -3

Query  601  FLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLES  422
             +   AI++P +  ++A +D  W QR+ +A +  + +++P+P NV+   N   H  L   
Sbjct  13   LVFLLAILVPHVQANVAVFDNYWTQRQGDALKQTIASYDPNPLNVTDHLN--YHVALAVD  70

Query  421  KNEPDRKKFVNGSDDTRRQLAHRKPY--NGPCNATNPIDRCWRCQPNWANNRRRLADCGM  248
              E         +++TRR+L  RK    +G C A NPID+CWRC PNW  NR++LA+C +
Sbjct  71   ATE--------STNNTRRELIGRKTQEGSGKCIAHNPIDKCWRCDPNWEKNRKKLAECVL  122

Query  247  GFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELI  71
            GFGRK  GGK G +YVVND SDD   NPKPGTLRHAV +  PLWIIF+  M I+L QEL+
Sbjct  123  GFGRKTTGGKDGPIYVVNDSSDDDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKLQQELM  182

Query  70   MQSDKTIDGRGFQVHVSGGAGIT  2
            + S+KTIDGRG +V++  G G+T
Sbjct  183  ITSNKTIDGRGAKVYIMEGVGLT  205



>emb|CDY03043.1| BnaC07g21840D [Brassica napus]
Length=459

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 129/216 (60%), Gaps = 13/216 (6%)
 Frame = -3

Query  631  AGFNINCFCMFLVTF--AIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAA  458
            A  NI  +     +   AI+ PS+ GH+A +DE W QR+ +A    +K+++P+P NV+  
Sbjct  4    AHLNIGSYVFAFASLFVAIVAPSVQGHVAVYDEYWTQRQTDALRQTIKSYDPNPFNVTDH  63

Query  457  FNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPC---NATNPIDRCWRCQPN  287
            FN   H  L       D     NG+    RQ+   +         ++ N ID+CWR   N
Sbjct  64   FN--YHAALAMETTGAD-----NGTRRELRQVRRGRRTKRRGGRHHSLNAIDKCWRGDKN  116

Query  286  WANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIF  110
            W  NR++LADC +GFGR+  GGK G  YVV D SD D  NPKPGTLRHAV + +PLWIIF
Sbjct  117  WHKNRKKLADCVLGFGRRTTGGKKGQFYVVTDASDHDLVNPKPGTLRHAVTRDRPLWIIF  176

Query  109  SRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             R M I+L QELI+  DKTIDGRG  VH+ GGAG+T
Sbjct  177  GRSMIIKLQQELIITHDKTIDGRGENVHIMGGAGLT  212



>gb|KFK43687.1| hypothetical protein AALP_AA1G160000 [Arabis alpina]
Length=460

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 130/205 (63%), Gaps = 4/205 (2%)
 Frame = -3

Query  613  CFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKT  434
             F  FL   A   P    H+A +D  W QR+ +A    + +++P+P NV+  FN  V   
Sbjct  12   VFVFFLSFIATFPPESRAHVAVFDNYWTQRQTDALRQTMNSYDPNPLNVTDHFNHHVSLA  71

Query  433  LLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADC  254
            +  +++    ++ +     + R++ H+   +G C A N ID+CWRC  NWA NR++L DC
Sbjct  72   MDATESNNGTRRELTQVRKSGRKI-HKS--SGKCLAYNAIDKCWRCDRNWAKNRKKLTDC  128

Query  253  GMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQE  77
             +GFGRK  GGK G +YVVND SD D  NPKPGTLR+AV +  PLWIIF+R M I+L QE
Sbjct  129  VLGFGRKTTGGKDGPIYVVNDASDNDLVNPKPGTLRYAVTRDGPLWIIFARSMIIKLQQE  188

Query  76   LIMQSDKTIDGRGFQVHVSGGAGIT  2
            L++ SDKTIDGRG ++++  GAG+T
Sbjct  189  LMITSDKTIDGRGARIYIMEGAGLT  213



>ref|XP_007137422.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
 gb|ESW09416.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
Length=439

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 130/212 (61%), Gaps = 15/212 (7%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            MAG         LVT AI +P +   IAE+D+  + +  +A + AL+++ P P  V++  
Sbjct  1    MAGSASKVVFSLLVTLAITIPCLEAGIAEFDDFLKAQSEKAHKIALESYVPTPEFVASEL  60

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANN  275
            N  VH ++L S     R+    G++D             PC+++NPID CWRC  +WAN+
Sbjct  61   NYHVHLSMLNST----RRGLKAGNNDA----------GAPCDSSNPIDNCWRCNKDWAND  106

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDM  98
            R RLA CG GFGR+A+GG  G +YVV D+SD D  NPK GTLR+ V QK PLWI F+R M
Sbjct  107  RYRLAKCGKGFGRRAVGGLGGPIYVVTDNSDEDMVNPKEGTLRYGVTQKGPLWITFARSM  166

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             I L QEL++ SDKTIDGRG  V +  GAG+T
Sbjct  167  IITLQQELLISSDKTIDGRGANVQIRDGAGLT  198



>ref|XP_002875142.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51401.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 134/216 (62%), Gaps = 13/216 (6%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            M       F    ++  +++PS+  HIA +D+ W QR+  A    L++++P+P NV+  F
Sbjct  1    MLNLGSYVFVFVSLSLTVVVPSVQAHIAVYDDYWTQRQTIALRQTLESYDPNPDNVTDHF  60

Query  454  NDE----VHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPN  287
            N      +  T + ++   D ++  +G    RR         G   + N ID+CWR   N
Sbjct  61   NYHAALAMETTGIVNETRRDLRQVRSGKKKPRR--------GGRFESLNAIDKCWRGDKN  112

Query  286  WANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIF  110
            W  NR++LADC +GFGRK  GGK+G +YVV D SD D  NPKPGT+RHAV + +PLWI+F
Sbjct  113  WDKNRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTIRHAVTRDRPLWIVF  172

Query  109  SRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            +R M I+L QELI+ +DKTIDGRG +++++GGAG+T
Sbjct  173  ARSMIIKLQQELIITNDKTIDGRGARIYITGGAGLT  208



>ref|XP_009408830.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 125/190 (66%), Gaps = 16/190 (8%)
 Frame = -3

Query  565  SGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNG  386
            S HIA++DE WQ++   A  HA   + P+P +V+  FN+ V + L               
Sbjct  22   SAHIADYDEYWQKKAALARSHANNAYNPNPESVTHHFNEAVMRDL--------------A  67

Query  385  SDDTRRQLAHR-KPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGV  209
            S+ TRR L  + +  +G C ATNPIDRC+RCQ NW ++R++LA C  GFGR A GGK+G 
Sbjct  68   SNSTRRGLRGKMRNEDGACQATNPIDRCFRCQSNWVHHRKKLATCAKGFGRHATGGKNGD  127

Query  208  LYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQ  32
             YVV D SD D  NP+ GTLRHAVIQ +PLWI+F+ DM IRL +ELI+ S+KTIDGRG  
Sbjct  128  FYVVTDSSDADLVNPRNGTLRHAVIQDRPLWIVFAHDMLIRLTEELIINSNKTIDGRGAN  187

Query  31   VHVSGGAGIT  2
            V ++ GAG+T
Sbjct  188  VQIAYGAGLT  197



>emb|CDX81636.1| BnaC08g39650D [Brassica napus]
Length=484

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 137/215 (64%), Gaps = 14/215 (7%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIIL-PSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAA  458
            MA   +N     LV  ++IL P +  ++A +D  W+QR+ +A +  + +++P+P NV+  
Sbjct  1    MAATFLNIGGYTLVFLSVILVPHVQANVAIFDNYWKQRQGDALKQTIASYDPNPLNVTDH  60

Query  457  FNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPY--NGPCNATNPIDRCWRCQPNW  284
             N   H  L     E         +++TRR+L  R+    +G C A NPID+CWRC PNW
Sbjct  61   LN--YHVALAVDATE--------STNNTRRELIGRETQEGSGKCIAYNPIDKCWRCDPNW  110

Query  283  ANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFS  107
              NR++L +C +GFGRK  GGK G +YVVND SD D  NPKPGTLRHAV +  PLWIIF+
Sbjct  111  EKNRKKLVECVLGFGRKTTGGKDGPIYVVNDSSDEDLVNPKPGTLRHAVTRDGPLWIIFA  170

Query  106  RDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
              M I+L QEL++ S+KTIDGRG +V++  GAG+T
Sbjct  171  NSMVIKLQQELMITSNKTIDGRGARVYIMEGAGLT  205



>dbj|BAK06965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 129/215 (60%), Gaps = 16/215 (7%)
 Frame = -3

Query  634  MAGFNIN---CFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVS  464
            M GF  +      ++ V F         +I E+DE WQ+RK+EA   A  T+ P+P  V+
Sbjct  1    MEGFQWSRPVSLLLYAVLFLSAAAVSEANIGEFDEHWQRRKLEARARAEATYHPNPIEVA  60

Query  463  AAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNW  284
             + N  VH++L +             S   R+ L   K + GPC ATNPIDRCWRC+ +W
Sbjct  61   NSLNRAVHRSLRDE------------SGSRRKLLGLHKKFAGPCTATNPIDRCWRCRKDW  108

Query  283  ANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFS  107
            A +R RLA C  GFGR A GG  G +Y+V D +DD    P+PGTLR  VIQ +PLWIIF+
Sbjct  109  ATDRMRLARCAQGFGRNATGGLGGKIYIVTDGTDDDVLEPRPGTLRWGVIQNEPLWIIFA  168

Query  106  RDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            R M I+L +EL++ SDKTIDGRG QV ++ GA +T
Sbjct  169  RPMLIKLKEELLVGSDKTIDGRGAQVRIADGAQVT  203



>ref|XP_010317101.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=389

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = -3

Query  394  VNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKH  215
            V+ ++  RR L  +K Y+GPC  TNPID+CWRC PNWA+NR++L +C MGFG K  GG+ 
Sbjct  17   VSKNETIRRALGTKK-YDGPCTVTNPIDKCWRCDPNWADNRKKLVECSMGFGYKTTGGRD  75

Query  214  GVLYVVNDHSDDPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGF  35
            G  YVV D SDD + PKPGTLRHAVIQK+PLWIIF ++M I+L+QELIMQ DKTIDGRG 
Sbjct  76   GEFYVVTDPSDDYTTPKPGTLRHAVIQKEPLWIIFEKNMKIKLHQELIMQGDKTIDGRGA  135

Query  34   QVHVSGGAGI  5
             VH++GGA I
Sbjct  136  TVHITGGASI  145



>ref|XP_007224275.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
 gb|EMJ25474.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
Length=443

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 130/196 (66%), Gaps = 14/196 (7%)
 Frame = -3

Query  586  AIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPD  407
            AII  + S    + DE W++R  +A  + ++++EP+P  V+  FN EV + ++       
Sbjct  20   AIIANAESDQPQQLDEYWKKRAEQAENYTMESYEPNPQRVTDEFNAEVGELIM-------  72

Query  406  RKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAI  227
                  G ++TRR L  +K Y GPC  TNPID CWRC PNWANNR ++ DC  GFGRK  
Sbjct  73   ------GKNETRRNLKGQKKYVGPCKVTNPIDSCWRCDPNWANNRMKIVDCIQGFGRKTT  126

Query  226  GGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTI  50
            GGK G +YVV D SD D  NP+PGTLRHAVIQK PLWI F+R+M I+L QEL++ SDKTI
Sbjct  127  GGKGGPIYVVTDPSDGDLVNPRPGTLRHAVIQKGPLWITFARNMVIKLQQELMVASDKTI  186

Query  49   DGRGFQVHVSGGAGIT  2
            DGRG  V++  GAGIT
Sbjct  187  DGRGANVNIFDGAGIT  202



>ref|XP_010320663.1| PREDICTED: probable pectate lyase 3 [Solanum lycopersicum]
Length=386

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 132/215 (61%), Gaps = 5/215 (2%)
 Frame = -3

Query  634  MAGFNINCFCMFLVT---FAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVS  464
            MA  + N   +FL +   F+ I+P +  +IA++D   ++R  EA + +L  +  +P  V+
Sbjct  1    MASISFNNSVIFLFSLFCFSSIIPKLYANIADFDPYLEKRAEEALQSSLAAYNENPEGVT  60

Query  463  AAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNW  284
              FN EV +TLL       ++K     +D   +    K  +G C A NPID+CWRC  NW
Sbjct  61   QIFNKEVGETLLNGTRRHLKEKDKEDKNDKDDKEGDEKSVDG-CKAYNPIDKCWRCDKNW  119

Query  283  ANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDD-PSNPKPGTLRHAVIQKKPLWIIFS  107
            ANNR+ LADC  GFG    GGK G  YVV D SD+    P PGTLRHAVIQ++PLWIIF 
Sbjct  120  ANNRKALADCARGFGHGTTGGKDGRFYVVTDPSDNNVEEPVPGTLRHAVIQEEPLWIIFE  179

Query  106  RDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            + M IRL QEL++ S+KTIDGRG  VHV+ G G+T
Sbjct  180  KSMIIRLKQELMINSNKTIDGRGVSVHVAYGGGLT  214



>gb|AAM60924.1| putative pectate lyase [Arabidopsis thaliana]
Length=475

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 130/221 (59%), Gaps = 22/221 (10%)
 Frame = -3

Query  598  LVTFAIILPSISGHIAE-WDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLES  422
            ++  A ++P+I  ++AE  DE W  +  EA +H L  + PDP  +   F++  +    + 
Sbjct  12   VICIASLIPTIRANVAEETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYDNSTDV  71

Query  421  KNEPDRKKFVNGSDD-----------TRRQLAHR---------KPYNGPCNATNPIDRCW  302
            +   + K   +  +D           TRR L  R             GPC A+NPID+CW
Sbjct  72   EGTEEEKAIASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNPIDKCW  131

Query  301  RCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVND-HSDDPSNPKPGTLRHAVIQKKP  125
            RCQP+WA  R++L  C  GFG +  GGK G +YVV     DD  NP+PGTLRHAVIQK+P
Sbjct  132  RCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAVIQKEP  191

Query  124  LWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            LWI+F  DM+IRL+QEL++ SDKTID RG  VH++ GAGIT
Sbjct  192  LWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGIT  232



>ref|XP_006363934.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=439

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 123/204 (60%), Gaps = 18/204 (9%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
              +  +  A ++P I   IAE+D   +++ +E    +L+ +  +P  V+ AFN EV   L
Sbjct  10   LLILFIWLASLVPHIHARIAEFDAYLEKQALEDLNSSLEAYTHNPEEVTNAFNKEVGNAL  69

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
            L+ K+              RR L  +      C ATNPIDRCWRC  NWA NR  L +C 
Sbjct  70   LKYKS-------------LRRNLKEKNK----CMATNPIDRCWRCDKNWAENRMDLEECA  112

Query  250  MGFGRKAIGGKHGVLYVVNDHSDD-PSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
             GFG K  GGK+G  YVV D SDD    PKPGTLRHAVIQ++PLWIIF + M I+L QEL
Sbjct  113  RGFGHKTTGGKNGKYYVVTDESDDNVQEPKPGTLRHAVIQEEPLWIIFEKSMVIKLQQEL  172

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            ++ SDKTIDGRG  VH++ GAG+T
Sbjct  173  MITSDKTIDGRGVAVHIANGAGLT  196



>ref|NP_186776.1| putative pectate lyase 7 [Arabidopsis thaliana]
 sp|Q9SRH4.1|PLY7_ARATH RecName: Full=Probable pectate lyase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF03499.1|AC010676_9 putative pectate lyase [Arabidopsis thaliana]
 gb|AAF26147.1|AC008261_4 putative pectate lyase [Arabidopsis thaliana]
 gb|ABI93918.1| At3g01270 [Arabidopsis thaliana]
 gb|AEE73631.1| putative pectate lyase 7 [Arabidopsis thaliana]
Length=475

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 130/221 (59%), Gaps = 22/221 (10%)
 Frame = -3

Query  598  LVTFAIILPSISGHIA-EWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLES  422
            ++  A ++P+I  ++A E DE W  +  EA +H L  + PDP  +   F++  +    + 
Sbjct  12   VICIASLIPTIRANVADETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYDNSTDV  71

Query  421  KNEPDRKKFVNGSDD-----------TRRQLAHR---------KPYNGPCNATNPIDRCW  302
            +   + K   +  +D           TRR L  R             GPC A+NPID+CW
Sbjct  72   EGTEEEKAVASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNPIDKCW  131

Query  301  RCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVND-HSDDPSNPKPGTLRHAVIQKKP  125
            RCQP+WA  R++L  C  GFG +  GGK G +YVV     DD  NP+PGTLRHAVIQK+P
Sbjct  132  RCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAVIQKEP  191

Query  124  LWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            LWI+F  DM+IRL+QEL++ SDKTID RG  VH++ GAGIT
Sbjct  192  LWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGIT  232



>ref|XP_009110541.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 136/223 (61%), Gaps = 18/223 (8%)
 Frame = -3

Query  652  ISVAKIMAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPS  473
            ++ A +  G  +  FC+ L+  A + P +  ++A +D  W QR+ +A +  + +F+P+P 
Sbjct  1    MTAAVLNIGGYLFVFCLSLL--ATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPL  58

Query  472  NVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAH-----RKPYNGPCNATNPIDR  308
            NV+   N   H  L     E         ++ TRR+L+      +   +G C A NPIDR
Sbjct  59   NVTDHLN--YHVALAVDATE--------STNSTRRELSQVRNGRKLKRSGKCVAYNPIDR  108

Query  307  CWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQK  131
            CWRC  +W  NR++LADC +GFGR+  GGK G +YVVND SDD   NPKPGTLRHAV + 
Sbjct  109  CWRCNGDWEKNRKKLADCVLGFGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRD  168

Query  130  KPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             PLWIIF   M I L QELI+ SDKTIDGRG +V++  GAG+T
Sbjct  169  GPLWIIFGSSMIINLQQELIITSDKTIDGRGARVYIMEGAGLT  211



>ref|XP_004951474.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=440

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 121/185 (65%), Gaps = 19/185 (10%)
 Frame = -3

Query  550  EWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTR  371
            +WDE WQ+R+  A   A + ++PDP NV+ +FN  VH+                 S   R
Sbjct  33   DWDEHWQKRRELAEASAREAYKPDPFNVTNSFNAAVHR-----------------STSPR  75

Query  370  RQLAHRKP-YNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVN  194
            R++  +K   NGPC ATNPID+CWRC+ NWA +R+RLA C  GFGR A GG  G +YVV 
Sbjct  76   REMREKKKKSNGPCRATNPIDKCWRCRKNWATDRQRLARCARGFGRAATGGLGGKIYVVT  135

Query  193  DHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSG  17
            D +D D  NP+PGTLR   IQ  PLWIIF+R M I+L+QEL++ SDKTIDGRG QVH++ 
Sbjct  136  DPTDADVVNPRPGTLRWGAIQPGPLWIIFARSMIIQLSQELLVSSDKTIDGRGAQVHIAN  195

Query  16   GAGIT  2
            G GIT
Sbjct  196  GGGIT  200



>ref|XP_004514773.1| PREDICTED: probable pectate lyase 3-like [Cicer arietinum]
Length=454

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 124/213 (58%), Gaps = 28/213 (13%)
 Frame = -3

Query  604  MFLVTFAIILPSISG-----------HIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAA  458
            +FL+  A++ P+++            H+ E+D  WQ+R   A E     +  DP  VS  
Sbjct  9    LFLLCLAVLTPTLNANPLEKNEYWEEHVPEFDSYWQERAKVAKEANQAAYFVDPYAVSGN  68

Query  457  FNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWAN  278
            F   V + +               +   RR L  R   NG C ATNPIDRCWRC PNWAN
Sbjct  69   FTATVSEII--------------AAKSARRSL--RGNNNGTCMATNPIDRCWRCDPNWAN  112

Query  277  NRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRD  101
            NR++LADC  GFGR   GGK G  YVV D SD+   +PKPGTLRHAV +  PLWI F+R 
Sbjct  113  NRQKLADCVQGFGRNTRGGKGGPFYVVTDPSDNELLDPKPGTLRHAVTRNGPLWITFARS  172

Query  100  MNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            M I L QELIM SDKTIDGRG +V+++ GAGIT
Sbjct  173  MVITLQQELIMSSDKTIDGRGVEVYIANGAGIT  205



>ref|XP_008221660.1| PREDICTED: probable pectate lyase 3 [Prunus mume]
Length=443

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 125/185 (68%), Gaps = 14/185 (8%)
 Frame = -3

Query  553  AEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDT  374
             + D  W+QR  EA + A+++F+ DP  V+  FN  V + L++          +NG   T
Sbjct  31   VQLDAYWKQRAEEAEKVAMQSFQTDPELVTEEFNSNVGELLMK----------LNG---T  77

Query  373  RRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVN  194
            RR L   K YNGPC ATNPID CWRC  NWA NR+RLA+C  GFGRK  GGK G +YVV 
Sbjct  78   RRNLRGVKKYNGPCMATNPIDACWRCDKNWAKNRKRLANCVQGFGRKTTGGKGGPIYVVT  137

Query  193  DHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSG  17
            D SD D  NPKPGTLRHAVIQK PLWIIF+R M IRL QELI+ SDKTIDGRG  V++  
Sbjct  138  DPSDLDLVNPKPGTLRHAVIQKGPLWIIFARSMVIRLQQELIVTSDKTIDGRGANVNIHD  197

Query  16   GAGIT  2
            GAGIT
Sbjct  198  GAGIT  202



>emb|CDX96854.1| BnaA08g23970D [Brassica napus]
Length=458

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 137/223 (61%), Gaps = 18/223 (8%)
 Frame = -3

Query  652  ISVAKIMAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPS  473
            ++ A +  G  +  FC+ L+  A + P +  ++A +D  W QR+ +A +  + +F+P+P 
Sbjct  1    MTAAFLNIGGYLFVFCLSLL--ATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPL  58

Query  472  NVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAH-----RKPYNGPCNATNPIDR  308
            NV+   N  V   +       D  + +N    TRR+L+      +   +G C A NPIDR
Sbjct  59   NVTDHLNYHVALAV-------DATESIN---STRRELSQVRNGRKLKRSGKCVAYNPIDR  108

Query  307  CWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQK  131
            CWRC  +W  NR++LADC +GFGR+  GGK G +YVVND SDD   NPKPGTLRHAV + 
Sbjct  109  CWRCNGDWEKNRKKLADCVLGFGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRD  168

Query  130  KPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             PLWIIF   M I L QELI+ SDKTIDGRG +V++  GAG+T
Sbjct  169  GPLWIIFGSSMIINLQQELIITSDKTIDGRGARVYIMEGAGLT  211



>ref|XP_007153840.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
 gb|ESW25834.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
Length=447

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 126/204 (62%), Gaps = 27/204 (13%)
 Frame = -3

Query  577  LPSISGHIAEWDEVWQQRKIE---AWEHALKT--------FEPDPSNVSAAFNDEVHKTL  431
            +P+++ +  E +E WQ+ + E    W+   +T        + PDP +VS   +  V + +
Sbjct  17   IPTLNANTLESEEYWQKHENEFDPYWKGRAETAAVDNNAAYFPDPYSVSGNLSSSVSELI  76

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
            +                D RR L  ++ Y GPC ATNPIDRCWRC PNWANNR++LADC 
Sbjct  77   V--------------GKDKRRNLKGQR-YTGPCMATNPIDRCWRCDPNWANNRQKLADCV  121

Query  250  MGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
             GFGR  +GGK G  YVV D SDD   + KPGTLRHAV +  PLWIIF R M I+L QEL
Sbjct  122  QGFGRNTVGGKGGPFYVVTDPSDDNMVDLKPGTLRHAVTRTGPLWIIFERSMMIKLKQEL  181

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            IM SDKTIDGRG +V+++ GAGIT
Sbjct  182  IMTSDKTIDGRGVEVYIASGAGIT  205



>ref|XP_004228388.1| PREDICTED: pectate lyase [Solanum lycopersicum]
Length=439

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 123/203 (61%), Gaps = 18/203 (9%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
              +  +  A ++P +   IAE+D   +++ +EA   +L+ +  +P  ++ AFN EV   L
Sbjct  10   LLVLFIWLASLVPHLHARIAEFDPYLEKQALEALNSSLEAYTNNPEEITNAFNKEVGNAL  69

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
            L+ K+              RR L  +      C ATNPIDRCWRC  NWA NR  L +C 
Sbjct  70   LKYKS-------------LRRHLKEKDK----CMATNPIDRCWRCDKNWAENRMDLEECA  112

Query  250  MGFGRKAIGGKHGVLYVVNDHSDD-PSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
             GFG K  GGK+G  YVV D SDD    PKPGTLRHAVIQ++PLWIIF + M I+L QEL
Sbjct  113  RGFGHKTTGGKNGKYYVVTDESDDNVQEPKPGTLRHAVIQEEPLWIIFEKSMVIKLRQEL  172

Query  73   IMQSDKTIDGRGFQVHVSGGAGI  5
            ++ SDKTIDGRG  VH++ GAG+
Sbjct  173  MITSDKTIDGRGVAVHIAYGAGL  195



>emb|CDY68729.1| BnaCnng60280D [Brassica napus]
Length=458

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 127/209 (61%), Gaps = 16/209 (8%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            F   L+  A + P +  ++A +D  W QR+ +A +  + +F+P+P NV+   N   H  L
Sbjct  13   FVFSLLLLATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLN--YHVAL  70

Query  430  LESKNEPDRKKFVNGSDDTRRQLAH-----RKPYNGPCNATNPIDRCWRCQPNWANNRRR  266
                 E          + TRR+L+      +   +G C A NPIDRCWRC  +W  NR++
Sbjct  71   AVGATE--------SINSTRRELSQVRNGRKLKRSGKCVAYNPIDRCWRCHGDWEKNRKK  122

Query  265  LADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFSRDMNIR  89
            LADC +GFGR+  GGK G +YVVND SDD   NPKPGTLRHAV +  PLWIIF   M I 
Sbjct  123  LADCVLGFGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLWIIFGSSMIIN  182

Query  88   LNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            L QELI+ SDKTIDGRG +V++  GAG+T
Sbjct  183  LQQELIITSDKTIDGRGARVYIMEGAGLT  211



>ref|XP_006826355.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
 gb|ERM93592.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
Length=479

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 116/182 (64%), Gaps = 16/182 (9%)
 Frame = -3

Query  544  DEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQ  365
            D V + R  ++W  A   +EPDP  VS      VH  L    +              RRQ
Sbjct  75   DSVLEARAHQSWLEAQAAYEPDPEAVSRNLTHLVHMELPSGNH-------------MRRQ  121

Query  364  LAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHS  185
            L  R  ++GPC ATNPIDRCWRC   W  NR++LADC MGFG++A+GGK+G  YVV D S
Sbjct  122  LGRR--WHGPCVATNPIDRCWRCDQKWHTNRKKLADCAMGFGQQALGGKYGRYYVVTDPS  179

Query  184  D-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAG  8
            D D  NPKPGTLRHAVIQ +PLWIIF RDM I+L +EL++ S KT+DGRG  VH++ GA 
Sbjct  180  DNDLLNPKPGTLRHAVIQNEPLWIIFQRDMVIKLTEELMVNSFKTVDGRGANVHIAYGAC  239

Query  7    IT  2
            IT
Sbjct  240  IT  241



>ref|XP_009758350.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=445

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/218 (45%), Positives = 130/218 (60%), Gaps = 22/218 (10%)
 Frame = -3

Query  634  MAGFNINC--FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSA  461
            MA F+ N   F   L+  A ++P++  +IAE+D   +++  EA + +L  +  +P  ++ 
Sbjct  1    MASFSCNSVIFLYSLLCIASLIPNLHANIAEFDPYLEKKAEEALKSSLAAYNENPEELTD  60

Query  460  AFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGP----CNATNPIDRCWRCQ  293
             FN EV +T+                + TRR L      +      C A NPID+CWRC 
Sbjct  61   TFNKEVGETIF---------------NGTRRHLKEEDKDDKDDNDGCKAYNPIDKCWRCD  105

Query  292  PNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDD-PSNPKPGTLRHAVIQKKPLWI  116
             NWANNR+ LADC  GFG    GGK G  YVV D SDD    PKPGTLRHAVIQ++PLWI
Sbjct  106  KNWANNRKALADCARGFGHGTTGGKDGKFYVVTDPSDDNVEEPKPGTLRHAVIQEEPLWI  165

Query  115  IFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IF + M I+L QEL++ +DKTIDGRG  VHV+ GAG+T
Sbjct  166  IFEKSMIIKLQQELMINNDKTIDGRGVSVHVAYGAGLT  203



>ref|XP_008793504.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=446

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 127/194 (65%), Gaps = 16/194 (8%)
 Frame = -3

Query  571  SISG-HIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKF  395
            ++SG ++AE+D+ WQ++  EA+  +   + PDP  V+  FN  VH  + +++N       
Sbjct  24   TLSGANMAEFDDHWQKKAEEAFARSRAAYHPDPEAVTNKFNKAVHLAVSQARNS------  77

Query  394  VNGSDDTRRQL--AHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGG  221
                  TRR L  A    + GPC ATNPIDRCWRC+ NW  NR++LA C  GFGR A+GG
Sbjct  78   ------TRRALRSAGVNKFKGPCVATNPIDRCWRCRENWMENRKKLAGCAKGFGRNAVGG  131

Query  220  KHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDG  44
            K G  YVV D SD D  NPK GTLR  VIQ +PLWIIF+RDM IRL++EL++ S+KTIDG
Sbjct  132  KDGDFYVVTDPSDNDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDG  191

Query  43   RGFQVHVSGGAGIT  2
            RG  V ++ GA IT
Sbjct  192  RGANVRIAYGAQIT  205



>gb|AAQ62997.1| oil palm polygalacturonase allergen PEST411 [Elaeis guineensis]
Length=447

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 125/207 (60%), Gaps = 19/207 (9%)
 Frame = -3

Query  613  CFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKT  434
            C  +FL + A+        I E D+ WQ++  EA   +   + PDP  V+  FN  VH  
Sbjct  13   CSLIFLASAALS----GADIPELDDHWQKKAEEALARSRAAYHPDPEAVTNHFNKAVHLA  68

Query  433  LLESKNEPDRKKFVNGSDDTRRQL--AHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLA  260
            L E++N             TRR L     K + G C ATNPIDRCWRCQ NW  +R++LA
Sbjct  69   LAEARNS------------TRRSLRAVGVKKFKGKCVATNPIDRCWRCQKNWIKHRKKLA  116

Query  259  DCGMGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLN  83
             CG GFGR A GGK G  YVV D SDD   NPK GTLR  VIQ +PLWI+F+RDM IRL+
Sbjct  117  TCGKGFGRHATGGKAGDFYVVTDPSDDDLVNPKFGTLRWGVIQDRPLWIVFARDMIIRLS  176

Query  82   QELIMQSDKTIDGRGFQVHVSGGAGIT  2
            +EL++ S+KTID RG  VH++ GA IT
Sbjct  177  EELMINSNKTIDARGANVHIAYGAQIT  203



>emb|CDX70590.1| BnaC03g06740D [Brassica napus]
Length=475

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 130/228 (57%), Gaps = 32/228 (14%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFND--------  449
            M +   A ++P+I   ++E DE W QR  EA E  L+ +  DP  +   F++        
Sbjct  10   MLVFCIAGLIPTIQADMSELDEYWSQRADEAREFTLQAYHSDPYEIIDHFHERHYDNSTD  69

Query  448  -------------EVHKTLLESKNEPDRKKFVNGSDDTRRQLAHR-----KPYNGPCNAT  323
                         EV   ++E     D     N ++ TRR L  +         GPC A+
Sbjct  70   ITPTEEASNAKPEEVENEVIEMVGSGD-----NSTNSTRRSLRGKGKGKWSKLKGPCTAS  124

Query  322  NPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRH  146
            NPID+CWRC+ NWA  R++L  C  GFG   +GGKHG +YVV  + D D  NP+PGTLRH
Sbjct  125  NPIDKCWRCRKNWAKRRKKLVKCVRGFGHMTVGGKHGRIYVVTSNLDEDVVNPEPGTLRH  184

Query  145  AVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            AVIQ++PLWIIF  DM+IRLNQEL++ S KTID RG  VH++ GAG+T
Sbjct  185  AVIQEEPLWIIFKNDMSIRLNQELMINSFKTIDARGANVHIAHGAGVT  232



>ref|XP_010678579.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 125/211 (59%), Gaps = 12/211 (6%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            M    +N    F++   I L  +  +I  +D+ W+QR+  A  +A + +  DP  ++   
Sbjct  1    MTDITLNLMLFFMLVSIIFLQHVEANIGNYDDHWKQREQAAKANAARAYNTDPHGITHQT  60

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANN  275
            N  VH   +   N  +           RR L     Y GPC A NPIDRCWRC  NW+ +
Sbjct  61   NQRVHNMGMNRTNRTNNY--------ARRGLG---KYEGPCQADNPIDRCWRCDDNWSKD  109

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFSRDM  98
            R++LADC +GFG K  GGK G +YVV D SD+   +PKPGTLRHAVIQ  PLWIIF   M
Sbjct  110  RQKLADCVVGFGHKTTGGKKGNIYVVTDDSDNELLDPKPGTLRHAVIQDGPLWIIFKHGM  169

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGI  5
             I+L +EL++ S+KTIDGRG  VH++GGAGI
Sbjct  170  VIKLKEELLVSSNKTIDGRGGHVHIAGGAGI  200



>ref|XP_010453638.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=490

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 133/238 (56%), Gaps = 37/238 (16%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            MF+   A ++P+I G+I+E DE W +R  EA E  L+ +  DP  +   F++  +    +
Sbjct  10   MFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  424  -SKNEPDR------------------------------KKFVNGSDDTRRQLAHR-----  353
             ++ E D                               K   N ++ TRR L  +     
Sbjct  70   ATETEEDGAVQLEEEHVGAQVEEEHGGAKPEEEEEEGIKMVGNSTNSTRRSLRGKGKGKW  129

Query  352  KPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DP  176
                GPC A+NPID+CWRC+ NWA  R++L  C  GFG +  GGK G +YVV  + D D 
Sbjct  130  SKLKGPCTASNPIDKCWRCRSNWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDM  189

Query  175  SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             NPKPGTLRHAVIQK+PLWIIF  DM+IRLNQEL++ S KTID RG  VH++ GAGIT
Sbjct  190  VNPKPGTLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHIAHGAGIT  247



>ref|XP_003613596.1| Pectate lyase [Medicago truncatula]
 gb|AES96554.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/224 (46%), Positives = 130/224 (58%), Gaps = 26/224 (12%)
 Frame = -3

Query  646  VAKIMAGFNINCFCMFLVTFAIILPSISGHIAEWDEV--------WQQRKIEAWEHALKT  491
            +AK+   F + C  + + T  ++  ++    A WD +        WQ++   A +   K 
Sbjct  1    MAKLYHLFLLTCLVVTIST--LVHANVKEDKAYWDRILPTLNTTYWQKKASIAAKANDKA  58

Query  490  FEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPID  311
            + PDP  VS   +  V + ++             G  + RR L      N  C ATNPID
Sbjct  59   YTPDPYAVSGNLSSTVSEMII-------------GGINGRRNLVGLG--NSSCMATNPID  103

Query  310  RCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQ  134
            RCWRC PNWANNR++LADC  GFGRK  GGK G +YVV D SD D  NP+PGTLRHAV +
Sbjct  104  RCWRCDPNWANNRKKLADCVQGFGRKTTGGKDGPIYVVTDPSDSDLVNPRPGTLRHAVTR  163

Query  133  KKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
              PLWIIF+R M IRLNQELIM  +KTIDGRG  V ++ GAGIT
Sbjct  164  NGPLWIIFARSMKIRLNQELIMAGNKTIDGRGADVTIANGAGIT  207



>ref|XP_010925369.1| PREDICTED: pectate lyase [Elaeis guineensis]
Length=444

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 125/207 (60%), Gaps = 19/207 (9%)
 Frame = -3

Query  613  CFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKT  434
            C  +FL + A+        I E D+ WQ++  EA   +   + PDP  V+  FN  VH  
Sbjct  13   CSLIFLASAALS----GADIPELDDHWQKKAEEALARSRAAYHPDPEAVTNHFNKAVHLA  68

Query  433  LLESKNEPDRKKFVNGSDDTRRQL--AHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLA  260
            L E++N             TRR L     K + G C ATNPIDRCWRCQ NW  +R++LA
Sbjct  69   LAEARNS------------TRRSLRAVGVKKFKGKCVATNPIDRCWRCQKNWIKHRKKLA  116

Query  259  DCGMGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLN  83
             CG GFGR A GGK G  YVV D SDD   NPK GTLR  VIQ +PLWI+F+RDM IRL+
Sbjct  117  TCGKGFGRHATGGKAGDFYVVTDPSDDDLVNPKFGTLRWGVIQDRPLWIVFARDMIIRLS  176

Query  82   QELIMQSDKTIDGRGFQVHVSGGAGIT  2
            +EL++ S+KTID RG  VH++ GA IT
Sbjct  177  EELMINSNKTIDARGANVHIAYGAQIT  203



>ref|XP_009599232.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=445

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/218 (45%), Positives = 129/218 (59%), Gaps = 22/218 (10%)
 Frame = -3

Query  634  MAGFNINC--FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSA  461
            MA F+ N   F   L+  A ++P++  +IAE+D   +++  EA + +L  +  +P  ++ 
Sbjct  1    MASFSCNSVIFLFSLLCIASLIPNLHANIAEFDPYLEKKAEEALKSSLAAYNENPEELTD  60

Query  460  AFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGP----CNATNPIDRCWRCQ  293
             FN EV +T+                + TRR L      +      C A NPID+CWRC 
Sbjct  61   TFNKEVGETIF---------------NGTRRHLKEEDKDDKDDNDGCKAYNPIDKCWRCD  105

Query  292  PNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDD-PSNPKPGTLRHAVIQKKPLWI  116
             NWANNR+ LADC  GFG    GGK G  YVV D SDD    P PGTLRHAVIQ++PLWI
Sbjct  106  KNWANNRKALADCARGFGHGTTGGKDGKFYVVTDPSDDNVEEPNPGTLRHAVIQEEPLWI  165

Query  115  IFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IF + M IRL QEL++ +DKTIDGRG  VHV+ GAG+T
Sbjct  166  IFEKSMIIRLKQELMINNDKTIDGRGVSVHVAYGAGLT  203



>ref|XP_010670318.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 128/220 (58%), Gaps = 28/220 (13%)
 Frame = -3

Query  625  FNINCFCMFLVTFAIILPSIS----GHIA-------EWDEVWQQRKIEAWEHALKTFEPD  479
            F I        T  + +P+I     GH+        E DE +Q++  EA+  +L  +  D
Sbjct  6    FKIQIPIFIFATIFVAIPTIQANTIGHVGNHTTKDTEHDEWFQRKLAEAYNASLLAYHHD  65

Query  478  PSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWR  299
            P  V   FN  VH+ L              G++ TRR L     Y G C A NPIDRCWR
Sbjct  66   PIEVMNHFNYHVHRAL-------------EGTNSTRRGL---NKYQGECKAQNPIDRCWR  109

Query  298  CQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPL  122
            C+ +WA +R++LADC  GFGR+  GGK G  Y V D SD D  NPKPGTLR AV+Q +PL
Sbjct  110  CKADWAVDRKKLADCVKGFGRQTTGGKKGAYYTVTDPSDNDVVNPKPGTLRFAVLQPQPL  169

Query  121  WIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            WIIF++DM I+L  EL++ SDKTIDGRG QV ++ GAGIT
Sbjct  170  WIIFAKDMTIKLKAELMITSDKTIDGRGAQVQIADGAGIT  209



>ref|XP_006357121.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=397

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 101/131 (77%), Gaps = 3/131 (2%)
 Frame = -3

Query  394  VNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKH  215
            V   + TRR LA  K Y GPC ATN ID+CWRC P+WA++R + ADC MGFG KAIGGK 
Sbjct  26   VAADNSTRRHLA--KKYKGPCMATNLIDKCWRCDPHWADHREKYADCAMGFGSKAIGGKG  83

Query  214  GVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRG  38
            G +YVV D+SD D  NP PGTLRHAVIQK+PLWIIF R M+I+L +EL+MQS KTIDGRG
Sbjct  84   GRVYVVTDNSDKDVENPTPGTLRHAVIQKEPLWIIFERHMHIKLKRELLMQSHKTIDGRG  143

Query  37   FQVHVSGGAGI  5
            F +H+  GAG+
Sbjct  144  FNIHIEKGAGL  154



>ref|XP_006656188.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=446

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 129/204 (63%), Gaps = 17/204 (8%)
 Frame = -3

Query  598  LVTFAIILPSISG----HIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            LV +A+ L S +     +I ++DE WQ+RK+ A   A  T++ DP  V+  FN  VH++ 
Sbjct  14   LVLYAVFLLSAAATSEANIGDYDEHWQKRKLMADAAAEATYKRDPFEVTNDFNRAVHRS-  72

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
               + E  R+  +         L+ RK + GPC ATNPIDRCWRC+ +WA +R+RLA C 
Sbjct  73   --EEKETARRSLM---------LSKRKKFAGPCKATNPIDRCWRCRDDWATDRKRLARCA  121

Query  250  MGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
             GFGR   GG  G  YVV D +DD   NP+PGTLR  VIQ +PLWIIF ++M I L +EL
Sbjct  122  QGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQDEPLWIIFGKNMIINLKEEL  181

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            ++ +DKT+DGRG QV ++ GA +T
Sbjct  182  MIGNDKTVDGRGAQVRITNGAQVT  205



>ref|XP_008221658.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=443

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 129/196 (66%), Gaps = 14/196 (7%)
 Frame = -3

Query  586  AIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPD  407
            AII  + +    E DE W++R  +A  + ++++EP+P  V+  FN +V + ++       
Sbjct  20   AIIANAETDQPQELDEYWKKRADQAENYTMESYEPNPERVTDEFNAQVGELIM-------  72

Query  406  RKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAI  227
                  G ++TRR L  +K Y GPC  TNPID CWRC PNWANNR ++ DC  GFGRK  
Sbjct  73   ------GKNETRRNLKGQKKYVGPCTVTNPIDACWRCDPNWANNRMKIVDCIQGFGRKTT  126

Query  226  GGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTI  50
            GGK G +YVV D SD D  NP+PGTLRHAVIQK PLWI F+R+M I+L QEL++ SDKTI
Sbjct  127  GGKGGPIYVVTDPSDGDLVNPRPGTLRHAVIQKGPLWITFARNMVIKLQQELMVASDKTI  186

Query  49   DGRGFQVHVSGGAGIT  2
            DGRG  V++  GA IT
Sbjct  187  DGRGANVNIFDGACIT  202



>ref|XP_006357289.1| PREDICTED: probable pectate lyase 3-like [Solanum tuberosum]
Length=459

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 129/221 (58%), Gaps = 14/221 (6%)
 Frame = -3

Query  634  MAGFNIN---CFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVS  464
            MA  + N    F   L+ F  I+P +  +IA++D   ++R  EA + +L  +  +P  V+
Sbjct  1    MASISFNNSVIFLFSLLCFISIIPKLYANIADFDPYLEKRAEEALQSSLAAYNENPEAVT  60

Query  463  AAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGP------CNATNPIDRCW  302
              FN EV +T+L       R+       + + +   +    G       C A NPID+CW
Sbjct  61   QIFNKEVGETILNGT----RRHLKEEDKEDKNEKVEKDDKEGDEKSVDICKAYNPIDKCW  116

Query  301  RCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDD-PSNPKPGTLRHAVIQKKP  125
            RC  NWANNR+ LADC  GFG    GGK G  YVV D SD+    P PGTLRHAVIQ++P
Sbjct  117  RCDKNWANNRKALADCARGFGHGTTGGKDGKFYVVTDPSDNNVEEPVPGTLRHAVIQEEP  176

Query  124  LWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            LWIIF + M I+L QEL++ +DKTIDGRG  VHV+ GAG+T
Sbjct  177  LWIIFEKSMIIKLKQELMINNDKTIDGRGISVHVAYGAGLT  217



>ref|XP_002453531.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
 gb|EES06507.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
Length=445

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 122/189 (65%), Gaps = 15/189 (8%)
 Frame = -3

Query  565  SGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNG  386
            + +IA++DE WQ+RK  A     +T+ PDP NV+ +FN  VH+     +           
Sbjct  31   TANIADFDEHWQKRKELAEASVRETYRPDPYNVTNSFNVAVHRATSLRR-----------  79

Query  385  SDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVL  206
               T R++  +    GPC ATNPID+CWRC+ +WA +R RLA C  GFG+   GG  G +
Sbjct  80   ---TMREMPRKHKKKGPCRATNPIDKCWRCKNDWATDRFRLARCARGFGQATTGGLGGPI  136

Query  205  YVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQV  29
            Y+V D SD D  NP+PGTLR  VIQ  PLWIIF++ M I+L+QEL++ SDKTIDGRG QV
Sbjct  137  YIVTDPSDGDVVNPRPGTLRWGVIQPGPLWIIFAKSMIIQLSQELLVSSDKTIDGRGAQV  196

Query  28   HVSGGAGIT  2
            H++ GAGIT
Sbjct  197  HIANGAGIT  205



>gb|AFW87059.1| pectate lyase [Zea mays]
Length=451

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 128/204 (63%), Gaps = 9/204 (4%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            F ++LV F +       +I ++DE WQQRK+ A   A  T++ DP  V+   N  VH+++
Sbjct  13   FVLYLVFFFLSAALSEANIGDFDEYWQQRKLMADAAAEATYKHDPVEVANQLNRAVHRSV  72

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
             E ++   R++ +  +         +  ++GPC ATNPIDRCWRC+ +WA +R+RLA C 
Sbjct  73   -EKEDIGTRREMMGTT-------TRKSKFSGPCRATNPIDRCWRCRQDWATDRKRLARCA  124

Query  250  MGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
             GFGR   GG  G  YVV D +DD   NP+PGTLR  VIQ +PLWI F++ M I L +EL
Sbjct  125  KGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKTMIITLKEEL  184

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            I++ DKTIDGRG QV ++ GA +T
Sbjct  185  IIRGDKTIDGRGVQVRITNGAQLT  208



>ref|XP_002437204.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
 gb|EER88571.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
Length=454

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 127/204 (62%), Gaps = 13/204 (6%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
             +LV F     S   +I ++D+ W+QRK+ A   A  T++ DP  V+   N  VH+++ E
Sbjct  17   FYLVLFLSAAVSSEANIGDFDDYWRQRKLMADAAAEATYKHDPLEVTNQLNRAVHRSV-E  75

Query  424  SKNEPDRKKFVNGSDDTRRQLAHRKPY--NGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
             ++   R+         R  + H+K    NGPC ATNPIDRCWRC+ +WA +R+RLA C 
Sbjct  76   KEDMSTRR---------RAMMGHKKGKLNNGPCEATNPIDRCWRCRQDWATDRKRLARCA  126

Query  250  MGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
             GFGR   GG  G  YVV D +DD   NP+PGTLR AVIQ +PLWI F+R M I L +EL
Sbjct  127  QGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWAVIQIEPLWITFARTMIITLKEEL  186

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            I+Q DKTIDGRG QV ++ GA +T
Sbjct  187  IIQGDKTIDGRGAQVRIANGAQLT  210



>ref|XP_006344502.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=435

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 129/190 (68%), Gaps = 17/190 (9%)
 Frame = -3

Query  571  SISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFV  392
            SI  HI E+DEVW++R  +A + A   + P+P  V+   N +V K              V
Sbjct  20   SIEAHIKEFDEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQVDKA-------------V  66

Query  391  NGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHG  212
             GS+  RR L HR  Y+G C ATNPID+CWRC PNWA NR +L DC +GFGRK  GGK G
Sbjct  67   RGSNSRRRDL-HR--YSGKCMATNPIDQCWRCDPNWARNRMKLTDCVLGFGRKTTGGKGG  123

Query  211  VLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGF  35
             +YVV D+SD+   NPKPGTLRHAVIQ +PLWIIF+++M IRLNQELIM S+KTID RG 
Sbjct  124  KIYVVMDNSDNELVNPKPGTLRHAVIQPEPLWIIFAKNMVIRLNQELIMTSNKTIDARGR  183

Query  34   QVHVSGGAGI  5
            QVH++ G G+
Sbjct  184  QVHIAHGGGL  193



>gb|KHN13240.1| Putative pectate lyase 3 [Glycine soja]
Length=446

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/220 (47%), Positives = 127/220 (58%), Gaps = 24/220 (11%)
 Frame = -3

Query  634  MAGFNINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            M G         L TFAI++P +   IAE+D+  + +  EA + AL ++ P+P +V+   
Sbjct  1    MVGSATKVAFTLLATFAIVIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHEL  60

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNG-PCNATNPIDRCWRCQPNWAN  278
            N  VH  L  S               TRR+L  RK   G  C A+NPID CWRC  +WAN
Sbjct  61   NFHVHMALENS---------------TRRELRQRKLRGGGKCQASNPIDACWRCNKDWAN  105

Query  277  NRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPK-------PGTLRHAVIQKKPL  122
            +R RLA CG GFGR+A GG  G +YVV D+SDD   NPK       PGT+RHAV QK PL
Sbjct  106  DRFRLAKCGKGFGRRATGGLGGPIYVVTDNSDDDMVNPKPGTIRHAPGTIRHAVTQKGPL  165

Query  121  WIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            WIIF   M I L QEL++ SDKTIDGRG  V    GAG+T
Sbjct  166  WIIFGHSMIISLRQELMISSDKTIDGRGANVVFRDGAGLT  205



>ref|XP_007215366.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
 gb|EMJ16565.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
Length=452

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 143/210 (68%), Gaps = 13/210 (6%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIA------EWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFND  449
              +F+++F I++PS+   IA      ++D VW++R+++A + ALK ++P+P  V+  FN+
Sbjct  7    LVLFMISFCILVPSLRASIANDSNVGQFDAVWKERELKAEKAALKAYQPNPEKVTDDFNE  66

Query  448  EVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRR  269
             V +   +  N  D  +    S+ T R L  +K Y GPC ATNPIDRCWRC+ +WAN+R+
Sbjct  67   SVQE--FDDLNFEDDDQV---SNITGRHLLGKK-YKGPCKATNPIDRCWRCRKDWANDRK  120

Query  268  RLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNI  92
            +LA+C  GFGR+  GGK G  YVV D SD +  +PKPGTLRHAVIQ +PLWIIF+R M I
Sbjct  121  KLANCVKGFGRRTRGGKRGGFYVVTDPSDSNVVDPKPGTLRHAVIQPQPLWIIFARSMTI  180

Query  91   RLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            RL QELI+ S KTID RG  V ++ GAGIT
Sbjct  181  RLTQELILTSHKTIDARGANVRIAHGAGIT  210



>ref|XP_004490004.1| PREDICTED: probable pectate lyase 3-like isoform X2 [Cicer arietinum]
Length=376

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 99/134 (74%), Gaps = 2/134 (1%)
 Frame = -3

Query  400  KFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGG  221
            + + G    RR L  RK   GPC ATNPIDRCWRC PNWANNR++LADC  GFGRK  GG
Sbjct  2    RMIIGGKKGRRNLRGRKTA-GPCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGG  60

Query  220  KHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDG  44
            K G  YVV D SD D  NP+PGTLRHAV +  PLWIIF+R MNIRLNQELIM SDKTIDG
Sbjct  61   KAGPFYVVTDPSDSDMVNPRPGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDG  120

Query  43   RGFQVHVSGGAGIT  2
            RG  + ++ GAGIT
Sbjct  121  RGADIVIANGAGIT  134



>ref|XP_008230729.1| PREDICTED: pectate lyase [Prunus mume]
Length=452

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 143/210 (68%), Gaps = 13/210 (6%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIA------EWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFND  449
              +F+++F I++PS+   IA      ++D VW++R+++A + ALK ++ +P  V+  FN+
Sbjct  7    LVLFMISFCILVPSLRASIANDSNVGQFDAVWKERELKAEKTALKAYQRNPEKVTDDFNE  66

Query  448  EVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRR  269
             V +  ++  N  D  +    S+ T R L  +K Y GPC ATNPIDRCWRC+ +WAN+R+
Sbjct  67   SVQE--VDDLNFEDDDQV---SNITGRHLLGKK-YKGPCKATNPIDRCWRCRKDWANDRK  120

Query  268  RLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNI  92
            +LA+C  GFGR+  GGK G  YVV D SD +   PKPGTLRHAVIQ +PLWIIF+R M I
Sbjct  121  KLANCVKGFGRRTRGGKRGEFYVVTDPSDSNVVEPKPGTLRHAVIQPQPLWIIFARSMTI  180

Query  91   RLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            RL QELIM S KTID RG  VH++ GAG+T
Sbjct  181  RLTQELIMTSHKTIDARGANVHIAHGAGLT  210



>emb|CDX85564.1| BnaA02g02490D [Brassica napus]
Length=473

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/221 (45%), Positives = 132/221 (60%), Gaps = 20/221 (9%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKT---  434
            MF    A ++P+I  +++E DE W +R  EA E  L+ +  +P  V   F++  +     
Sbjct  10   MFTFYIAGLIPTIRANLSELDEYWSKRAGEAREFTLQAYHSNPYEVVDHFHERHYDNSTD  69

Query  433  LLESKNEPDRKKFVNGSDD-----------TRRQLAHRKP-----YNGPCNATNPIDRCW  302
            + E++ + D +K     DD           TRR L  ++        GPC A+NPID+CW
Sbjct  70   VKETEEDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKRKGKWSKLKGPCTASNPIDKCW  129

Query  301  RCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKP  125
            RC+ NWA  R+ L  C  GFG   IGGK G +YVV  + D D  NPKPGTLRHAVIQK+P
Sbjct  130  RCRSNWAKRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEP  189

Query  124  LWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            LWIIF  DM+IRL+QEL++ S KTID RG  VH++ GAGIT
Sbjct  190  LWIIFKNDMHIRLSQELMICSFKTIDARGTDVHIAHGAGIT  230



>ref|NP_001150723.1| pectate lyase precursor [Zea mays]
 gb|ACG40127.1| pectate lyase precursor [Zea mays]
Length=451

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 127/204 (62%), Gaps = 9/204 (4%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            F ++LV F +       +I ++DE WQQRK+ A   A  T++ DP  V+   N  VH+++
Sbjct  13   FVLYLVFFFLSAALSEANIGDFDEYWQQRKLMADAAAEATYKHDPVEVANQLNRAVHRSV  72

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCG  251
             E  +   R++ +  +         +  ++GPC ATNPIDRCWRC+ +WA +R+RLA C 
Sbjct  73   -EKDDIGTRREMMGTT-------TRKSKFSGPCRATNPIDRCWRCRQDWATDRKRLARCA  124

Query  250  MGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQEL  74
             GFGR   GG  G  YVV D +DD   NP+PGTLR  VIQ +PLWI F++ M I L +EL
Sbjct  125  KGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKTMIITLKEEL  184

Query  73   IMQSDKTIDGRGFQVHVSGGAGIT  2
            I++ DKTIDGRG QV ++ GA +T
Sbjct  185  IIRGDKTIDGRGVQVRITNGAQLT  208



>gb|EYU28712.1| hypothetical protein MIMGU_mgv1a006498mg [Erythranthe guttata]
Length=442

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 129/208 (62%), Gaps = 18/208 (9%)
 Frame = -3

Query  622  NINCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEV  443
            +I    + ++ F  ++P     IA++D+  +++  E++  +LK F+P+P  V+   N++V
Sbjct  9    SIILLLLSMIYFVTLIPKSHAAIAKYDDYLRKKANESFAESLKAFDPNPEKVADELNEQV  68

Query  442  HKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRL  263
             +TL+               + +RR L         C ATNPIDRCWRC  +W+ NR++L
Sbjct  69   GETLVHE-------------NLSRRHLKEEND----CKATNPIDRCWRCDGDWSKNRKKL  111

Query  262  ADCGMGFGRKAIGGKHGVLYVVNDHSDDPSN-PKPGTLRHAVIQKKPLWIIFSRDMNIRL  86
            A+C  GFG +  GGK G  Y+V D SDD  + PK GTLRHAVIQ +PLWIIF+R M IRL
Sbjct  112  AECVRGFGHRTTGGKDGRYYLVTDPSDDDMDKPKNGTLRHAVIQSEPLWIIFARSMVIRL  171

Query  85   NQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             QELI  SDKT+DGRG +V ++ GAG+T
Sbjct  172  KQELIFASDKTVDGRGVRVRIAYGAGLT  199



>ref|XP_010492335.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=499

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 131/247 (53%), Gaps = 46/247 (19%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE  425
            MF+   A ++P+I G+I+E DE W +R  EA E  L+ +  DP  +   F++  +    +
Sbjct  10   MFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  424  SKNEPDR----------------------------------------KKFVNGSDDTRRQ  365
               E +                                         K   N ++ TRR 
Sbjct  70   DATETEDGVAQLEEEHGGAKPEEEHGGVQLEEEHGGAKPEEEEEEGIKMVGNSTNSTRRS  129

Query  364  LAHR-----KPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYV  200
            L  +         GPC A+NPID+CWRC+ NWA  R++L  C  GFG +  GGK G +YV
Sbjct  130  LRGKGKGKWSKLKGPCTASNPIDKCWRCRTNWAKRRKKLTRCVRGFGHRTTGGKRGRIYV  189

Query  199  VNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHV  23
            V  + D D  NPKPGTLRHAVIQK+PLWIIF  DM+IRLNQEL++ S KTID RG  VH+
Sbjct  190  VTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHI  249

Query  22   SGGAGIT  2
            + GAGIT
Sbjct  250  AHGAGIT  256



>ref|XP_008446067.1| PREDICTED: pectate lyase-like, partial [Cucumis melo]
Length=381

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 111/157 (71%), Gaps = 17/157 (11%)
 Frame = -3

Query  469  VSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQP  290
            V+  FN +VH++L             +G+++TRR L   + Y GPC ATNPIDRCWRC  
Sbjct  1    VTNNFNKQVHRSL-------------DGANNTRRHL---RKYTGPCLATNPIDRCWRCDR  44

Query  289  NWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWII  113
            NWA NR++LADC +GFGR   GGK G +YVV D SD D  NPKPGTLRHAVIQ++PLWII
Sbjct  45   NWARNRKKLADCALGFGRGTTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWII  104

Query  112  FSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            F+ DM IRL++ELIM  +KT+DGRG  VH++ G  IT
Sbjct  105  FAHDMVIRLSEELIMTDNKTLDGRGANVHIANGGQIT  141



>ref|XP_003563707.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=448

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 126/212 (59%), Gaps = 14/212 (7%)
 Frame = -3

Query  628  GFNINCFCMFLVTFAIIL--PSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAF  455
            G     F +++V F +    P    +I ++DE WQQRK  A   A   ++ DP  V+ + 
Sbjct  7    GRRAGSFVLYVVFFFLSASAPVSQANIGDFDEHWQQRKAAARAAAEAIYQSDPLEVANSL  66

Query  454  NDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANN  275
            N  VH+   E           + +   R  L   K + GPC ATNPIDRCWRC+ +WA +
Sbjct  67   NRAVHRATKE-----------DDAGTRRSMLGKHKKFAGPCRATNPIDRCWRCRKDWATD  115

Query  274  RRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFSRDM  98
            R+RLA C  GFGR A GG  G  Y+V D SDD    P+PGTLR AVIQ +PLWIIF+R M
Sbjct  116  RKRLARCAQGFGRNATGGLAGKFYIVTDGSDDDVLAPRPGTLRWAVIQAEPLWIIFARSM  175

Query  97   NIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             I+L +EL++ SDKTIDGRG QV ++ GA +T
Sbjct  176  LIKLKEELLIGSDKTIDGRGAQVRIADGAQVT  207



>ref|XP_009131435.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX78607.1| BnaA03g05190D [Brassica napus]
Length=475

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 94/223 (42%), Positives = 132/223 (59%), Gaps = 22/223 (10%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFND-------E  446
            M ++    ++P+I   ++E DE W  R  EA E  L+ +  DP  +   F++       +
Sbjct  10   MLVLCIVGLIPTIRADMSELDEYWSGRADEAREFTLQAYHSDPYEIIDHFHERHYDNSTD  69

Query  445  VHKTLLESKNEPDRKKFV---------NGSDDTRRQLAHR-----KPYNGPCNATNPIDR  308
            V  T  ++  +P+  +           N ++ TRR L  +         GPC A+NPID+
Sbjct  70   VTPTEEDNNTKPEEVENEVIEMVGSGDNSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDK  129

Query  307  CWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQK  131
            CWRC+ NW+  R++L  C  GFG   +GGKHG +YVV  + D D  NP+PGTLRHAVIQK
Sbjct  130  CWRCRKNWSKRRKKLVKCVRGFGHMTVGGKHGRIYVVTSNLDEDMVNPEPGTLRHAVIQK  189

Query  130  KPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            +PLWIIF  DM+IRLNQEL++ S KTID RG  VH++ GAG+T
Sbjct  190  EPLWIIFKNDMSIRLNQELLINSFKTIDARGANVHIAHGAGVT  232



>ref|XP_002882189.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58448.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=475

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/224 (43%), Positives = 131/224 (58%), Gaps = 24/224 (11%)
 Frame = -3

Query  607  CMFLVTFAIILPSISGHIA-EWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            C+F +  A ++P+I  ++A E D+ W  +  EA +H L  + PDP  +   F++  +   
Sbjct  11   CVFCI--ASLIPTIRANVADETDDYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYDNS  68

Query  430  LESKNEPDRKKFVNGSDD-----------TRRQLAHRKPYNG---------PCNATNPID  311
             + +   + K   +  +D           TRR L  R    G         PC A+NPID
Sbjct  69   TDVEGTEEEKAVASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLKGPCTASNPID  128

Query  310  RCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVND-HSDDPSNPKPGTLRHAVIQ  134
            +CWRCQP+WA  R++L  C  GFG +  GGK G +YVV     DD  NP+PGTLRHAVIQ
Sbjct  129  KCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAVIQ  188

Query  133  KKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            K+PLWIIF  DM+IRLNQEL++ S KTID RG  VH++ GAGIT
Sbjct  189  KEPLWIIFKHDMSIRLNQELMIASHKTIDARGANVHIAYGAGIT  232



>ref|XP_008679844.1| PREDICTED: pectate lyase [Zea mays]
 gb|AFW66064.1| pectate lyase-like protein [Zea mays]
Length=444

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 119/186 (64%), Gaps = 14/186 (8%)
 Frame = -3

Query  556  IAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDD  377
            + ++D+  Q+RK  A   A + + PDP NV+ +FN  VH+ +  S+ E            
Sbjct  33   VGQFDDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAVSSSRRE------------  80

Query  376  TRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVV  197
              R+   +    GPC ATNPID+CWRC+ +WA +R+RLA C  GFG    GG  G +YVV
Sbjct  81   -MRERPRKHKKRGPCRATNPIDKCWRCRRDWATDRQRLARCARGFGHATTGGLGGKIYVV  139

Query  196  NDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVS  20
             D +D D  NP+PGTLR  VIQ  PLWIIF+R M I+L+QEL+M SDKTIDGRG QVH++
Sbjct  140  TDPTDLDVVNPRPGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRGAQVHIA  199

Query  19   GGAGIT  2
             GAGIT
Sbjct  200  NGAGIT  205



>emb|CDY63769.1| BnaCnng42620D [Brassica napus]
Length=479

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/227 (44%), Positives = 132/227 (58%), Gaps = 26/227 (11%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKT---  434
            MF+   A ++P+I  + +E DE W +R  EA E  L+ +  +P  V   F++  +     
Sbjct  10   MFMFYIAGLIPTIRANFSELDEYWSKRAGEAREFTLQAYHSNPYEVVDHFHERHYDNSTD  69

Query  433  LLESKNEPDRKKFVNGSDD-----------TRRQLAHRKP-----------YNGPCNATN  320
            + E++ + D +K     DD           TRR L  +               GPC A+N
Sbjct  70   VKETEEDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKSKGKGKRKGKWSKLKGPCTASN  129

Query  319  PIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVV-NDHSDDPSNPKPGTLRHA  143
            PID+CWRC+ NWA  R+ L  C  GFG   IGGK G +YVV ++  DD  NPKPGTLRHA
Sbjct  130  PIDKCWRCRSNWAKRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNRDDDMVNPKPGTLRHA  189

Query  142  VIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            VIQK+PLWIIF  DM+IRL+QEL++ S KTID RG  VH++ GAGIT
Sbjct  190  VIQKEPLWIIFKNDMHIRLSQELMICSFKTIDARGANVHIAHGAGIT  236



>ref|XP_003519771.2| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=447

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 128/208 (62%), Gaps = 16/208 (8%)
 Frame = -3

Query  604  MFLVT-FAIILPSISGHIAEWDEVWQQRKIE-----AWEHALKTFEPDPSNVSAAFNDEV  443
             FL+T   +I+P++  ++ E DE++ +R+ +      W+      E +      +    +
Sbjct  7    FFLLTCLIVIIPTLHANVKE-DEIYWKRQSQILNDSYWKQKASVAEKENKQAYTSDPYSL  65

Query  442  HKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRL  263
             K L  S +E      + G  + RR L   K   G C ATNPIDRCWRC PNWANNR++L
Sbjct  66   TKNLTYSVSE-----IIVGEQNGRRNL---KGKGGNCMATNPIDRCWRCDPNWANNRKKL  117

Query  262  ADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRL  86
            A+C  GFGR  +GGK+G  YVV  + D D  NP PGTLRHAV +  PLWIIF+  M IRL
Sbjct  118  ANCVQGFGRNTVGGKNGPFYVVTSNLDNDMVNPVPGTLRHAVTRTGPLWIIFAHSMKIRL  177

Query  85   NQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            NQELIM SDKTIDGRG  V+++GGAGIT
Sbjct  178  NQELIMASDKTIDGRGVDVYLAGGAGIT  205



>gb|KHN08706.1| Putative pectate lyase 3 [Glycine soja]
Length=444

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 128/208 (62%), Gaps = 16/208 (8%)
 Frame = -3

Query  604  MFLVT-FAIILPSISGHIAEWDEVWQQRKIE-----AWEHALKTFEPDPSNVSAAFNDEV  443
             FL+T   +I+P++  ++ E DE++ +R+ +      W+      E +      +    +
Sbjct  4    FFLLTCLIVIIPTLHANVKE-DEIYWKRQSQILNDSYWKQKASVAEKENKQAYTSDPYSL  62

Query  442  HKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRL  263
             K L  S +E      + G  + RR L   K   G C ATNPIDRCWRC PNWANNR++L
Sbjct  63   TKNLTYSVSE-----IIVGEQNGRRNL---KGKGGNCMATNPIDRCWRCDPNWANNRKKL  114

Query  262  ADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRL  86
            A+C  GFGR  +GGK+G  YVV  + D D  NP PGTLRHAV +  PLWIIF+  M IRL
Sbjct  115  ANCVQGFGRNTVGGKNGPFYVVTSNLDNDMVNPVPGTLRHAVTRTGPLWIIFAHSMKIRL  174

Query  85   NQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            NQELIM SDKTIDGRG  V+++GGAGIT
Sbjct  175  NQELIMASDKTIDGRGVDVYLAGGAGIT  202



>emb|CDY28691.1| BnaCnng05770D [Brassica napus]
Length=469

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 129/217 (59%), Gaps = 18/217 (8%)
 Frame = -3

Query  598  LVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE--  425
            ++  A ++P++  ++AE DE W  +  EA    L  + PDP  +   F++  +    +  
Sbjct  10   VICIASLIPTLRANVAETDEYWVTKANEARRRTLMAYHPDPYQIVDHFHERHYDNSTDVE  69

Query  424  ------SKNEPDRKKFVNGSDDTRRQLAHR---------KPYNGPCNATNPIDRCWRCQP  290
                  S+ E D +   + ++ TRR L  R             GPC A+NPID+CWRCQP
Sbjct  70   EMEENASEEEDDIEMISSATNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCWRCQP  129

Query  289  NWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWII  113
            +WA  R++L  C  GFG K  GGK G +YVV  + DD + NP+PGTLRHAVIQ +PLWII
Sbjct  130  DWARRRKKLVKCVRGFGYKTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEPLWII  189

Query  112  FSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            F  DM+IRL QEL++ S KTID RG  VH++ GAGIT
Sbjct  190  FKHDMSIRLCQELMINSHKTIDARGTNVHIAYGAGIT  226



>ref|XP_004236194.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=435

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 127/190 (67%), Gaps = 17/190 (9%)
 Frame = -3

Query  571  SISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFV  392
            SI  HI E+DEVW++R  +A + A   + P+P  V+   N +V K              V
Sbjct  20   SIEAHIKEFDEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQVDKA-------------V  66

Query  391  NGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHG  212
             GS   RR L   + Y+G C ATNPID+CWRC PNWA NR +L DC +GFGRK  GGK G
Sbjct  67   RGSKSRRRDL---QRYSGKCMATNPIDQCWRCDPNWARNRMKLTDCVLGFGRKTTGGKGG  123

Query  211  VLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGF  35
             +YVV D+SD+   NPKPGTLRHAVIQ +PLWIIF+++M I+LNQELIM S+KTID RG 
Sbjct  124  KIYVVMDNSDNELVNPKPGTLRHAVIQPEPLWIIFAKNMVIKLNQELIMTSNKTIDARGR  183

Query  34   QVHVSGGAGI  5
            QVH++ G G+
Sbjct  184  QVHIAHGGGL  193



>ref|XP_007151201.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
 gb|ESW23195.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
Length=441

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 121/202 (60%), Gaps = 17/202 (8%)
 Frame = -3

Query  601  FLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLES  422
             L T AI +P +   IAE+DE  + +  +A E AL+++ P P  V+   N  VH ++   
Sbjct  14   LLATLAITIPCLEAGIAEFDEFLRAQSEKAHEIALQSYVPTPEFVTNDLNYHVHLSM---  70

Query  421  KNEPDRKKFVNGSDDTRRQLAHRKPYNG-PCNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                         + TRR L       G PC ++NPID CWRC  +WA +R RLA CG G
Sbjct  71   ------------QNVTRRGLKEGNNAIGKPCESSNPIDNCWRCNKDWAKDRYRLAKCGKG  118

Query  244  FGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FGR+A+GG  G +YVV D+SD D  NPKPGTLR+AV QK PLWI F R M I L QEL++
Sbjct  119  FGRRAVGGLGGPIYVVTDNSDEDMINPKPGTLRYAVTQKGPLWITFERSMIISLQQELMI  178

Query  67   QSDKTIDGRGFQVHVSGGAGIT  2
             SDKTIDGRG  V +  G G+T
Sbjct  179  SSDKTIDGRGANVQIRDGGGLT  200



>gb|KFK37588.1| hypothetical protein AALP_AA3G002600 [Arabis alpina]
Length=472

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 126/219 (58%), Gaps = 21/219 (10%)
 Frame = -3

Query  598  LVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVH--KTLLE  425
            +V  A ++P++  ++AE D+ W  +  EA +  L  + PDP  +   F++  +   T +E
Sbjct  12   VVCIASLIPTLRANVAETDDYWVNKANEARKRTLSVYHPDPYAIVDHFHERHYDNSTDVE  71

Query  424  SKNEPDRKKFVNGSDDT-----------------RRQLAHRKPYNGPCNATNPIDRCWRC  296
             + E +   F    DDT                 R +        GPC A+NPID+CWRC
Sbjct  72   EREEHEATAFAE-EDDTEMISSSTNSTRRSLSGNRGKRGKWSKLKGPCTASNPIDKCWRC  130

Query  295  QPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVND-HSDDPSNPKPGTLRHAVIQKKPLW  119
            Q +WA  R++L  C  GFG +  GGK G +YVV     DD  NPKPGTLRHAVIQK+PLW
Sbjct  131  QADWAKRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDVVNPKPGTLRHAVIQKEPLW  190

Query  118  IIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IIF  DM+IRL QEL++ S KTID RG  VHV+ GAGIT
Sbjct  191  IIFKHDMSIRLKQELMINSHKTIDARGANVHVAYGAGIT  229



>ref|XP_004233352.1| PREDICTED: pectate lyase-like [Solanum lycopersicum]
Length=397

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 98/131 (75%), Gaps = 3/131 (2%)
 Frame = -3

Query  394  VNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKH  215
            V   + TRR LA  K Y GPC ATN ID+CWRC P WA+NR + ADC MGFG KA GGK 
Sbjct  26   VAADNSTRRHLA--KKYKGPCMATNLIDKCWRCDPQWADNREKYADCAMGFGSKATGGKG  83

Query  214  GVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRG  38
            G +YVV+D+SD D  NP PGTLRHAVIQ +PLWIIF R M+I+L +EL+MQ  KTIDGRG
Sbjct  84   GRVYVVSDNSDSDVENPAPGTLRHAVIQTEPLWIIFERHMHIKLQRELLMQGHKTIDGRG  143

Query  37   FQVHVSGGAGI  5
            F +H+  GAG+
Sbjct  144  FNIHIEKGAGL  154



>ref|XP_008786760.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=467

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 10/186 (5%)
 Frame = -3

Query  556  IAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDD  377
            +AE D+ WQ++  EA+  +   + PDP  V+  FN  VH  L +++N   R      +D 
Sbjct  50   VAELDDHWQKKAEEAFARSRAAYHPDPEGVTNHFNQAVHLALAQARNSTRRGLKAVRADK  109

Query  376  TRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVV  197
             R+         G C A+NPIDRCWRCQ +W  +R++LA CG GFGR A+GG+ G  YVV
Sbjct  110  FRQ---------GQCVASNPIDRCWRCQKDWIKDRKKLASCGKGFGRNAVGGRDGDFYVV  160

Query  196  NDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVS  20
             D SD D  NPK GTLR  VIQ +PLWIIF+RDM IRL++ELI+ S+KTID RG  VH++
Sbjct  161  TDPSDNDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELIINSNKTIDARGANVHIA  220

Query  19   GGAGIT  2
             GA I+
Sbjct  221  FGAQIS  226



>ref|XP_004302354.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 137/211 (65%), Gaps = 23/211 (11%)
 Frame = -3

Query  610  FCMFLVTFAIILPSIS-------GHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFN  452
              +F+ +F +ILP +        G IA +D V Q+R+  A   ALK ++PDP +V+    
Sbjct  8    LVLFMCSFCVILPCLKAGADSDDGTIAVFDPVLQEREKRAEIAALKAYQPDPESVT----  63

Query  451  DEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNR  272
            DE+ K         D +  +  S+ TRR LA  K     C ATNPIDRCWRC P+WA NR
Sbjct  64   DELIK---------DVETSIERSNTTRRHLA--KKIKAECTATNPIDRCWRCNPDWAKNR  112

Query  271  RRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMN  95
            ++LA+C +GFGR+  GGK G +YVV+D SD D +NPKPGTLRHAVIQ  PLWIIF   M 
Sbjct  113  KQLANCVLGFGRRTRGGKRGPIYVVHDSSDNDMANPKPGTLRHAVIQTGPLWIIFKHSMT  172

Query  94   IRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            I+LN+ELIM S KTIDGRG  VH++ GAGIT
Sbjct  173  IKLNKELIMTSHKTIDGRGANVHIAHGAGIT  203



>ref|XP_006579282.1| PREDICTED: probable pectate lyase P59-like [Glycine max]
Length=420

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 103/132 (78%), Gaps = 3/132 (2%)
 Frame = -3

Query  394  VNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKH  215
            + GS+++RR L+++  Y+GPC ATNPID+CWRC PNW  NR+RLADC +GFG    GGK 
Sbjct  1    MRGSNNSRRGLSNQ--YDGPCKATNPIDKCWRCDPNWEKNRKRLADCALGFGHGTTGGKD  58

Query  214  GVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRG  38
            G +YVVND SD D  NPKPGTLRHA IQ++PLWIIF R+MNI+L+ EL++  +KTID RG
Sbjct  59   GKIYVVNDSSDNDLVNPKPGTLRHAAIQREPLWIIFDRNMNIKLHAELMLTDNKTIDARG  118

Query  37   FQVHVSGGAGIT  2
              VH+S GA IT
Sbjct  119  ANVHISEGAQIT  130



>gb|ACF87417.1| unknown [Zea mays]
Length=444

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 120/186 (65%), Gaps = 14/186 (8%)
 Frame = -3

Query  556  IAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDD  377
            + ++D+  Q+RK  A   A + + PDP NV+ +FN  VH+ +  S+ E            
Sbjct  33   VGQFDDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAVSSSRREM-----------  81

Query  376  TRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVV  197
              R   H+K   GPC ATNPID+CWRC+ +WA +R+RLA C  GFG    GG  G +YVV
Sbjct  82   WERPRKHKK--RGPCRATNPIDKCWRCRRDWATDRQRLARCARGFGHATTGGLGGKIYVV  139

Query  196  NDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVS  20
             D +D D  NP+PGTLR  VIQ  PLWIIF+R M I+L+QEL+M SDKTIDGRG QVH++
Sbjct  140  TDPTDLDVVNPRPGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRGAQVHIA  199

Query  19   GGAGIT  2
             GAGIT
Sbjct  200  NGAGIT  205



>gb|KHG23093.1| hypothetical protein F383_29772 [Gossypium arboreum]
Length=385

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 100/130 (77%), Gaps = 2/130 (2%)
 Frame = -3

Query  385  SDDTRRQL-AHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGV  209
            ++ TRR L    K Y GPC A NPIDRCWRC+ NWA NR+RLA C +GFG K  GGK G 
Sbjct  13   TNSTRRDLRGKHKKYTGPCMAINPIDRCWRCRKNWAKNRKRLAKCVLGFGHKTRGGKKGE  72

Query  208  LYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQ  32
             Y+V D+SDD   NPKPGTLRHAVIQK+PLWIIF+ DMNI+L+QEL++QS KTIDGRG  
Sbjct  73   YYLVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSQELMVQSHKTIDGRGAN  132

Query  31   VHVSGGAGIT  2
            VH++ G GIT
Sbjct  133  VHIAYGCGIT  142



>ref|XP_010420163.1| PREDICTED: probable pectate lyase 19 isoform X1 [Camelina sativa]
Length=499

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 101/247 (41%), Positives = 134/247 (54%), Gaps = 46/247 (19%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFND--------  449
            MF+   A ++P+I G+I+E DE W +R  EA E  L+ +  DP  +   F++        
Sbjct  10   MFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  448  -----EVHKTLLESKN---EPDR------------------------KKFVNGSDDTRRQ  365
                 E     LE ++   +P+                         K   N +  TRR 
Sbjct  70   ATETEEDGAVQLEEEHGGAQPEEEHSGAQLEEEHGGAKPEEEEEEGIKMVGNSTKSTRRS  129

Query  364  LAHR-----KPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYV  200
            L  +         GPC A+NPID+CWRC+ NWA  R++L  C  GFG +  GGK G +YV
Sbjct  130  LRGKGKGKWSKLKGPCTASNPIDKCWRCRTNWAKRRKKLTRCVRGFGHRTTGGKRGRIYV  189

Query  199  VNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHV  23
            V  + D D  NPKPGTLRHAVIQK+PLWIIF  DM+IRL+QEL++ S KTID RG  VH+
Sbjct  190  VTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLINSHKTIDARGANVHI  249

Query  22   SGGAGIT  2
            + GAGIT
Sbjct  250  AHGAGIT  256



>ref|XP_004966014.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=486

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 128/206 (62%), Gaps = 15/206 (7%)
 Frame = -3

Query  610  FCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTL  431
            F ++ V   +       +I E+D+ W+QRK+ A   A  T++ DP  V    N  VH+++
Sbjct  50   FVLYAVVLLLSAAVSEANIGEFDDYWRQRKLMADAAAEATYQHDPIEVPNQLNRAVHRSI  109

Query  430  LESKNEPDRKKFVNGSDDTRRQLAHRKP--YNGPCNATNPIDRCWRCQPNWANNRRRLAD  257
                    +K+ ++    TRR++  +K    NGPC ATNPIDRCWRC+ +WA +R+RLA 
Sbjct  110  --------KKEDIS----TRREMLGQKKGKMNGPCKATNPIDRCWRCRKDWATDRKRLAR  157

Query  256  CGMGFGRKAIGGKHGVLYVVNDHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQ  80
            C  GFGR   GG  G  YVV D +DD   NP+PGTLR AVIQ +PLWI F++ M I L +
Sbjct  158  CAQGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWAVIQIEPLWITFAKTMIITLKE  217

Query  79   ELIMQSDKTIDGRGFQVHVSGGAGIT  2
            ELI++ DKTIDGRG QV ++ GA +T
Sbjct  218  ELIIRGDKTIDGRGVQVRIANGAQLT  243



>ref|XP_008365507.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=396

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 105/146 (72%), Gaps = 6/146 (4%)
 Frame = -3

Query  436  TLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLAD  257
            T++E   E D+    +  + TRR L   K Y GPC ATNPIDRCWRC+ NWANNR++LA 
Sbjct  14   TVVEEDLEDDQ----SAGNSTRRNL-RGKQYKGPCKATNPIDRCWRCRANWANNRKKLAS  68

Query  256  CGMGFGRKAIGGKHGVLYVVNDHSDD-PSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQ  80
            C  GFGRK  GGK G  Y+V D SDD   +PKPGTLRHAVIQ +PLWIIF+R M IRL+Q
Sbjct  69   CVKGFGRKTRGGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQ  128

Query  79   ELIMQSDKTIDGRGFQVHVSGGAGIT  2
            ELI+ S KTID RG  VH++ GAGIT
Sbjct  129  ELIVTSHKTIDARGANVHIAHGAGIT  154



>gb|KHG05193.1| hypothetical protein F383_30875 [Gossypium arboreum]
Length=385

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 100/130 (77%), Gaps = 2/130 (2%)
 Frame = -3

Query  385  SDDTRRQL-AHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGV  209
            ++ TRR L    K Y GPC A NPIDRCWRC+ NWA NR+RLA C +GFG K  GGK G 
Sbjct  13   TNSTRRSLRGKHKKYTGPCMAINPIDRCWRCKKNWAKNRKRLAKCVLGFGHKTRGGKKGE  72

Query  208  LYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQ  32
             Y+V D+SDD   NPKPGTLRHAVIQK+PLWIIF+ DMNI+L++EL++QS KTIDGRG  
Sbjct  73   YYLVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSKELMVQSHKTIDGRGVN  132

Query  31   VHVSGGAGIT  2
            VH++ G GIT
Sbjct  133  VHIAYGCGIT  142



>ref|XP_009757256.1| PREDICTED: pectate lyase [Nicotiana sylvestris]
 sp|P40972.1|PLY_TOBAC RecName: Full=Pectate lyase; Flags: Precursor [Nicotiana tabacum]
 emb|CAA47630.1| pectate lyase [Nicotiana tabacum]
 emb|CAA43414.1| pectate lyase [Nicotiana tabacum]
Length=397

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 101/124 (81%), Gaps = 2/124 (2%)
 Frame = -3

Query  373  RRQLAHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVN  194
            RRQL+++K Y GPC A N ID+CWRC PNWA NR+++ADC +GFG  AIGGK G +YVV 
Sbjct  30   RRQLSNKK-YKGPCRAENAIDKCWRCDPNWAENRQKMADCALGFGSNAIGGKLGRIYVVT  88

Query  193  DHSDDP-SNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSG  17
            D+SDD   +PKPGTLR+ VIQK+PLWIIF ++M I+L++ELI+ S+KTIDGRGF VH+  
Sbjct  89   DNSDDDVVDPKPGTLRYGVIQKEPLWIIFGKNMKIKLSRELIVTSNKTIDGRGFNVHIQN  148

Query  16   GAGI  5
            GAGI
Sbjct  149  GAGI  152



>ref|XP_009126031.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
Length=481

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 131/229 (57%), Gaps = 28/229 (12%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKT---  434
            MF    A ++P+I  +++E DE W +R  EA E  L+ +  +P  V   F++  +     
Sbjct  10   MFTFYIAGLIPTIRANLSELDEYWSKRAGEAREFTLQAYHSNPYEVVDHFHERHYDNSTD  69

Query  433  LLESKNEPDRKKFVNGSDD-----------TRRQLAHR-------------KPYNGPCNA  326
            + E++ + D +K     DD           TRR L  +                 GPC A
Sbjct  70   VKETEEDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKPKGKGKGKRKGKWSKLKGPCTA  129

Query  325  TNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLR  149
            +NPID+CWRC+ NWA  R+ L  C  GFG   IGGK G +YVV  + D D  NPKPGTLR
Sbjct  130  SNPIDKCWRCRSNWAKRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNLDEDMVNPKPGTLR  189

Query  148  HAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            HAVIQK+PLWIIF  DM+IRL+QEL++ S KTID RG  VH++ GAGIT
Sbjct  190  HAVIQKEPLWIIFKNDMHIRLSQELMICSFKTIDARGADVHIAHGAGIT  238



>emb|CDY66593.1| BnaCnng51570D [Brassica napus]
Length=499

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/251 (41%), Positives = 138/251 (55%), Gaps = 47/251 (19%)
 Frame = -3

Query  619  INCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDP------------  476
            +   C+F +  A ++P+I  +I+E DE W QR  EA E  L+ +  DP            
Sbjct  7    LKLMCVFCI--AGLIPTIRANISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHY  64

Query  475  ----------------SNVSAAFNDEVHKTLL-------ESKNEPDRKKFV----NGSDD  377
                            ++V+A   D  + T +        +K E +R + +    N  + 
Sbjct  65   DNSTDDTTTEEHSSNSADVTATAEDSSNSTDVTATEEDSSTKPEEERTEVIEMVGNSKNS  124

Query  376  TRRQLAHRKPYNG-----PCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHG  212
            TRR L  +          PC A+NPID+CWRC+ NWAN R++LA C  GFG    GGK G
Sbjct  125  TRRSLKGKGKGKWSKLKGPCTASNPIDKCWRCRSNWANRRKKLAKCVRGFGHGTTGGKRG  184

Query  211  VLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGF  35
             +YVV  + D D  NP PGTLRHAVIQK+PLWIIF  DM+IRL+QEL++ SDKTID RG 
Sbjct  185  RIYVVTSNLDEDMVNPIPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLVNSDKTIDARGA  244

Query  34   QVHVSGGAGIT  2
             VH++ GAGIT
Sbjct  245  DVHIAHGAGIT  255



>ref|XP_009125036.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 7 [Brassica 
rapa]
Length=470

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 127/218 (58%), Gaps = 19/218 (9%)
 Frame = -3

Query  598  LVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE--  425
            ++  A ++P++  ++AE DE W  +  EA    L  + PDP  +   F++  +    +  
Sbjct  10   VICIASLIPTLRANVAETDEYWVTKANEARRRTLMAYHPDPYQIVDHFHERHYDNSTDVE  69

Query  424  ------SKNEPDRKKFVNGSDDTRRQLAHR----------KPYNGPCNATNPIDRCWRCQ  293
                  S+ E D +   + ++ TRR                   GPC A+NPID+CWRCQ
Sbjct  70   EMEENASEEEDDIEMISSATNSTRRSYLRGRGKGKGRGKWSKLKGPCTASNPIDKCWRCQ  129

Query  292  PNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWI  116
            P+WA  R++L  C  GFG K  GGK G +YVV  + DD + NP+PGTLRHAVIQ +PLWI
Sbjct  130  PDWARRRKKLVKCVRGFGYKTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEPLWI  189

Query  115  IFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            IF  DM+IRL QEL++ S KTID RG  VH++ GAGIT
Sbjct  190  IFKHDMSIRLCQELMINSHKTIDARGTNVHIAYGAGIT  227



>ref|XP_002436463.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
 gb|EER87830.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
Length=465

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 113/178 (63%), Gaps = 14/178 (8%)
 Frame = -3

Query  541  EVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQL  362
            E W +R   A  +    +E DP  V   FND V + +  S   P R +         R L
Sbjct  54   EYWAERAEVAHAYNRAAYESDPVGVMDRFNDGVRRAMETST--PTRSR--------SRSL  103

Query  361  AHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD  182
            AH K   GPC ATNPID+CWRC+ +WA NR+RLA CGMGFG +  GG  G +YVV D SD
Sbjct  104  AH-KARGGPCTATNPIDQCWRCRGDWARNRKRLARCGMGFGHRTTGGLAGRIYVVTDPSD  162

Query  181  DPSN---PKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHVSG  17
            +P+N   P+ GTLR+AVIQ +PLWI F+RDM I L +EL++ SDKTIDGRG QVHV G
Sbjct  163  EPANLVVPRKGTLRYAVIQDRPLWITFARDMVINLCRELLVTSDKTIDGRGAQVHVVG  220



>ref|XP_006573090.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=448

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 123/214 (57%), Gaps = 30/214 (14%)
 Frame = -3

Query  601  FLVTFAIILPSISGHIAE----W---------DEVWQQRKIEAWEHALKTFEPDPSNVSA  461
             L    +++P++  ++ E    W         D  WQ+R   A +   + +  DP +++ 
Sbjct  9    LLTCLVVMIPTLYANVKEDEAYWKRQSEVLLVDSYWQERASIAEKENQQAYTSDPYSLTK  68

Query  460  AFNDEVHKTLLESKNEPDRKKFVNGSDDTRRQLAHRKPYNGPCNATNPIDRCWRCQPNWA  281
                 V + ++  K+                   + +   G C ATNPIDRCWRC PNWA
Sbjct  69   NLTFSVSEIIIGEKS----------------GRRNLRGRGGKCMATNPIDRCWRCDPNWA  112

Query  280  NNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSR  104
            NNR++LADC  GFGR  IGGK+G  YVVN   D D  NP PGTLRHAV +  PLWIIF+R
Sbjct  113  NNRKKLADCVQGFGRNTIGGKNGPFYVVNSSLDNDMVNPAPGTLRHAVTRSGPLWIIFAR  172

Query  103  DMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
             MNIRL+QELIM SDKTIDGRG  V+++ GAGIT
Sbjct  173  SMNIRLSQELIMTSDKTIDGRGVDVYIANGAGIT  206



>ref|XP_009121613.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX69550.1| BnaA10g18990D [Brassica napus]
Length=499

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 102/251 (41%), Positives = 134/251 (53%), Gaps = 47/251 (19%)
 Frame = -3

Query  619  INCFCMFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDP------------  476
            +   C+F +  A ++P+I  +I+E DE W QR  EA E  L+ +  DP            
Sbjct  7    LKLMCVFCI--AGLIPTIKANISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHY  64

Query  475  ----------------SNVSAAFNDEVHKTLLESKNEPDRKK-----------FVNGSDD  377
                            ++V+A   D  + T + +  E    K             N  + 
Sbjct  65   DNSTDDTTTEEHSSNSTDVTATEEDNSNSTDVTATEEDSSTKPEEEGTEVIEMVGNSKNS  124

Query  376  TRRQLAHRKPYNG-----PCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHG  212
            TRR L  +          PC A+NPID+CWRC+ NWAN R++LA C  GFG    GGK G
Sbjct  125  TRRSLKGKGKGKWSKLKGPCTASNPIDKCWRCRSNWANRRKKLAKCVRGFGHGTTGGKRG  184

Query  211  VLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGF  35
             +YVV  + D D  NP PGTLRHAVIQK+PLWIIF  DM+IRL+QEL++ SDKTID RG 
Sbjct  185  RIYVVTSNLDEDMVNPIPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLVNSDKTIDARGA  244

Query  34   QVHVSGGAGIT  2
             VH++ GAGIT
Sbjct  245  DVHIAHGAGIT  255



>emb|CDX91953.1| BnaC03g32550D [Brassica napus]
Length=471

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 131/217 (60%), Gaps = 18/217 (8%)
 Frame = -3

Query  598  LVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE--  425
            ++  A ++P++  ++AE D+ W +   EA +  L  + PDP  +   F++  +    +  
Sbjct  12   VICIASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHYDNSTDVE  71

Query  424  ------SKNEPDRKKFVNGSDDTRRQLAHR---------KPYNGPCNATNPIDRCWRCQP  290
                  S+ E D +   + ++ TRR L  R             GPC A+NPID+CWRCQP
Sbjct  72   ETEEHASEEEDDIEMSSSPTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCWRCQP  131

Query  289  NWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWII  113
            +WA  R++L  C  GFG +  GGK G +YVV  + DD + NP+PGTLRHAVIQ +PLWII
Sbjct  132  DWARRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEPLWII  191

Query  112  FSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            F  DM+IRL+QEL++ S KTID RG  VH++ GAGIT
Sbjct  192  FKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGIT  228



>emb|CDX74293.1| BnaA03g27540D [Brassica napus]
Length=471

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 131/217 (60%), Gaps = 18/217 (8%)
 Frame = -3

Query  598  LVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE--  425
            ++  A ++P++  ++AE D+ W +   EA +  L  + PDP  +   F++  +    +  
Sbjct  12   VICIASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHYDNSTDVE  71

Query  424  ------SKNEPDRKKFVNGSDDTRRQLAHR---------KPYNGPCNATNPIDRCWRCQP  290
                  S+ E D +   + ++ TRR L  R             GPC A+NPID+CWRCQP
Sbjct  72   ETEEHASEEEDDIEMSSSLTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCWRCQP  131

Query  289  NWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWII  113
            +WA  R++L  C  GFG +  GGK G +YVV  + DD + NP+PGTLRHAVIQ +PLWII
Sbjct  132  DWARRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEPLWII  191

Query  112  FSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            F  DM+IRL+QEL++ S KTID RG  VH++ GAGIT
Sbjct  192  FKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGIT  228



>ref|XP_009134622.1| PREDICTED: probable pectate lyase 7 [Brassica rapa]
Length=471

 Score =   175 bits (443),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 131/217 (60%), Gaps = 18/217 (8%)
 Frame = -3

Query  598  LVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLE--  425
            ++  A ++P++  ++AE D+ W +   EA +  L  + PDP  +   F++  +    +  
Sbjct  12   VICIASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHYDNSTDVE  71

Query  424  ------SKNEPDRKKFVNGSDDTRRQLAHR---------KPYNGPCNATNPIDRCWRCQP  290
                  S+ E D +   + ++ TRR L  R             GPC A+NPID+CWRCQP
Sbjct  72   ETEEHASEEEDDIEMSSSLTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCWRCQP  131

Query  289  NWANNRRRLADCGMGFGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWII  113
            +WA  R++L  C  GFG +  GGK G +YVV  + DD + NP+PGTLRHAVIQ +PLWII
Sbjct  132  DWARRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEPLWII  191

Query  112  FSRDMNIRLNQELIMQSDKTIDGRGFQVHVSGGAGIT  2
            F  DM+IRL+QEL++ S KTID RG  VH++ GAGIT
Sbjct  192  FKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGIT  228



>ref|NP_001046281.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAD25039.1| putative pectate lyase precursor [Oryza sativa Japonica Group]
 dbj|BAF08195.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAG94880.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   174 bits (441),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 120/188 (64%), Gaps = 17/188 (9%)
 Frame = -3

Query  556  IAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLESKNEPDRKKFVNGSDD  377
            I E+DE W++R+  A   A + ++PDP NV+  FN  V ++                   
Sbjct  33   IGEFDEHWEKRRAAAEAAAEEVYKPDPFNVTNEFNHAVIRSTERGV--------------  78

Query  376  TRRQLAHR-KPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGGKHGVLYV  200
             RR+L+ +   Y GPC ATNPIDRCWRC+ +WA +R+RLA C MGFGR A GG  G +YV
Sbjct  79   LRRELSGKNSKYKGPCLATNPIDRCWRCRKDWATDRKRLARCAMGFGRGATGGVRGKIYV  138

Query  199  VNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDGRGFQVHV  23
            V D  D D +NP+ GTLR   +Q  PLWI F++ M IRL QEL++ SDKTIDGRG QVH+
Sbjct  139  VTDPGDGDAANPRYGTLRWGAMQAAPLWITFAKSMVIRLTQELLVASDKTIDGRGAQVHI  198

Query  22   S-GGAGIT  2
            + GGAGIT
Sbjct  199  ARGGAGIT  206



>ref|XP_010420165.1| PREDICTED: probable pectate lyase 19 isoform X3 [Camelina sativa]
Length=506

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 101/254 (40%), Positives = 133/254 (52%), Gaps = 53/254 (21%)
 Frame = -3

Query  604  MFLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFND--------  449
            MF+   A ++P+I G+I+E DE W +R  EA E  L+ +  DP  +   F++        
Sbjct  10   MFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  448  -----EVHKTLLESKN---EPDR------------------------KKFVNGSDDTRRQ  365
                 E     LE ++   +P+                         K   N +  TRR 
Sbjct  70   ATETEEDGAVQLEEEHGGAQPEEEHSGAQLEEEHGGAKPEEEEEEGIKMVGNSTKSTRRS  129

Query  364  L------------AHRKPYNGPCNATNPIDRCWRCQPNWANNRRRLADCGMGFGRKAIGG  221
            L                   GPC A+NPID+CWRC+ NWA  R++L  C  GFG +  GG
Sbjct  130  LRGKGKGKWSKGKGKWSKLKGPCTASNPIDKCWRCRTNWAKRRKKLTRCVRGFGHRTTGG  189

Query  220  KHGVLYVVNDHSD-DPSNPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIMQSDKTIDG  44
            K G +YVV  + D D  NPKPGTLRHAVIQK+PLWIIF  DM+IRL+QEL++ S KTID 
Sbjct  190  KRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLINSHKTIDA  249

Query  43   RGFQVHVSGGAGIT  2
            RG  VH++ GAGIT
Sbjct  250  RGANVHIAHGAGIT  263



>gb|KHN45481.1| Putative pectate lyase 3 [Glycine soja]
Length=379

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 129/202 (64%), Gaps = 17/202 (8%)
 Frame = -3

Query  601  FLVTFAIILPSISGHIAEWDEVWQQRKIEAWEHALKTFEPDPSNVSAAFNDEVHKTLLES  422
             LVTFAI++P +   IAE+D+  + +  EA + AL+ + P P +V+   N  VH +L  S
Sbjct  12   LLVTFAIVIPCLEAGIAEFDDFLKAQADEAQKIALEAYVPVPEDVTDELNFHVHLSLENS  71

Query  421  KNEPDRKKFVNGSDDTRRQLAHRKPYNGP-CNATNPIDRCWRCQPNWANNRRRLADCGMG  245
                           TRR+L  RK  +G  C A+NPID CWRC  NWAN+R RLA CG G
Sbjct  72   ---------------TRRELRQRKGRSGKKCVASNPIDTCWRCNKNWANDRYRLAKCGKG  116

Query  244  FGRKAIGGKHGVLYVVNDHSDDPS-NPKPGTLRHAVIQKKPLWIIFSRDMNIRLNQELIM  68
            FGR A GG  G +YVV D+SDD   NPKPGT+RHAV Q+ PLWIIF R M I+LNQEL++
Sbjct  117  FGRGARGGLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQRGPLWIIFQRSMMIKLNQELMI  176

Query  67   QSDKTIDGRGFQVHVSGGAGIT  2
             SDKTIDGRG  V    GAG+T
Sbjct  177  SSDKTIDGRGANVVFRDGAGLT  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117891235824