BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1457_g1_i1 len=2289 path=[1:0-713 715:714-2283 2285:2284-2288]

Length=2289
                                                                      Score     E

emb|CDP01856.1|  unnamed protein product                                365   1e-112   
ref|XP_009759466.1|  PREDICTED: la-related protein 1C-like              337   6e-102   
ref|XP_009599727.1|  PREDICTED: la-related protein 1C-like              333   1e-100   
ref|XP_006361948.1|  PREDICTED: uncharacterized HTH La-type RNA-b...    333   1e-100   
ref|XP_009587443.1|  PREDICTED: la-related protein 1C-like              327   2e-98    
ref|XP_004233568.1|  PREDICTED: la-related protein 1C isoform X1        325   3e-97    
ref|XP_006361949.1|  PREDICTED: uncharacterized HTH La-type RNA-b...    318   8e-95    
ref|XP_010317249.1|  PREDICTED: la-related protein 1C isoform X2        309   2e-91    
ref|XP_010317248.1|  PREDICTED: la-related protein 1C-like              307   2e-91    
ref|XP_009780990.1|  PREDICTED: la-related protein 1C-like              307   3e-91    
ref|XP_006361946.1|  PREDICTED: la-related protein-like                 304   1e-89    
ref|XP_006361945.1|  PREDICTED: la-related protein-like                 301   2e-89    
ref|XP_011078964.1|  PREDICTED: la-related protein 1B                   270   8e-78    
ref|XP_010646870.1|  PREDICTED: la-related protein 1C isoform X1        263   2e-74    
ref|XP_010646872.1|  PREDICTED: la-related protein 1C isoform X2        257   4e-72    
ref|XP_010266852.1|  PREDICTED: la-related protein 1C-like              248   6e-69    
ref|XP_006467003.1|  PREDICTED: uncharacterized serine-rich prote...    243   1e-67    
ref|XP_008242034.1|  PREDICTED: la-related protein 1C-like              243   5e-67    
ref|XP_008337981.1|  PREDICTED: la-related protein 1C                   242   5e-67    
gb|KDO71314.1|  hypothetical protein CISIN_1g039779mg                   240   5e-67    
ref|XP_007204320.1|  hypothetical protein PRUPE_ppa003845mg             240   3e-66    
ref|XP_009363455.1|  PREDICTED: la-related protein 1C-like              237   3e-65    
ref|XP_007046622.1|  Winged-helix DNA-binding transcription facto...    236   1e-64    
ref|XP_008393834.1|  PREDICTED: la-related protein 1C                   236   1e-64    
ref|XP_010266025.1|  PREDICTED: la-related protein 1C-like isofor...    234   9e-64    
ref|XP_006383055.1|  La domain-containing family protein                230   2e-62    
ref|XP_011043135.1|  PREDICTED: la-related protein 1C                   220   6e-59    
ref|XP_010266026.1|  PREDICTED: la-related protein 1C-like isofor...    220   7e-59    
ref|XP_004134845.1|  PREDICTED: uncharacterized protein LOC101218665    219   1e-58    
ref|XP_004165603.1|  PREDICTED: uncharacterized LOC101218665            215   6e-57    
ref|XP_008440860.1|  PREDICTED: la-related protein 1C                   214   6e-57    
ref|XP_006425387.1|  hypothetical protein CICLE_v10025634mg             206   6e-55    
gb|KDP23970.1|  hypothetical protein JCGZ_25358                         207   6e-55    
ref|XP_008440861.1|  PREDICTED: la-related protein 1C-like              209   7e-55    
ref|XP_010548255.1|  PREDICTED: la-related protein 1C isoform X1        207   1e-54    
gb|KHG05772.1|  La-related 1B                                           207   2e-54    
ref|XP_002310700.2|  hypothetical protein POPTR_0007s08650g             207   2e-54    Populus trichocarpa [western balsam poplar]
ref|XP_010548258.1|  PREDICTED: la-related protein 1C isoform X3        206   3e-54    
ref|XP_004165604.1|  PREDICTED: uncharacterized LOC101218903            204   1e-53    
ref|XP_004134846.1|  PREDICTED: uncharacterized protein LOC101218903    204   1e-53    
emb|CBI19921.3|  unnamed protein product                                202   1e-52    
ref|XP_002279250.2|  PREDICTED: la-related protein 1C-like              202   1e-52    Vitis vinifera
emb|CDY24825.1|  BnaA08g14850D                                          201   1e-52    
gb|EYU18067.1|  hypothetical protein MIMGU_mgv1a005127mg                200   2e-52    
ref|XP_009109261.1|  PREDICTED: la-related protein 1C-like              200   3e-52    
ref|XP_008809436.1|  PREDICTED: la-related protein 1C-like              197   1e-50    
gb|KHG19339.1|  La-related 1B                                           194   2e-50    
ref|XP_010933359.1|  PREDICTED: la-related protein 1C-like              192   1e-49    
ref|XP_003519856.1|  PREDICTED: la-related protein 1-like               192   1e-49    
ref|XP_011011173.1|  PREDICTED: la-related protein 1C-like isofor...    191   2e-49    
ref|XP_007156194.1|  hypothetical protein PHAVU_003G266200g             191   2e-49    
emb|CDY62050.1|  BnaC03g76880D                                          191   2e-49    
ref|XP_003516540.1|  PREDICTED: la-related protein-like isoform X1      191   2e-49    
ref|XP_006412048.1|  hypothetical protein EUTSA_v10024905mg             191   4e-49    
ref|XP_006590733.1|  PREDICTED: la-related protein-like isoform X2      187   7e-48    
ref|XP_002869052.1|  La domain-containing protein                       184   7e-47    
ref|XP_003538889.1|  PREDICTED: la-related protein-like isoform X1      184   1e-46    
ref|XP_004509397.1|  PREDICTED: uncharacterized protein LOC101504108    182   3e-46    
ref|XP_010920098.1|  PREDICTED: la-related protein 1C                   182   7e-46    
ref|XP_006283537.1|  hypothetical protein CARUB_v10004587mg             179   3e-45    
gb|KHN00450.1|  La-related protein 1                                    176   4e-45    
ref|XP_004512173.1|  PREDICTED: la-related protein-like                 178   7e-45    
ref|NP_567991.1|  La-related protein 1C                                 177   2e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003612233.1|  ATP synthase subunit a chloroplastic               178   5e-44    
gb|KHN35543.1|  La-related protein 1                                    170   1e-43    
ref|XP_003548829.1|  PREDICTED: trithorax group protein osa-like        173   3e-43    
gb|KGN48944.1|  hypothetical protein Csa_6G507180                       169   6e-43    
ref|XP_007157876.1|  hypothetical protein PHAVU_002G105500g             172   9e-43    
ref|XP_009418686.1|  PREDICTED: la-related protein 1C-like isofor...    170   1e-42    
ref|XP_010432215.1|  PREDICTED: la-related protein 1C-like              171   3e-42    
ref|XP_010029642.1|  PREDICTED: la-related protein 1B-like              171   4e-42    
ref|XP_007017875.1|  Winged-helix DNA-binding transcription facto...    171   5e-42    
ref|XP_010680405.1|  PREDICTED: la-related protein 1C-like              170   7e-42    
ref|XP_010446861.1|  PREDICTED: la-related protein 1C isoform X1        170   8e-42    
ref|XP_010437404.1|  PREDICTED: la-related protein 1C-like              169   9e-42    
ref|XP_008806121.1|  PREDICTED: la-related protein 1C-like              170   1e-41    
gb|KHN36006.1|  La-related protein 1                                    164   2e-41    
emb|CDP07362.1|  unnamed protein product                                169   2e-41    
ref|XP_010531117.1|  PREDICTED: la-related protein 1C-like isofor...    167   3e-41    
gb|KHN09066.1|  La-related protein 1B                                   167   4e-41    
ref|XP_004292934.1|  PREDICTED: uncharacterized protein LOC101305142    168   5e-41    
ref|XP_009418695.1|  PREDICTED: la-related protein 1C-like isofor...    165   5e-41    
ref|XP_004287781.1|  PREDICTED: uncharacterized protein LOC101290802    163   6e-41    
ref|XP_009138389.1|  PREDICTED: la-related protein 1C-like              166   7e-41    
ref|XP_010113302.1|  hypothetical protein L484_026632                   163   1e-40    
emb|CDX69180.1|  BnaC01g02730D                                          165   2e-40    
emb|CDY47040.1|  BnaAnng08280D                                          165   2e-40    
gb|KGN48946.1|  hypothetical protein Csa_6G507200                       159   6e-40    
ref|XP_010531116.1|  PREDICTED: la-related protein 1C-like isofor...    163   1e-39    
ref|XP_003527653.1|  PREDICTED: leucine-rich repeat extensin-like...    162   2e-39    
ref|XP_010941333.1|  PREDICTED: LOW QUALITY PROTEIN: la-related p...    162   3e-39    
ref|XP_009334716.1|  PREDICTED: la-related protein 1C-like              162   6e-39    
ref|XP_008359756.1|  PREDICTED: la-related protein 1C-like              160   2e-38    
ref|XP_006573541.1|  PREDICTED: la-related protein-like isoform X2      157   5e-38    
gb|KEH27598.1|  ATP synthase, A subunit                                 155   8e-38    
ref|XP_007226751.1|  hypothetical protein PRUPE_ppa018923mg             158   9e-38    
ref|XP_010547410.1|  PREDICTED: la-related protein 1B-like              155   3e-37    
ref|XP_009384001.1|  PREDICTED: LOW QUALITY PROTEIN: la-related p...    155   5e-37    
ref|XP_010095554.1|  La-related protein 1B                              155   9e-37    
ref|XP_004238379.1|  PREDICTED: la-related protein 1C                   153   4e-36    
ref|XP_003612234.1|  ATP synthase subunit a chloroplastic               153   4e-36    
emb|CAN73670.1|  hypothetical protein VITISV_031857                     151   5e-36    Vitis vinifera
ref|XP_008221222.1|  PREDICTED: la-related protein 1C-like              152   8e-36    
ref|XP_006577960.1|  PREDICTED: la-related protein-like                 152   8e-36    
ref|XP_006342071.1|  PREDICTED: la-related protein 1-like               152   1e-35    
ref|XP_010666913.1|  PREDICTED: la-related protein 1C-like              151   1e-35    
ref|XP_009380210.1|  PREDICTED: la-related protein 1B-like              150   2e-35    
ref|XP_002531141.1|  lupus la ribonucleoprotein, putative               150   2e-35    Ricinus communis
gb|KFK30224.1|  hypothetical protein AALP_AA7G233700                    151   2e-35    
ref|XP_007160637.1|  hypothetical protein PHAVU_001G004100g             150   5e-35    
ref|XP_006596535.1|  PREDICTED: leucine-rich repeat extensin-like...    149   9e-35    
ref|XP_003544386.1|  PREDICTED: leucine-rich repeat extensin-like...    148   1e-34    
ref|XP_010550483.1|  PREDICTED: la-related protein 1B                   140   2e-34    
emb|CDX75537.1|  BnaA01g01650D                                          147   2e-34    
ref|XP_009148977.1|  PREDICTED: la-related protein 1C-like              147   3e-34    
ref|NP_201411.2|  LA RELATED PROTEIN 1B                                 145   1e-33    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009401898.1|  PREDICTED: la-related protein 1B-like isofor...    144   3e-33    
ref|XP_009401897.1|  PREDICTED: la-related protein 1C-like isofor...    144   7e-33    
ref|XP_006473702.1|  PREDICTED: protein enabled homolog                 141   5e-32    
ref|XP_003550435.2|  PREDICTED: la-related protein-like                 140   8e-32    
gb|KDO84933.1|  hypothetical protein CISIN_1g008981mg                   140   8e-32    
ref|XP_006435231.1|  hypothetical protein CICLE_v10000767mg             140   9e-32    
ref|XP_009382039.1|  PREDICTED: la-related protein 1B-like              140   1e-31    
ref|XP_006435232.1|  hypothetical protein CICLE_v10000767mg             140   1e-31    
ref|XP_006435234.1|  hypothetical protein CICLE_v10000767mg             137   1e-31    
gb|KDP36886.1|  hypothetical protein JCGZ_08177                         138   1e-31    
dbj|BAJ53096.1|  JHL20J20.1                                             139   2e-31    
emb|CDX72562.1|  BnaC07g45840D                                          138   2e-31    
ref|XP_006435233.1|  hypothetical protein CICLE_v10000767mg             136   4e-31    
ref|XP_008811609.1|  PREDICTED: la-related protein 1C-like              136   2e-30    
ref|XP_010033527.1|  PREDICTED: la-related protein 1B-like              133   3e-30    
ref|NP_001049009.1|  Os03g0156500                                       134   5e-30    Oryza sativa Japonica Group [Japonica rice]
gb|EAY88604.1|  hypothetical protein OsI_10079                          134   5e-30    Oryza sativa Indica Group [Indian rice]
emb|CDY18588.1|  BnaA09g08070D                                          132   9e-30    
emb|CAA18483.1|  putative protein                                       133   9e-30    Arabidopsis thaliana [mouse-ear cress]
gb|KCW53214.1|  hypothetical protein EUGRSUZ_J02483                     127   1e-29    
ref|XP_004136486.1|  PREDICTED: uncharacterized protein LOC101220887    133   2e-29    
ref|XP_010061089.1|  PREDICTED: la-related protein 1B-like isofor...    132   5e-29    
ref|XP_011011174.1|  PREDICTED: la-related protein 1C-like isofor...    130   6e-29    
gb|KFK28269.1|  hypothetical protein AALP_AA8G494800                    130   6e-29    
ref|XP_009112277.1|  PREDICTED: la-related protein 1B                   129   6e-29    
ref|XP_010465945.1|  PREDICTED: la-related protein 1B-like              130   7e-29    
ref|XP_008466467.1|  PREDICTED: la-related protein 1C-like              131   1e-28    
ref|XP_011074705.1|  PREDICTED: la-related protein 1B-like              130   1e-28    
ref|XP_008807133.1|  PREDICTED: la-related protein 1C-like              129   2e-28    
ref|XP_002866774.1|  hypothetical protein ARALYDRAFT_497006             129   3e-28    
ref|XP_010531118.1|  PREDICTED: la-related protein 1C-like isofor...    128   3e-28    
ref|XP_010446307.1|  PREDICTED: la-related protein 1B-like              128   4e-28    
ref|XP_003629259.1|  La-related protein 1B                              127   9e-28    
ref|XP_009414439.1|  PREDICTED: la-related protein 1B-like isofor...    127   9e-28    
ref|XP_009414437.1|  PREDICTED: la-related protein 1B-like isofor...    127   1e-27    
ref|XP_006280466.1|  hypothetical protein CARUB_v10026401mg             126   1e-27    
gb|AES59797.2|  LA-related protein 6 LA RNA-binding domain protein      127   2e-27    
ref|XP_009619448.1|  PREDICTED: la-related protein 1C-like              126   4e-27    
gb|KHN12624.1|  La-related protein 1B                                   123   1e-26    
ref|XP_002510581.1|  lupus la ribonucleoprotein, putative               123   1e-26    Ricinus communis
ref|XP_009769236.1|  PREDICTED: la-related protein 1C-like              124   2e-26    
ref|XP_006842028.1|  hypothetical protein AMTR_s00203p00014740          122   5e-26    
ref|XP_004499300.1|  PREDICTED: uncharacterized protein DDB_G0271...    122   6e-26    
gb|KHN45947.1|  La-related protein 1B                                   121   1e-25    
ref|XP_009393945.1|  PREDICTED: la-related protein 1B-like              121   1e-25    
ref|XP_004985649.1|  PREDICTED: la-related protein-like                 119   4e-25    
ref|XP_009757102.1|  PREDICTED: la-related protein 1C-like              120   4e-25    
ref|XP_009605222.1|  PREDICTED: la-related protein 1C-like              119   1e-24    
ref|XP_011003070.1|  PREDICTED: la-related protein 1B-like              117   2e-24    
tpg|DAA43433.1|  TPA: hypothetical protein ZEAMMB73_264797              116   3e-24    
ref|XP_008651177.1|  PREDICTED: la-related protein 1B-like isofor...    116   4e-24    
ref|XP_002468481.1|  hypothetical protein SORBIDRAFT_01g046660          114   1e-23    Sorghum bicolor [broomcorn]
dbj|BAB10415.1|  unnamed protein product                                114   2e-23    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002299786.2|  hypothetical protein POPTR_0001s22740g             114   8e-23    Populus trichocarpa [western balsam poplar]
ref|XP_004980963.1|  PREDICTED: transcription activator BRG1-like       112   8e-23    
ref|XP_006652050.1|  PREDICTED: pollen-specific leucine-rich repe...    111   9e-23    
ref|XP_006836151.1|  hypothetical protein AMTR_s00101p00028940          114   9e-23    
ref|XP_010484684.1|  PREDICTED: la-related protein 1B-like              110   9e-23    
ref|XP_010229179.1|  PREDICTED: la-related protein 1B-like isofor...    112   1e-22    
ref|XP_008651176.1|  PREDICTED: la-related protein 1C-like isofor...    111   1e-22    
ref|XP_011006050.1|  PREDICTED: la-related protein 1A isoform X1        113   2e-22    
ref|XP_011006051.1|  PREDICTED: la-related protein 1A isoform X2        113   2e-22    
ref|XP_002299785.2|  hypothetical protein POPTR_0001s22740g             112   3e-22    Populus trichocarpa [western balsam poplar]
gb|KHG10712.1|  La-related 1                                            112   6e-22    
ref|XP_002272083.3|  PREDICTED: la-related protein 1A                   111   9e-22    Vitis vinifera
ref|XP_007016697.1|  Lupus la ribonucleoprotein, putative isoform 4     110   1e-21    
emb|CAN73529.1|  hypothetical protein VITISV_006639                     110   2e-21    Vitis vinifera
ref|XP_009126508.1|  PREDICTED: la-related protein 1A-like              110   2e-21    
ref|XP_002313496.2|  hypothetical protein POPTR_0009s02330g             110   2e-21    Populus trichocarpa [western balsam poplar]
ref|XP_010229178.1|  PREDICTED: la-related protein 1B-like isofor...    108   2e-21    
ref|NP_001146038.1|  uncharacterized protein LOC100279569               107   2e-21    Zea mays [maize]
ref|XP_010229180.1|  PREDICTED: la-related protein 1B-like isofor...    107   2e-21    
ref|XP_007016695.1|  Lupus la ribonucleoprotein, putative isoform 2     109   3e-21    
ref|XP_007016696.1|  Lupus la ribonucleoprotein, putative isoform 3     109   4e-21    
gb|KEH40236.1|  LA-related protein 6 LA RNA-binding domain protein      107   4e-21    
ref|XP_007016694.1|  Lupus la ribonucleoprotein, putative isoform 1     108   5e-21    
ref|XP_006446392.1|  hypothetical protein CICLE_v10014180mg             108   6e-21    
ref|XP_010270255.1|  PREDICTED: la-related protein 1B-like              107   6e-21    
ref|XP_011003847.1|  PREDICTED: la-related protein 1A-like isofor...    106   6e-21    
ref|XP_010943274.1|  PREDICTED: la-related protein 1A-like isofor...    108   6e-21    
gb|KDO66353.1|  hypothetical protein CISIN_1g008506mg                   105   7e-21    
ref|XP_011003848.1|  PREDICTED: la-related protein 1A-like isofor...    106   8e-21    
ref|XP_010943270.1|  PREDICTED: la-related protein 1A-like isofor...    108   8e-21    
ref|NP_001051966.1|  Os03g0859300                                       105   9e-21    Oryza sativa Japonica Group [Japonica rice]
gb|ABG00009.1|  La domain containing protein, expressed                 105   9e-21    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010251686.1|  PREDICTED: la-related protein 1A                   108   9e-21    
ref|XP_010943269.1|  PREDICTED: la-related protein 1A-like isofor...    108   1e-20    
ref|XP_009402440.1|  PREDICTED: la-related protein 1A-like isofor...    108   1e-20    
ref|XP_010943271.1|  PREDICTED: la-related protein 1A-like isofor...    108   1e-20    
ref|XP_010943273.1|  PREDICTED: la-related protein 1A-like isofor...    107   1e-20    
gb|KDO66352.1|  hypothetical protein CISIN_1g008506mg                   106   1e-20    
ref|XP_008805342.1|  PREDICTED: LOW QUALITY PROTEIN: la-related p...    107   1e-20    
ref|XP_006446391.1|  hypothetical protein CICLE_v10014180mg             107   1e-20    
ref|XP_008385592.1|  PREDICTED: la-related protein 1A                   107   1e-20    
ref|XP_009350498.1|  PREDICTED: la-related protein 1A-like              107   2e-20    
ref|XP_009402441.1|  PREDICTED: la-related protein 1A-like isofor...    107   2e-20    
ref|XP_006470432.1|  PREDICTED: la-related protein 1B-like              107   2e-20    
ref|XP_001269282.1|  La domain family                                   106   2e-20    Aspergillus clavatus NRRL 1
ref|XP_010268999.1|  PREDICTED: la-related protein 1B-like              105   2e-20    
ref|XP_002519615.1|  lupus la ribonucleoprotein, putative               106   2e-20    Ricinus communis
ref|XP_002463470.1|  hypothetical protein SORBIDRAFT_01g000420          104   2e-20    Sorghum bicolor [broomcorn]
ref|XP_001264789.1|  La domain family                                   106   3e-20    Aspergillus fischeri NRRL 181
ref|XP_010943673.1|  PREDICTED: la-related protein 1A-like isofor...    106   3e-20    
ref|XP_010064987.1|  PREDICTED: la-related protein 1B-like              105   3e-20    
ref|XP_008804063.1|  PREDICTED: la-related protein 1A-like isofor...    106   3e-20    
ref|XP_008804064.1|  PREDICTED: la-related protein 1A-like isofor...    106   3e-20    
ref|XP_008804065.1|  PREDICTED: la-related protein 1A-like isofor...    106   3e-20    
ref|XP_008804066.1|  PREDICTED: la-related protein 1A-like isofor...    106   3e-20    
ref|XP_010943672.1|  PREDICTED: la-related protein 1A-like isofor...    106   4e-20    
emb|CBI24386.3|  unnamed protein product                                105   5e-20    
gb|KDO84934.1|  hypothetical protein CISIN_1g008981mg                   103   5e-20    
gb|EYU46157.1|  hypothetical protein MIMGU_mgv1a000957mg                105   6e-20    
ref|XP_011090202.1|  PREDICTED: la-related protein 1A-like              105   7e-20    
emb|CDP09681.1|  unnamed protein product                                105   7e-20    
gb|KCW70527.1|  hypothetical protein EUGRSUZ_F03731                     103   8e-20    
emb|CDX81414.1|  BnaC09g08250D                                        99.0    8e-20    
ref|XP_009416371.1|  PREDICTED: la-related protein 1A                   105   1e-19    
ref|XP_752344.1|  La domain family                                      104   1e-19    Aspergillus fumigatus Af293
ref|XP_002889049.1|  hypothetical protein ARALYDRAFT_895473           96.7    1e-19    
gb|KDP46005.1|  hypothetical protein JCGZ_14912                         104   2e-19    
ref|XP_002560965.1|  Pc16g06290                                         103   2e-19    Penicillium rubens Wisconsin 54-1255
gb|KEY76231.1|  hypothetical protein BA78_4655                          103   2e-19    
ref|XP_003603810.1|  La-related protein 1B                              102   2e-19    
ref|XP_006347270.1|  PREDICTED: la-related protein 1-like               103   2e-19    
ref|XP_011080478.1|  PREDICTED: la-related protein 1A                   103   3e-19    
ref|XP_009591974.1|  PREDICTED: la-related protein 1A                   102   4e-19    
gb|EYU35969.1|  hypothetical protein MIMGU_mgv1a001057mg                102   4e-19    
gb|KHG06515.1|  La-related                                              102   4e-19    
ref|XP_001623976.1|  predicted protein                                97.4    6e-19    Nematostella vectensis
emb|CDM30230.1|  Winged helix-turn-helix transcription repressor ...    102   6e-19    
ref|XP_005650093.1|  hypothetical protein COCSUDRAFT_65296              102   7e-19    
ref|XP_010093802.1|  hypothetical protein L484_022514                   102   7e-19    
ref|XP_010535758.1|  PREDICTED: la-related protein 1A                   101   8e-19    
ref|XP_002455416.1|  hypothetical protein SORBIDRAFT_03g010440          101   1e-18    Sorghum bicolor [broomcorn]
ref|XP_010045127.1|  PREDICTED: la-related protein 1A isoform X2        101   1e-18    
ref|XP_007141559.1|  hypothetical protein PHAVU_008G206300g             101   1e-18    
ref|XP_010689356.1|  PREDICTED: la-related protein 1A isoform X1        101   1e-18    
ref|XP_010689357.1|  PREDICTED: la-related protein 1A isoform X2        101   1e-18    
ref|XP_010045126.1|  PREDICTED: la-related protein 1A isoform X1        101   1e-18    
gb|KGO47504.1|  Winged helix-turn-helix transcription repressor D...    101   2e-18    
ref|NP_001170142.1|  uncharacterized protein LOC100384071             99.0    2e-18    Zea mays [maize]
gb|AES74050.2|  LA-related protein 6 LA RNA-binding domain protein    98.6    2e-18    
gb|KGO61886.1|  Winged helix-turn-helix transcription repressor D...    100   2e-18    
gb|KGO54441.1|  Winged helix-turn-helix transcription repressor D...    100   2e-18    
ref|XP_007208095.1|  hypothetical protein PRUPE_ppa001319mg             100   2e-18    
gb|KGO74150.1|  Winged helix-turn-helix transcription repressor D...    100   2e-18    
ref|XP_009773869.1|  PREDICTED: la-related protein 1A                   100   2e-18    
ref|XP_008645896.1|  PREDICTED: uncharacterized protein LOC100384...  99.0    2e-18    
gb|KFK26365.1|  hypothetical protein AALP_AA8G239200                    100   2e-18    
gb|EPS68153.1|  hypothetical protein M569_06620                       93.6    2e-18    
ref|XP_008231193.1|  PREDICTED: la-related protein 1A isoform X2        100   2e-18    
ref|XP_003545463.1|  PREDICTED: la-related protein 1B-like              100   2e-18    
gb|KHN38429.1|  La-related protein                                      100   2e-18    
ref|XP_006575609.1|  PREDICTED: la-related protein 1B-like              100   2e-18    
ref|XP_009112450.1|  PREDICTED: la-related protein 1C-like isofor...  96.7    3e-18    
ref|XP_004491190.1|  PREDICTED: la-related protein 1-like               100   3e-18    
ref|XP_008231186.1|  PREDICTED: la-related protein 1A isoform X1        100   3e-18    
ref|XP_008668569.1|  PREDICTED: uncharacterized protein LOC100502...  99.0    3e-18    
gb|EAW61633.1|  La ribonucleoprotein domain family, member 1, iso...    100   3e-18    
ref|XP_009448301.1|  PREDICTED: la-related protein 1 isoform X4         100   3e-18    
ref|XP_009448304.1|  PREDICTED: la-related protein 1 isoform X6       99.8    3e-18    
gb|EKV18340.1|  hypothetical protein PDIG_10200                         100   3e-18    
ref|XP_005268461.1|  PREDICTED: la-related protein 1 isoform X1         100   3e-18    
gb|EKV15571.1|  hypothetical protein PDIP_40240                         100   3e-18    
ref|XP_009448298.1|  PREDICTED: la-related protein 1 isoform X1         100   3e-18    
ref|XP_010541709.1|  PREDICTED: la-related protein 1A-like            96.3    3e-18    
dbj|BAC03668.1|  unnamed protein product                              99.8    3e-18    
ref|XP_009448302.1|  PREDICTED: la-related protein 1 isoform X5       99.8    3e-18    
dbj|BAA34451.1|  KIAA0731 protein                                       100   4e-18    
ref|XP_009112449.1|  PREDICTED: la-related protein 1C-like isofor...  97.1    4e-18    
ref|XP_009448299.1|  PREDICTED: la-related protein 1 isoform X2         100   4e-18    
ref|XP_005268464.1|  PREDICTED: la-related protein 1 isoform X4       99.8    4e-18    
ref|XP_009448300.1|  PREDICTED: la-related protein 1 isoform X3         100   4e-18    
ref|XP_008952659.1|  PREDICTED: la-related protein 1 isoform X5       99.8    4e-18    
ref|XP_005268463.1|  PREDICTED: la-related protein 1 isoform X3         100   4e-18    
ref|XP_004042923.1|  PREDICTED: la-related protein 1-like             99.8    4e-18    
ref|XP_006714838.1|  PREDICTED: la-related protein 1 isoform X6       99.8    4e-18    
ref|XP_008952658.1|  PREDICTED: la-related protein 1 isoform X4       99.8    4e-18    
ref|XP_003276618.2|  PREDICTED: LOW QUALITY PROTEIN: la-related p...  99.8    4e-18    
ref|XP_008952656.1|  PREDICTED: la-related protein 1 isoform X2       99.8    4e-18    
ref|XP_008952655.1|  PREDICTED: la-related protein 1 isoform X1       99.8    4e-18    
emb|CDY30348.1|  BnaA09g09290D                                        97.1    4e-18    
ref|XP_008952657.1|  PREDICTED: la-related protein 1 isoform X3       99.8    4e-18    
ref|XP_009406828.1|  PREDICTED: la-related protein 1A-like            99.8    4e-18    
ref|XP_004165480.1|  PREDICTED: LOW QUALITY PROTEIN: la-related p...  99.8    4e-18    
ref|NP_056130.2|  la-related protein 1                                99.8    4e-18    
ref|XP_003190071.1|  RNA-binding La domain protein                    99.4    4e-18    
ref|XP_004149652.1|  PREDICTED: la-related protein 1-like             99.8    4e-18    
ref|XP_004241387.1|  PREDICTED: la-related protein 1A                 99.8    4e-18    
ref|XP_001727814.1|  RNA-binding La domain protein                    99.0    5e-18    
emb|CDY26828.1|  BnaC09g09550D                                        96.7    5e-18    
ref|XP_004967760.1|  PREDICTED: la-related protein 1-like             99.4    5e-18    
ref|XP_010493238.1|  PREDICTED: la-related protein 1A                 99.0    5e-18    
ref|XP_010420964.1|  PREDICTED: la-related protein 1A-like            99.0    6e-18    
ref|XP_004291726.1|  PREDICTED: la-related protein 1-like             99.0    7e-18    
ref|XP_002968241.1|  hypothetical protein SELMODRAFT_39325            90.5    8e-18    
dbj|BAJ90801.1|  predicted protein                                    98.2    8e-18    
ref|XP_010454438.1|  PREDICTED: la-related protein 1A-like            98.6    8e-18    
ref|XP_001213367.1|  predicted protein                                98.2    9e-18    
ref|XP_008449871.1|  PREDICTED: la-related protein 1A isoform X2      98.2    1e-17    
gb|EEE54292.1|  hypothetical protein OsJ_01217                        98.2    1e-17    
gb|EEC70367.1|  hypothetical protein OsI_01301                        98.2    1e-17    
dbj|BAJ97323.1|  predicted protein                                    98.2    1e-17    
ref|XP_008449869.1|  PREDICTED: la-related protein 1A isoform X1      98.2    1e-17    
ref|NP_001042674.2|  Os01g0266000                                     98.2    1e-17    
ref|XP_001392277.2|  RNA-binding La domain protein                    97.8    1e-17    
emb|CAK39838.1|  unnamed protein product                              97.8    1e-17    
ref|XP_008783345.1|  PREDICTED: la-related protein 1A-like            94.7    1e-17    
ref|XP_004606335.1|  PREDICTED: la-related protein 1B                 95.9    1e-17    
gb|EYU18068.1|  hypothetical protein MIMGU_mgv1a020046mg              95.1    1e-17    
ref|XP_003603799.1|  NAD(P)H-quinone oxidoreductase chain             97.1    2e-17    
ref|XP_006400686.1|  hypothetical protein EUTSA_v10012690mg           97.4    2e-17    
ref|XP_005069736.1|  PREDICTED: la-related protein 1B-like isofor...  94.4    2e-17    
ref|NP_568409.1|  LA RNA-binding protein                              97.4    2e-17    
ref|XP_005069737.1|  PREDICTED: la-related protein 1B-like isofor...  94.0    2e-17    
ref|NP_001190355.1|  LA RNA-binding protein                           97.1    2e-17    
ref|NP_001190354.1|  LA RNA-binding protein                           97.1    2e-17    
ref|XP_010653138.1|  PREDICTED: la-related protein 1A-like isofor...  97.1    2e-17    
ref|XP_004635058.1|  PREDICTED: la-related protein 1B                 94.0    2e-17    
ref|NP_001183819.1|  uncharacterized protein LOC100502412             90.5    3e-17    
gb|EGW06058.1|  La-related protein 1                                  95.9    3e-17    
ref|XP_006274063.1|  PREDICTED: la-related protein 1B                 96.7    3e-17    
ref|XP_008653561.1|  PREDICTED: la-related protein 1B                 95.1    4e-17    
ref|XP_003617130.1|  La-related protein                               96.7    4e-17    
ref|XP_004657488.1|  PREDICTED: LOW QUALITY PROTEIN: la-related p...  96.7    4e-17    
ref|XP_005812480.1|  PREDICTED: la-related protein 1-like             96.7    4e-17    
ref|XP_007216274.1|  hypothetical protein PRUPE_ppa017375mg           92.8    4e-17    
dbj|GAA89588.1|  La domain family                                     96.3    4e-17    
ref|XP_007607049.1|  PREDICTED: la-related protein 1B isoform X10     93.6    4e-17    
ref|XP_007625286.1|  PREDICTED: la-related protein 1 isoform X2       96.3    5e-17    
ref|XP_005067789.1|  PREDICTED: la-related protein 1                  96.3    5e-17    
ref|XP_010653137.1|  PREDICTED: la-related protein 1A-like isofor...  96.3    5e-17    
ref|XP_005350081.1|  PREDICTED: la-related protein 1                  96.3    5e-17    
ref|XP_007641629.1|  PREDICTED: LOW QUALITY PROTEIN: la-related p...  96.3    5e-17    
ref|XP_006015690.1|  PREDICTED: la-related protein 1B                 96.3    5e-17    
ref|XP_007643544.1|  PREDICTED: la-related protein 1B isoform X7      93.2    5e-17    
gb|KDE08165.1|  hypothetical protein MVLG_01645                       96.3    5e-17    
ref|XP_010590387.1|  PREDICTED: LOW QUALITY PROTEIN: la-related p...  96.3    6e-17    
gb|ERE68760.1|  la-related protein 1B-like protein                    95.9    6e-17    
ref|XP_002266709.1|  PREDICTED: la-related protein 1A-like isofor...  95.9    6e-17    
ref|XP_010238437.1|  PREDICTED: LOW QUALITY PROTEIN: la-related p...  94.7    6e-17    
ref|XP_006500834.1|  PREDICTED: La ribonucleoprotein domain famil...  95.5    6e-17    
ref|XP_006985001.1|  PREDICTED: la-related protein 1                  95.9    7e-17    
dbj|GAA51069.1|  La-related protein 1                                 95.9    7e-17    
ref|XP_003566763.1|  PREDICTED: la-related protein 1A                 95.5    7e-17    
ref|XP_007534444.1|  PREDICTED: la-related protein 1                  95.5    8e-17    
ref|XP_004876436.1|  PREDICTED: la-related protein 1B isoform X2      92.4    8e-17    
ref|XP_008013285.1|  PREDICTED: la-related protein 1 isoform X2       95.5    8e-17    
ref|XP_010358843.1|  PREDICTED: la-related protein 1                  95.5    8e-17    
ref|XP_005991350.1|  PREDICTED: la-related protein 1B isoform X2      95.5    9e-17    
ref|XP_003900460.1|  PREDICTED: la-related protein 1 isoform X2       95.5    9e-17    
ref|XP_008840565.1|  PREDICTED: la-related protein 1                  95.1    9e-17    
ref|NP_001035489.1|  La ribonucleoprotein domain family, member 1B    92.4    9e-17    
ref|XP_005991349.1|  PREDICTED: la-related protein 1B isoform X1      95.5    9e-17    
gb|EPS32109.1|  hypothetical protein PDE_07068                        95.1    9e-17    
dbj|BAC36459.1|  unnamed protein product                              92.0    9e-17    
ref|XP_005991351.1|  PREDICTED: la-related protein 1B isoform X3      95.5    9e-17    
dbj|BAE37311.1|  unnamed protein product                              91.7    9e-17    
ref|XP_010637960.1|  PREDICTED: la-related protein 1 isoform X1       95.1    1e-16    
gb|KDR07137.1|  La-related protein                                    95.5    1e-16    
ref|XP_005991352.1|  PREDICTED: la-related protein 1B isoform X4      95.5    1e-16    
emb|CDH58693.1|  la-related protein 1-like                            95.1    1e-16    
ref|XP_007472254.1|  PREDICTED: LOW QUALITY PROTEIN: La ribonucle...  95.1    1e-16    
emb|CEG78048.1|  hypothetical protein RMATCC62417_12708               94.0    1e-16    
ref|XP_005870583.1|  PREDICTED: LOW QUALITY PROTEIN: la-related p...  95.1    1e-16    
ref|XP_008070972.1|  PREDICTED: la-related protein 1                  95.1    1e-16    
ref|XP_007944608.1|  PREDICTED: la-related protein 1 isoform X3       95.1    1e-16    
ref|XP_010617168.1|  PREDICTED: la-related protein 1B isoform X4      92.0    1e-16    
ref|XP_007111892.1|  PREDICTED: la-related protein 1 isoform X1       95.1    1e-16    
ref|XP_008064465.1|  PREDICTED: la-related protein 1B                 92.0    1e-16    
ref|XP_006127948.1|  PREDICTED: la-related protein 1B                 95.1    1e-16    
ref|XP_004629511.1|  PREDICTED: la-related protein 1                  95.1    1e-16    
ref|XP_005343078.1|  PREDICTED: LOW QUALITY PROTEIN: La ribonucle...  95.1    1e-16    
ref|XP_010911037.1|  PREDICTED: la-related protein 1B-like            87.8    1e-16    
ref|XP_006215030.1|  PREDICTED: la-related protein 1 isoform X1       95.1    1e-16    
ref|XP_008150480.1|  PREDICTED: la-related protein 1                  95.1    1e-16    
ref|XP_010637961.1|  PREDICTED: la-related protein 1 isoform X2       95.1    1e-16    
ref|XP_008571390.1|  PREDICTED: la-related protein 1                  95.1    1e-16    
ref|XP_006165178.1|  PREDICTED: la-related protein 1-like             95.1    1e-16    
ref|XP_004314238.1|  PREDICTED: la-related protein 1                  95.1    1e-16    
gb|EMT02818.1|  hypothetical protein F775_26253                       91.7    1e-16    
ref|XP_007944606.1|  PREDICTED: la-related protein 1 isoform X1       95.1    1e-16    
ref|XP_003782063.1|  PREDICTED: la-related protein 1                  95.1    1e-16    
ref|XP_004801820.1|  PREDICTED: la-related protein 1                  95.1    1e-16    
ref|XP_007077635.1|  PREDICTED: la-related protein 1                  95.1    1e-16    
emb|CDM80744.1|  unnamed protein product                              95.1    1e-16    
ref|XP_010474359.1|  PREDICTED: la-related protein 1B-like            89.0    1e-16    
gb|EPQ10361.1|  La-related protein 1                                  95.1    1e-16    
ref|XP_005619323.1|  PREDICTED: la-related protein 1 isoform X2       95.1    1e-16    
ref|XP_008013284.1|  PREDICTED: la-related protein 1 isoform X1       95.1    1e-16    
ref|XP_004281045.1|  PREDICTED: la-related protein 1                  95.1    1e-16    
ref|XP_007165565.1|  PREDICTED: la-related protein 1 isoform X2       95.1    1e-16    
ref|XP_007111893.1|  PREDICTED: la-related protein 1 isoform X2       95.1    1e-16    
ref|XP_003473259.1|  PREDICTED: la-related protein 1                  95.1    1e-16    
ref|XP_006906636.1|  PREDICTED: la-related protein 1                  95.1    1e-16    
ref|XP_006089162.1|  PREDICTED: LOW QUALITY PROTEIN: la-related p...  95.1    1e-16    
gb|ELK17303.1|  La-related protein 1                                  95.1    1e-16    
ref|XP_004391380.1|  PREDICTED: LOW QUALITY PROTEIN: La ribonucle...  95.1    1e-16    
ref|XP_010968360.1|  PREDICTED: la-related protein 1                  95.1    1e-16    
ref|XP_010985566.1|  PREDICTED: la-related protein 1                  95.1    1e-16    
ref|XP_004738165.1|  PREDICTED: la-related protein 1                  95.1    1e-16    
ref|XP_008013286.1|  PREDICTED: la-related protein 1 isoform X3       95.1    1e-16    
ref|XP_009207717.1|  PREDICTED: la-related protein 1 isoform X1       95.1    1e-16    
gb|ELK28341.1|  La-related protein 1                                  95.1    1e-16    
ref|XP_004482662.1|  PREDICTED: LOW QUALITY PROTEIN: la-related p...  95.1    1e-16    
ref|XP_009207720.1|  PREDICTED: la-related protein 1 isoform X5       95.1    1e-16    
ref|XP_008013287.1|  PREDICTED: la-related protein 1 isoform X4       94.7    1e-16    
ref|XP_010342891.1|  PREDICTED: la-related protein 1 isoform X1       94.7    1e-16    
ref|XP_007944607.1|  PREDICTED: la-related protein 1 isoform X2       95.1    1e-16    
ref|XP_007165564.1|  PREDICTED: la-related protein 1 isoform X1       94.7    1e-16    
ref|XP_005991353.1|  PREDICTED: la-related protein 1B isoform X5      95.1    1e-16    
ref|XP_001112050.1|  PREDICTED: la-related protein 1-like isoform 3   95.1    1e-16    
ref|XP_009207721.1|  PREDICTED: la-related protein 1 isoform X6       94.7    1e-16    
gb|KFO26564.1|  La-related protein 1                                  94.7    1e-16    
ref|XP_010342892.1|  PREDICTED: la-related protein 1 isoform X2       94.7    1e-16    
ref|XP_006194936.1|  PREDICTED: la-related protein 1                  94.7    1e-16    
ref|XP_009207719.1|  PREDICTED: la-related protein 1 isoform X4       95.1    1e-16    
ref|XP_005619324.1|  PREDICTED: la-related protein 1 isoform X3       94.7    1e-16    
ref|XP_006748462.1|  PREDICTED: la-related protein 1-like             94.7    1e-16    
ref|XP_008314278.1|  PREDICTED: la-related protein 1B isoform X1      95.1    1e-16    
ref|XP_005558417.1|  PREDICTED: la-related protein 1                  94.7    1e-16    
ref|XP_009207718.1|  PREDICTED: la-related protein 1 isoform X3       95.1    1e-16    
ref|XP_004554806.1|  PREDICTED: la-related protein 1-like isoform X1  95.1    1e-16    
ref|XP_006286832.1|  hypothetical protein CARUB_v10003787mg           94.7    1e-16    
ref|XP_005674605.1|  PREDICTED: LOW QUALITY PROTEIN: La ribonucle...  94.7    1e-16    
ref|XP_006928128.1|  PREDICTED: la-related protein 1                  95.1    1e-16    
ref|XP_010812074.1|  PREDICTED: la-related protein 1B isoform X9      91.7    1e-16    
ref|XP_004417840.1|  PREDICTED: LOW QUALITY PROTEIN: La ribonucle...  94.7    1e-16    
ref|XP_005619322.1|  PREDICTED: la-related protein 1 isoform X1       94.7    1e-16    
ref|XP_002462752.1|  hypothetical protein SORBIDRAFT_02g031380        87.4    1e-16    
ref|XP_004554808.1|  PREDICTED: la-related protein 1-like isoform X3  94.7    1e-16    
ref|XP_004554807.1|  PREDICTED: la-related protein 1-like isoform X2  94.7    1e-16    
gb|EFB20605.1|  hypothetical protein PANDA_005407                     94.7    1e-16    
ref|XP_004876435.1|  PREDICTED: la-related protein 1B isoform X1      92.4    1e-16    
ref|XP_010858547.1|  PREDICTED: la-related protein 1B isoform X4      91.7    1e-16    
ref|XP_006766411.1|  PREDICTED: la-related protein 1                  94.7    1e-16    
ref|XP_004697161.1|  PREDICTED: la-related protein 1                  94.7    1e-16    
ref|XP_008314286.1|  PREDICTED: la-related protein 1B isoform X2      94.7    1e-16    
ref|XP_008986875.1|  PREDICTED: la-related protein 1                  94.7    1e-16    
ref|XP_004836580.1|  PREDICTED: la-related protein 1 isoform X1       94.7    1e-16    
gb|EMT16061.1|  hypothetical protein F775_27114                       94.4    2e-16    
ref|XP_008690946.1|  PREDICTED: la-related protein 1                  94.7    2e-16    
ref|XP_005376254.1|  PREDICTED: la-related protein 1 isoform X2       94.7    2e-16    
ref|XP_006917827.1|  PREDICTED: la-related protein 1B isoform X2      91.7    2e-16    
ref|XP_010821611.1|  PREDICTED: la-related protein 1B isoform X8      93.6    2e-16    
ref|XP_006786355.1|  PREDICTED: la-related protein 1-like             94.7    2e-16    
ref|XP_006876165.1|  PREDICTED: la-related protein 1B                 91.3    2e-16    
gb|KFH69260.1|  hypothetical protein MVEG_04075                       94.4    2e-16    
ref|XP_007540141.1|  PREDICTED: la-related protein 1B-like isofor...  94.7    2e-16    
ref|XP_007540140.1|  PREDICTED: la-related protein 1B-like isofor...  94.7    2e-16    
ref|XP_004836581.1|  PREDICTED: la-related protein 1 isoform X2       94.4    2e-16    
ref|XP_005376253.1|  PREDICTED: la-related protein 1 isoform X1       94.4    2e-16    
ref|XP_004883058.1|  PREDICTED: la-related protein 1                  94.4    2e-16    
ref|XP_005728693.1|  PREDICTED: la-related protein 1-like isoform X1  94.4    2e-16    
ref|XP_006878347.1|  PREDICTED: LOW QUALITY PROTEIN: La ribonucle...  94.4    2e-16    
ref|XP_007540144.1|  PREDICTED: la-related protein 1B-like isofor...  94.4    2e-16    
gb|KFM29147.1|  La-related protein 1                                  92.4    2e-16    
ref|XP_005728695.1|  PREDICTED: la-related protein 1-like isoform X3  94.4    2e-16    
ref|XP_005728694.1|  PREDICTED: la-related protein 1-like isoform X2  94.4    2e-16    
ref|XP_005929738.1|  PREDICTED: la-related protein 1-like isoform X1  94.4    2e-16    
ref|XP_005929740.1|  PREDICTED: la-related protein 1-like isoform X3  94.4    2e-16    
ref|XP_004428667.1|  PREDICTED: la-related protein 1                  94.4    2e-16    
ref|XP_006178668.1|  PREDICTED: la-related protein 1B isoform X3      91.3    2e-16    
ref|XP_007540142.1|  PREDICTED: la-related protein 1B-like isofor...  94.4    2e-16    
gb|KFO35548.1|  La-related protein 1B                                 93.6    2e-16    
gb|EPY73115.1|  la-related protein 1                                  94.4    2e-16    
ref|NP_082727.1|  la-related protein 1                                94.4    2e-16    
ref|XP_005929739.1|  PREDICTED: la-related protein 1-like isoform X2  94.4    2e-16    
ref|XP_007540143.1|  PREDICTED: la-related protein 1B-like isofor...  94.4    2e-16    
ref|XP_001917577.2|  PREDICTED: LOW QUALITY PROTEIN: la-related p...  94.4    2e-16    
ref|XP_006212293.1|  PREDICTED: la-related protein 1B isoform X4      91.3    2e-16    
ref|XP_007909338.1|  PREDICTED: la-related protein 1B isoform X2      94.4    2e-16    
ref|XP_002710379.1|  PREDICTED: la-related protein 1                  94.4    2e-16    
gb|EHB01918.1|  La-related protein 1                                  94.4    2e-16    
ref|XP_006534397.1|  PREDICTED: la-related protein 1 isoform X1       94.4    2e-16    
ref|XP_008765967.1|  PREDICTED: LOW QUALITY PROTEIN: la-related p...  94.4    2e-16    
gb|EMP36378.1|  La-related protein 1B                                 94.0    2e-16    
ref|XP_010796819.1|  PREDICTED: la-related protein 1 isoform X1       94.4    2e-16    
gb|EGW06346.1|  La-related protein 1B                                 92.0    2e-16    
dbj|BAE23795.1|  unnamed protein product                              93.6    2e-16    
ref|XP_008520620.1|  PREDICTED: la-related protein 1                  94.0    2e-16    
tpg|DAA27253.1|  TPA: La ribonucleoprotein domain family, member 1    94.0    2e-16    
ref|XP_005683414.1|  PREDICTED: la-related protein 1                  94.0    2e-16    
ref|XP_007909339.1|  PREDICTED: la-related protein 1B isoform X3      94.0    2e-16    



>emb|CDP01856.1| unnamed protein product [Coffea canephora]
Length=577

 Score =   365 bits (937),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 310/447 (69%), Gaps = 20/447 (4%)
 Frame = -1

Query  1767  QDAATEAQPESFENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSA  1591
             +D A +AQPE  +N   GNN  KKPAWNKP NG+TEAGPVMGA SWPALSEST+ASPKS+
Sbjct  104   EDCAGDAQPEGSDNGSGGNNGAKKPAWNKPSNGATEAGPVMGAFSWPALSESTRASPKSS  163

Query  1590  TYDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGG-GN  1414
             + + LKT SD SVP  Q TG+A  S+ K     NT + ++  +    RQRS KR GG GN
Sbjct  164   S-ESLKTLSDVSVPVSQATGMASPSAHKQGINANTNSSSTPNHAPYNRQRSMKRGGGSGN  222

Query  1413  SSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGN  1234
              S+ A ANG  SQ    +S  VE   N++GKP   P S D+ HR+GGQRGG GSQS  GN
Sbjct  223   PSSNASANGGPSQLPSPRSSGVETGSNNSGKP-ANPVS-DSSHREGGQRGGVGSQSHSGN  280

Query  1233  ENQYTrssprkgngrprprgdgSYHHAHGGAR-DQERGNQEWNANRSFGS-RDAHLQplr  1060
             ++Q  +       G   PRGDGS+HH +GG R DQ+RGNQ+WN NRSFG  RD H+Q  R
Sbjct  281   DHQ--QQRNSFKRGSGGPRGDGSHHHGYGGRRGDQDRGNQDWNPNRSFGGGRDTHMQSQR  338

Query  1059  vpsrpflrvpppsppfipplmpmrpL--GSPLVYPEV-HPMYYVPGPHPDSL-VMPMLAS  892
             V SRPF+R P P+PP   P  PM     G+P+VYP+V   ++Y+PGPHP+SL  +PM+  
Sbjct  339   VASRPFMRGPHPTPPPFMPPTPMPVRPFGTPIVYPDVPSTVFYLPGPHPESLRAVPMVP-  397

Query  891   pppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKV  712
               P  P+F+ F DP L +KIVNQIEYYFSN+NL+KD YLR+ MDDQGWVP++LIA+FKKV
Sbjct  398   --PMAPLFFPFPDPQLQTKIVNQIEYYFSNENLVKDTYLRQNMDDQGWVPIKLIASFKKV  455

Query  711   AVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYS-ISSPQSARSPGSDV  535
               LTD+IQ IL ++RTS  +EV+GEK+R RNDW KWI+PPSVQYS ISSPQS +    D+
Sbjct  456   TQLTDNIQFILDSVRTSGAVEVEGEKVRRRNDWMKWIMPPSVQYSTISSPQSMQKSSQDM  515

Query  534   LSQHFQGVTLDDNNANEHERGNAEAHL  454
             L+ +FQ + LD+      ++G  E +L
Sbjct  516   LALNFQSMALDEKTT---KQGYGETYL  539



>ref|XP_009759466.1| PREDICTED: la-related protein 1C-like [Nicotiana sylvestris]
Length=572

 Score =   337 bits (865),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 252/449 (56%), Positives = 310/449 (69%), Gaps = 17/449 (4%)
 Frame = -1

Query  1761  AATEAQPESFEN---SDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKS  1594
             AATEAQ ES +N    DS +N  KKPAWNKP NG+ E  PVMGAV WPALS+STKASPKS
Sbjct  101   AATEAQLESSDNGNSDDSNSNVSKKPAWNKPSNGAAEVSPVMGAVCWPALSDSTKASPKS  160

Query  1593  ATYDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGN  1414
             ++ + LK  SDGSV   QGTG+A SSS    +TNN    ++  +  P RQRS KR GGG 
Sbjct  161   SSSESLKALSDGSVSVTQGTGMA-SSSHGQANTNNANPNSTLNHVAPTRQRSMKR-GGGY  218

Query  1413  SSNTALANGsvsqpqqlqslvVEMAPNSAGKPG---VEPYSRDNVHRDGGQRGGFGSQSI  1243
             S++ A ANG  SQ Q   S   E+  N +GK G    +  S+DN HRDGGQ GGFGSQS 
Sbjct  219   SNHNASANGGFSQQQGQSSEA-EIVFNKSGKSGNSGADSSSKDNSHRDGGQWGGFGSQSH  277

Query  1242  GGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQpl  1063
             GG+E+Q+ R+S R+GN  P PRGDG+YH  +GG RDQERGNQ+W  +R +G+RDAH+QP 
Sbjct  278   GGHEHQHQRNSNRRGNVGPHPRGDGTYHLGYGGRRDQERGNQDWKPHRGWGNRDAHMQPQ  337

Query  1062  rvpsrpflrvpppsppfipplmpmrp-LGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpp  886
             RVP+RPF+  PP + P   P +       +P+VY EV P+Y+ PGP PD+  MPML+   
Sbjct  338   RVPARPFMGGPPHTSPPFIPPIMPVHPYRAPMVYSEVPPVYFFPGPLPDTFRMPMLS---  394

Query  885   pgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAV  706
             P PPVF+   DP L +KIVNQI+YYFSN+NLIKD +LR+ MD+ GWV V LIA FKKV  
Sbjct  395   PVPPVFFHMPDPQLQTKIVNQIDYYFSNENLIKDTFLRRNMDEHGWVSVMLIAGFKKVMS  454

Query  705   LTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQ  526
             LTD+IQLIL  MR+ST++EVQGEKLR RNDW  WI+PPSVQ S  SPQS +    D L++
Sbjct  455   LTDNIQLILDVMRSSTVVEVQGEKLRRRNDWNHWIIPPSVQNSTISPQSPQKSSPDSLAE  514

Query  525   HFQGVTLDDNNANEHERGNAEAHLNRSSS  439
             + Q V  DD        GNAEA+L+R SS
Sbjct  515   NLQRVAFDDETI---RHGNAEAYLSRPSS  540



>ref|XP_009599727.1| PREDICTED: la-related protein 1C-like [Nicotiana tomentosiformis]
Length=572

 Score =   333 bits (855),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 250/449 (56%), Positives = 308/449 (69%), Gaps = 17/449 (4%)
 Frame = -1

Query  1761  AATEAQPESFENSDS---GNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKS  1594
             AATEAQ ES +N +S    +N  KKPAWNKP NG+ E  PVMGAV WPALS+STKASPKS
Sbjct  101   AATEAQLESSDNGNSDGSNSNVAKKPAWNKPLNGAAEVSPVMGAVCWPALSDSTKASPKS  160

Query  1593  ATYDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGN  1414
             ++ + LK  SD SV   QGTG+  SSS    +TNN    ++  +  P RQRS KR GGG 
Sbjct  161   SSSESLKALSDVSVSVTQGTGMT-SSSHGQANTNNANPNSTLNHVAPTRQRSMKR-GGGY  218

Query  1413  SSNTALANGsvsqpqqlqslvVEMAPNSAGKPG---VEPYSRDNVHRDGGQRGGFGSQSI  1243
             S++ A ANG  SQ Q   S V E+  N +GK G    +  S+DN HRDGGQ GGFGSQS 
Sbjct  219   SNHNASANGGFSQQQGQSSEV-EIVLNKSGKSGNSGADSSSKDNSHRDGGQWGGFGSQSH  277

Query  1242  GGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQpl  1063
             GGNE+Q+ R+S R+GN  P PRGDG++H  +GG RDQERGNQ+W  +R +G+RDAH+QP 
Sbjct  278   GGNEHQHQRNSNRRGNVGPHPRGDGTHHQGYGGRRDQERGNQDWKPHRGWGNRDAHMQPQ  337

Query  1062  rvpsrpflrvpppsppfipplmpmrp-LGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpp  886
             RVP+RPF+  PP + P   P         +P+VY EV P+Y+ PGP PD+  MPML+   
Sbjct  338   RVPARPFMGGPPHTSPPFIPPTMPVQPYRAPMVYSEVPPVYFFPGPLPDTFRMPMLS---  394

Query  885   pgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAV  706
             P PPVF+   DP L +KIVNQI+YYFSN+NLIKD +LR+ MD+ GWV V LIA FKKV  
Sbjct  395   PVPPVFFHMPDPQLQTKIVNQIDYYFSNENLIKDTFLRRNMDEHGWVSVTLIAGFKKVMS  454

Query  705   LTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQ  526
             LTD+IQLIL  MR+ST++EVQGEKLR RNDW  WI+PPSVQ S  SPQS +    D L++
Sbjct  455   LTDNIQLILDVMRSSTVVEVQGEKLRRRNDWNHWIIPPSVQNSTISPQSPQKSSPDFLTE  514

Query  525   HFQGVTLDDNNANEHERGNAEAHLNRSSS  439
             + Q V  DD        GNAEA+L+R SS
Sbjct  515   NLQRVAFDDETI---RHGNAEAYLSRPSS  540



>ref|XP_006361948.1| PREDICTED: uncharacterized HTH La-type RNA-binding protein C1527.03-like 
isoform X1 [Solanum tuberosum]
Length=570

 Score =   333 bits (855),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 248/463 (54%), Positives = 315/463 (68%), Gaps = 22/463 (5%)
 Frame = -1

Query  1809  VSGWATGNSPLPLLQDAATEAQPESFENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSW  1633
             ++G+A+  SP    +DAA + Q ES    D+ +N  KKPAWNKP NG+ +  PVMGAVSW
Sbjct  92    IAGYASSLSP----EDAAIDTQLES----DTNSNGAKKPAWNKPSNGAADVSPVMGAVSW  143

Query  1632  PALSESTKASPKSATYDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvP  1453
             PALS+STKASPK  + D LK+ SDGSV   +GTG+A S+S +  +TNN        + VP
Sbjct  144   PALSDSTKASPKLPSSDSLKSLSDGSVSVTEGTGMA-SASHRQANTNNVNPNTMLNHVVP  202

Query  1452  ARQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVEMAPNSA--GKPGVEPYSRD-NVHR  1282
             +RQR  KR GGGNS++ A ANG  SQ Q     V  +  NSA  G  G E  SRD N +R
Sbjct  203   SRQRFMKR-GGGNSNHNASANGGFSQQQAQGFEVETVFNNSAKSGNSGAESSSRDNNNYR  261

Query  1281  DGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNAN  1102
             +GGQ GGFGSQS GGN+ Q+ R++ R+GN  P PRGDG+Y++ +GG RDQER N +W  +
Sbjct  262   NGGQWGGFGSQSHGGNDYQHQRNANRRGNVGPHPRGDGTYYNGYGGRRDQERRNPDWKPH  321

Query  1101  RSFGSRDAHLQ-plrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPH  925
             RS+G+RDAH+Q             P  SPPFIP  MP++P   P+VY EV P++Y PGP 
Sbjct  322   RSWGNRDAHMQPQRGPARPFMGGPPHTSPPFIPTPMPVQPYRPPMVYSEVPPLFYFPGPF  381

Query  924   PDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWV  745
             PDSL MPML+  PP         D  L ++IVNQI+YYFSN+NLIKD +LR+ MD+QGWV
Sbjct  382   PDSLRMPMLSPVPPVYV---HVPDTQLHTRIVNQIDYYFSNENLIKDTFLRQNMDEQGWV  438

Query  744   PVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYS-ISS  568
             PV LIA FKKV  LTD+IQLIL+ MR+ST++EVQGEKLR RNDW  W++PPSVQ S +SS
Sbjct  439   PVTLIAGFKKVMELTDNIQLILNVMRSSTVVEVQGEKLRRRNDWFHWLIPPSVQNSTMSS  498

Query  567   PQSARSPGSDVLSQHFQGVTLDDNNANEHERGNAEAHLNRSSS  439
             P+S +  G D+L+++ Q V  D N       GNAEAHL+RSSS
Sbjct  499   PRSPQMSGPDLLAENLQRVVFDYNTTGH---GNAEAHLSRSSS  538



>ref|XP_009587443.1| PREDICTED: la-related protein 1C-like [Nicotiana tomentosiformis]
Length=569

 Score =   327 bits (839),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 253/448 (56%), Positives = 310/448 (69%), Gaps = 17/448 (4%)
 Frame = -1

Query  1764  DAATEAQPESFENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSAT  1588
             D ATEAQ ES  + +S NN  KK AW+KP NG+ E  PVMGAVSWPALSESTKASPKS +
Sbjct  92    DVATEAQLES--SDNSNNNVSKKQAWSKPSNGAAEVSPVMGAVSWPALSESTKASPKSPS  149

Query  1587  YDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSS  1408
              D LK  SDGSV   QGT +A SSS +  ++NN      + +  P RQRS KR GGG S+
Sbjct  150   SDSLKALSDGSVSVSQGTEMA-SSSHRQANSNNANPNLMSNHVGPTRQRSMKR-GGGYSN  207

Query  1407  NTALANGsvsqpqqlqslvVEMAPNSAGKPG---VEPYSRDNVHRDGGQRGGFGSQSIGG  1237
             + A ANG   Q Q   S V E+  N++GK G    E  SRD  HRDGGQ GGFGSQS GG
Sbjct  208   HNASANGGFPQQQAQGSEV-EIVTNNSGKSGNFGAEFSSRDTSHRDGGQSGGFGSQSHGG  266

Query  1236  NENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrv  1057
             NENQ+ R+S R+GN  P PRGDG+Y+H +GG RDQERGNQ+W  +R +G+RDA +QP RV
Sbjct  267   NENQHQRTSNRRGNVDPHPRGDGAYNHGYGGRRDQERGNQDWKPHRGWGNRDAPMQPHRV  326

Query  1056  psrpflrvpppsppfipplmpmrp-LGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppg  880
             P+RPF+  PP + P   P         +P+VYPEV P+YY PGP PDS  MPML+   P 
Sbjct  327   PARPFMGGPPHTSPPFIPPHMPVQPYRAPIVYPEVAPVYYFPGPLPDSFRMPMLS---PV  383

Query  879   pPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLT  700
             PP F+   DP + +KIVNQI+YYFS++NLIKD +LR+ MD+ GWVPV LIA FKKV  LT
Sbjct  384   PPFFFHVPDPQMQTKIVNQIDYYFSDENLIKDTFLRRNMDEHGWVPVMLIAGFKKVMQLT  443

Query  699   DDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYS-ISSPQSARSPGSDVLSQH  523
             D+IQLIL  MR+ST +EVQGEKLR RNDW +W++PPSVQ S +S PQS +    D+L+++
Sbjct  444   DNIQLILDVMRSSTAVEVQGEKLRRRNDWNRWLIPPSVQNSTMSGPQSPQKYSPDLLAEN  503

Query  522   FQGVTLDDNNANEHERGNAEAHLNRSSS  439
              Q VT DD       RG AEA+ +RSSS
Sbjct  504   LQRVTFDDKTT---RRGTAEAYHSRSSS  528



>ref|XP_004233568.1| PREDICTED: la-related protein 1C isoform X1 [Solanum lycopersicum]
Length=570

 Score =   325 bits (832),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 236/444 (53%), Positives = 302/444 (68%), Gaps = 18/444 (4%)
 Frame = -1

Query  1767  QDAATEAQPESFENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSA  1591
             +DAA + Q ES    D+ +N  KKPAWNKP NG+ +  PVMGAVSWPALS+STKASPK  
Sbjct  102   EDAAIDTQIES----DTNSNGAKKPAWNKPSNGAADVSPVMGAVSWPALSDSTKASPKLP  157

Query  1590  TYDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNS  1411
             + D LK+ SDGSV   QG+G+A S+S +  +TNN        + VP+RQRS KR GGGNS
Sbjct  158   SSDSLKSLSDGSVSVTQGSGMA-SASHRQANTNNVNPNTMPNHVVPSRQRSMKR-GGGNS  215

Query  1410  SNTALANGsvsqpqqlqslvVEMAPNS--AGKPGVEPYSRD-NVHRDGGQRGGFGSQSIG  1240
             ++ A ANG  SQ Q     V  +  NS  +G  G E  SRD N +R+GGQ GGFGSQS G
Sbjct  216   NHNASANGGFSQQQTQGFEVETVHNNSVKSGNSGAESSSRDNNNYRNGGQWGGFGSQSHG  275

Query  1239  GNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQ-pl  1063
             GN+ Q+  ++ R+G+  P PRGDG YH+ +GG RDQ+R NQ+W   RS+G+RDA +Q   
Sbjct  276   GNDYQHQLNANRRGSVGPHPRGDGMYHNGYGGRRDQDRRNQDWKPQRSWGNRDARMQPQR  335

Query  1062  rvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSLVMPMLASppp  883
                       P  SPPFIP  MP++P   P+VY EV P++Y PGP PDSL MPML+   P
Sbjct  336   GPARPFMGGPPHTSPPFIPTPMPVQPYRPPMVYSEVPPLFYFPGPFPDSLRMPMLS---P  392

Query  882   gpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVL  703
              PPV++   D  L ++IVNQI+YYFSN+NLIKD++LR++MD+QGWVPV LIA FKKV  L
Sbjct  393   VPPVYFHLPDTQLHNRIVNQIDYYFSNENLIKDIFLREQMDEQGWVPVTLIAGFKKVMEL  452

Query  702   TDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYS-ISSPQSARSPGSDVLSQ  526
             TD+IQLIL+ +R+ST++EVQGEKLR RNDW  W++P SV  S +SSPQS + P  D+L++
Sbjct  453   TDNIQLILNVVRSSTVVEVQGEKLRRRNDWSHWLIPASVHNSTMSSPQSPQMPSPDLLAE  512

Query  525   HFQGVTLDDNNANEHERGNAEAHL  454
             + Q V  D         GN EAHL
Sbjct  513   NLQRVVFDYKTTGH---GNTEAHL  533



>ref|XP_006361949.1| PREDICTED: uncharacterized HTH La-type RNA-binding protein C1527.03-like 
isoform X2 [Solanum tuberosum]
Length=561

 Score =   318 bits (815),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 246/463 (53%), Positives = 313/463 (68%), Gaps = 31/463 (7%)
 Frame = -1

Query  1809  VSGWATGNSPLPLLQDAATEAQPESFENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSW  1633
             ++G+A+  SP    +DAA + Q ES    D+ +N  KKPAWNKP NG+ +  PVMGAVSW
Sbjct  92    IAGYASSLSP----EDAAIDTQLES----DTNSNGAKKPAWNKPSNGAADVSPVMGAVSW  143

Query  1632  PALSESTKASPKSATYDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvP  1453
             PALS+STKASPK  + D LK+ SDGSV   +GTG+A S+S +  +TNN        + VP
Sbjct  144   PALSDSTKASPKLPSSDSLKSLSDGSVSVTEGTGMA-SASHRQANTNNVNPNTMLNHVVP  202

Query  1452  ARQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVEMAPNSA--GKPGVEPYSRDNV-HR  1282
             +RQR  KR GGGNS++ A ANG  SQ Q     V  +  NSA  G  G E  SRDN  +R
Sbjct  203   SRQRFMKR-GGGNSNHNASANGGFSQQQAQGFEVETVFNNSAKSGNSGAESSSRDNNNYR  261

Query  1281  DGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNAN  1102
             +GGQ GGFGSQS GGN+ Q+ R++ R+GN  P PRGDG+Y++ +GG RDQER N +W  +
Sbjct  262   NGGQWGGFGSQSHGGNDYQHQRNANRRGNVGPHPRGDGTYYNGYGGRRDQERRNPDWKPH  321

Query  1101  RSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPL-VYPEVHPMYYVPGPH  925
             RS+G+RDAH+QP R P+RPF+  PP + P   P        +P+ V P   PM Y  GP 
Sbjct  322   RSWGNRDAHMQPQRGPARPFMGGPPHTSPPFIP--------TPMPVQPYRPPMVYS-GPF  372

Query  924   PDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWV  745
             PDSL MPML+  PP         D  L ++IVNQI+YYFSN+NLIKD +LR+ MD+QGWV
Sbjct  373   PDSLRMPMLSPVPPVYV---HVPDTQLHTRIVNQIDYYFSNENLIKDTFLRQNMDEQGWV  429

Query  744   PVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYS-ISS  568
             PV LIA FKKV  LTD+IQLIL+ MR+ST++EVQGEKLR RNDW  W++PPSVQ S +SS
Sbjct  430   PVTLIAGFKKVMELTDNIQLILNVMRSSTVVEVQGEKLRRRNDWFHWLIPPSVQNSTMSS  489

Query  567   PQSARSPGSDVLSQHFQGVTLDDNNANEHERGNAEAHLNRSSS  439
             P+S +  G D+L+++ Q V  D N       GNAEAHL+RSSS
Sbjct  490   PRSPQMSGPDLLAENLQRVVFDYNTTGH---GNAEAHLSRSSS  529



>ref|XP_010317249.1| PREDICTED: la-related protein 1C isoform X2 [Solanum lycopersicum]
Length=561

 Score =   309 bits (791),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 233/444 (52%), Positives = 299/444 (67%), Gaps = 27/444 (6%)
 Frame = -1

Query  1767  QDAATEAQPESFENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSA  1591
             +DAA + Q ES    D+ +N  KKPAWNKP NG+ +  PVMGAVSWPALS+STKASPK  
Sbjct  102   EDAAIDTQIES----DTNSNGAKKPAWNKPSNGAADVSPVMGAVSWPALSDSTKASPKLP  157

Query  1590  TYDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNS  1411
             + D LK+ SDGSV   QG+G+A S+S +  +TNN        + VP+RQRS KR GGGNS
Sbjct  158   SSDSLKSLSDGSVSVTQGSGMA-SASHRQANTNNVNPNTMPNHVVPSRQRSMKR-GGGNS  215

Query  1410  SNTALANGsvsqpqqlqslvVEMAPNS--AGKPGVEPYSRDNV-HRDGGQRGGFGSQSIG  1240
             ++ A ANG  SQ Q     V  +  NS  +G  G E  SRDN  +R+GGQ GGFGSQS G
Sbjct  216   NHNASANGGFSQQQTQGFEVETVHNNSVKSGNSGAESSSRDNNNYRNGGQWGGFGSQSHG  275

Query  1239  GNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplr  1060
             GN+ Q+  ++ R+G+  P PRGDG YH+ +GG RDQ+R NQ+W   RS+G+RDA +QP R
Sbjct  276   GNDYQHQLNANRRGSVGPHPRGDGMYHNGYGGRRDQDRRNQDWKPQRSWGNRDARMQPQR  335

Query  1059  vpsrpflrvpppsppfipplmpmrpLGSPL-VYPEVHPMYYVPGPHPDSLVMPMLASppp  883
              P+RPF+  PP + P   P        +P+ V P   PM Y  GP PDSL MPML+  PP
Sbjct  336   GPARPFMGGPPHTSPPFIP--------TPMPVQPYRPPMVYS-GPFPDSLRMPMLSPVPP  386

Query  882   gpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVL  703
                V++   D  L ++IVNQI+YYFSN+NLIKD++LR++MD+QGWVPV LIA FKKV  L
Sbjct  387   ---VYFHLPDTQLHNRIVNQIDYYFSNENLIKDIFLREQMDEQGWVPVTLIAGFKKVMEL  443

Query  702   TDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYS-ISSPQSARSPGSDVLSQ  526
             TD+IQLIL+ +R+ST++EVQGEKLR RNDW  W++P SV  S +SSPQS + P  D+L++
Sbjct  444   TDNIQLILNVVRSSTVVEVQGEKLRRRNDWSHWLIPASVHNSTMSSPQSPQMPSPDLLAE  503

Query  525   HFQGVTLDDNNANEHERGNAEAHL  454
             + Q V  D         GN EAHL
Sbjct  504   NLQRVVFDYKTTGH---GNTEAHL  524



>ref|XP_010317248.1| PREDICTED: la-related protein 1C-like [Solanum lycopersicum]
Length=495

 Score =   307 bits (786),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 228/439 (52%), Positives = 287/439 (65%), Gaps = 22/439 (5%)
 Frame = -1

Query  1737  SFENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSD  1561
             +FE SD+ +N  KK  WNKP NG+ +  PVMGA+SWPALS+STKAS KS++  P   P D
Sbjct  65    AFE-SDTNSNGAKKTVWNKPSNGTADVSPVMGAISWPALSDSTKASFKSSSDSPRTLP-D  122

Query  1560  GSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsv  1381
             GSV   Q TG+  ++S +  +TNN        + VP+RQRS KR GGGNS++   ANG V
Sbjct  123   GSVSETQVTGMV-AASHRQANTNNANPNTMLNHVVPSRQRSMKR-GGGNSNHNISANG-V  179

Query  1380  sqpqqlqslvVEMAPNSAGKP---GVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrss  1210
                QQ     VE   N++GK    G E  SRDN  RDGG  GGFG+QS GGN++Q+ R++
Sbjct  180   FSQQQAHGFEVETVLNNSGKSANYGAEFSSRDNNRRDGGHWGGFGAQSHGGNDHQHQRNA  239

Query  1209  prkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQ-plrvpsrpflrv  1033
              R+GN  P PRGDG YH+ HGG RDQER       +R +G+RDAH+Q             
Sbjct  240   NRRGNFGPHPRGDGMYHNGHGGRRDQER-----QPHRGWGNRDAHMQPQRGPARPFMGAP  294

Query  1032  pppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLD  853
             P  SPP+IP  MP++P   P+VY EV P++Y PGP PD L MPML+  PP         D
Sbjct  295   PHTSPPYIPGPMPVQPYQPPMVYSEVPPVFYFPGPFPDPLRMPMLSPVPPVFV---HVPD  351

Query  852   PLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHA  673
               L ++IVNQ++YYFSN+NLIKD++LRK MD+ GWVPV LIA F KV  LTD+IQLIL+A
Sbjct  352   TQLQTRIVNQMDYYFSNENLIKDIFLRKNMDEHGWVPVTLIAGFNKVMELTDNIQLILNA  411

Query  672   MRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYS-ISSPQSARSPGSDVLSQHFQGVTLDDN  496
              R+ST++EVQGEKLR RNDW  W++PPSVQ S +SSPQS     SD+L ++ Q V  DD 
Sbjct  412   ARSSTVVEVQGEKLRRRNDWFNWLMPPSVQNSTVSSPQSLPKSASDLLVENLQRVAFDDK  471

Query  495   NANEHERGNAEAHLNRSSS  439
                    GN EAHL+RSSS
Sbjct  472   TVTH---GNVEAHLSRSSS  487



>ref|XP_009780990.1| PREDICTED: la-related protein 1C-like [Nicotiana sylvestris]
Length=531

 Score =   307 bits (787),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 298/441 (68%), Gaps = 17/441 (4%)
 Frame = -1

Query  1761  AATEAQPESFENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATY  1585
             AATE Q ES +NS++  N  KK AW+KP NG  E  PVMGAVSWPALSESTKASPKS + 
Sbjct  100   AATEGQLESSDNSNN--NVSKKQAWSKPSNGVAEVSPVMGAVSWPALSESTKASPKSPSS  157

Query  1584  DPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSN  1405
             D LK  SDGSV   QGT +  SSS +  +TNN      + +  P RQRS KR GGG S++
Sbjct  158   DSLKALSDGSVSVSQGTEMT-SSSHRQANTNNANPNLISNHVGPTRQRSMKR-GGGYSNH  215

Query  1404  TALANGsvsqpqqlqslvVEMAPNSAGKPG---VEPYSRDNVHRDGGQRGGFGSQSIGGN  1234
              A ANG   Q Q   S V E+  N++GK G    E  S+D  HRDGGQ GGFGSQS GGN
Sbjct  216   NASANGGFPQQQAQGSEV-EIVTNNSGKSGNFGAESSSKDTSHRDGGQSGGFGSQSHGGN  274

Query  1233  ENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvp  1054
             E+Q+ R+S R+GN  P   GDG+Y+H +GG RDQERGNQ+W  +R +G+RDA +QP RVP
Sbjct  275   EHQHQRTSNRRGNVGPHSHGDGTYNHGYGGRRDQERGNQDWKPHRGWGNRDAPMQPHRVP  334

Query  1053  srpflrvpppsppfipplmpmrp-LGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgp  877
             +RPF+  PP + P   P         +P+VYPEV P+YY PGP PDS  MPML+   P P
Sbjct  335   ARPFMGGPPHTSPPFIPPHMPVQPYRAPMVYPEVAPVYYFPGPLPDSFRMPMLS---PVP  391

Query  876   PVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTD  697
             P F+   DP + +KIVNQI+YYFS++NLIKD +LR+ MD+ GWVPV LIA FKKV  LTD
Sbjct  392   PFFFHVPDPQMQTKIVNQIDYYFSDENLIKDTFLRRNMDEHGWVPVTLIAGFKKVMQLTD  451

Query  696   DIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYS-ISSPQSARSPGSDVLSQHF  520
             +IQLIL  MR+ST +EVQGEKLR RNDW +W++PPSVQ S ++ PQS +    D L+++ 
Sbjct  452   NIQLILDVMRSSTAVEVQGEKLRRRNDWNRWLIPPSVQNSTMAGPQSPQKSSPDFLAENL  511

Query  519   QGVTLDDNNANEHERGNAEAH  457
             Q V  DD        G AEA+
Sbjct  512   QRVAFDDKTL---IHGTAEAY  529



>ref|XP_006361946.1| PREDICTED: la-related protein-like [Solanum tuberosum]
Length=567

 Score =   304 bits (779),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 232/455 (51%), Positives = 295/455 (65%), Gaps = 27/455 (6%)
 Frame = -1

Query  1764  DAATEAQPESFENSDSGN------NAVKKPAWNKP-NGSTEAGPVMGAVSWPALSEST--  1612
             DA TEAQ    ENSD+G+      N  KK AWNKP NG+ +  PVMGAVSWPALS+ST  
Sbjct  95    DATTEAQ---IENSDNGSSDGTNGNGAKKQAWNKPSNGAADLSPVMGAVSWPALSDSTKA  151

Query  1611  KASPKSATYDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNK  1432
                  S++ D LKTPS  SV   QG G+A S+S +  +TNN        + VP+RQRS K
Sbjct  152   SPKLSSSSSDLLKTPSR-SVSLSQGPGMA-SASHRQSNTNNVNPDTMLNHVVPSRQRSMK  209

Query  1431  RAGGGNSSNTALANGsvsqpqqlqslvVEMAPNS--AGKPGVEPYSRDNVHRDGGQRGGF  1258
             R GGGNS++ A ANG  S  Q     V  +  NS   G  GVE  SRD  HRDGGQ GGF
Sbjct  210   R-GGGNSNHNASANGVFSSQQAQGFEVETVLNNSGKTGNSGVESSSRDYSHRDGGQWGGF  268

Query  1257  GSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDA  1078
             G+QS GG ++Q+ R++ R+GN  P PRGDG+Y + +GG RDQER NQ+W  +R + +RDA
Sbjct  269   GAQSHGGIDHQHQRNANRRGNVGPHPRGDGTYQNGYGGRRDQERRNQDWKPHRGWVNRDA  328

Query  1077  HLQ-plrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSLVMPM  901
             H+Q             P  SPPFIP  +P++P   P+VY EV  ++Y+PGP PDS   PM
Sbjct  329   HMQPHRGPARPYMGAPPHTSPPFIPTPIPVQPYRPPMVYSEVPSVFYLPGPFPDSFRGPM  388

Query  900   LASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATF  721
              +  P     F+   D  L ++IVNQ++YYFSN+NLIKD +LR+ MD+ GWVPV LI+ F
Sbjct  389   FSPVP-----FFHVPDTQLHTRIVNQMDYYFSNENLIKDTFLRQNMDEHGWVPVTLISGF  443

Query  720   KKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYS-ISSPQSARSPG  544
             KKV  LTD+IQLIL+A+R ST++EVQGEKLR RN+W  W++PPSVQ S +S+PQS     
Sbjct  444   KKVMELTDNIQLILNAVRFSTVVEVQGEKLRRRNEWFHWLLPPSVQNSTVSNPQSLHKST  503

Query  543   SDVLSQHFQGVTLDDNNANEHERGNAEAHLNRSSS  439
              D+L ++FQ V  DD        GNAEAHL+RSSS
Sbjct  504   PDLLVENFQRVAFDDKTV---RHGNAEAHLSRSSS  535



>ref|XP_006361945.1| PREDICTED: la-related protein-like [Solanum tuberosum]
Length=501

 Score =   301 bits (772),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 225/439 (51%), Positives = 290/439 (66%), Gaps = 16/439 (4%)
 Frame = -1

Query  1737  SFENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSE-STKASPKSATYDPLKTPS  1564
             +FE SD+ +N  KK  WNKP NG+ +  PVMGA+SWPALS+ +  +   S++ D L+T  
Sbjct  65    AFE-SDTNSNGAKKTVWNKPSNGAADVSPVMGALSWPALSDSTKASFKSSSSSDSLRTLP  123

Query  1563  DGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGs  1384
             +GSV   Q TG+A S+S +  +TNN        + VP+RQRS KR GGGNS++ A ANG 
Sbjct  124   NGSVSETQVTGMA-SASHRQANTNNANPNTMLNHVVPSRQRSMKR-GGGNSNHNASANG-  180

Query  1383  vsqpqqlqslvVEMAPNS--AGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrss  1210
             V   QQ     VE   NS  +G  G E  SRDN  RDGGQ GGFG+QS GGN++Q+ R++
Sbjct  181   VFSQQQAHGFEVETVNNSGKSGNYGAEFSSRDNNRRDGGQWGGFGAQSHGGNDHQHQRNA  240

Query  1209  prkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQ-plrvpsrpflrv  1033
              R+GN  P PRGDG+YH+ +GG RDQER NQ+W  +R +G+RDAH+Q             
Sbjct  241   NRRGNVGPHPRGDGTYHNGYGGRRDQERQNQDWKPHRGWGNRDAHMQPQRGPARPFMGAP  300

Query  1032  pppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLD  853
             P  SPP+IP  M ++P   P+VY EV P++Y PGP PD L MPML+  PP         D
Sbjct  301   PHTSPPYIPGPMHVQPYQPPMVYSEVPPVFYFPGPFPDPLRMPMLSPVPPVFV---HVPD  357

Query  852   PLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHA  673
               L  +IVNQ++YYFSN+NLIKD +LR+ MD+ GWVPV LIA FKKV  LTD+IQLIL+A
Sbjct  358   TQLQIRIVNQMDYYFSNENLIKDTFLRQNMDEHGWVPVTLIAGFKKVMELTDNIQLILNA  417

Query  672   MRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYS-ISSPQSARSPGSDVLSQHFQGVTLDDN  496
             +R+ST++EVQGE+LR RNDW  W++PPSVQ S +SSPQS     SD+L ++ Q V  DD 
Sbjct  418   VRSSTVVEVQGERLRRRNDWFHWLMPPSVQNSTVSSPQSLPKSTSDLLVENLQRVAFDDK  477

Query  495   NANEHERGNAEAHLNRSSS  439
                    GN EA L+RSSS
Sbjct  478   TVTH---GNVEARLSRSSS  493



>ref|XP_011078964.1| PREDICTED: la-related protein 1B [Sesamum indicum]
Length=494

 Score =   270 bits (691),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 218/456 (48%), Positives = 284/456 (62%), Gaps = 38/456 (8%)
 Frame = -1

Query  1818  MDSVSG-WATGNSPLPLLQDAATEAQPESFENSDSGNNAVKKPAWNKP-NGST-EAGPVM  1648
             M+SVS   A   SP P    A ++AQ   F+NSD+G  A K+PAWNKP NG+T E G VM
Sbjct  64    MESVSSSLAEEGSPAP----AGSDAQ---FDNSDNGG-AAKRPAWNKPSNGATVEIGAVM  115

Query  1647  GAVSWPALSESTKASPKSATYDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnst  1468
             GA SWPALSES +ASPK ++   LKT   GS+  PQ   +   SSPK V  + +T  +  
Sbjct  116   GADSWPALSESARASPKPSSPYSLKTLPQGSITVPQEMTVGSVSSPKEVSASISTPNHVA  175

Query  1467  pnhvPARQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVEMAPNSAGKPG--VEPYSRD  1294
                   RQ+S KR GG +S ++  ANGS+ Q   LQ  VVE  P + GK G  V   S+D
Sbjct  176   T----TRQKSMKRGGGSSSHSSIPANGSLPQALPLQDAVVEGVPPTPGKSGGSVGESSKD  231

Query  1293  NVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQE  1114
             N H+D GQRGG    S GGNE Q  RSS R+ N  P+PRG+GSYHH+HG  RDQER  Q+
Sbjct  232   NTHKDSGQRGG----SYGGNELQPQRSSFRRNNSGPQPRGEGSYHHSHG-RRDQERAKQD  286

Query  1113  W-NANRSFGSRDAHLQplrvpsrpfl--rvpppsppfipplmpmrpLGSPLVYPEV-HPM  946
             W N++RS+G+RD H Q                P  P  PP +P+RP  +P+VY EV   +
Sbjct  287   WANSHRSYGNRDNHPQQRVGSRPFMRGPAPNTPFIPPPPPPVPVRPFVAPMVYTEVPSAV  346

Query  945   YYVPGPHPDSL----VMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMY  778
             YYV GPHPD L    ++P         PV++   DP L+SKIVNQI+YYFSN+NL+KD +
Sbjct  347   YYVSGPHPDPLRPVHMIPF-------SPVYFPVPDPYLVSKIVNQIDYYFSNENLVKDTF  399

Query  777   LRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIV  598
             LR++MD +GWV ++LIA FKKV  LTD+IQLIL A++ ST++EVQG+K+R ++DW KWI+
Sbjct  400   LRQKMDSEGWVSIKLIAGFKKVMQLTDNIQLILDAIQASTVVEVQGDKVRRKSDWNKWII  459

Query  597   PPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNA  490
              P VQ + +SPQ        +L+     V LD+  A
Sbjct  460   SP-VQTTATSPQPIHESSQSMLTAQLNSVALDEKAA  494



>ref|XP_010646870.1| PREDICTED: la-related protein 1C isoform X1 [Vitis vinifera]
 ref|XP_010646871.1| PREDICTED: la-related protein 1C isoform X1 [Vitis vinifera]
 emb|CBI22123.3| unnamed protein product [Vitis vinifera]
Length=568

 Score =   263 bits (673),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 233/512 (46%), Positives = 302/512 (59%), Gaps = 42/512 (8%)
 Frame = -1

Query  1914  WTQIV-GESELvpvvvippqcppspstsVAQEHM----DSVSGWATGNSPLPLLQDAATE  1750
             WTQ+V GESE               S   +QE +    D     AT +SP      +  E
Sbjct  41    WTQVVRGESE--------SITAAPSSPVSSQEQIVVSSDCSPTKATSDSPASPEDSSQVE  92

Query  1749  AQPESFENSDSGN-NAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPL  1576
             AQ    E+SD+GN NA K+PAWNKP NG  E GPVMGA SWPALSES +AS KSA+   L
Sbjct  93    AQ---LESSDNGNGNAGKRPAWNKPSNGVAEVGPVMGASSWPALSESARASAKSASDS-L  148

Query  1575  KTPSDGSVPPP------QGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGN  1414
             K+P+DGS+  P      QG+G A S S K V+ N   +   +      RQ+S KR  G  
Sbjct  149   KSPTDGSISTPPAQVHVQGSGNASSPSHKQVNNNPIPSSTPSHALP-TRQKSMKR--GDR  205

Query  1413  SSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGN  1234
             S  ++ AN  + QP   Q  V+E+ PN++       ++  ++H +GGQRGGF  QS  GN
Sbjct  206   SGGSSSANAGLPQPAAPQGPVMEVPPNNSSP---RDHTNRSIHPEGGQRGGFVPQSHSGN  262

Query  1233  ENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvp  1054
             +  + R S RKGN  P  RGDGS+HH +GG RDQ+R N +WN +R+F +R+ H+QP  V 
Sbjct  263   DYPHQRGSYRKGNSAPHSRGDGSHHHGYGGRRDQDRVNHDWNPHRNF-NREPHMQPRVVA  321

Query  1053  srpflrvpppsppfipplmpmrpLGSPLVYPE----VHPMYYVPGPHPDSL-VMPMLASp  889
                       S  FI P       G+P++Y E    V  + YVP PH D L  +P +A  
Sbjct  322   RGFIRPPSHSSAQFIAPPHLRPF-GNPILYQELASPVSQVVYVPAPHADPLRTVPFVAPM  380

Query  888   ppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVA  709
             P       Q  D  L +K+V QI+YYFSN+NLIKD+YLR+ MD+QGWVPV+LIA FKKV 
Sbjct  381   PHPMFFPPQ--DHQLHAKLVAQIDYYFSNENLIKDIYLRQNMDEQGWVPVKLIAGFKKVK  438

Query  708   VLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYS-ISSPQSARSPGSDVL  532
             +LT++IQLIL A+RTST++EVQG+KLR R DW KWI+PPSVQ+S +SSPQS  S   D L
Sbjct  439   LLTENIQLILEAVRTSTVVEVQGDKLRKRGDWMKWIMPPSVQFSPLSSPQSIGSSSYDTL  498

Query  531   SQHFQGVTLDDNNANEHE-RGNAEAHLNRSSS  439
             +  FQ VTL +   N    R  A+ H+   SS
Sbjct  499   AARFQNVTLGEQTTNYSTVRSEADVHVEAFSS  530



>ref|XP_010646872.1| PREDICTED: la-related protein 1C isoform X2 [Vitis vinifera]
Length=561

 Score =   257 bits (657),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 231/508 (45%), Positives = 297/508 (58%), Gaps = 41/508 (8%)
 Frame = -1

Query  1914  WTQIV-GESELvpvvvippqcppspstsVAQEHM----DSVSGWATGNSPLPLLQDAATE  1750
             WTQ+V GESE               S   +QE +    D     AT +SP      +  E
Sbjct  41    WTQVVRGESE--------SITAAPSSPVSSQEQIVVSSDCSPTKATSDSPASPEDSSQVE  92

Query  1749  AQPESFENSDSGN-NAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPL  1576
             AQ    E+SD+GN NA K+PAWNKP NG  E GPVMGA SWPALSES +AS KSA+   L
Sbjct  93    AQ---LESSDNGNGNAGKRPAWNKPSNGVAEVGPVMGASSWPALSESARASAKSASDS-L  148

Query  1575  KTPSDGSVPPP------QGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGN  1414
             K+P+DGS+  P      QG+G A S S K V+ N   +   +      RQ+S KR  G  
Sbjct  149   KSPTDGSISTPPAQVHVQGSGNASSPSHKQVNNNPIPSSTPSHALP-TRQKSMKR--GDR  205

Query  1413  SSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGN  1234
             S  ++ AN  + QP   Q  V+E+ PN++       ++  ++H +GGQRGGF  QS  GN
Sbjct  206   SGGSSSANAGLPQPAAPQGPVMEVPPNNSSP---RDHTNRSIHPEGGQRGGFVPQSHSGN  262

Query  1233  ENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvp  1054
             +  + R S RKGN  P  RGDGS+HH +GG RDQ+R N +WN +R+F +R+ H+QP  V 
Sbjct  263   DYPHQRGSYRKGNSAPHSRGDGSHHHGYGGRRDQDRVNHDWNPHRNF-NREPHMQPRVVA  321

Query  1053  srpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSL-VMPMLASpppgp  877
                       S  FI P          L  P V  + YVP PH D L  +P +A  P   
Sbjct  322   RGFIRPPSHSSAQFIAPPHLRPFE---LASP-VSQVVYVPAPHADPLRTVPFVAPMPHPM  377

Query  876   PVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTD  697
                 Q  D  L +K+V QI+YYFSN+NLIKD+YLR+ MD+QGWVPV+LIA FKKV +LT+
Sbjct  378   FFPPQ--DHQLHAKLVAQIDYYFSNENLIKDIYLRQNMDEQGWVPVKLIAGFKKVKLLTE  435

Query  696   DIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYS-ISSPQSARSPGSDVLSQHF  520
             +IQLIL A+RTST++EVQG+KLR R DW KWI+PPSVQ+S +SSPQS  S   D L+  F
Sbjct  436   NIQLILEAVRTSTVVEVQGDKLRKRGDWMKWIMPPSVQFSPLSSPQSIGSSSYDTLAARF  495

Query  519   QGVTLDDNNANEHE-RGNAEAHLNRSSS  439
             Q VTL +   N    R  A+ H+   SS
Sbjct  496   QNVTLGEQTTNYSTVRSEADVHVEAFSS  523



>ref|XP_010266852.1| PREDICTED: la-related protein 1C-like [Nelumbo nucifera]
Length=561

 Score =   248 bits (633),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 206/457 (45%), Positives = 276/457 (60%), Gaps = 26/457 (6%)
 Frame = -1

Query  1758  ATEAQPESFENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYD  1582
             A++ Q E  +N  S     KKPAWNKP NG  E GPVMGAVSWPALSESTK+ PKS+T D
Sbjct  87    ASDGQLE-IDNETSNVARAKKPAWNKPSNGVVELGPVMGAVSWPALSESTKSLPKSST-D  144

Query  1581  PLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNT  1402
              LK  SDGS+  PQG  IA  SSP+   TNNT   +   +  P RQ+S KR        +
Sbjct  145   SLKGLSDGSISIPQGPVIA--SSPQKQSTNNTNANSIPNHAFPVRQKSMKRG----GGGS  198

Query  1401  ALANGsvsqpqqlqslvVEMAPNS-AGKPG-VEPYS--RDNVHR----DGGQRGGFGSQS  1246
               ANG    P  L   V+E   N+ +GKP  V P S  +D+ H+    + G RGGF SQS
Sbjct  199   GPANGITQPPPPLPPPVMETPNNNKSGKPAPVVPESAPKDHGHKSNNWETGPRGGFVSQS  258

Query  1245  IGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNAN--RSFGSRDAHL  1072
              GGN+    R+S R+GNG   PRGDG +H+ +GG RD +RGN EWN++  RSF  RD H+
Sbjct  259   HGGNDQPQQRNSFRRGNGGSNPRGDGPHHNNYGGRRDPDRGNYEWNSHSHRSFNGRDVHM  318

Query  1071  Qplrvpsrpflrvpppsppfipplmp-mrpLGSPLVYPEV-HPMYYVPGPHPDSLVMPML  898
             Q  RV  R F+R PPP         P ++  G P+ +P++  P+++VP   P    MP +
Sbjct  319   QQQRVIPRGFIRPPPPPNSTTFISPPPVQQFGGPMGFPDMTSPVFFVPA-SPGMSGMPFI  377

Query  897   ASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFK  718
               PPP   +F+   DP L + +V QI+YYFS +NL KD++LR+ MD+QGWV   LI+TF 
Sbjct  378   PHPPPPHAMFFPAPDPQLRAMLVRQIDYYFSPENLCKDIFLRQNMDEQGWVSASLISTFN  437

Query  717   KVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISS-PQSARSPGS  541
             +V  LT++I  IL A+R+ST++EVQG+K+R RN+W  W +PP  Q++ +S  QS   P  
Sbjct  438   RVKQLTNNISFILDAVRSSTIVEVQGDKIRKRNEWMNWPLPPYGQFATASGSQSPSIPSY  497

Query  540   DVLSQHFQGVTLDDNNANEHE---RGNAEAHLNRSSS  439
             D+L+   Q + LDD     H      + EA ++RSSS
Sbjct  498   DMLATRVQNIGLDDGKGTNHSNLTEFHTEAVISRSSS  534



>ref|XP_006467003.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Citrus 
sinensis]
Length=504

 Score =   243 bits (620),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 195/429 (45%), Positives = 248/429 (58%), Gaps = 33/429 (8%)
 Frame = -1

Query  1719  SGNNAVKKPAWNK--PNGSTEAGPVMGAVSWPALSESTKASPKSATYDP--LKTPSDGSV  1552
             +GN   K+P WN+   NG+ E  PVMGA SWPALSE+T+ S  S       LK   DGS 
Sbjct  72    NGNAGSKRPPWNRQPSNGAAEMEPVMGAHSWPALSETTRGSSSSTKSSSDSLKGLVDGSS  131

Query  1551  PPP---QGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsv  1381
                   QGT    SSS K V  N      +       RQRS KR    +SSN  L     
Sbjct  132   SSSSVLQGTAATNSSSHKQVSNNANPNSTTNHAAPN-RQRSMKRNNSHSSSNGGLP----  186

Query  1380  sqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprk  1201
                           P S G   VE  S +   RD  Q+ GFGSQ  GGN++ + R S + 
Sbjct  187   ------------QPPASQGSV-VEGRSNNPSPRDHTQKSGFGSQFHGGNDHPHPRGSFKH  233

Query  1200  gngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvppps  1021
              NG   PRGDGS+HH +GG RDQ+RGNQ+WN++R++  RDAH+QP RV  R     PPP 
Sbjct  234   RNGNQHPRGDGSHHHNYGGRRDQDRGNQDWNSHRNYSGRDAHMQPQRVVQRFTRHPPPPP  293

Query  1020  ppfipplmpmrpL------GSPLVYPEV-HPMYYVPGPHPDSLVMPMLASpppgpPVFYQ  862
             PP  P   P  P       GSP+ +PE   P+YYV    P++L      +P P   VF+ 
Sbjct  294   PPPPPSSSPFIPPPPVRPFGSPIGFPEFASPVYYVAAAPPEALRGVPFVAPIPPHAVFFP  353

Query  861   FLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLI  682
               DP L S+IV QI+YYFSN+NL+KD +LR+ MDDQGWVP+RLIA F KV++LTD+IQLI
Sbjct  354   APDPQLHSRIVTQIDYYFSNENLVKDTFLRQNMDDQGWVPIRLIAGFNKVSLLTDNIQLI  413

Query  681   LHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLD  502
             L A+R+ST++EVQG+++R RNDW +WI+PP    S+ SPQS    G D+LS   Q ++LD
Sbjct  414   LDALRSSTVVEVQGDRIRKRNDWMRWIMPPGKFSSLPSPQSQGKSGIDMLSAQVQSISLD  473

Query  501   DNNANEHER  475
                 N H R
Sbjct  474   QKTLN-HSR  481



>ref|XP_008242034.1| PREDICTED: la-related protein 1C-like [Prunus mume]
Length=544

 Score =   243 bits (619),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 192/424 (45%), Positives = 249/424 (59%), Gaps = 40/424 (9%)
 Frame = -1

Query  1731  ENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDG-  1558
             E S++GN A K+PAWNKP NG+ E GPVMGAVSWPALSES +AS K  + +PLK  S+  
Sbjct  115   EGSENGN-AGKRPAWNKPSNGAVEVGPVMGAVSWPALSESARASTK-LSPEPLKGVSEPP  172

Query  1557  -SVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsv  1381
              SV   QGTG  P+SSPK V++++T           ARQR  KR   G SSN  L     
Sbjct  173   LSVSVSQGTGTTPTSSPKQVNSSSTPNHTGP-----ARQRPMKRNNAGASSNGGLP----  223

Query  1380  sqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprk  1201
              Q Q      VEM PN+       P  +++ HR        GSQS   N++   R+S R 
Sbjct  224   -QHQSSAGQGVEMVPNN-------PSPKEHTHRSA-----IGSQSHSNNDHPQQRNSLRS  270

Query  1200  gngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvppps  1021
              NG   PRGDGS+HH +   RDQ+RG Q+WN +R+F +RD H+ P R   R       P 
Sbjct  271   RNGGSHPRGDGSHHHNY--RRDQDRGGQDWNTHRNFNNRDNHMHPQRSVPRMMRPHQTPP  328

Query  1020  ppfipplm-----pmrpLGSPLVYPEVHP--MYYVPGPHPDSLVMPMLASpppgpPVFYQ  862
             PP            MR  G P+ + E+ P  +Y    PH + L +P +A  P   P+ + 
Sbjct  329   PPPPNAAQFIHQPQMRAFGGPIGF-EMQPQLVYVTHTPH-EPLGVPFVA--PMRHPMVFP  384

Query  861   FLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLI  682
               DP L +KI+NQIEYYFSNDNLIKD +LR+ MDDQGWV ++LIA F KV  LTD+IQLI
Sbjct  385   APDPQLHTKIINQIEYYFSNDNLIKDTFLRRNMDDQGWVRIKLIAGFNKVMNLTDNIQLI  444

Query  681   LHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLD  502
             L AMR ST++EVQG+K+R RNDW +W++P +   + S  Q+    G D+LS   Q + LD
Sbjct  445   LDAMRMSTVVEVQGDKIRRRNDWMRWVMPTAQPPNASGSQALGKSGQDILSAQIQSIALD  504

Query  501   DNNA  490
             +  A
Sbjct  505   EKTA  508



>ref|XP_008337981.1| PREDICTED: la-related protein 1C [Malus domestica]
Length=541

 Score =   242 bits (618),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 183/420 (44%), Positives = 244/420 (58%), Gaps = 39/420 (9%)
 Frame = -1

Query  1731  ENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSAT--YDPLKTPSD  1561
             E SD+GN A K+PAWNKP NG+ E GPVMGAVSWPALSES +AS KS++     +  PS 
Sbjct  114   EGSDNGN-AGKRPAWNKPSNGAVEVGPVMGAVSWPALSESARASTKSSSESLKGVSEPSL  172

Query  1560  GSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsv  1381
              SV  PQGTGI   SSPK  + +              RQRS KR    N++N A +NG  
Sbjct  173   LSVSVPQGTGITTISSPKQGNPSTPNHTGL------MRQRSMKR----NNAN-ASSNGGA  221

Query  1380  sqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprk  1201
              Q Q       E+       P   P  +++ HR+      FGSQS   N++   R+S R 
Sbjct  222   PQHQSSSGQGGEL-------PSSNPPPKEHTHRNA-----FGSQSHSNNDHPQQRNSFRN  269

Query  1200  gngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQp-----lrvpsrpflr  1036
              N    PRG+GS+H+     RDQ+RGNQ+WN+ R+F +RD H+         +       
Sbjct  270   RNSGSHPRGEGSHHNYR---RDQDRGNQDWNSPRNFNNRDNHMHSPRGVPRMMRPHQTPP  326

Query  1035  vpppsppfipplmpmrpLGSPLVYP-EVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQF  859
              PPP+         MR  G P+ +  + H + YV    P   ++P +A  P   P+ +  
Sbjct  327   PPPPNAAQFIHQPQMRAFGGPIGFDMQPHQLVYV-AHSPHEPLVPFVA--PLRHPMMFPA  383

Query  858   LDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLIL  679
              DP L +KI+NQI+YYFSNDNLIKD YLR+ MDDQGWV ++LIA FKKV  LTD+IQLIL
Sbjct  384   PDPQLHTKIINQIDYYFSNDNLIKDTYLRRNMDDQGWVRIKLIAGFKKVLSLTDNIQLIL  443

Query  678   HAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDD  499
              AMR ST++EVQG+K+R RNDW++W++P +   + S  Q+  + G D LS H Q + LD+
Sbjct  444   DAMRMSTVVEVQGDKIRRRNDWERWVMPAAQPPNASGSQALGNSGPDTLSAHIQSIALDE  503



>gb|KDO71314.1| hypothetical protein CISIN_1g039779mg, partial [Citrus sinensis]
Length=471

 Score =   240 bits (613),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 195/428 (46%), Positives = 248/428 (58%), Gaps = 32/428 (7%)
 Frame = -1

Query  1719  SGNNAVKKPAWNK--PNGSTEAGPVMGAVSWPALSESTKASPKSATYDP--LKTPSDGSV  1552
             +GN   K+P WN+   NG+ E  PVMGA SWPALSE+T+ S  S       LK   DGS 
Sbjct  40    NGNAGSKRPPWNRQPSNGAAEMEPVMGAHSWPALSETTRGSSSSTKSSSDSLKGSVDGSS  99

Query  1551  PPP--QGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvs  1378
                  QGT    SSS K V  N      +       RQRS KR    +SSN  L      
Sbjct  100   SSSVLQGTAATNSSSHKQVSNNANPNSTTNHAASN-RQRSMKRNNSHSSSNGGLP-----  153

Query  1377  qpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprkg  1198
                          P S G   VE  S +   RD  Q+ GFGSQ  GGN++ + R S +  
Sbjct  154   -----------QPPASQGSV-VEGRSNNPSPRDHTQKSGFGSQFHGGNDHPHPRGSFKHR  201

Query  1197  ngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsp  1018
             NG   PRGDGS+HH +GG RDQ+RGNQ+WN++R++  RDAH+QP RV  R     PPP P
Sbjct  202   NGNQHPRGDGSHHHNYGGRRDQDRGNQDWNSHRNYSGRDAHMQPQRVVQRFTRHPPPPPP  261

Query  1017  pfipplmpmrpL------GSPLVYPEV-HPMYYVPGPHPDSLVMPMLASpppgpPVFYQF  859
             P  P   P  P       GSP+ +PE   P+YYV    P++L      +P P   VF+  
Sbjct  262   PPPPSSSPFIPPPPVRPFGSPIGFPEFASPVYYVAAAPPEALRGVPFVAPIPPHAVFFPA  321

Query  858   LDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLIL  679
              DP L S+IV QI+YYFSN+NL+KD +LR+ MDDQGWVP+RLIA F KV++LTD+IQLIL
Sbjct  322   PDPQLHSRIVTQIDYYFSNENLVKDTFLRQNMDDQGWVPIRLIAGFNKVSLLTDNIQLIL  381

Query  678   HAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDD  499
              A+R+ST++EVQG+++R RNDW +WI+PP    S+ SPQS    G D+LS   Q ++LD 
Sbjct  382   DALRSSTVVEVQGDRIRKRNDWMRWIMPPGKFSSLPSPQSQGKSGIDMLSAQVQSISLDQ  441

Query  498   NNANEHER  475
                N H R
Sbjct  442   KTLN-HSR  448



>ref|XP_007204320.1| hypothetical protein PRUPE_ppa003845mg [Prunus persica]
 gb|EMJ05519.1| hypothetical protein PRUPE_ppa003845mg [Prunus persica]
Length=544

 Score =   240 bits (613),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 189/424 (45%), Positives = 247/424 (58%), Gaps = 40/424 (9%)
 Frame = -1

Query  1731  ENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDG-  1558
             E S++GN A K+PAWNKP NG+ E GPVMGAVSWPALSES +AS K  + +PLK  S+  
Sbjct  115   EGSENGN-AGKRPAWNKPSNGAIEVGPVMGAVSWPALSESARASTK-LSPEPLKGVSEPP  172

Query  1557  -SVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsv  1381
              SV   QGTG  P+SSPK V++++T           ARQRS KR     SSN  L     
Sbjct  173   LSVSMSQGTGTTPTSSPKQVNSSSTPNHTGP-----ARQRSMKRNNASASSNGGLPQHQ-  226

Query  1380  sqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprk  1201
                            +SAG+ GVE    +   ++   R   GSQS   N++   R+S R 
Sbjct  227   ---------------SSAGQ-GVETVPNNPSPKEHTHRSAIGSQSHSNNDHPQQRNSFRN  270

Query  1200  gngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvppps  1021
              NG   PRGDGS+HH +   RDQ+RG Q+WN +R+F +RD H+ P R   R       P 
Sbjct  271   RNGGSHPRGDGSHHHNY--RRDQDRGGQDWNTHRNFNNRDNHMHPQRSVPRMMRPHQTPP  328

Query  1020  ppfipplm-----pmrpLGSPLVYPEVHP--MYYVPGPHPDSLVMPMLASpppgpPVFYQ  862
             PP            MR  G P+ + E+ P  +Y    PH + L +P +A  P   P+ + 
Sbjct  329   PPPPNAAQFIHQPQMRAFGGPIGF-EMQPQLVYVTHTPH-EPLGVPFVA--PMRHPMVFP  384

Query  861   FLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLI  682
               DP L +KI+NQIEYYFSNDNLIKD +LR+ MDDQGWV ++LIA F KV  LTD+IQLI
Sbjct  385   APDPQLHTKIINQIEYYFSNDNLIKDTFLRRNMDDQGWVRIKLIAGFNKVMNLTDNIQLI  444

Query  681   LHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLD  502
             L AMR ST++EVQG+K+R RNDW +W++P +   + S  Q+    G D+LS   Q + LD
Sbjct  445   LDAMRMSTVVEVQGDKIRRRNDWMRWVMPTAQPPNASGSQALGKSGQDILSAQIQSIALD  504

Query  501   DNNA  490
             +  A
Sbjct  505   EKTA  508



>ref|XP_009363455.1| PREDICTED: la-related protein 1C-like [Pyrus x bretschneideri]
Length=531

 Score =   237 bits (605),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 201/487 (41%), Positives = 271/487 (56%), Gaps = 47/487 (10%)
 Frame = -1

Query  1914  WTQIV-GESELvpvvvippqcppspstsVAQEHMDSVSGWA---TGNSPLPLLQDAATEA  1747
             WTQIV GESEL+  V   P    +     A       S ++   T ++  P L  ++   
Sbjct  48    WTQIVRGESELIAAVPSSPSAGVTEPAVAAAAPPPLPSSFSANQTQSNSAPQLNSSSPPP  107

Query  1746  QPESF-ENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSAT--YDP  1579
               ES  E SD+GN A K+PAWNKP NG+ E GPVMGAVSWPALSES +AS KS++     
Sbjct  108   VEESVGEGSDNGN-AGKRPAWNKPSNGAVEVGPVMGAVSWPALSESARASTKSSSESLKG  166

Query  1578  LKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTA  1399
             +  PS  SV  PQGTGI   SSPK  + +              RQRS KR    N++N +
Sbjct  167   VSEPSLLSVSVPQGTGITTISSPKQGNPSTPNHTGP------TRQRSMKR----NNANAS  216

Query  1398  LANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYT  1219
               NG   Q Q       E+       P   P  +++ HR+      FGSQS   N++   
Sbjct  217   F-NGGAPQHQSSAGQGGEL-------PSSNPPPKEHTHRNA-----FGSQSHSNNDHPQQ  263

Query  1218  rssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQp------lrv  1057
             R+S R  N    PRG+G    +H   RDQ+RGNQ+WN++R+F +RD H+        +  
Sbjct  264   RNSFRNRNVGSHPRGEG----SHNYRRDQDRGNQDWNSHRNFNNRDNHMHSPRGVPRMMR  319

Query  1056  psrpflrvpppsppfipplmpmrpLGSPLVYP-EVHPMYYVPGPHPDSLVMPMLASpppg  880
             P +     PPP+         MR  G P+ +  + H + YV    P   ++P +A P   
Sbjct  320   PHQTPPPPPPPNAAQFIHQPQMRAFGGPIGFDMQPHQLVYVTH-SPHEPLVPFVA-PLRH  377

Query  879   pPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLT  700
             P +F    DP L +KI+NQI+YYFSNDNLIKD YLR+ MDDQGWV ++LIA FKKV  LT
Sbjct  378   PMMFAP--DPQLHTKIINQIDYYFSNDNLIKDTYLRRNMDDQGWVRIKLIAGFKKVLSLT  435

Query  699   DDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHF  520
             D+IQLIL AMR ST++EVQG+K+R R+DW++W++P +   + S  Q   + G D+LS H 
Sbjct  436   DNIQLILDAMRMSTVVEVQGDKIRRRSDWERWVMPAAQPPNASGSQVLGNSGPDMLSAHI  495

Query  519   QGVTLDD  499
             Q + LD+
Sbjct  496   QSIALDE  502



>ref|XP_007046622.1| Winged-helix DNA-binding transcription factor family protein, 
putative [Theobroma cacao]
 gb|EOX90779.1| Winged-helix DNA-binding transcription factor family protein, 
putative [Theobroma cacao]
Length=533

 Score =   236 bits (601),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 205/444 (46%), Positives = 267/444 (60%), Gaps = 48/444 (11%)
 Frame = -1

Query  1764  DAATEAQPESFENSDSG--NNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKS  1594
             +AA E   E  EN  SG   NA K+PAWNKP NG+ E G VMGA  WPALSES + S KS
Sbjct  76    NAAVEE--EGVENGGSGPNGNAGKRPAWNKPSNGAAEFGAVMGAHMWPALSESARVSSKS  133

Query  1593  ATYDPLKTPSDGS----VPPPQGTGIAPSSSPKpvhtnntttpnstpnhvP--ARQRSNK  1432
             ++     +P DGS    VP  QG+G A SSS +   +NN  + ++   +     RQRS K
Sbjct  134   SSDSSKASP-DGSSSPAVPVSQGSGNALSSSSQKQVSNNVNSNSNATPNNAMPVRQRSMK  192

Query  1431  RAGGGNSSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGS  1252
             R    NS+N+A   G      Q Q  V E   N             N  RD  QRGGF S
Sbjct  193   R----NSNNSASNGGLTQPQPQPQGPVAEATAN-------------NPSRDHIQRGGFVS  235

Query  1251  Q-SIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAH  1075
             Q   GGN++ + R+S R  NG P PRGDGS+H  +GG R+Q+ GNQ+WN  R+F SRD H
Sbjct  236   QPHSGGNDHPHPRNSFRNRNGGPHPRGDGSHHQNYGGRRNQDHGNQDWNG-RNFNSRDGH  294

Query  1074  LQplrvpsrpflrvpppsppfipplmp--mrpLGSPLVYPEV-HPMYYVPGPHPDSLV-M  907
             +QP  V        PPP P   P + P  +RP G+P+ +PE+   +Y +P P P+SL  +
Sbjct  295   MQPRVVSRLMRHPPPPPPPNTAPFITPPPVRPFGTPMGFPELPSHVYLLPAPPPESLRGV  354

Query  906   PMLASpppgpPVFYQFLDPL---LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVR  736
             P +A   P P VF+   +P    L ++IVNQI+YYFSN+NLIKD YLR+ MDDQGWV ++
Sbjct  355   PFVA---PMPQVFFPAPEPQDHQLHARIVNQIDYYFSNENLIKDTYLRQNMDDQGWVSIK  411

Query  735   LIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSA  556
             LIA FKKV+ LTD+IQLIL A+R+ST++EVQG+K+R R DW +WI+PPSVQ+   S    
Sbjct  412   LIAGFKKVSFLTDNIQLILDALRSSTVVEVQGDKVRKRIDWMRWIMPPSVQFPTMS----  467

Query  555   RSPGSDVLSQHFQGVTLDDNNANE  484
                G D+L    Q ++LD   AN+
Sbjct  468   ---GQDMLVSRVQNISLDQRTANQ  488



>ref|XP_008393834.1| PREDICTED: la-related protein 1C [Malus domestica]
Length=542

 Score =   236 bits (601),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 176/419 (42%), Positives = 238/419 (57%), Gaps = 39/419 (9%)
 Frame = -1

Query  1731  ENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDP--LKTPSD  1561
             E S++GN A K+PAWNKP NG+ E G VMGAVSWPALSES +AS KS++  P  +  PS 
Sbjct  114   EGSENGN-AGKRPAWNKPSNGAVEVGSVMGAVSWPALSESARASTKSSSESPKGVSEPSL  172

Query  1560  GSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsv  1381
              S+   QGTG  P+SSPK  + +       T      R  SN  + GG            
Sbjct  173   LSISVSQGTGTXPTSSPKQGNPSTPNHTGPTRQKSMKRNNSNASSNGG------------  220

Query  1380  sqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprk  1201
                         +  +SAG+ GVE  S +   ++   R  FGSQS   N++   R+S R 
Sbjct  221   ----------APLHQSSAGQ-GVELPSNNPSPKEHTPRNAFGSQSHSNNDHPQQRNSFRN  269

Query  1200  gngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQp-----lrvpsrpflr  1036
              NG   PRG+GS+H+     RDQ+RGNQ+WN +R+F +RD H+         +       
Sbjct  270   RNGGSHPRGEGSHHNYR---RDQDRGNQDWNTHRNFNNRDNHMHSPRGVPRMMRPHQTPP  326

Query  1035  vpppsppfipplmpmrpLGSPLVYP-EVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQF  859
              PPP+         MR  G P+ +  + H + YV    P   ++P +A  P   P+ +  
Sbjct  327   PPPPNAAQFIHQPQMRAFGGPIGFDMQPHQLVYVTHA-PHEPLVPFVA--PLRHPMMFPA  383

Query  858   LDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLIL  679
              DP L +KI+NQI+YYFSNDNLIKD YLR+ MDDQGWV ++LI  FKKV  LTD+IQLIL
Sbjct  384   PDPHLHTKIINQIDYYFSNDNLIKDTYLRRNMDDQGWVRIKLIVGFKKVMSLTDNIQLIL  443

Query  678   HAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLD  502
              AMR ST++EVQG+K+R RNDW++W++P +   + S  Q+    G D+LS H Q + LD
Sbjct  444   DAMRMSTVVEVQGDKIRRRNDWERWVMPAAEPPNASGSQTPGKAGPDMLSAHIQSIALD  502



>ref|XP_010266025.1| PREDICTED: la-related protein 1C-like isoform X1 [Nelumbo nucifera]
Length=574

 Score =   234 bits (597),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 198/453 (44%), Positives = 268/453 (59%), Gaps = 51/453 (11%)
 Frame = -1

Query  1701  KKPAWNK-PNGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGSVPPPQGTGIA  1525
             K+ AWNK  NG+ E GPVMGAVSWPALSESTKA PKS+T D LK  SDGSV  PQG  + 
Sbjct  102   KRQAWNKLSNGAVELGPVMGAVSWPALSESTKALPKSST-DSLKGLSDGSVSIPQGPIV-  159

Query  1524  PSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVE  1345
              +SS +   TNN TT ++  +    RQ+S KR GGG  S    ANG+ SQP         
Sbjct  160   -TSSQQKESTNNATTNSTPNHVFSTRQKSMKRGGGGGGS----ANGNFSQPPPPPPAPAM  214

Query  1344  MAP--NSAGKPG---VEPYSRDNVHR----DGGQRGGFGSQSIGGNENQYTrssprkgng  1192
               P  N +GKP    +E   RD  H+    + GQRGGF SQS  GN++   R+S R+GNG
Sbjct  215   EMPQNNKSGKPPQVVLESAPRDPSHKSNNWETGQRGGFVSQSHIGNDHPQQRNSFRRGNG  274

Query  1191  rprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppf  1012
                PR DG++H+ +G  RDQ+RGN EWN++R F  RD H+Q  R+  R F+R PPP+   
Sbjct  275   GSHPRSDGTHHNNYGSRRDQDRGNHEWNSHRGFNGRDVHMQQQRMVPRGFIRPPPPNSTP  334

Query  1011  ipplmpmrpLGSPLVYPEV------------HPMYYVPGPHPDSLVMPMLASpppgpPVF  868
                  P+RP G+P+ +P+V             P   VP  H               PP+F
Sbjct  335   FIGPPPVRPFGNPMGFPDVTSPVYYVPAPPPEPFRGVPFIH------------HTPPPMF  382

Query  867   YQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQ  688
             +  LDP L + +V QI+YYFS +NL KD++LR+ MD+QGWVPV LI++F +V  LT++I 
Sbjct  383   FPTLDPQLCAMLVRQIDYYFSPENLCKDIFLRQNMDEQGWVPVSLISSFNRVKQLTNNIP  442

Query  687   LILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSIS-SPQSARSPGSDVLSQHFQGV  511
              IL A+R+ST++EVQG+K+R RN+W  W +PP  Q+  S  PQS   P  ++L+   Q +
Sbjct  443   FILEAVRSSTVVEVQGDKIRRRNEWMNWPLPPYGQFVTSPGPQSPTVPSYNLLASRVQSI  502

Query  510   TLDDNNANEHER---------GNAEAHLNRSSS  439
              LD+ +  +  +          ++EA L+RSSS
Sbjct  503   GLDEVHEEKSTKDISKRNSTDSHSEAILSRSSS  535



>ref|XP_006383055.1| La domain-containing family protein [Populus trichocarpa]
 gb|ERP60852.1| La domain-containing family protein [Populus trichocarpa]
Length=549

 Score =   230 bits (586),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 197/459 (43%), Positives = 259/459 (56%), Gaps = 51/459 (11%)
 Frame = -1

Query  1713  NNAVKKPAWNKP----NGSTEAGPVMGAVSWPALSESTKASPKSATYDP--LKTPSDGSV  1552
             NNA K+P WNKP    NG  E G VMGA SWPALSES   +  S       LK       
Sbjct  89    NNASKRPVWNKPLTASNGPVEIGNVMGADSWPALSESAARASSSTKSSSDSLKGSLSDGS  148

Query  1551  PPP----QGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGs  1384
                    QG G A SSS K V  +  T   S       RQRS KR+G   +SN       
Sbjct  149   SSSVSVSQGIGTASSSSQKQVANSANTNSTSNHIVP-VRQRSMKRSGANTTSNGG-----  202

Query  1383  vsqpqqlqslvVEMAPNSAGKPGV--EPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrss  1210
                           AP S G  G   E +S ++   D GQR    SQS   N++   R+S
Sbjct  203   --------------APQSPGSQGTTGEGHSNNSSSGDHGQRN---SQSRSFNDHPQQRNS  245

Query  1209  prkgngrprprgdgSYHHAHGGAR-DQERGNQEWNANRSFGSRDAHLQplrvpsrpflrv  1033
              R  NG P  RGDGS+HH++GG R DQ+R NQ+WNA+R+F     H+QP    S   +R 
Sbjct  246   FRNRNGGPHSRGDGSHHHSYGGRRNDQDRSNQDWNAHRNFNRDGGHVQPSPGVSARLMRH  305

Query  1032  pppsppfipplmpmrpL-----GSPLVYPEVH-PMYYVPGPHPDSLV-MPMLASpppgpP  874
             PPP PP                 SP+ +P++  P+YYV  PHPDS+  +P++A+P P   
Sbjct  306   PPPPPPPPAAATTFVAPPPVRPFSPMGFPDMRSPLYYV-APHPDSMRGVPIIAAPIPPHA  364

Query  873   VFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDD  694
             VF+   DP L +KI+ QI+YYFSN+NLIKD+YLRK MDDQGWVP++LIA+F KV +LTD+
Sbjct  365   VFFSS-DPQLHNKILRQIDYYFSNENLIKDLYLRKNMDDQGWVPIKLIASFNKVLLLTDN  423

Query  693   IQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQY-SISSPQSARSPGSDVLSQHFQ  517
             IQLIL A+R S+++E+QGEK+R RNDW +WI+   +Q+ ++SSPQS    G D+L+ + Q
Sbjct  424   IQLILDAIRNSSVVEIQGEKVRKRNDWLRWIMTTPIQFPNVSSPQSGEKSGHDMLAANVQ  483

Query  516   GVTLDD-----NNANEHERGNAEAHLNRSSSE*KNSRVQ  415
             G++L++     +N         EA L RS S   NS+ Q
Sbjct  484   GISLEEMTAGHSNVRSQADVRTEAFLGRSLSGDFNSQSQ  522



>ref|XP_011043135.1| PREDICTED: la-related protein 1C [Populus euphratica]
Length=548

 Score =   220 bits (561),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 195/454 (43%), Positives = 256/454 (56%), Gaps = 50/454 (11%)
 Frame = -1

Query  1701  KKPAWNKP----NGSTEAGPVMGAVSWPALSESTKASPKSATYDP--LKTPSDGSVPPPQ  1540
             K+P WNKP    NG  E G VMGA SWPALSES   +  S       LK           
Sbjct  93    KRPVWNKPLTASNGPVEIGNVMGADSWPALSESAARASSSTKSSSDSLKGSLSDGSSSSV  152

Query  1539  GT--GIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvsqpqq  1366
                 GI  SSS K V  +  T   S       RQRS KR+G   +SN             
Sbjct  153   SVSQGIGTSSSQKQVANSANTNSTSNHIVP-VRQRSMKRSGANTTSNGG-----------  200

Query  1365  lqslvVEMAPNSAGKPGV--EPYSRDNVHRDGGQRGGFGSQSIGGNEN-QYTrssprkgn  1195
                     AP S G  G   E +S ++   D GQR    SQS   N++ Q  R+S R  N
Sbjct  201   --------APQSPGSQGATGEGHSNNSSSGDHGQRN---SQSRSFNDHPQQQRNSFRNRN  249

Query  1194  grprprgdgSYHHAHGGAR-DQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsp  1018
             G P  RGDGS+HH++GG R DQ+R NQ+WNA+R+F     H+QP    S   +R PPP P
Sbjct  250   GGPHSRGDGSHHHSYGGRRNDQDRSNQDWNAHRNFNRDGGHVQPSPGVSPRHMRHPPPPP  309

Query  1017  pfipplmpmrpLG-----SPLVYPEVH-PMYYVPGPHPDSLV-MPMLASpppgpPVFYQF  859
             P                 SP+ +P++  P+YYV  PHPDS+  +P++A+P P   VF+  
Sbjct  310   PPPAAATAFVAPPPVRPFSPMGFPDMRSPLYYV-APHPDSMRGVPIIAAPIPPHAVFFPS  368

Query  858   LDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLIL  679
              DP L +KI++QI+YYFSN+NLIKD+YLRK MDDQGWVP++LIA+F KV +LTD+IQLIL
Sbjct  369   -DPQLHNKILHQIDYYFSNENLIKDIYLRKNMDDQGWVPIKLIASFNKVLLLTDNIQLIL  427

Query  678   HAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQY-SISSPQSARSPGSDVLSQHFQGVTLD  502
              A+R S+++EVQGEKLR RNDW +WI+   +Q+ ++SSPQS    G D+L+ + QG++L+
Sbjct  428   DAIRNSSVVEVQGEKLRKRNDWMRWIMTAPIQFPNVSSPQSGEKSGHDMLAANVQGISLE  487

Query  501   D-----NNANEHERGNAEAHLNRSSSE*KNSRVQ  415
             +     +N         EA L RS S   NS+ Q
Sbjct  488   ELTAGHSNVRSQADVRTEAFLGRSLSGDFNSQSQ  521



>ref|XP_010266026.1| PREDICTED: la-related protein 1C-like isoform X2 [Nelumbo nucifera]
Length=544

 Score =   220 bits (560),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 188/453 (42%), Positives = 252/453 (56%), Gaps = 81/453 (18%)
 Frame = -1

Query  1701  KKPAWNK-PNGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGSVPPPQGTGIA  1525
             K+ AWNK  NG+ E GPVMGAVSWPALSESTKA PKS+T D LK  SDGSV  PQ     
Sbjct  102   KRQAWNKLSNGAVELGPVMGAVSWPALSESTKALPKSST-DSLKGLSDGSVSIPQ-----  155

Query  1524  PSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVE  1345
                                        +S KR GGG  S    ANG+ SQP         
Sbjct  156   ---------------------------KSMKRGGGGGGS----ANGNFSQPPPPPPAPAM  184

Query  1344  MAP--NSAGKPG---VEPYSRDNVHR----DGGQRGGFGSQSIGGNENQYTrssprkgng  1192
               P  N +GKP    +E   RD  H+    + GQRGGF SQS  GN++   R+S R+GNG
Sbjct  185   EMPQNNKSGKPPQVVLESAPRDPSHKSNNWETGQRGGFVSQSHIGNDHPQQRNSFRRGNG  244

Query  1191  rprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppf  1012
                PR DG++H+ +G  RDQ+RGN EWN++R F  RD H+Q  R+  R F+R PPP+   
Sbjct  245   GSHPRSDGTHHNNYGSRRDQDRGNHEWNSHRGFNGRDVHMQQQRMVPRGFIRPPPPNSTP  304

Query  1011  ipplmpmrpLGSPLVYPEV------------HPMYYVPGPHPDSLVMPMLASpppgpPVF  868
                  P+RP G+P+ +P+V             P   VP  H               PP+F
Sbjct  305   FIGPPPVRPFGNPMGFPDVTSPVYYVPAPPPEPFRGVPFIH------------HTPPPMF  352

Query  867   YQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQ  688
             +  LDP L + +V QI+YYFS +NL KD++LR+ MD+QGWVPV LI++F +V  LT++I 
Sbjct  353   FPTLDPQLCAMLVRQIDYYFSPENLCKDIFLRQNMDEQGWVPVSLISSFNRVKQLTNNIP  412

Query  687   LILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSIS-SPQSARSPGSDVLSQHFQGV  511
              IL A+R+ST++EVQG+K+R RN+W  W +PP  Q+  S  PQS   P  ++L+   Q +
Sbjct  413   FILEAVRSSTVVEVQGDKIRRRNEWMNWPLPPYGQFVTSPGPQSPTVPSYNLLASRVQSI  472

Query  510   TLDDNNANEHER---------GNAEAHLNRSSS  439
              LD+ +  +  +          ++EA L+RSSS
Sbjct  473   GLDEVHEEKSTKDISKRNSTDSHSEAILSRSSS  505



>ref|XP_004134845.1| PREDICTED: uncharacterized protein LOC101218665 [Cucumis sativus]
Length=555

 Score =   219 bits (559),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 176/448 (39%), Positives = 241/448 (54%), Gaps = 53/448 (12%)
 Frame = -1

Query  1746  QPESFENSDSGN----NAVKKPAWNK-PNGSTEAGPVMGAVSWPALSESTKASPKSATYD  1582
             +P   E SDSGN    NA  KPAWNK  NG+ E GPVMGAVSWPALSEST+ + KS+   
Sbjct  90    EPAGAERSDSGNESLTNAGNKPAWNKLSNGAVEVGPVMGAVSWPALSESTRFTNKSSLDS  149

Query  1581  PLKTPSDGSV-PPPQGTGIAPSSSPKpvhtnntttpnstpnhvPA---------------  1450
             P K  +DGSV P  +GTGI PSS  K   + +     +                      
Sbjct  150   P-KDSADGSVGPACEGTGIQPSSPYKKSISASPNPSPNPTLTPNPIPTPTPTPAATPTLT  208

Query  1449  ---RQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRD  1279
                RQ+S KR+G  +S      +G VSQ        ++  PN+       P S+D++   
Sbjct  209   PTHRQKSMKRSGAASS-----YSGGVSQQSATSVSTIDTTPNN-------PSSKDHM---  253

Query  1278  GGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANR  1099
               QR  F SQS   +  Q+ + +  +  G   PRGD S+HH HG  RDQ+RGN +WN +R
Sbjct  254   --QRSSFASQSHNDHNYQH-QPNSFRSRGSGYPRGDSSHHHNHGSRRDQDRGNHDWNPHR  310

Query  1098  SFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPE-VHPMYYVPGPHP  922
             ++G     +Q    P  P            P        G P+ + E V P+ YV  P  
Sbjct  311   NYGQPQRVVQRYIRPPPPPSNATFIPSSMRPL-------GGPMPFHEFVPPVVYVAAPPQ  363

Query  921   DSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVP  742
             ++L      +P P   VF+   DP L ++IV+QIEYYFS++NL+KD YLR+ MD+ GWVP
Sbjct  364   EALRSVPFVAPMPPNAVFFPASDPQLYARIVHQIEYYFSDENLVKDTYLRRNMDEDGWVP  423

Query  741   VRLIATFKKVAVLTDDIQLILHAMR-TSTMIEVQGEKLRVRNDWKKWIVPPSVQYSIS-S  568
             + L+A FK V  LTD+I +IL A+R TST++EVQG+K+R RND+ KWI+ PS   S   +
Sbjct  424   IHLVAGFKMVRSLTDNIPVILDALRSTSTVVEVQGDKVRRRNDYSKWIMLPSTPTSNEVA  483

Query  567   PQSARSPGSDVLSQHFQGVTLDDNNANE  484
             P S  +   D+L+   Q +TL+  N+ E
Sbjct  484   PLSPANSSQDLLAAGVQSITLETYNSTE  511



>ref|XP_004165603.1| PREDICTED: uncharacterized LOC101218665 [Cucumis sativus]
Length=567

 Score =   215 bits (547),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 176/460 (38%), Positives = 241/460 (52%), Gaps = 65/460 (14%)
 Frame = -1

Query  1746  QPESFENSDSGN----NAVKKPAWNK-PNGSTEAGPVMGAVSWPALSESTKASPKSATYD  1582
             +P   E SDSGN    NA  KPAWNK  NG+ E GPVMGAVSWPALSEST+ + KS+   
Sbjct  90    EPAGAERSDSGNESLTNAGNKPAWNKLSNGAVEVGPVMGAVSWPALSESTRFTNKSSLDS  149

Query  1581  PLKTPSDGSV-PPPQGTGIAPSSSPKpvhtnntttpnstpnhvPA---------------  1450
             P K  +DGSV P  +GTGI PSS  K   + +     +                      
Sbjct  150   P-KDSADGSVGPACEGTGIQPSSPYKKSISASPNPSPNPTLTPNPIPTPTPTPAATPTPA  208

Query  1449  ---------------RQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVEMAPNSAGKPG  1315
                            RQ+S KR+G  +S      +G VSQ        ++  PN+     
Sbjct  209   ATPTPAATPTLTPTHRQKSMKRSGAASS-----YSGGVSQQSATSVSTIDTTPNN-----  258

Query  1314  VEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARD  1135
               P S+D++     QR  F SQS   +  Q+ + +  +  G   PRGD S+HH HG  RD
Sbjct  259   --PSSKDHM-----QRSSFASQSHNDHNYQH-QPNSFRSRGSGYPRGDSSHHHNHGSRRD  310

Query  1134  QERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPE-  958
             Q+RGN +WN +R++G     +Q    P  P            P        G P+ + E 
Sbjct  311   QDRGNHDWNPHRNYGQPQRVVQRYIRPPPPPSNATFIPSSMRPL-------GGPMPFHEF  363

Query  957   VHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMY  778
             V P+ YV  P  ++L      +P P   VF+   DP L ++IV+QIEYYFS++NL+KD Y
Sbjct  364   VPPVVYVAAPPQEALRSVPFVAPMPPNAVFFPASDPQLYARIVHQIEYYFSDENLVKDTY  423

Query  777   LRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR-TSTMIEVQGEKLRVRNDWKKWI  601
             LR+ MD+ GWVP+ L+A FK V  LTD+I +IL A+R TST++EVQG+K+R RND+ KWI
Sbjct  424   LRRNMDEDGWVPIHLVAGFKMVRSLTDNIPVILDALRSTSTVVEVQGDKVRRRNDYSKWI  483

Query  600   VPPSVQYSIS-SPQSARSPGSDVLSQHFQGVTLDDNNANE  484
             + PS   S   +P S  +   D+L+   Q +TL+  N+ E
Sbjct  484   MLPSTPTSNEVAPLSPANSSQDLLAAGVQSITLETYNSTE  523



>ref|XP_008440860.1| PREDICTED: la-related protein 1C [Cucumis melo]
Length=527

 Score =   214 bits (544),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 176/451 (39%), Positives = 256/451 (57%), Gaps = 34/451 (8%)
 Frame = -1

Query  1731  ENSDSGN----NAVKKPAWNKPNGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPS  1564
             E+ D GN    NA KKPAWNK    TEAGPVMGAVSWPALSES KA+PKS++        
Sbjct  92    ESYDGGNGSTANAGKKPAWNKLANGTEAGPVMGAVSWPALSESAKATPKSSSDSLKSL-G  150

Query  1563  DGSVPPPQGTGIAPS--SSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALAN  1390
             DGS    QGTG + S  S+ +  +  +    ++  + + +RQ+S +R G  NS N+ L  
Sbjct  151   DGSTGA-QGTGTSSSAPSNKEGNNDVSPNPDSTLAHPITSRQKSMRRNGSSNSYNSNLPQ  209

Query  1389  GsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGF-GSQSIGGNENQYTrs  1213
                           + AP+S     V   + +N  +D  QR  F  SQS   + +Q  R+
Sbjct  210   --------------QSAPSSP----VIDTAPNNSSKDQTQRTTFVSSQSHNDHGHQQPRN  251

Query  1212  sprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrv  1033
             S R   G   PRGD S+HH +G  RD +RGNQ+WN+NR++   +A    +          
Sbjct  252   SFRSRGGGSHPRGDNSHHHNYGSRRDHDRGNQDWNSNRNY---NAQPHRVVHRFIRPSPP  308

Query  1032  pppsppfipplmpmrpLGSPLVYPEVHP-MYYVPGPHPDSLVMPMLASpppgpPVFYQFL  856
             PPP+         MR +G PL +P+  P + Y+  P P++L      +P     +F+   
Sbjct  309   PPPNTTGYISSPTMRAIGGPLPFPDFAPPVVYIGPPPPEALRGVPFVAPISPNAMFFHGP  368

Query  855   DPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILH  676
             DP L + IV+QIEYYFS +NLIKD +LR+ M+++GWVPV+LIA+F KV  LT++IQ IL 
Sbjct  369   DPQLYAMIVSQIEYYFSGENLIKDTFLRQNMNEEGWVPVKLIASFSKVQRLTENIQTILD  428

Query  675   AMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGS---DVLSQHFQGVTL  505
             A+++ST++EV+G+ +R R+D+ +WI+ P    +IS P S  SPGS   D+L+   QG+ L
Sbjct  429   ALQSSTVVEVKGDTVRRRHDYDRWIIRPGQVPNISGPLSPLSPGSSNQDMLAGGVQGIAL  488

Query  504   DDNNANEHERGNAEAHLNRSSSE*KNSRVQS  412
             ++ N    E G  E H++ +S    N++  S
Sbjct  489   ENVNHKVSEGGQGEVHVDEASHGDSNTKAGS  519



>ref|XP_006425387.1| hypothetical protein CICLE_v10025634mg [Citrus clementina]
 gb|ESR38627.1| hypothetical protein CICLE_v10025634mg [Citrus clementina]
Length=436

 Score =   206 bits (524),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 174/381 (46%), Positives = 221/381 (58%), Gaps = 32/381 (8%)
 Frame = -1

Query  1719  SGNNAVKKPAWNK--PNGSTEAGPVMGAVSWPALSESTKASPKSATYDP--LKTPSDGSV  1552
             +GN   K+P WN+   NG+ E  PVMGA SWPALSE+T+ S  S       LK   DGS 
Sbjct  72    NGNAGSKRPPWNRQPSNGAAEMEPVMGAHSWPALSETTRGSSSSTKSSSDSLKGLVDGSS  131

Query  1551  PPP---QGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsv  1381
                   QGT    SSS K V  N      +       RQRS KR    +SSN  L     
Sbjct  132   SSSSVLQGTATTNSSSHKQVSNNANPNSTTNHAAPN-RQRSMKRNNSHSSSNGGLP----  186

Query  1380  sqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprk  1201
                           P S G   VE  S +   RD  Q+ GFGSQ  GGN++ + R S + 
Sbjct  187   ------------QPPASQGSV-VEGRSNNPSPRDHTQKSGFGSQFHGGNDHPHPRGSFKH  233

Query  1200  gngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvppps  1021
              NG   PRGDGS+HH +GG RDQ+RGNQ+WN++R++  RDAH+QP RV  R     PPP 
Sbjct  234   RNGNQHPRGDGSHHHNYGGRRDQDRGNQDWNSHRNYSGRDAHMQPQRVVQRFTRHPPPPP  293

Query  1020  ppfipplmpmrpL------GSPLVYPEV-HPMYYVPGPHPDSLVMPMLASpppgpPVFYQ  862
             PP  P   P  P       GSP+ +PE   P+YYV    P++L      +P P   VF+ 
Sbjct  294   PPPPPSSSPFIPPPPVRPFGSPIGFPEFASPVYYVAAAPPEALRGVPFVAPIPPHAVFFP  353

Query  861   FLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLI  682
               DP L S+IV QI+YYFSN+NL+KD +LR+ MDDQGWVP+RLIA F KV++LTD+IQLI
Sbjct  354   APDPQLHSRIVTQIDYYFSNENLVKDTFLRQNMDDQGWVPIRLIAGFNKVSLLTDNIQLI  413

Query  681   LHAMRTSTMIEVQGEKLRVRN  619
             L A+R+ST++EVQG+++R RN
Sbjct  414   LDALRSSTVVEVQGDRIRKRN  434



>gb|KDP23970.1| hypothetical protein JCGZ_25358 [Jatropha curcas]
Length=477

 Score =   207 bits (526),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 149/343 (43%), Positives = 209/343 (61%), Gaps = 38/343 (11%)
 Frame = -1

Query  1452  ARQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEP-----YSRDNV  1288
             ARQRS KR    NS+NT+   G                  ++  PG +P     +S +  
Sbjct  114   ARQRSMKR----NSANTSSNGG------------------TSQPPGSQPLIGEVHSNNPS  151

Query  1287  HRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWN  1108
              RD  QR    SQS   N++   + +  + NG P  RGDGS+HH +GG RDQ+R NQ+W+
Sbjct  152   PRDHSQRN---SQSRSANDHPQQQRNSFRRNGGPHSRGDGSHHHNYGGRRDQDRSNQDWS  208

Query  1107  ANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmp----mrpLGSPLVYPEV-HPMY  943
             ++R+F  RD H+Q  RV  R     PPP PP           +R  GSP+ + E+  P+Y
Sbjct  209   SHRNFNGRDPHMQQQRVVPRFMRHPPPPPPPPTTAPFIGPPPVRGFGSPIGFHELGSPVY  268

Query  942   YVPGPHPDSLV-MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKE  766
             YV GP PD L  +P +A+P P   +++   D  L SKIVNQI+YYFSN+NLIKD +LR+ 
Sbjct  269   YVAGPPPDPLRGVPFVAAPLPPHAMYFPAPDLQLHSKIVNQIDYYFSNENLIKDTFLRQN  328

Query  765   MDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSV  586
             MDDQGWVP++LIA F KV+ LTD++QLIL A+R ST++EVQG+K+R RNDW +WI+PPSV
Sbjct  329   MDDQGWVPIKLIAGFNKVSHLTDNVQLILDAIRNSTVVEVQGDKVRRRNDWMRWIMPPSV  388

Query  585   QY-SISSPQSARSPGSDVLSQHFQGVTLDDNNANEHERGNAEA  460
             Q+ ++S P S      D+L+ H   ++L++  A+ H  G ++A
Sbjct  389   QFPNVSVPASPGRSSHDMLAAHVHSISLEE-TASSHSSGRSQA  430



>ref|XP_008440861.1| PREDICTED: la-related protein 1C-like [Cucumis melo]
Length=553

 Score =   209 bits (531),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 169/448 (38%), Positives = 234/448 (52%), Gaps = 49/448 (11%)
 Frame = -1

Query  1755  TEAQPESFENSDSGN----NAVKKPAWNK-PNGSTEAGPVMGAVSWPALSESTKASPKSA  1591
             T  +P   E SDSGN    NA  KPAWNK  NG+ E GPVMGAVSWPALSEST+ +   +
Sbjct  87    TVEEPAGAERSDSGNESLSNAGNKPAWNKLSNGAVEVGPVMGAVSWPALSESTRFT-NKS  145

Query  1590  TYDPLKTPSDGSV-PPPQGTGIAPSS--------------SPKpvhtnntttpnstpnhv  1456
             + D  K  +DGS  P  +GTG  PSS              +P    T   T   +     
Sbjct  146   SSDSPKDSADGSAGPACEGTGNPPSSPYKKGISASPSPNPTPAATPTLTPTPAATPTLTP  205

Query  1455  PARQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDG  1276
               RQ+S KR+G  +S      +G VSQ        ++  P++       P S+D++    
Sbjct  206   THRQKSMKRSGAASS-----YSGGVSQQSATSVSTIDTTPSN-------PSSKDHM----  249

Query  1275  GQRGGFGSQSIGGNENQYTrssprkgngrprprg-dgSYHHAHGGARDQERGNQEWNANR  1099
              QR  F SQS   +  Q+        +        D S+HH HG  RDQ+RGN +WN +R
Sbjct  250   -QRNSFASQSHNDHNYQHQHQPNSFRSRGSGYPRGDSSHHHNHGSRRDQDRGNHDWNPHR  308

Query  1098  SFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPE-VHPMYYVPGPHP  922
             ++G     +Q    P  P            P        G P+ + E V P+ YV  P  
Sbjct  309   NYGQPQRVVQRYIRPPPPPSNATFIPSSMRPL-------GGPIPFHEFVPPVVYVAAPPQ  361

Query  921   DSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVP  742
             ++L      +P P   VF+   DP L ++IV+QIEYYFS++NL+KD YLR+ MD+ GWVP
Sbjct  362   EALRSVPFVAPMPPNAVFFPASDPQLYARIVHQIEYYFSDENLVKDTYLRRNMDEDGWVP  421

Query  741   VRLIATFKKVAVLTDDIQLILHAMR-TSTMIEVQGEKLRVRNDWKKWIVPPSVQYSIS-S  568
             + L+A FK V  LTD+I +IL A+R TST++EVQG+K+R RND+ KWI+ PS   S   +
Sbjct  422   IHLVAGFKMVRSLTDNIPVILDALRSTSTVVEVQGDKVRRRNDYSKWIMLPSTPTSNDVA  481

Query  567   PQSARSPGSDVLSQHFQGVTLDDNNANE  484
             P S  +   D+L+   Q +TL+  N+ +
Sbjct  482   PLSPANSSQDLLAAGVQNITLETYNSTD  509



>ref|XP_010548255.1| PREDICTED: la-related protein 1C isoform X1 [Tarenaya hassleriana]
 ref|XP_010548257.1| PREDICTED: la-related protein 1C isoform X2 [Tarenaya hassleriana]
Length=534

 Score =   207 bits (527),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 192/515 (37%), Positives = 267/515 (52%), Gaps = 71/515 (14%)
 Frame = -1

Query  1914  WTQIV-GESELvpvvvippqcppspstsVAQEHMDSVSGWATGNSPLPLLQDAATEAQPE  1738
             WTQIV GESE           P SP +  A + + SVS   +     PL+  AA+    E
Sbjct  51    WTQIVRGESE------PIAAAPSSPQSRAAIQPIASVSAAPSS----PLMTAAASVEDDE  100

Query  1737  SFENSDS-GNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKA-----SPKSATYDP  1579
               E+S     NA KKP WN+P NG++E GPVMGA SWPALSE+TK      S  S     
Sbjct  101   KSESSGGVQGNAGKKPVWNRPSNGASEIGPVMGASSWPALSETTKTPSNKSSSDSLKSLS  160

Query  1578  LKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTA  1399
               + S  SVP  QGTG     +               P    +R RS KR G   S+N  
Sbjct  161   DGSASSSSVPFSQGTG-----NESVPVQKQGNDTQPNPTPHHSRHRSFKRNGTFPSANGT  215

Query  1398  LANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYT  1219
             +A               ++  + A  P   P  R +      QR GFGSQS GGN+NQ  
Sbjct  216   VAQ-------------PQVPGSFADLPLHNPSPRGH-----NQRNGFGSQSQGGNDNQ--  255

Query  1218  rssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvp----s  1051
                            +G++H  HGG R+QE GN  W  NR+F  RD H  P R       
Sbjct  256   ------SQRNSYRNQNGNHHQNHGGRRNQEHGNHNW--NRNFNGRDGHAPPQRGNPGFVR  307

Query  1050  rpflrvpppsppfipplmpmrpLGSPLVYPEVH-PMYYVPGPHPDSLVMPMLASpppgpP  874
                  V  P P        ++P GSP+ +PE+  P+YY          MP +A+ P   P
Sbjct  308   HAPAPVQQPIPAPFMAAQTIQPFGSPVAFPELALPIYYP--------RMPFIAA-PVPSP  358

Query  873   VFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDD  694
             VFYQ  DP L ++I NQI +YFS +NLIKD YLR+ MDDQG+VP++L+A F+KVA LTD+
Sbjct  359   VFYQVQDPPLYTRIQNQIHFYFSEENLIKDTYLRQFMDDQGFVPIQLVAGFRKVAELTDN  418

Query  693   IQLILHAMRTSTMIEVQ-GEKLRVRNDWKKWIVPPSVQY-SISSPQSARSPGSDVLSQHF  520
             +Q IL A++ S ++EVQ G+K+R R++W+K+++P ++++  +SSPQS     ++ L+   
Sbjct  419   VQHILDALQGSPVVEVQGGDKIRKRHNWQKFLLPATMRFPGVSSPQSGER--ANTLAAQV  476

Query  519   QGVTLDDNNANEHERGNAEAHLNRSSSE*KNSRVQ  415
             +G++L+  N+ EH  G++  H+  S +    S VQ
Sbjct  477   RGLSLEQ-NSTEH-IGSSSHHVETSKTLSDYSNVQ  509



>gb|KHG05772.1| La-related 1B [Gossypium arboreum]
Length=523

 Score =   207 bits (526),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 197/469 (42%), Positives = 261/469 (56%), Gaps = 60/469 (13%)
 Frame = -1

Query  1755  TEAQPESFENSDSG--NNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATY  1585
             T  + E  +N  +G   NA K+PAWNKP +G+TE GPV+ A +WPALS+S + S K ++ 
Sbjct  75    TAVEGEGVDNVSAGPNGNAGKRPAWNKPSDGATEFGPVIEADAWPALSKSARVSSKPSSD  134

Query  1584  DPLKTPSDGS---VPPPQGTGIAPSSSPKpvhtnntttpnstpn---hvPARQRSNKRAG  1423
                  P DGS   VP  QG+G     S       N    N        +PARQRS KR  
Sbjct  135   SSRALP-DGSPSVVPFSQGSGSTSVLSSSQKQAKNVEKLNLNSTPNHAMPARQRSMKR--  191

Query  1422  GGNSSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVE-----PYSRDNVHRDGGQRGGF  1258
               NS+N+A + G              + P   G P VE     P SR        QR GF
Sbjct  192   --NSNNSASSGGL-------------LQPPPEG-PLVEAPVNGPSSRI-------QRSGF  228

Query  1257  GSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDA  1078
                S+ GN+  + R+S R  N   RPRGDGS+H  +GG R+   GNQ+WN  R+F SRDA
Sbjct  229   --VSLAGND--HPRNSFRHRNAGQRPRGDGSHHQNYGGRRNPALGNQDWNG-RNFNSRDA  283

Query  1077  HLQplrvpsrpflrvpppsppfipplmpmrpL--GSPLVYPEVHP-MYYVPGPHPDSLV-  910
             H+QP  VP     + P P P   P + P      G+P+ YPE+    Y++P P P+SL  
Sbjct  284   HMQPRVVPRLMRHQPPAPPPNAAPFIAPPPVRPFGTPVGYPELASQFYFIPAPPPESLRG  343

Query  909   MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLI  730
             +P +A  PP      +  D  L + IVNQI+YYFS++NLIKD YLR+ MDDQGWVP++LI
Sbjct  344   VPFVAPMPPVLFPAPEPPDRQLHANIVNQIDYYFSDENLIKDTYLRQNMDDQGWVPIKLI  403

Query  729   ATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARS  550
             A F+KV++LTD+IQLI  A+R+ST++EVQGEK+R R DW KWI+PPSV++   S      
Sbjct  404   AGFRKVSLLTDNIQLIRDALRSSTVVEVQGEKVRKRIDWMKWILPPSVKFPAMS------  457

Query  549   PGSDVLSQHFQGVTLDDNNANEHERGNAEAHL----NRSSSE*KNSRVQ  415
              G D+L    Q ++LD   A+     N E       +RSSS   N+R Q
Sbjct  458   -GQDMLVARVQDISLDQRTADVSGSRNQEDACAGLSDRSSSGEFNNRSQ  505



>ref|XP_002310700.2| hypothetical protein POPTR_0007s08650g [Populus trichocarpa]
 gb|EEE91150.2| hypothetical protein POPTR_0007s08650g [Populus trichocarpa]
Length=543

 Score =   207 bits (527),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 185/447 (41%), Positives = 256/447 (57%), Gaps = 56/447 (13%)
 Frame = -1

Query  1764  DAATEAQPESF------ENSDSGNNAVKKPAWNKP----NGSTEAGPVMGAVSWPALSES  1615
             +A+TEA+  +       E+ +S NN  K+P WNKP    NG  E G VMGA SWP LSES
Sbjct  65    NASTEAEQAAAVFVAEKESVESENNVSKRPVWNKPSTASNGLVEIGSVMGADSWPDLSES  124

Query  1614  TK--ASPKSATYDPLK-TPSDGSVPPP---QGTGIAPSSSPKpvhtnntttpnstpnhvP  1453
                 +S   ++ D LK    DGS       QGT  A SSS K V+               
Sbjct  125   AARVSSLTKSSADSLKGLLFDGSSSSVSVSQGTETASSSSQKQVNNTANPNSTPNNAVP-  183

Query  1452  ARQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGG  1273
             A Q+S K     N  NTA   G+              +P S    G E +  ++  RD  
Sbjct  184   ACQKSMK----CNGVNTASNGGTH-------------SPGSQSAAG-EGHLNNSSSRDHA  225

Query  1272  QRGGFGSQSIGGNEN-QYTrssprkgngrprprgdgSYHHAHGGAR-DQERGNQEWNANR  1099
             Q+    SQS G N++ Q  R+S R  NG    RGDGS+HH++GG R D +  N +WNA+R
Sbjct  226   QKS---SQSRGSNDHPQQQRTSFRNRNGGLHSRGDGSHHHSYGGRRNDLDLANHDWNAHR  282

Query  1098  SFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLV-------YPEVH-PMY  943
             +F SRD H+QPL   +   +R PPP PP       +     P V       +P++  P+Y
Sbjct  283   NF-SRDGHMQPLPRVAPRHMRHPPPPPPSPATSPFI---APPPVRPFGLVGFPDMGLPLY  338

Query  942   YVPGPHPDSLV-MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKE  766
             YV  PHP S+  +P++A+P P   V +   DP L  +I++QI+YYFSN+NL+KD+YLR+ 
Sbjct  339   YV-SPHPGSMRGVPIIAAPVPSHTVLFPS-DPQLHIRILHQIDYYFSNENLVKDIYLRRN  396

Query  765   MDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSV  586
             MDDQGWVP++LIA+F KV++LTD+I +IL A+RTS+++EVQGEK+R RNDW +WI+   V
Sbjct  397   MDDQGWVPIKLIASFNKVSLLTDNIHVILDAIRTSSVVEVQGEKVRKRNDWMRWIMTTPV  456

Query  585   QY-SISSPQSARSPGSDVLSQHFQGVT  508
             Q+ ++SSPQ     G D+L+ H QG++
Sbjct  457   QFPNVSSPQYGEKSGHDMLAAHVQGIS  483



>ref|XP_010548258.1| PREDICTED: la-related protein 1C isoform X3 [Tarenaya hassleriana]
Length=544

 Score =   206 bits (525),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 192/519 (37%), Positives = 268/519 (52%), Gaps = 69/519 (13%)
 Frame = -1

Query  1914  WTQIV-GESELvpvvvip----pqcppspstsVAQEHMDSVSGWATGNSPLPLLQDAATE  1750
             WTQIV GESE +             P SP +  A + + SVS   +     PL+  AA+ 
Sbjct  51    WTQIVRGESEPIAAAPSSELPIAAAPSSPQSRAAIQPIASVSAAPSS----PLMTAAASV  106

Query  1749  AQPESFENSDS-GNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKA-----SPKSA  1591
                E  E+S     NA KKP WN+P NG++E GPVMGA SWPALSE+TK      S  S 
Sbjct  107   EDDEKSESSGGVQGNAGKKPVWNRPSNGASEIGPVMGASSWPALSETTKTPSNKSSSDSL  166

Query  1590  TYDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNS  1411
                   + S  SVP  QGTG     +               P    +R RS KR G   S
Sbjct  167   KSLSDGSASSSSVPFSQGTG-----NESVPVQKQGNDTQPNPTPHHSRHRSFKRNGTFPS  221

Query  1410  SNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNE  1231
             +N  +A               ++  + A  P   P  R +      QR GFGSQS GGN+
Sbjct  222   ANGTVAQ-------------PQVPGSFADLPLHNPSPRGH-----NQRNGFGSQSQGGND  263

Query  1230  NQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvp-  1054
             NQ                 +G++H  HGG R+QE GN  W  NR+F  RD H  P R   
Sbjct  264   NQ--------SQRNSYRNQNGNHHQNHGGRRNQEHGNHNW--NRNFNGRDGHAPPQRGNP  313

Query  1053  ---srpflrvpppsppfipplmpmrpLGSPLVYPEVH-PMYYVPGPHPDSLVMPMLASpp  886
                      V  P P        ++P GSP+ +PE+  P+YY          MP +A+ P
Sbjct  314   GFVRHAPAPVQQPIPAPFMAAQTIQPFGSPVAFPELALPIYYP--------RMPFIAA-P  364

Query  885   pgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAV  706
                PVFYQ  DP L ++I NQI +YFS +NLIKD YLR+ MDDQG+VP++L+A F+KVA 
Sbjct  365   VPSPVFYQVQDPPLYTRIQNQIHFYFSEENLIKDTYLRQFMDDQGFVPIQLVAGFRKVAE  424

Query  705   LTDDIQLILHAMRTSTMIEVQ-GEKLRVRNDWKKWIVPPSVQY-SISSPQSARSPGSDVL  532
             LTD++Q IL A++ S ++EVQ G+K+R R++W+K+++P ++++  +SSPQS     ++ L
Sbjct  425   LTDNVQHILDALQGSPVVEVQGGDKIRKRHNWQKFLLPATMRFPGVSSPQSGER--ANTL  482

Query  531   SQHFQGVTLDDNNANEHERGNAEAHLNRSSSE*KNSRVQ  415
             +   +G++L+  N+ EH  G++  H+  S +    S VQ
Sbjct  483   AAQVRGLSLEQ-NSTEH-IGSSSHHVETSKTLSDYSNVQ  519



>ref|XP_004165604.1| PREDICTED: uncharacterized LOC101218903 [Cucumis sativus]
Length=529

 Score =   204 bits (520),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 171/448 (38%), Positives = 254/448 (57%), Gaps = 34/448 (8%)
 Frame = -1

Query  1722  DSGN----NAVKKPAWNKPNGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGS  1555
             D GN    NA KKPAWNK    TEAGPVMGAVSWPALSES K +PKS++        DGS
Sbjct  97    DGGNGSTANAGKKPAWNKLANGTEAGPVMGAVSWPALSESAKGTPKSSSDSLKSL-GDGS  155

Query  1554  VPPPQGTGIAPSS--SPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsv  1381
                 QGTG + S+  + +  +  +    ++  + + +RQ+S +R G  NS N++L     
Sbjct  156   AGA-QGTGTSSSASSNKEGNNDVSPNPDSTLTHPITSRQKSMRRNGSSNSYNSSLPQ---  211

Query  1380  sqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGF-GSQSIGGNENQYTrsspr  1204
                        + AP+S     V   + +N  +D  QR  F  SQS   + +Q  R+S R
Sbjct  212   -----------QSAPSSP----VIDTAPNNSPKDQTQRTTFVSSQSHSDHGHQQPRNSYR  256

Query  1203  kgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvppp  1024
                G   PRGD S+HH +G  RD +RGNQ+WN+NR++   +A    +          PPP
Sbjct  257   SRGGGSHPRGDNSHHHNYGSRRDHDRGNQDWNSNRNY---NAQPHRVVHRFIRPSPPPPP  313

Query  1023  sppfipplmpmrpLGSPLVYPEVHP-MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPL  847
             +         MR +G PL +P+  P + Y+  P P++L      +P     +F+   DP 
Sbjct  314   NTTGYISSPTMRAIGGPLPFPDFAPPVVYIGPPPPEALRGVPFVAPISPNAMFFHGPDPQ  373

Query  846   LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
             L + IV+QIEYYFS +NLIKD +LR+ M+++GWVPV+LIA+F KV  LT++IQ IL A++
Sbjct  374   LYAMIVSQIEYYFSGENLIKDTFLRQNMNEEGWVPVKLIASFSKVQRLTENIQTILDALQ  433

Query  666   TSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGS---DVLSQHFQGVTLDDN  496
             +ST++EV+G+ +R R+D+ +WI+ P    +IS P S  SPGS   D+L+   +G+ L++ 
Sbjct  434   SSTVVEVKGDTVRRRHDYDRWIIRPGQVPNISGPLSPLSPGSSKQDMLAAGVKGIALENI  493

Query  495   NANEHERGNAEAHLNRSSSE*KNSRVQS  412
             N    E G  + H++ +S    N++  S
Sbjct  494   NHRVSEGGQGDVHVDEASHGDNNTKAGS  521



>ref|XP_004134846.1| PREDICTED: uncharacterized protein LOC101218903 [Cucumis sativus]
Length=529

 Score =   204 bits (520),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 171/448 (38%), Positives = 254/448 (57%), Gaps = 34/448 (8%)
 Frame = -1

Query  1722  DSGN----NAVKKPAWNKPNGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGS  1555
             D GN    NA KKPAWNK    TEAGPVMGAVSWPALSES K +PKS++        DGS
Sbjct  97    DGGNGSTANAGKKPAWNKLANGTEAGPVMGAVSWPALSESAKGTPKSSSDSLKSL-GDGS  155

Query  1554  VPPPQGTGIAPSS--SPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsv  1381
                 QGTG + S+  + +  +  +    ++  + + +RQ+S +R G  NS N++L     
Sbjct  156   AGA-QGTGTSSSASSNKEGNNDVSPNPDSTLTHPITSRQKSMRRNGSSNSYNSSLPQ---  211

Query  1380  sqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGF-GSQSIGGNENQYTrsspr  1204
                        + AP+S     V   + +N  +D  QR  F  SQS   + +Q  R+S R
Sbjct  212   -----------QSAPSSP----VIDTAPNNSPKDQTQRTTFVSSQSHSDHGHQQPRNSYR  256

Query  1203  kgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvppp  1024
                G   PRGD S+HH +G  RD +RGNQ+WN+NR++   +A    +          PPP
Sbjct  257   SRGGGSHPRGDNSHHHNYGSRRDHDRGNQDWNSNRNY---NAQPHRVVHRFIRPSPPPPP  313

Query  1023  sppfipplmpmrpLGSPLVYPEVHP-MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPL  847
             +         MR +G PL +P+  P + Y+  P P++L      +P     +F+   DP 
Sbjct  314   NTTGYISSPTMRAIGGPLPFPDFAPPVVYIGPPPPEALRGVPFVAPISPNAMFFHGPDPQ  373

Query  846   LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
             L + IV+QIEYYFS +NLIKD +LR+ M+++GWVPV+LIA+F KV  LT++IQ IL A++
Sbjct  374   LYAMIVSQIEYYFSGENLIKDTFLRQNMNEEGWVPVKLIASFSKVQRLTENIQTILDALQ  433

Query  666   TSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGS---DVLSQHFQGVTLDDN  496
             +ST++EV+G+ +R R+D+ +WI+ P    +IS P S  SPGS   D+L+   +G+ L++ 
Sbjct  434   SSTVVEVKGDTVRRRHDYDRWIIRPGQVPNISGPLSPLSPGSSKQDMLAAGVKGIALENI  493

Query  495   NANEHERGNAEAHLNRSSSE*KNSRVQS  412
             N    E G  + H++ +S    N++  S
Sbjct  494   NHRVSEGGQGDVHVDEASHGDNNTKAGS  521



>emb|CBI19921.3| unnamed protein product [Vitis vinifera]
Length=559

 Score =   202 bits (514),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 193/460 (42%), Positives = 246/460 (53%), Gaps = 42/460 (9%)
 Frame = -1

Query  1734  FENSD-SGNNA--VKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTP  1567
              ENSD  G+NA   KKPAWNKP N   E GPVMGAVSWPALSEST+ASP+S++  P K  
Sbjct  88    LENSDGCGSNAGRQKKPAWNKPSNDVVEVGPVMGAVSWPALSESTRASPRSSSDSP-KPA  146

Query  1566  SDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANG  1387
              DGS    QG  I    SP+     NT   +S  +  P RQRS K +GGG+S        
Sbjct  147   VDGSAASIQGPVIP--HSPQKQVPANTNPNSSQNHASPFRQRSIK-SGGGSSQTVHGHLP  203

Query  1386  svsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQR---------GGFGSQSIGGN  1234
             S   P      + EM  N   K  + P   D+  R+   R         GGF  Q  G +
Sbjct  204   SQPPPPPPPYPLFEMPQNKYAK--MAPQVLDSSTREPPYRNNTWETRPIGGFVPQPRGLS  261

Query  1233  ENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvp  1054
             ++   R+S R   G         +H+ +GG RDQ+RGN EWN+ RS   RD H+QP R P
Sbjct  262   DHPLPRNSRRGNFGPHPRGDGP-HHNNYGGRRDQDRGNYEWNS-RSSNVRDIHMQPQRAP  319

Query  1053  srpflrvpppsppfipplmpmrpLGSPLVYPEVHP-----MYYVPG-PHPDSLVMPMLAS  892
              R F+R  P S               P + P  +P     MYY P  P      +P +A 
Sbjct  320   PRGFIRAAPQSSSPRFMTPQPIR---PFMNPAGYPDMPSQMYYFPALPSEPFRSVPFVAH  376

Query  891   pppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKV  712
              PP P       DP L + +VNQIEYYFS+ NLIKD YLR  MDDQGWVP+ LIA F +V
Sbjct  377   APPPPMFIPV-PDPPLPTLLVNQIEYYFSDVNLIKDDYLRSYMDDQGWVPITLIAGFPRV  435

Query  711   AVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGS---  541
               LT+ I LIL ++RTST +EVQG+K+R RN+W KW+ P S ++        +SPG    
Sbjct  436   QSLTNSIPLILDSLRTSTSVEVQGDKVRRRNEWMKWL-PSSARFHAD--LGLQSPGGLSY  492

Query  540   DVLSQHFQGVTLDDNNANEHE-RGNAEAH----LNRSSSE  436
               L   FQ VT+++ +AN++  +G  EAH    L R+SSE
Sbjct  493   GTLVSSFQKVTVEEGSANQNSLKGKTEAHTETVLGRASSE  532



>ref|XP_002279250.2| PREDICTED: la-related protein 1C-like [Vitis vinifera]
Length=565

 Score =   202 bits (514),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 193/460 (42%), Positives = 246/460 (53%), Gaps = 42/460 (9%)
 Frame = -1

Query  1734  FENSD-SGNNA--VKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTP  1567
              ENSD  G+NA   KKPAWNKP N   E GPVMGAVSWPALSEST+ASP+S++  P K  
Sbjct  94    LENSDGCGSNAGRQKKPAWNKPSNDVVEVGPVMGAVSWPALSESTRASPRSSSDSP-KPA  152

Query  1566  SDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANG  1387
              DGS    QG  I    SP+     NT   +S  +  P RQRS K +GGG+S        
Sbjct  153   VDGSAASIQGPVIP--HSPQKQVPANTNPNSSQNHASPFRQRSIK-SGGGSSQTVHGHLP  209

Query  1386  svsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQR---------GGFGSQSIGGN  1234
             S   P      + EM  N   K  + P   D+  R+   R         GGF  Q  G +
Sbjct  210   SQPPPPPPPYPLFEMPQNKYAK--MAPQVLDSSTREPPYRNNTWETRPIGGFVPQPRGLS  267

Query  1233  ENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvp  1054
             ++   R+S R   G         +H+ +GG RDQ+RGN EWN+ RS   RD H+QP R P
Sbjct  268   DHPLPRNSRRGNFGPHPRGDGP-HHNNYGGRRDQDRGNYEWNS-RSSNVRDIHMQPQRAP  325

Query  1053  srpflrvpppsppfipplmpmrpLGSPLVYPEVHP-----MYYVPG-PHPDSLVMPMLAS  892
              R F+R  P S               P + P  +P     MYY P  P      +P +A 
Sbjct  326   PRGFIRAAPQSSSPRFMTPQPIR---PFMNPAGYPDMPSQMYYFPALPSEPFRSVPFVAH  382

Query  891   pppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKV  712
              PP P       DP L + +VNQIEYYFS+ NLIKD YLR  MDDQGWVP+ LIA F +V
Sbjct  383   APPPPMFIPV-PDPPLPTLLVNQIEYYFSDVNLIKDDYLRSYMDDQGWVPITLIAGFPRV  441

Query  711   AVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGS---  541
               LT+ I LIL ++RTST +EVQG+K+R RN+W KW+ P S ++        +SPG    
Sbjct  442   QSLTNSIPLILDSLRTSTSVEVQGDKVRRRNEWMKWL-PSSARFHAD--LGLQSPGGLSY  498

Query  540   DVLSQHFQGVTLDDNNANEHE-RGNAEAH----LNRSSSE  436
               L   FQ VT+++ +AN++  +G  EAH    L R+SSE
Sbjct  499   GTLVSSFQKVTVEEGSANQNSLKGKTEAHTETVLGRASSE  538



>emb|CDY24825.1| BnaA08g14850D [Brassica napus]
Length=503

 Score =   201 bits (510),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 157/378 (42%), Positives = 201/378 (53%), Gaps = 47/378 (12%)
 Frame = -1

Query  1710  NAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGSVPPPQGT  1534
             NA KKPAW++P NG++E GPVMGA SWPALSE+TKA     +  P    S G VP     
Sbjct  101   NAGKKPAWSRPSNGASEIGPVMGASSWPALSEATKA----PSNKPSSDSSIGDVPSSVSQ  156

Query  1533  GIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvsqpqqlqsl  1354
             G A +S P           N  P+   +RQRS KR G   S+    ANG+  Q       
Sbjct  157   GAASASVP--APKQVGRANNLNPSPNHSRQRSFKRNGASGST----ANGTAPQ-------  203

Query  1353  vVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprg  1174
                  P+S G   VE  S +   R   Q+ GF SQ  GG +NQ             R + 
Sbjct  204   -----PSSHGS-LVEGTSHNPSPRGQNQKNGFASQPHGGADNQRD---------SHRNQN  248

Query  1173  dgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsr----pflrvpppsppfip  1006
                +H  HGG R+QE GNQ WN +RSF  RD + Q  R             PPP     P
Sbjct  249   GNHHHQNHGGRRNQEHGNQNWNFHRSFNGRDGNAQSPRGAPAFVRYAPPPPPPPVQAIPP  308

Query  1005  plmpmrpLGSPLVY-PEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIV  829
               M  +  GSP+ Y PE+ P +Y PG       MP +A P    PVFY   DP L  K+ 
Sbjct  309   QFMAAQSFGSPVPYPPELAPPFY-PG-------MPFVA-PLSPGPVFYHVQDPPLNIKLQ  359

Query  828   NQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIE  649
             NQI YYFS +NLIKD YLR +MDDQG+ P+ +IA F+KVA LTD IQ I+ A++ S  +E
Sbjct  360   NQIHYYFSEENLIKDTYLRDQMDDQGFAPLHVIAGFRKVAELTDSIQEIVEALQGSPFVE  419

Query  648   VQGEKLRVRNDWKKWIVP  595
             VQG+++R R++W+ W++P
Sbjct  420   VQGDRIRKRHNWQLWLIP  437



>gb|EYU18067.1| hypothetical protein MIMGU_mgv1a005127mg [Erythranthe guttata]
Length=496

 Score =   200 bits (508),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 168/419 (40%), Positives = 230/419 (55%), Gaps = 72/419 (17%)
 Frame = -1

Query  1734  FENSDSGNNAVKKPAWNKPNGSTEA----GPVMGAVSWPALSES------TKASPKSATY  1585
              +NS++ + AVKKP WNKP+  T A    G VMGA+SWPAL ES       +ASPKS++ 
Sbjct  86    LDNSENNSGAVKKPVWNKPSNETTAAADVGVVMGAMSWPALGESLSEPPAARASPKSSSA  145

Query  1584  DPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSN  1405
               LK  S GS+P  Q  G+  SSSPK V+T+ ++   ++ + VPARQ+S KR GG +S  
Sbjct  146   HSLKALSVGSIPLSQELGVGSSSSPKEVNTSLSSPNLTSTHVVPARQKSMKRGGGSSSQG  205

Query  1404  TALANGsvsqpqqlqslvVEMAPN-SAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNEN  1228
             + LA    S       + +  AP+ ++GK  V  +SRD   RD GQR     ++  G + 
Sbjct  206   SILAANDTSSQVSPMQVAMVEAPSPNSGKSSVGEFSRD---RDVGQRSYPFRRNNNGPQP  262

Query  1227  QYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHL-Qplrvps  1051
             +                GDGSYHH+HGG RD        N NRSFG+R++H  Q      
Sbjct  263   R----------------GDGSYHHSHGGRRD--------NPNRSFGNRESHAPQQRVASR  298

Query  1050  rpflrvpppsppfipplmpmrpLGSPLVYP-------EVH--------------------  952
                    P +P   PP  PMRP  SP++Y         +H                    
Sbjct  299   PFTRGPAPSAPLVTPPPPPMRPFISPMIYTGEFSMSFLIHSLICIFLSTNVFVQLAEMPS  358

Query  951   -PMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYL  775
              PMYY+P  + D    PM+      P +     DP L S+I+NQI+YYFSN+NL+KD +L
Sbjct  359   PPMYYLPHTYLDPF-RPMVP----VPQMHVNMPDPQLPSRILNQIDYYFSNENLVKDTFL  413

Query  774   RKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIV  598
             R+ MD++GWV V+LIA FKKV  LTD+IQLIL A++ S ++EVQG+KLR + DW +WI+
Sbjct  414   RRNMDNEGWVSVKLIAGFKKVMQLTDNIQLILDAVQASNVVEVQGDKLRRKGDWNRWIM  472



>ref|XP_009109261.1| PREDICTED: la-related protein 1C-like [Brassica rapa]
Length=503

 Score =   200 bits (508),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 157/378 (42%), Positives = 200/378 (53%), Gaps = 47/378 (12%)
 Frame = -1

Query  1710  NAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGSVPPPQGT  1534
             NA KKPAW++P NG++E GPVMGA SWPALSE+TKA     +  P    S G VP     
Sbjct  101   NAGKKPAWSRPSNGASEIGPVMGASSWPALSEATKA----PSNKPSSDSSIGDVPSSVSQ  156

Query  1533  GIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvsqpqqlqsl  1354
             G A +S P           N  P    +RQRS KR G   S+    ANG+ SQ       
Sbjct  157   GAASASVP--APKQAGRANNPNPTPNHSRQRSFKRNGASGST----ANGTASQ-------  203

Query  1353  vVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprg  1174
                  P++ G   VE  S +   R   Q+ GF SQ  GG +NQ             R + 
Sbjct  204   -----PSAQGS-LVEGTSHNPSPRGQNQKNGFASQPHGGADNQRD---------SHRNQN  248

Query  1173  dgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsr----pflrvpppsppfip  1006
                +H  HGG R+QE GNQ WN +RSF  RD + Q  R             PPP     P
Sbjct  249   GNHHHQNHGGRRNQEHGNQNWNFHRSFNGRDGNAQSPRGAPAFVRYAPPPPPPPVQAIPP  308

Query  1005  plmpmrpLGSPLVY-PEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIV  829
               M  +  GSP+ Y PE+ P +Y PG       MP +A P    PVFY   DP L  K+ 
Sbjct  309   QFMAAQSFGSPVPYPPELAPPFY-PG-------MPFVA-PLSPGPVFYHVQDPPLNIKLQ  359

Query  828   NQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIE  649
             NQI YYFS +NLIKD YLR +MDDQG+ P+ +IA F+KVA LTD IQ I+ A++ S  +E
Sbjct  360   NQIHYYFSEENLIKDTYLRDQMDDQGFAPLHVIAGFRKVAELTDSIQEIVEALQGSPFVE  419

Query  648   VQGEKLRVRNDWKKWIVP  595
             VQG+ +R R++W+ W++P
Sbjct  420   VQGDGIRKRHNWQLWLIP  437



>ref|XP_008809436.1| PREDICTED: la-related protein 1C-like [Phoenix dactylifera]
Length=585

 Score =   197 bits (501),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 173/439 (39%), Positives = 229/439 (52%), Gaps = 32/439 (7%)
 Frame = -1

Query  1701  KKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGSVPPPQGTGIA  1525
             KKPAW +P NGS E GPVMGAVSWP LSESTKASPKS++ + LK  SDG+V  P G  I 
Sbjct  119   KKPAWQRPSNGSIEVGPVMGAVSWPPLSESTKASPKSSSPNTLKGSSDGTVSAPPGPVI-  177

Query  1524  PSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvsqpq--qlqslv  1351
              S+ P+P   N      +     P RQ+ NKR  G  SS+    NG+ +        +  
Sbjct  178   -STPPRPNSNNMNLNSTTNHVASPVRQKPNKRGSGSGSSSGTPVNGAPALQSPPPASAAA  236

Query  1350  VEMAPNSAGKPGVEP-----YSRDNVHRDGGQR-GGFGSQSIGGNENQYTrssprkgngr  1189
              ++ P+    P   P      S  N + D G R GGF  Q  G N++       R+G G 
Sbjct  237   TQITPDRETIPEPSPGDLPSKSSGNSNWDRGTRGGGFAPQQHGWNDHHRGYGGNRRGGGG  296

Query  1188  prprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfi  1009
                RG           RDQ+RG+  W   R FGSRDA  Q             PP PPF+
Sbjct  297   GSHRGSFGSR------RDQDRGSFVWGP-RGFGSRDASAQ----QRGVRPYPRPPPPPFL  345

Query  1008  pplmpmrpLGSPLVYPEV-HPMYYVPGPHP----DSLVMPMLASpppgpPVFYQFLDPLL  844
              P   +RP G+P+ YP++  P+YYV  P P      L      +  P        +DP  
Sbjct  346   SPPPQVRPFGNPVGYPDMPSPVYYVATPPPPETLSGLPFIAHPAAAPPAVFSPAAIDP-Q  404

Query  843   LSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRT  664
              + ++ QI YYFS+DNL KD+YLR+ MD+QGWVP+ LIA F +V   T++IQ IL  +R 
Sbjct  405   RAMLLKQINYYFSSDNLCKDIYLRRNMDEQGWVPITLIAGFNRVKQFTNNIQYILDTIRL  464

Query  663   STMIEVQGEKLRVRNDWKKWIVPPSVQYSISSP--QSARSPGSDVLSQHFQGVTLDDNNA  490
             S ++EVQGEK+R RNDW  W++PPS  +  + P  QS  +   D L    Q V L+  + 
Sbjct  465   SDVVEVQGEKIRKRNDWMNWVLPPSPNHFGTVPGLQSPATSDYDTLVAQLQAVELEGASN  524

Query  489   NEHERG--NAEAHLNRSSS  439
             +   RG  + E  L RS+S
Sbjct  525   HNSMRGSTHTEVVLIRSAS  543



>gb|KHG19339.1| La-related 1B [Gossypium arboreum]
Length=491

 Score =   194 bits (494),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 175/438 (40%), Positives = 240/438 (55%), Gaps = 55/438 (13%)
 Frame = -1

Query  1731  ENSDSGN-----NAVKKPAWNKPNGST---EAGPVMGAVSWPALSESTKASPKSAT----  1588
             E ++ GN     NA K+PAWNKP+  T   E+  VMGA +WP L +S +A  KS +    
Sbjct  82    EGAEHGNVGPNGNAAKRPAWNKPSNLTSESESDSVMGARAWPPLPQSARAPSKSPSDSSR  141

Query  1587  ------YDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRA  1426
                   Y P    S GS P       + SS  +  +  N  + ++  + +PARQRS K+ 
Sbjct  142   ASSDGSYSPFVPGSQGSRP----ASSSSSSQKQVRNNANFNSNSTANHTMPARQRSMKQN  197

Query  1425  GGGNSSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQS  1246
                ++SN  L+                  P   G P VE    ++  RD  QR GF   S
Sbjct  198   SNISASNGGLSQ-----------------PPPQG-PMVE-APLNSPSRDHIQRTGFLPYS  238

Query  1245  IGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQp  1066
              GG + Q+ R+S R  N  P PRG+GS+H  + G R+Q+ GNQ+WN  R+F SRD H+ P
Sbjct  239   -GGPDQQHPRNSFRHRNNGPHPRGNGSHHLNYRGRRNQDHGNQDWNG-RNFISRDGHMMP  296

Query  1065  lrvpsrpflrvpppsppfi---pplmpmrpLGSPLVYPEVHPMYY-VPGPHPDSLV-MPM  901
                P       PPP P           +RP G+P  +PE    +Y VP P+P+SL  +P 
Sbjct  297   RVAPRFMRHPPPPPLPANTGPLFAPPHVRPFGTPFGFPEFSSQFYLVPAPYPESLRGVPF  356

Query  900   LASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATF  721
             +   PP  P   +  D  L +KIVNQI+YYFSN+NLIKD YLR+ MDDQGWVP++LIA F
Sbjct  357   IQPMPPMFPPPQEPQDHQLHAKIVNQIDYYFSNENLIKDTYLRQNMDDQGWVPIKLIAGF  416

Query  720   KKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGS  541
             +KV++LT +IQLI+ A++ ST +EVQG+K+R R DW +WI+ PS Q+ I S       G 
Sbjct  417   RKVSLLTANIQLIVDALQNSTAVEVQGDKVRKRMDWMRWIMLPSFQFPIKS-------GQ  469

Query  540   DVLSQHFQGVTLDDNNAN  487
             D+L    Q ++LD   AN
Sbjct  470   DMLVAGVQNISLDQGTAN  487



>ref|XP_010933359.1| PREDICTED: la-related protein 1C-like [Elaeis guineensis]
Length=500

 Score =   192 bits (488),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 174/439 (40%), Positives = 232/439 (53%), Gaps = 31/439 (7%)
 Frame = -1

Query  1701  KKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGSVPPPQGTGIA  1525
             KKPAW +P NGS E GPVMGAVSWP LSESTKASPKS++ D LK P DG+V    G  I+
Sbjct  33    KKPAWQRPSNGSIEVGPVMGAVSWPPLSESTKASPKSSSSDALKGPFDGTVSASPGPVIS  92

Query  1524  PSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVE  1345
              + SP+P   N            P RQ+ NKR  GG SS+   ANG+        +    
Sbjct  93    -TPSPRPNSNNINLNSTPNHVAPPVRQKPNKRGSGGGSSSGTPANGAPPLQSPPAASAAA  151

Query  1344  MAPNSAGKPGVEPYSRD-------NVHRDGGQRGG-FGSQSIGGNENQYTrssprkgngr  1189
                  A +   EP + D       + + D G RGG F  Q  GGN++       R+G G 
Sbjct  152   TQITPAKETIPEPSAGDLPSKNSGSTNWDHGTRGGSFAPQQHGGNDHHRGYGGNRRGGGG  211

Query  1188  prprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfi  1009
                   GS        RDQ+RG+  W ++R F SRD  +Q             PP PPF+
Sbjct  212   SHRGSYGS-------RRDQDRGSFVW-SHRGFNSRDTSVQ----QRGVRPYHRPPPPPFL  259

Query  1008  pplmpmrpLGSPLVYPEV-HPMYYVPGPHPDSLV--MPMLASpppgpPVFYQFLDPL--L  844
              P   +RP G+P+ YP++  P+YYV  P P   +  +P +A P   PP        +   
Sbjct  260   SPPPQVRPFGNPIGYPDMPSPVYYVTTPPPPETLGGLPYIAHPAAAPPPAMFSPPAIDHP  319

Query  843   LSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRT  664
              + ++ QI YYFS+DNL KD++LR+ MD+QGWVP+ LIA F +V  LT++IQ IL  +R 
Sbjct  320   RAMLLKQINYYFSSDNLCKDIFLRRNMDEQGWVPINLIAGFNRVKQLTNNIQYILDTVRL  379

Query  663   STMIEVQGEKLRVRNDWKKWIVPPSVQYSISSP--QSARSPGSDVLSQHFQGVTLDDNNA  490
             S ++EVQGEK+R RNDW  W++PPS       P  QS  +   D L    Q V L+  + 
Sbjct  380   SDVVEVQGEKIRKRNDWMNWVLPPSPNRFGIVPGLQSPATSDYDTLVAQLQTVGLEGASN  439

Query  489   NEHERG--NAEAHLNRSSS  439
             +   RG  + E  L RS+S
Sbjct  440   HNSMRGATHTEVVLIRSAS  458



>ref|XP_003519856.1| PREDICTED: la-related protein 1-like [Glycine max]
Length=497

 Score =   192 bits (487),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 162/440 (37%), Positives = 235/440 (53%), Gaps = 46/440 (10%)
 Frame = -1

Query  1758  ATEAQPESFENSDSGNNAV--KKPAWNKPNGSTEAGPVMGAVSWPALSESTKASPKSATY  1585
             A  + P    ++  GNN +  K+PAWNKP+ +  +  V+GA SWP  +ES +A  KS + 
Sbjct  46    AVNSPPTEDSDNGGGNNVITGKRPAWNKPSNAASSS-VIGADSWPLPAESARAPTKSPSP  104

Query  1584  -----DPLKTPSD-GSVPPP-QGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRA  1426
                  +  KT +D  S+PPP QG+G    S  + V  N     N+   H  + +RSN   
Sbjct  105   SPSPSEMTKTSTDISSLPPPLQGSGSVTPSPQRNVRDNANADNNTVQTHQKSFKRSNSNT  164

Query  1425  GGGNSSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQS  1246
                   +    +G         S     +P    +P    +  D++     QR  F  ++
Sbjct  165   SSNGGHHPPQMSGPQGPIAPAGSHNYNSSPKEH-QPRAGFFPNDHL----PQRNSFRYRN  219

Query  1245  IGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQE-RGNQEWNANRSFGSRDAHLQ  1069
              GG   +                GDG +HH +GG RDQ+ RGNQ+WN +RSF  RD  + 
Sbjct  220   GGGPHQR----------------GDGHHHHNYGGRRDQDHRGNQDWNNHRSFNGRDNFMS  263

Query  1068  plrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHP-MYYVPGPHPDSLVMPMLAS  892
             P   P      +PP   P  PP  P+ P G  + +PE+ P M YVP P  +S+      S
Sbjct  264   PRFGPRFIRPPLPPNPAPLFPPPPPLHPYGGSIGFPELPPQMIYVPPPPLESMRGVPFVS  323

Query  891   pppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKV  712
             P P   +F+Q  D  L +KIVNQI+YYFSN+NL+KD+YLR+ MDDQGWV + LIA FKKV
Sbjct  324   PIPPNAMFFQPSDNQLHTKIVNQIDYYFSNENLVKDIYLRRNMDDQGWVTINLIAGFKKV  383

Query  711   AVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVP----PSVQYSISSPQSARSPG  544
               LT++IQ++L A+RTS+++EVQG+K+R RNDW++WI+P    P+V+ S +  Q      
Sbjct  384   KYLTENIQIVLDAVRTSSVVEVQGDKIRRRNDWRRWIMPGGQVPNVRGSQTVGQ------  437

Query  543   SDVLSQHFQGVTLDDNNANE  484
                L++  Q +TL+  N N+
Sbjct  438   ---LAERVQNITLERTNNND  454



>ref|XP_011011173.1| PREDICTED: la-related protein 1C-like isoform X1 [Populus euphratica]
Length=464

 Score =   191 bits (485),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 176/428 (41%), Positives = 241/428 (56%), Gaps = 56/428 (13%)
 Frame = -1

Query  1764  DAATEAQPESF------ENSDSGNNAVKKPAWNKP----NGSTEAGPVMGAVSWPALSES  1615
             +A+TEA+  +       E+ +S NN  K+P WNKP    NG  E G VMGA SWP LSES
Sbjct  65    NASTEAEQAAAVFVAEKESVESENNVSKRPVWNKPSTAGNGLVEIGSVMGADSWPDLSES  124

Query  1614  TK--ASPKSATYDPLK-TPSDGSVPPP---QGTGIAPSSSPKpvhtnntttpnstpnhvP  1453
                 +S   ++ D LK    DGS       QGT  A SSS K V+               
Sbjct  125   AARVSSLTKSSADSLKGLLFDGSSSSVSVSQGTETASSSSQKQVNNTANPNSTPNNAVP-  183

Query  1452  ARQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGG  1273
             ARQ+S K  G   +SN                     +P S    G E +  ++  RD  
Sbjct  184   ARQKSMKCKGVNTASNGGT-----------------HSPGSQSAAG-EGHLNNSSSRDHA  225

Query  1272  QRGGFGSQSIGGNEN-QYTrssprkgngrprprgdgSYHHAHGGAR-DQERGNQEWNANR  1099
             Q+    SQS G N++ Q  R+S R  NG    RGDGS+HH +GG R D +  N +WNA+ 
Sbjct  226   QKS---SQSRGSNDHPQQQRTSFRNCNGGLHSRGDGSHHHGYGGRRNDLDLANHDWNAHP  282

Query  1098  SFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLV-------YPEVH-PMY  943
             +F SRD H+QPL   +   +R  PP PP       +     P V       +P++  P+Y
Sbjct  283   NF-SRDGHMQPLPRVAPRHMRHQPPPPPTPATSPFI---APPPVRPFGLVGFPDMGLPLY  338

Query  942   YVPGPHPDSLV-MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKE  766
             YV  PHP S+  +P++A+P P   VF+   DP L  +I++QI+YYFSN+NL+KD+YLR+ 
Sbjct  339   YV-SPHPGSMRGVPIIAAPVPTHTVFFPS-DPQLHIRILHQIDYYFSNENLVKDIYLRRN  396

Query  765   MDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSV  586
             MDDQGWVP++LIA+F KV++LTD+I +IL A+RTS+++EVQGEK+R RN W KWI+  +V
Sbjct  397   MDDQGWVPIKLIASFNKVSLLTDNIHVILDAIRTSSVVEVQGEKVRKRNHWMKWIMTTTV  456

Query  585   QY-SISSP  565
             Q  ++SSP
Sbjct  457   QLPNVSSP  464



>ref|XP_007156194.1| hypothetical protein PHAVU_003G266200g [Phaseolus vulgaris]
 gb|ESW28188.1| hypothetical protein PHAVU_003G266200g [Phaseolus vulgaris]
Length=487

 Score =   191 bits (486),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 162/419 (39%), Positives = 224/419 (53%), Gaps = 49/419 (12%)
 Frame = -1

Query  1701  KKPAWNKP-NGSTEAGPVMGAVSWPALSESTKA----SPKSATYDPLKTPSDG-SVPPPQ  1540
             K+PAWNKP NG++ +  VM A SWPALSES +A    SP     D  K   D  S P  Q
Sbjct  62    KRPAWNKPSNGASSS--VMDADSWPALSESARATAVKSPSPLELD--KGSVDAMSTPSLQ  117

Query  1539  GTGIAPSSSPKpvhtnntttpnstpnhvPARQRS-NKRAGGGNSSNTALANGsvsqpqql  1363
             G+G   SS  +    N +    +        Q+S NKR   G SSN              
Sbjct  118   GSGSVVSSPHRQDRDNASGNNTAQ-----THQKSFNKRGNFGPSSNGG------------  160

Query  1362  qslvVEMAPNSAGKPG-VEPYSRDNVH---RDGGQRGGFGSQSIGGNENQYTrssprkgn  1195
                   + P ++G  G + P    N +   ++   R GF S       N +     R  N
Sbjct  161   -----HLPPQTSGPQGPMAPAVSHNYNSSPKEHQPRAGFVSNDHPQQRNSF-----RHRN  210

Query  1194  grprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppspp  1015
             G    +    +HH +GG RD +RGNQ+W+ +R+F  RD ++ P  VP       PP    
Sbjct  211   GGGPHQRGDGHHHNYGGRRDHDRGNQDWSNHRNFNGRDNYMSPRFVPRFIRPPPPPNIAQ  270

Query  1014  fipplmpmrpLGSPLVY-PEVHP-MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLL  841
               PPL PMRP    + Y PE+ P M YVP P  +S+      SP P   +F+Q  D LL 
Sbjct  271   LYPPLPPMRPPYGSIGYPPEIPPQMVYVPPPPLESMRGVPFVSPIPPNAMFFQPTDNLLH  330

Query  840   SKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTS  661
             +KIVNQI+YYFSNDNL+KD+YLR+ MDDQGWVP+ LI+ FKKV  LT++IQ ++ A+R S
Sbjct  331   TKIVNQIDYYFSNDNLVKDIYLRRNMDDQGWVPINLISNFKKVKYLTENIQTVIDAVRAS  390

Query  660   TMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANE  484
             +++E+QG+K+R RNDW++WI+PP+       P S  S     L++  Q +TL+  N ++
Sbjct  391   SVVEIQGDKVRKRNDWRRWIMPPA-----QLPNSRGSQTIGQLAEQVQNITLETTNNDD  444



>emb|CDY62050.1| BnaC03g76880D [Brassica napus]
Length=458

 Score =   191 bits (484),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 154/391 (39%), Positives = 198/391 (51%), Gaps = 73/391 (19%)
 Frame = -1

Query  1710  NAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGSVP-----  1549
             NA KKP WN+P NG++E GPVMGA SWPALSE++KA     +  P    S G VP     
Sbjct  56    NAGKKPVWNRPSNGASEIGPVMGASSWPALSEASKA----PSNKPSSDSSLGDVPSSVSQ  111

Query  1548  --------PPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALA  1393
                      P+  G A + +P                   +RQRS KR G   S+    A
Sbjct  112   GAASASAPAPKQVGRANNPNP---------------TPNHSRQRSFKRNGASGST----A  152

Query  1392  NGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrs  1213
             NG+ SQ            P+S G   VE  S +   R   Q  GF SQ  GG +NQ    
Sbjct  153   NGTASQ------------PSSHGS-LVEGTSHNPSPRGQNQNNGFASQPHGGADNQRD--  197

Query  1212  sprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsr----p  1045
                      R +    +H  HGG R+QE GN  WN +RSF  RD + Q  R         
Sbjct  198   -------SHRNQNGNHHHQNHGGRRNQEHGNHNWNFHRSFNGRDGNAQSPRGAPAFVRYA  250

Query  1044  flrvpppsppfipplmpmrpLGSPLVY-PEVHPMYYVPGPHPDSLVMPMLASpppgpPVF  868
                 PPP     P  M  +  GSP+ Y PE+ P +Y PG       MP +A P    PVF
Sbjct  251   PPPPPPPVQAITPQFMAAQSFGSPVPYPPELAPPFY-PG-------MPFVA-PLSPGPVF  301

Query  867   YQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQ  688
             Y   DP L  K+ NQI YYFS +NLIKD YLR +MDDQG+ P+ +IA F+KVA LTD IQ
Sbjct  302   YHVQDPPLNIKLQNQIHYYFSEENLIKDTYLRDQMDDQGFAPLHVIAGFRKVAELTDSIQ  361

Query  687   LILHAMRTSTMIEVQGEKLRVRNDWKKWIVP  595
              I+ A++ S  +EVQG+++R R++W+ W++P
Sbjct  362   QIVEALQGSPFVEVQGDRIRKRHNWQHWLIP  392



>ref|XP_003516540.1| PREDICTED: la-related protein-like isoform X1 [Glycine max]
Length=501

 Score =   191 bits (486),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 172/423 (41%), Positives = 234/423 (55%), Gaps = 43/423 (10%)
 Frame = -1

Query  1731  ENSDSGNNAVKKPAWNKP--NGSTEAG----PVMGAVSWPALSESTKASPKSATYDPLKT  1570
             E+SD+G  A++ P WNKP  NG+  A     P M A SWP  SEST+A+ KS +   L  
Sbjct  68    ESSDNGGAALR-PVWNKPSPNGAAAAASDVRPEMDANSWPLPSESTRAATKSESSKGLLD  126

Query  1569  PSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALAN  1390
              S  SVP  QG G + S S      ++    N+T + VPARQ+S K      SSN   A 
Sbjct  127   GS--SVPQSQGLG-STSFSSSQREVSDNARTNNTNSLVPARQKSMKHHSSNASSNGGHA-  182

Query  1389  GsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrss  1210
                      Q  V +++  + G       SR++  +D  QR GF S       N +    
Sbjct  183   ---------QHSVPQVSIAATG-------SRNSSPKDHTQRSGFASNDHPQQRNSF----  222

Query  1209  prkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvp  1030
              R  NG    RGDGS+HH +G  RDQE     WN NRSFGSRD H+ P   P       P
Sbjct  223   -RNRNGGQHQRGDGSHHHNYGNRRDQE-----WNNNRSFGSRDTHVPPRVAPRFIRPPPP  276

Query  1029  ppsppfipplmpmrp-LGSPLVYPEVHP-MYYVPGPHP--DSLVMPMLASpppgpPVFYQ  862
             PP               GSP+ + E+ P + +V  P P  DSL       P P  P+F+ 
Sbjct  277   PPPNSAQFFHPSPMRPFGSPIGFHELAPPLVFVAAPPPPPDSLRGVPFVPPMPHHPLFFT  336

Query  861   FLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLI  682
               DP L SKIVNQ++YYFSN+NL+KD +LR+ MDDQGWVP++LIA F KV  LTD+IQ+I
Sbjct  337   GPDPQLHSKIVNQVDYYFSNENLVKDAFLRQNMDDQGWVPIKLIAGFNKVMHLTDNIQVI  396

Query  681   LHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLD  502
             L A++TS+++EVQG+K+R +NDW++WI+ P VQ+S ++     +P  D L++  Q + L+
Sbjct  397   LDAIQTSSVVEVQGDKIRRQNDWRRWIMHPPVQFSNATTIGVLNP--DKLAEQVQNIALE  454

Query  501   DNN  493
              +N
Sbjct  455   TSN  457



>ref|XP_006412048.1| hypothetical protein EUTSA_v10024905mg [Eutrema salsugineum]
 gb|ESQ53501.1| hypothetical protein EUTSA_v10024905mg [Eutrema salsugineum]
Length=525

 Score =   191 bits (485),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 161/411 (39%), Positives = 219/411 (53%), Gaps = 53/411 (13%)
 Frame = -1

Query  1731  ENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYD--------P  1579
             E S   +NA KKP W +P NG++E GPVMGA SWPAL+E+TKA    ++ D        P
Sbjct  100   EESGGQSNAGKKPVWKRPSNGASEVGPVMGASSWPALNEATKAPSNKSSSDSLKSLGDVP  159

Query  1578  LKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTA  1399
             + +PS   VP  QG   A + +PK +   N     +      +RQRS KR G   S+   
Sbjct  160   VSSPS---VPISQGIANASAPAPKQIGRTNPNPTPNH-----SRQRSFKRNGASGSA---  208

Query  1398  LANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYT  1219
              ANG+VSQ            P++ G     P S +   R   Q+ GF SQS GG++N   
Sbjct  209   -ANGTVSQ------------PSAQGSLAELP-SHNPSPRGQNQKNGFASQSHGGSDN---  251

Query  1218  rssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpfl  1039
                            +G++H +HGG R+QE GNQ W+  R+F  RD + Q  R       
Sbjct  252   -----PSQRDSYRNQNGNHHQSHGGRRNQEHGNQNWSFQRNFNGRDGNAQSQRGNPAFVR  306

Query  1038  rvpppsppfipplmpmrpL---GSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVF  868
               PPP  P  P LM  +P+   GSP+ +P      Y P        MP + +P   PPVF
Sbjct  307   HAPPPVQPIPPQLMAAQPIQPFGSPVPFPPEFASPYYP-------RMPFI-TPLAPPPVF  358

Query  867   YQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQ  688
             Y   DP L  K+  QI YYFS +NLI+D YLR  MDDQG+ P+R+IA FKKVA LTD IQ
Sbjct  359   YHVQDPPLNMKLQKQIHYYFSEENLIRDTYLRGHMDDQGFAPLRVIAGFKKVAELTDSIQ  418

Query  687   LILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDV  535
              I+ A+  S  +EVQG+++R R++W+ W++P     ++SSP+S  +  S V
Sbjct  419   QIVEALHGSPYVEVQGDRIRKRHNWQHWLLPRGSGPAVSSPRSVDAVASQV  469



>ref|XP_006590733.1| PREDICTED: la-related protein-like isoform X2 [Glycine max]
Length=498

 Score =   187 bits (474),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 167/420 (40%), Positives = 231/420 (55%), Gaps = 58/420 (14%)
 Frame = -1

Query  1731  ENSDSGNNAVKKPAWNKP--NGS-----TEAGPVMGAVSWPALSESTKASPKSATYDPLK  1573
             E+SD+G  A K+P WNKP  NG+     +E  P M A SWP  SEST+A+ KS +   LK
Sbjct  68    ESSDNGG-AAKRPVWNKPSPNGAAAAAASEVRPEMDANSWPLPSESTRAATKSES---LK  123

Query  1572  TPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALA  1393
                DGS  P     ++ ++S              T + VPARQ+S K      SSN    
Sbjct  124   GLLDGSSVPQSQREVSDNAS--------------TNSVVPARQKSTKHHSSNASSNGG--  167

Query  1392  NGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrs  1213
                             M  +++        SR++  +D  QR GF S       N +   
Sbjct  168   ---------------HMQHSASQVSIAATGSRNSSPKDHTQRSGFASHDHPQQRNSF---  209

Query  1212  sprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrv  1033
               R  NG    RGDGS+HH +G      R +Q+WN NR+FGSRD H+ P RV  R     
Sbjct  210   --RNRNGGQHQRGDGSHHHNYGN-----RHDQDWNNNRTFGSRDTHV-PPRVVPRFIRPP  261

Query  1032  pppsppfipplmpmrpLGSPLVYPEVHP-MYYVPGPHP--DSLVMPMLASpppgpPVFYQ  862
             PPP+        PMRP GSP+ + E+ P + +V  P P  DSL       P P   +F+ 
Sbjct  262   PPPNSAQFFHPSPMRPFGSPIGFHELAPQLVFVAAPPPPPDSLRGVPFVPPMPHHSLFFT  321

Query  861   FLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLI  682
               DP L +KIVNQ++YYFSN+NL+KD +LR+ MDDQGWVP++LIA F KV  LTD+IQ+I
Sbjct  322   GPDPQLHNKIVNQVDYYFSNENLVKDTFLRQNMDDQGWVPIKLIAGFNKVMHLTDNIQVI  381

Query  681   LHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLD  502
             L A+RTS+++EVQG+K+R RNDW++WI+ P VQ+S ++     +P  D+L++    + L+
Sbjct  382   LDAIRTSSVVEVQGDKIRRRNDWRRWIMHPPVQFSNATTIGVLNP--DMLAEQVHNIALE  439



>ref|XP_002869052.1| La domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45311.1| La domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=526

 Score =   184 bits (468),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 151/438 (34%), Positives = 215/438 (49%), Gaps = 69/438 (16%)
 Frame = -1

Query  1740  ESFENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATY-------  1585
             E  E S    NA KKP W +P NG++E GPVMGA SWPALSE+TKA    ++        
Sbjct  99    EKSEESGGQGNAGKKPVWKRPSNGASEVGPVMGASSWPALSETTKAPSNKSSSDSLKSLG  158

Query  1584  DPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSN  1405
             D   + +  SVP  QG   A  ++PK     N     +      +RQRS KR G   S+N
Sbjct  159   DVPSSSASSSVPVSQGIANASVTAPKQASRANPNPTQNH-----SRQRSFKRNGASGSAN  213

Query  1404  TALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQ  1225
               ++                  P++ G     P S +   R   Q+ GF S + GG EN 
Sbjct  214   GTVSQ-----------------PSAQGSFAELP-SHNPSPRGQNQKNGFASHNHGGIEN-  254

Query  1224  YTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplr---vp  1054
                              +G++H +HGG R+QE GNQ W   RSF  R+ + Q  R     
Sbjct  255   -------LSQRDSYRNQNGNHHQSHGGRRNQEHGNQNWTFQRSFSGREGNAQSQRGIPAF  307

Query  1053  srpflrvpppsppfipplmpmrpLGSPL---------VYPEVHPMYYVPGPHPDSLVMPM  901
                      P PP      P++  G P           YP + P +  P PH        
Sbjct  308   VTHAPPPMQPIPPQFMAAQPIQSFGVPFPAELASSGPYYPRMQP-FMTPLPH--------  358

Query  900   LASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATF  721
                     PVFY   DP L  K+ NQI+YYFS++NLI D+YLR  M++QG+VP+R++A F
Sbjct  359   -------GPVFYHVQDPPLHMKLHNQIQYYFSDENLITDIYLRGFMNEQGFVPLRVVAGF  411

Query  720   KKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGS  541
             KKVA LTD IQ I+ A++ S  +EVQGE +R R++W+ W++P     ++SSPQS     +
Sbjct  412   KKVAELTDSIQQIVEALQNSPSVEVQGESIRKRHNWQNWLLPIMRIPAVSSPQSGDR--A  469

Query  540   DVLSQHFQGVTLDDNNAN  487
             D +++    +++D ++A+
Sbjct  470   DAVAKRLGNLSIDQSSAD  487



>ref|XP_003538889.1| PREDICTED: la-related protein-like isoform X1 [Glycine max]
Length=510

 Score =   184 bits (466),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 169/420 (40%), Positives = 231/420 (55%), Gaps = 46/420 (11%)
 Frame = -1

Query  1731  ENSDSGNNAVKKPAWNKP--NGS-----TEAGPVMGAVSWPALSESTKASPKSATYDPLK  1573
             E+SD+G  A K+P WNKP  NG+     +E  P M A SWP  SEST+A+ KS +   LK
Sbjct  68    ESSDNGG-AAKRPVWNKPSPNGAAAAAASEVRPEMDANSWPLPSESTRAATKSES---LK  123

Query  1572  TPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALA  1393
                DGS  P      + SS          +   ST + VPARQ+S K      SSN    
Sbjct  124   GLLDGSSVPQSQGLGSMSS--SSPSQREVSDNASTNSVVPARQKSTKHHSSNASSNGG--  179

Query  1392  NGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrs  1213
                             M  +++        SR++  +D  QR GF S       N +   
Sbjct  180   ---------------HMQHSASQVSIAATGSRNSSPKDHTQRSGFASHDHPQQRNSF---  221

Query  1212  sprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrv  1033
               R  NG    RGDGS+HH +G      R +Q+WN NR+FGSRD H+ P RV  R     
Sbjct  222   --RNRNGGQHQRGDGSHHHNYGN-----RHDQDWNNNRTFGSRDTHV-PPRVVPRFIRPP  273

Query  1032  pppsppfipplmpmrpLGSPLVYPEVHP-MYYVPGPHP--DSLVMPMLASpppgpPVFYQ  862
             PPP+        PMRP GSP+ + E+ P + +V  P P  DSL       P P   +F+ 
Sbjct  274   PPPNSAQFFHPSPMRPFGSPIGFHELAPQLVFVAAPPPPPDSLRGVPFVPPMPHHSLFFT  333

Query  861   FLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLI  682
               DP L +KIVNQ++YYFSN+NL+KD +LR+ MDDQGWVP++LIA F KV  LTD+IQ+I
Sbjct  334   GPDPQLHNKIVNQVDYYFSNENLVKDTFLRQNMDDQGWVPIKLIAGFNKVMHLTDNIQVI  393

Query  681   LHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLD  502
             L A+RTS+++EVQG+K+R RNDW++WI+ P VQ+S ++     +P  D+L++    + L+
Sbjct  394   LDAIRTSSVVEVQGDKIRRRNDWRRWIMHPPVQFSNATTIGVLNP--DMLAEQVHNIALE  451



>ref|XP_004509397.1| PREDICTED: uncharacterized protein LOC101504108 [Cicer arietinum]
Length=481

 Score =   182 bits (461),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 160/407 (39%), Positives = 224/407 (55%), Gaps = 32/407 (8%)
 Frame = -1

Query  1710  NAVKKPAWNKPNGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSD-GSVPPPQGT  1534
             N VK+  WNKP+ +  +  VMGA SWPALSES + SP  +  + +K  +D  ++P  QGT
Sbjct  61    NTVKRQVWNKPSNAASSS-VMGAESWPALSESAR-SPAKSPLESVKAVTDSATLPSLQGT  118

Query  1533  GIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvsqpqqlqsl  1354
             G   S  P P          +     P  Q+  +R   GNS+   L+NG           
Sbjct  119   G---SLLPSPQRQVRENATANNVAPGPTHQKPFRR---GNSN--LLSNGGHPPQMSAPQG  170

Query  1353  vVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprg  1174
              + + P         P+S ++  +D   R GF       N++Q  R+S R  NG P  RG
Sbjct  171   SMVVPPG--------PHSHNHTPKDNPPRAGFVP-----NDHQQHRNSFRNRNGGPHQRG  217

Query  1173  dgSYHHAHGGARDQERGNQEWNANR-SFGSRDAHLQplrvpsrpflrvpp-psppfippl  1000
             DGS+HH +GG RDQ+R NQ+WN +R +F  RD ++ P  VP      +P        PP 
Sbjct  218   DGSHHHNYGGRRDQDRANQDWNTHRRNFNGRDNYMSPRFVPQFIRPPLPSPGQLYPPPPP  277

Query  999   mpmrpLGSPLVYPEVHP-MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQ  823
              P+R  G  + Y E+ P M Y+P P      +P +  P P   +++Q  D  L +KIVNQ
Sbjct  278   PPIRSFGGSMGYHELAPPMLYIPPPMESLRGVPFVPPPMPPNAMYFQPQDLQLHTKIVNQ  337

Query  822   IEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQ  643
             I+YYFSN+NLIKD+YLRK MDDQGWVP+ LIA FKKV  +TD+ Q++  A+RTS+++E+Q
Sbjct  338   IDYYFSNENLIKDIYLRKNMDDQGWVPLNLIAGFKKVKQMTDNFQIVSDAVRTSSVVEMQ  397

Query  642   GEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLD  502
             G+K+R  NDWKKWI+P     S   P  A S     L++  Q + L+
Sbjct  398   GDKIRRWNDWKKWIMP-----STQLPNVAGSQNIGQLAEKVQSIALE  439



>ref|XP_010920098.1| PREDICTED: la-related protein 1C [Elaeis guineensis]
Length=585

 Score =   182 bits (463),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 167/453 (37%), Positives = 234/453 (52%), Gaps = 33/453 (7%)
 Frame = -1

Query  1710  NAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGSVPPPQGT  1534
             N  KKPAW +P NG  E  PVM A SWP LS STKA PKS++ D  K  SD  +  P G 
Sbjct  111   NRGKKPAWQRPSNGWIEVDPVMEA-SWPPLSLSTKAFPKSSSSDTSKGSSDIPISTPPGP  169

Query  1533  GIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTAL-ANGsvsqpqqlqs  1357
              I+ + SPK    N            PARQ+ NKR  GG  S++   ANG  +      +
Sbjct  170   VIS-TPSPKRNSNNINLNSTPDLVVPPARQKPNKRGSGGGGSSSGTPANGIPALQSLPPA  228

Query  1356  lvVEMAPNSAGKPGVEPYSRDNVHRDGGQR--------GGFGSQSIGGNENQYTrssprk  1201
               V      A +   EP  RD  +++ G          GGF  Q  GGN++       R+
Sbjct  229   SAVAAQITPAKQTTQEPSPRDVPNKNSGNSNWEHGTGGGGFTPQQHGGNDHHRGYGGNRR  288

Query  1200  gngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvppps  1021
             G G         +H + G  RDQERGN EWN +R F +RDA +Q  +         PPP 
Sbjct  289   GGGSAS------HHGSFGSRRDQERGNYEWN-HRGFSNRDASVQQHQQRGVRPYPRPPPP  341

Query  1020  ppfipplmpmrpLG---SPLVYPEVHPMYYVPGPHPDSLV--MPMLASpppgpPVFYQFL  856
                 P + P  P+    +P+ YP++ P+YYV  P P   +  +P +A P   P +F+  +
Sbjct  342   VAPPPFIGPPPPVRPFVNPIGYPDIPPVYYVAAPPPPETLRGLPFVAHPAAPPAMFFPPI  401

Query  855   DPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILH  676
             DP   + ++ QI YYFS +NL KD++LR+ MD+QGWVP+ LIA F +V  LT+  Q IL 
Sbjct  402   DPQR-AMLLKQINYYFSTENLCKDIFLRQNMDEQGWVPISLIAGFNRVKQLTNSKQYILD  460

Query  675   AMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQY--SISSPQSARSPGSDVLSQHFQGVTLD  502
              +R S ++E+QGEK+R RNDW  W++ PS  +  ++S  Q   +   D L    Q V L+
Sbjct  461   TVRLSDVVELQGEKIRKRNDWMNWVLTPSPNHFGTVSGMQYPATSDYDALVAQLQTVGLE  520

Query  501   DNNANEHERGNAEAH----LNRSSSE*KNSRVQ  415
             +  A+ H       H    L+RS+S   N+++Q
Sbjct  521   E--ASNHSSMGGSTHTGVFLSRSASGSLNNQLQ  551



>ref|XP_006283537.1| hypothetical protein CARUB_v10004587mg [Capsella rubella]
 gb|EOA16435.1| hypothetical protein CARUB_v10004587mg [Capsella rubella]
Length=523

 Score =   179 bits (455),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 168/493 (34%), Positives = 239/493 (48%), Gaps = 70/493 (14%)
 Frame = -1

Query  1914  WTQIV-GESELvpvvvippqcppspstsVAQEHMDSVSGWATGNSPLPLLQDAATEAQPE  1738
             WTQIV GESE +    +     P     +  E + SVS  AT +S L +  +AA  A+ E
Sbjct  45    WTQIVRGESEPIAAAAVAAPSSPQSRAPI--EPVASVSASATPDSVLTV--EAA--ARDE  98

Query  1737  SFENSDSGNNAVKKPAWNKPN--GSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPS  1564
               E S    NA KKP W +P+   S+E GPVMGA SWPALSE+TKA    ++ D LK+  
Sbjct  99    KSEESGGLGNAGKKPVWKRPSNGASSEGGPVMGASSWPALSETTKAPSNKSSSDSLKSLG  158

Query  1563  DGSVPPP--------QGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSS  1408
             D              QG   AP  +PK     N     +      +RQRS KR G   S+
Sbjct  159   DVPSSSSPSPTVPVSQGIANAPVPAPKQAVRANPNPTPNH-----SRQRSFKRNGASGSA  213

Query  1407  NTALANGsvsqpqqlqslvVEMAPNSAGKPGVE-PYSRDNVH----RDGGQRGGFGSQSI  1243
             N  ++                       +P V+  ++   +H    R   Q+ GF SQ+ 
Sbjct  214   NGTVS-----------------------QPSVQGSFAELPLHSPSPRGQHQKNGFASQTH  250

Query  1242  GGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQpl  1063
             GG++N                  +G++H +HGG R+QE GNQ W  NRSF  R+ + Q  
Sbjct  251   GGSDN--------LPQRDSYRNQNGNHHQSHGGRRNQEHGNQNWGYNRSFNGREGNGQSQ  302

Query  1062  rvpsrpflrvpppsppfipplmpmrp-LGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpp  886
             R         P    P             SP+ +P      Y P        +P + +P 
Sbjct  303   RPAFVRHAPPPVQPIPPQFMTAQPIQPYASPVPFPPDMAASYYP-------RIPFM-TPL  354

Query  885   pgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAV  706
                PVFY   DP L  K+ NQI+YYFS++NL+ D+YLR  MD+ G+VP+R++A FKKVA 
Sbjct  355   AHGPVFYHVQDPPLHIKLQNQIQYYFSDENLVTDVYLRSFMDENGFVPLRVVAGFKKVAE  414

Query  705   LTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQ  526
             LTD IQ I+ A++ S ++EVQG+ +R R++W KW++        SSPQS     +D +  
Sbjct  415   LTDSIQQIVEALQNSPVVEVQGDLIRKRHNWGKWVIQMKAPAE-SSPQSVDR--ADAVGS  471

Query  525   HFQGVTLDDNNAN  487
                 ++LD ++A+
Sbjct  472   RLGKLSLDQSSAD  484



>gb|KHN00450.1| La-related protein 1 [Glycine soja]
Length=387

 Score =   176 bits (447),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 108/233 (46%), Positives = 151/233 (65%), Gaps = 15/233 (6%)
 Frame = -1

Query  1164  YHHAHGGARDQE-RGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmr  988
             +HH +GG RDQ+ RGNQ+WN +RSF  RD  + P   P      +PP   P  PP  P+ 
Sbjct  121   HHHNYGGRRDQDHRGNQDWNNHRSFNGRDNFMSPRFGPRFIRPPLPPNPAPLFPPPPPLH  180

Query  987   pLGSPLVYPEVHP-MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYY  811
             P G  + +PE+ P M YVP P  +S+      SP P   +F+Q  D  L +KIVNQI+YY
Sbjct  181   PYGGSIGFPELPPQMIYVPPPPLESMRGVPFVSPIPPNAMFFQPSDNQLHTKIVNQIDYY  240

Query  810   FSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKL  631
             FSN+NL+KD+YLR+ MDDQGWV + LIA FKKV  LT++IQ++L A+RTS+++EVQG+K+
Sbjct  241   FSNENLVKDIYLRRNMDDQGWVTINLIAGFKKVKYLTENIQIVLDAVRTSSVVEVQGDKI  300

Query  630   RVRNDWKKWIVP----PSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANE  484
             R RNDW++WI+P    P+V+ S +  Q         L++  Q +TL+  N N+
Sbjct  301   RRRNDWRRWIMPGGQVPNVRGSQTVGQ---------LAERVQNITLERTNNND  344



>ref|XP_004512173.1| PREDICTED: la-related protein-like [Cicer arietinum]
Length=486

 Score =   178 bits (451),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 171/434 (39%), Positives = 232/434 (53%), Gaps = 77/434 (18%)
 Frame = -1

Query  1731  ENSDSGNN----AVKKPAWNKPN---GSTEAGPVMGAVSWPALSESTKASPKSATYDPLK  1573
             E+SD+G        K+P WNKP+    ++E  PV+ A SWPALSES + + KS   +P K
Sbjct  63    ESSDNGGEPNGGTAKRPVWNKPSSNCAASEVRPVIDAHSWPALSESARVTTKS---EPSK  119

Query  1572  TPSDGS-VPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTAL  1396
                DGS VP  QG G  PSSS +    +N +  N  P     RQ+  K     NSSN + 
Sbjct  120   GLLDGSSVPQSQGMGSMPSSSSQRQVGDNVSVNNMAP----IRQKPIKH----NSSNASS  171

Query  1395  ANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDG-------GQRGGFGSQSIGG  1237
               G   Q     S     + NS+        S+D++ R G        QR  F +++ G 
Sbjct  172   NGGQSQQSAPQVSTAATGSHNSS--------SKDHIQRSGFVSNDHPQQRNSFRNRNGGP  223

Query  1236  NENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrv  1057
             N+                  GDG++HH +G  RDQ+     WN+ R+F  RD H+ P R 
Sbjct  224   NQR-----------------GDGAHHHNYGNRRDQD-----WNSRRNFNGRDMHV-PPRN  260

Query  1056  psrpflrvpppsppfipplmpmrpLGSPLVYPEVHP---MYYVPGPHPDSL-----VMPM  901
               R      PP+     P  PMRP GS + + E+ P       P P PDSL     V PM
Sbjct  261   VPRILRPSLPPNSAQFIPPPPMRPFGSHMGFHELAPPVVFVAAPPPSPDSLRGVPFVPPM  320

Query  900   LASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATF  721
                     P+++   DP L SKIV QI+YYFSN+NLIKD +LR+ MDDQGWVP++LIA F
Sbjct  321   --------PLYFAGPDPQLHSKIVIQIDYYFSNENLIKDTFLRQNMDDQGWVPIKLIAGF  372

Query  720   KKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQY-SISSPQSARSPG  544
             KKV  LTD+IQLIL A+RTS+ +EVQG+K+R RNDWK+WI+P  VQ+ ++++P       
Sbjct  373   KKVMHLTDNIQLILDAVRTSSAVEVQGDKIRRRNDWKRWIMPTPVQFPNVNTPVVL---N  429

Query  543   SDVLSQHFQGVTLD  502
              DVL++    + L+
Sbjct  430   QDVLAEQVHNIALE  443



>ref|NP_567991.1| La-related protein 1C [Arabidopsis thaliana]
 sp|Q94K80.1|LRP1C_ARATH RecName: Full=La-related protein 1C; Short=AtLARP1c [Arabidopsis 
thaliana]
 gb|AAK44022.1|AF370207_1 unknown protein [Arabidopsis thaliana]
 gb|AAM91803.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86585.1| senescence related LAM domain containing protein [Arabidopsis 
thaliana]
Length=523

 Score =   177 bits (449),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 169/497 (34%), Positives = 237/497 (48%), Gaps = 78/497 (16%)
 Frame = -1

Query  1914  WTQIV-GESELvpvvvippqcppspstsVAQEHMDSVSGWATGNSPLPLLQDAATEAQPE  1738
             WTQIV GESE +             S +   E + SVS  A    P   +      A  E
Sbjct  45    WTQIVRGESEPIAAAAAVAGPSSPQSRAPI-EPIASVSVAA----PTAAVLTVEAAAGDE  99

Query  1737  SFENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYD-------  1582
               E S   +NA KKP W +P NG++E GPVMGA SWPALSE+TKA    ++ D       
Sbjct  100   KSEASGGQDNAGKKPVWKRPSNGASEVGPVMGASSWPALSETTKAPSNKSSSDSLKSLGD  159

Query  1581  -PLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSN  1405
              P  + +  SVP  QG   A   +PK     N     +      +RQRS K+  G + S 
Sbjct  160   VPSSSSASSSVPVTQGIANASVPAPKQAGRANPNPTPNH-----SRQRSFKQRNGASGS-  213

Query  1404  TALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQ  1225
                ANG+VSQ            P++ G    E  S +   R   Q+ GF SQ+ GG EN 
Sbjct  214   ---ANGTVSQ------------PSAQGS-FTELPSHNPSPRGQNQKNGFASQNHGGTEN-  256

Query  1224  YTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrp  1045
                              +G++H +HGG R+QE GNQ W   RSF  R+ + Q  R     
Sbjct  257   -------PSQRDSYRNQNGNHHQSHGGRRNQEHGNQNWTFQRSFNGREGNAQSQRGTPAF  309

Query  1044  flrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGP----HPDSLV-------MPML  898
                                   SP V P    M   P P     P  L        MP +
Sbjct  310   VRHP------------------SPTVQPIPQFMAAQPFPSHIPFPTELAQSSYYPRMPYM  351

Query  897   ASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFK  718
                P GP  FY + DP L  K+  QI+YYFS++NLI D+YLR  M+++G+VP+R++A FK
Sbjct  352   TPIPHGPQFFYHYQDPPLHMKLHKQIQYYFSDENLITDIYLRGFMNNEGFVPLRVVAGFK  411

Query  717   KVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSD  538
             KVA LTD+IQ I+ A++ S  +EVQG+ +R R++W+ W++      + S PQS     +D
Sbjct  412   KVAELTDNIQQIVEALQNSPHVEVQGDFIRKRDNWQNWVL--RRNPTGSGPQSVDR--AD  467

Query  537   VLSQHFQGVTLDDNNAN  487
              +++    +++D ++A+
Sbjct  468   AVAKRLGNLSVDQSSAD  484



>ref|XP_003612233.1| ATP synthase subunit a chloroplastic [Medicago truncatula]
 gb|AES95191.1| ATP synthase, A subunit [Medicago truncatula]
Length=670

 Score =   178 bits (451),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 166/445 (37%), Positives = 232/445 (52%), Gaps = 56/445 (13%)
 Frame = -1

Query  1764  DAATEAQPESFENSDSGNN----AVKKPAWNKPNGS---TEAGPVMGAVSWPALSESTKA  1606
             D +T A+  S +N+D+G        K+PAWN+ +G+   +E  PVM A SWPALS+S + 
Sbjct  56    DDSTSAEVIS-DNADNGGERNGGTGKRPAWNRSSGNGGVSEVQPVMDAHSWPALSDSARG  114

Query  1605  SPKSATYDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRA  1426
             S KS +   L   S  SV P QG    PSSS             +  N  P RQ+S K  
Sbjct  115   STKSESSKGLLDGS--SVSPWQGMESTPSSS----MQRQVGDNVNVNNMAPTRQKSIKH-  167

Query  1425  GGGNSSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVH---------RDGG  1273
                NSSN A +NG  +Q    Q  +     +++         RD+           RD  
Sbjct  168   ---NSSN-ASSNGGHTQQSAPQVSIAATGSHTSSSRDHTQSPRDHTQSPRDHAQSPRDHT  223

Query  1272  QRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSF  1093
             QR GF    +  +  Q   S   +  G  +      +HH +G  RDQ+     WN+ R++
Sbjct  224   QRSGF----VPSDHPQQRNSFRHRNGGPHQRGDGSHHHHNYGNRRDQD-----WNSRRNY  274

Query  1092  GSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHP--D  919
               RD H+ P   P      +PP S PFI P       G    +    P+    GP P  D
Sbjct  275   NGRDMHVPPRVSPRIIRPSLPPNSAPFIHPPPLRPFGGHMGFHELAAPVVLFAGPPPPID  334

Query  918   SL-----VMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQ  754
             SL     V PM        P++Y   DP L SKIVNQI+YYFSN+NL+KD++LRK MD Q
Sbjct  335   SLRGVPFVPPM--------PLYYAGPDPQLHSKIVNQIDYYFSNENLVKDIFLRKNMDAQ  386

Query  753   GWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQY-S  577
             GWVP+ LIA FKKV  LTD+IQLI+ A+RTS+++EVQG+K+R +NDW+KWI+P  VQ+ +
Sbjct  387   GWVPITLIAGFKKVMDLTDNIQLIIDAIRTSSVVEVQGDKIRRQNDWEKWIMPSPVQFPN  446

Query  576   ISSPQSARSPGSDVLSQHFQGVTLD  502
             ++SP+       D+L++  + + L+
Sbjct  447   VTSPEVL---NQDMLAEKMRNIALE  468



>gb|KHN35543.1| La-related protein 1 [Glycine soja]
Length=323

 Score =   170 bits (430),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 143/222 (64%), Gaps = 6/222 (3%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             +H+ +GG RDQ+ GNQ+WN +R+F  RD  + P   P       PP      PP  P+RP
Sbjct  58    HHNNYGGRRDQDPGNQDWNNHRNFNGRDNFMSPRFGPRFIRPPPPPNPAQLFPPPPPLRP  117

Query  984   LGSPLVYPEVHP-MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYF  808
              G  + + E+ P M YVP P  +S+      SP P   +F+Q LD  L +KIVNQI+YYF
Sbjct  118   YGGSIGFTELPPQMVYVPPPPLESMRGVPFVSPIPPNAMFFQPLDNQLHTKIVNQIDYYF  177

Query  807   SNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLR  628
             SN+NL+KD YLR+ MDDQGWVP+ LIA FKKV  LT++IQ++L A+RTS+++EVQG+K+R
Sbjct  178   SNENLVKDTYLRRNMDDQGWVPINLIAGFKKVKYLTENIQIVLDAVRTSSVVEVQGDKIR  237

Query  627   VRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLD  502
              RNDW++WI+P  +  ++   Q+        L++  Q + L+
Sbjct  238   RRNDWRRWILPAGLVPNVRGSQTVGQ-----LAEQVQNIALE  274



>ref|XP_003548829.1| PREDICTED: trithorax group protein osa-like [Glycine max]
Length=483

 Score =   173 bits (438),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 143/222 (64%), Gaps = 6/222 (3%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             +H+ +GG RDQ+ GNQ+WN +R+F  RD  + P   P       PP      PP  P+RP
Sbjct  218   HHNNYGGRRDQDPGNQDWNNHRNFNGRDNFMSPRFGPRFIRPPPPPNPAQLFPPPPPLRP  277

Query  984   LGSPLVYPEVHP-MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYF  808
              G  + + E+ P M YVP P  +S+      SP P   +F+Q LD  L +KIVNQI+YYF
Sbjct  278   YGGSIGFTELPPQMVYVPPPPLESMRGVPFVSPIPPNAMFFQPLDNQLHTKIVNQIDYYF  337

Query  807   SNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLR  628
             SN+NL+KD YLR+ MDDQGWVP+ LIA FKKV  LT++IQ++L A+RTS+++EVQG+K+R
Sbjct  338   SNENLVKDTYLRRNMDDQGWVPINLIAGFKKVKYLTENIQIVLDAVRTSSVVEVQGDKIR  397

Query  627   VRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLD  502
              RNDW++WI+P  +  ++   Q+        L++  Q + L+
Sbjct  398   RRNDWRRWILPAGLVPNVRGSQTVGQ-----LAEQVQNIALE  434



>gb|KGN48944.1| hypothetical protein Csa_6G507180 [Cucumis sativus]
Length=334

 Score =   169 bits (427),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 155/255 (61%), Gaps = 7/255 (3%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             +HH +G  RD +RGNQ+WN+NR++   +A    +          PPP+         MR 
Sbjct  75    HHHNYGSRRDHDRGNQDWNSNRNY---NAQPHRVVHRFIRPSPPPPPNTTGYISSPTMRA  131

Query  984   LGSPLVYPEVHP-MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYF  808
             +G PL +P+  P + Y+  P P++L      +P     +F+   DP L + IV+QIEYYF
Sbjct  132   IGGPLPFPDFAPPVVYIGPPPPEALRGVPFVAPISPNAMFFHGPDPQLYAMIVSQIEYYF  191

Query  807   SNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLR  628
             S +NLIKD +LR+ M+++GWVPV+LIA+F KV  LT++IQ IL A+++ST++EV+G+ +R
Sbjct  192   SGENLIKDTFLRQNMNEEGWVPVKLIASFSKVQRLTENIQTILDALQSSTVVEVKGDTVR  251

Query  627   VRNDWKKWIVPPSVQYSISSPQSARSPGS---DVLSQHFQGVTLDDNNANEHERGNAEAH  457
              R+D+ +WI+ P    +IS P S  SPGS   D+L+   +G+ L++ N    E G  + H
Sbjct  252   RRHDYDRWIIRPGQVPNISGPLSPLSPGSSKQDMLAAGVKGIALENINHRVSEGGQGDVH  311

Query  456   LNRSSSE*KNSRVQS  412
             ++ +S    N++  S
Sbjct  312   VDEASHGDNNTKAGS  326



>ref|XP_007157876.1| hypothetical protein PHAVU_002G105500g [Phaseolus vulgaris]
 gb|ESW29870.1| hypothetical protein PHAVU_002G105500g [Phaseolus vulgaris]
Length=510

 Score =   172 bits (436),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 159/463 (34%), Positives = 220/463 (48%), Gaps = 127/463 (27%)
 Frame = -1

Query  1731  ENSDSGNNAVKKPAWNKPN----GSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPS  1564
             E+SD+G  A K+P WNKP+     ++EA PV+ A+SWPALS STKA+ KS   D  K   
Sbjct  74    ESSDNGG-AAKRPVWNKPSPNGAAASEAQPVIDALSWPALSVSTKAAMKS---DSAKGLL  129

Query  1563  DGS-VPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRS------NKRAGGGNSSN  1405
             DGS VP  Q  G   SSS      ++ T+ +ST   V  R +S      N  + GG+   
Sbjct  130   DGSSVPQLQVLGSPSSSSSLQREVSDNTSTDSTNGVVSTRPKSLKNHSSNASSNGGHHPQ  189

Query  1404  TALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNV-HRDGG--QRGGFGSQSIGGN  1234
              ++   SV+      S   +  P S       P  R++  +R+GG  QRG          
Sbjct  190   QSVPQASVAATGSHNSSPKDHTPRSGFVSNDHPQHRNSFRNRNGGPHQRG----------  239

Query  1233  ENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvp  1054
                                 DGS+HH +G  R      Q+WN NRSF SRD ++      
Sbjct  240   --------------------DGSHHHNYGNRR------QDWNNNRSFSSRDTNV------  267

Query  1053  srpflrvpppsppfipplmpmrpLGSPLVYPEV--------HPMYYVPGPHP--------  922
                                      SP V P             ++ P P P        
Sbjct  268   -------------------------SPRVVPRFIRPPPPPNSTQFFHPSPMPPFGGHIGF  302

Query  921   -----------------DSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNL  793
                              DSL       P P  P+F+   DP L +KIV QI+YYFSN+NL
Sbjct  303   HELSPPVVFVAAPPPPPDSLRSVPFVPPMPHHPLFFTGPDPQLQNKIVTQIDYYFSNENL  362

Query  792   IKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDW  613
             IKD +LR+ MDDQGWVP++LIA F KV  LTD+IQ+I+ A+R S+ +E+QG+K+R RNDW
Sbjct  363   IKDTFLRQNMDDQGWVPIKLIAGFNKVMYLTDNIQMIVEAVRNSSAVELQGDKIRRRNDW  422

Query  612   KKWIVPPSVQYSISSPQSARSPGS---DVLSQHFQGVTLDDNN  493
             ++W++PP VQ+S     +A SPG    D+L++    + L+ +N
Sbjct  423   RRWLMPP-VQFS-----NATSPGESNPDILAEQVHNIALETSN  459



>ref|XP_009418686.1| PREDICTED: la-related protein 1C-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=446

 Score =   170 bits (431),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 162/473 (34%), Positives = 225/473 (48%), Gaps = 86/473 (18%)
 Frame = -1

Query  1824  EHMDSVSGWATGNSPLPLLQDAATEAQPESFENSDSGNNAVKK---PAWNKP-NGSTEAG  1657
             E  D+  GW T                 ES E+ + GN A  +   PAW+ P NG++EAG
Sbjct  31    ETCDAAVGWRTA----------------ESEEHRNGGNAAGDRGWTPAWSVPANGASEAG  74

Query  1656  PVMGAVSWPALSES-TKASPKSATYDPLKTPSDG-SVPPPQGTGIAPSSSPKpvhtnntt  1483
             PVMGA  WP+L ES ++ S +S++ D L   SDG S     G+ IA  SS   ++  +T 
Sbjct  75    PVMGADCWPSLPESASRVSIRSSSLDSLMALSDGPSAAAALGSMIA--SSQMKLNAKSTN  132

Query  1482  tpnstpnhvPARQRSN------KRAGGGNSSNTALANGsvsqpqqlqslvVEMAPNS---  1330
               +S  +    RQ  N      KR GG  SS+ A          Q    + EM P S   
Sbjct  133   PISSQDHDALGRQGPNSSPNLMKRRGGTGSSSAA---NHGPGASQEPHFISEMPPVSVDT  189

Query  1329  ---AGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYH  1159
                +   G+  +   N+ R   +R  F  Q   G+ NQ +     K            +H
Sbjct  190   SQGSSPQGIADHGNSNLGRH--RRDEFLPQLQSGSNNQRSGYGGNKRGNA--------HH  239

Query  1158  HAHGGARDQERGNQEWNANRSFGSRDAHL------Qplrvpsrpflrvpppsppfipplm  997
               HG  RDQE+G  +W+  R F  RD+H+      Q  +         PP + PF+    
Sbjct  240   RRHGSRRDQEQGGYDWSGPRGFSGRDSHILMPLPQQRGQSQPFIRAPPPPTTAPFVGMPP  299

Query  996   pmrpLGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIE  817
               RP  SPL YP    M+  P  H                    +F+       +V QIE
Sbjct  300   YFRPFVSPLGYPA---MFLPPADH-------------------QRFM-------LVKQIE  330

Query  816   YYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGE  637
             YYFS DNL KD++LR+ MDDQGWVP+ LIA+F +V  LT D+  IL A+R ST++EVQGE
Sbjct  331   YYFSPDNLCKDLFLRRNMDDQGWVPISLIASFNRVKQLTRDMPHILDAVRGSTVVEVQGE  390

Query  636   KLRVRNDWKKWIVPPSV-QYSISS-PQSARSPGSDVLSQHFQGVTLDDNNANE  484
             K+R R DW KW++PP+  QY ++S  QS  +PG D +  H     LD+ +++ 
Sbjct  391   KIRKRGDWMKWMMPPTPNQYDLASGSQSPLTPGYDSVIAHMHTFGLDEGSSHH  443



>ref|XP_010432215.1| PREDICTED: la-related protein 1C-like [Camelina sativa]
Length=523

 Score =   171 bits (433),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 145/419 (35%), Positives = 203/419 (48%), Gaps = 55/419 (13%)
 Frame = -1

Query  1710  NAVKKPAWNKP-NGST-EAGPVMGAVSWPALSESTKASPKSATYDPLKTPS-------DG  1558
             NA KKP W +P NGS+ E GPVMGA SWPALSE+T  +P + +                 
Sbjct  109   NAGKKPVWKRPSNGSSSEVGPVMGASSWPALSEATTKAPSNKSSSDSLKSLGDVPSSSPS  168

Query  1557  SVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvs  1378
             S   P   GIA +S P           N  P    +RQRS KR G   S+N  ++     
Sbjct  169   SSSVPVSQGIANASVP-------AARANPGPTPNHSRQRSFKRNGASGSANGTVSQ----  217

Query  1377  qpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprkg  1198
                          P++ G     P S +   R   QR GF SQ+ G  +N          
Sbjct  218   -------------PSAHGSFAELP-SHNPSPRGQNQRNGFASQTHGSADN--------LP  255

Query  1197  ngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsp  1018
                     +G++H +HGG R+QE GNQ W  +RSF  R+ + Q  R         P    
Sbjct  256   QRDSFRNQNGNHHQSHGGRRNQEHGNQNWAYHRSFNGREGNAQSQRPAFVRHAPPPVQPI  315

Query  1017  pfipplmpmrp-LGSPLVY-PEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLL  844
             P             SP+ + PE+   YY     P    M  LA      PVFY   DP L
Sbjct  316   PPHFMAAQPIQPFASPVPFSPEMASSYY-----PRMPFMTPLA----PGPVFYHVQDPPL  366

Query  843   LSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRT  664
               K+ NQI+YYFS +NL+ D+YLR  MD+ G+VP+R+IA FKKVA LTD IQ I+ A++ 
Sbjct  367   HIKLQNQIQYYFSEENLVTDLYLRGFMDEDGFVPLRVIAGFKKVAELTDSIQHIVEALQN  426

Query  663   STMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNAN  487
             S ++EVQG+ +R R++W +W++      ++SSPQ+     +D ++     + LD ++A+
Sbjct  427   SPVVEVQGDVIRKRHEWHQWVLQNMRTPAVSSPQAVDR--ADAVASRLGNLALDQSSAD  483



>ref|XP_010029642.1| PREDICTED: la-related protein 1B-like [Eucalyptus grandis]
 gb|KCW56598.1| hypothetical protein EUGRSUZ_I02318 [Eucalyptus grandis]
Length=531

 Score =   171 bits (432),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 178/440 (40%), Positives = 236/440 (54%), Gaps = 45/440 (10%)
 Frame = -1

Query  1725  SDSGNNAVKKPAWNKPNGS-----TEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSD  1561
             S++GN   K P W  P+ S      E GPVMGA SWPALSEST++S KS +  P+K  SD
Sbjct  92    SENGNVGKKTP-WKLPSESPGPPAAEFGPVMGAESWPALSESTRSSTKSTSV-PVKGLSD  149

Query  1560  GSVPPP--QGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANG  1387
             GS P P  +G G A S S K   T+N     +T + +PAR RS KR  G  SS   +A  
Sbjct  150   GSPPVPVTEGNGNASSVSQK-QLTDNKDAIIATSSPMPARPRS-KRQSGSTSSGGGVAQT  207

Query  1386  svsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssp  1207
                              ++   P V+  S +   RD   R G  S S  GNE+   + S 
Sbjct  208   -----------------SAVVAPSVDLRSNNPSARDHNHRSGPVSHSQNGNEHPQQQRSS  250

Query  1206  rkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSF-GSRDAHLQplrvpsrpflrvp  1030
              +  G    RGDGSYHH++G  RD ERGNQE + +R+F  +RD+H+   R   R     P
Sbjct  251   FRRGGGNYSRGDGSYHHSYGVRRDHERGNQELSGHRNFNNNRDSHMPHQRGMPRIGRPAP  310

Query  1029  ppsppfippl----mpmrpLGSPLVYPEVHPMYYVPGPHP--DSLVMPMLASpppgpPVF  868
             PP              +RPLG PLV+PE  P+YY P P    +    PM       P V+
Sbjct  311   PPPVSPSTAPYIGPASVRPLGGPLVFPET-PVYYFPIPLDIRNPFYPPM-----QPPMVY  364

Query  867   YQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQ  688
                 + LL ++IV+QI+YYFSN+NL+KD YLR++MD QGWV + +IA FKKV  LT+D+Q
Sbjct  365   IPPPNHLLRAQIVSQIDYYFSNENLVKDPYLRQQMDRQGWVSIAVIAGFKKVKELTNDVQ  424

Query  687   LILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYS-ISSPQSARSPGSDVLSQHFQGV  511
             LIL A+RTS ++EVQG+K+R R DW K+++  S   S  +SPQ   S   D L+    G 
Sbjct  425   LILDAVRTSAVVEVQGDKVRKRTDWMKFVLSTSAHSSGTTSPQVPTSLNHDTLA---SGT  481

Query  510   TLDDNNANEHERGNAEAHLN  451
              L   N  E    N    ++
Sbjct  482   ELGSLNVRETRSDNVVGQVD  501



>ref|XP_007017875.1| Winged-helix DNA-binding transcription factor family protein, 
putative [Theobroma cacao]
 gb|EOY15100.1| Winged-helix DNA-binding transcription factor family protein, 
putative [Theobroma cacao]
Length=550

 Score =   171 bits (432),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 164/451 (36%), Positives = 231/451 (51%), Gaps = 55/451 (12%)
 Frame = -1

Query  1728  NSDSGNNAV---KKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSD  1561
             +S+S +NA    KKPAWNKP NG  E  PVMGA SWPALSE+ +ASPKS      KT  D
Sbjct  96    DSNSNSNAAARSKKPAWNKPSNGVVEVSPVMGAASWPALSEAARASPKSLADSSSKTVPD  155

Query  1560  GSVPPPQGTGIA------------PSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGG  1417
             GS+   QG  I             P+S+P    ++   +     +       S     G 
Sbjct  156   GSLSTSQGPVIPQSTQKQGTSNANPTSTPNRTMSSRQRSSKRGGSGGGNNSASGPPHSGF  215

Query  1416  NSSNTALANGsvsqpqqlqslvVEMAPNSAGK--PGV-EPYSRDNVHR----DGGQRGGF  1258
             +  +                 V++M PNS G   P + +P  RD  +R    +    GGF
Sbjct  216   SHQHPPPPP------PPPPFPVLQMPPNSYGNFVPAMPDPSMRDPQYRGNNWENRPVGGF  269

Query  1257  GSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGS-RD  1081
              SQS   N+++++         R        YH+ +GG RDQ+RGN        +GS RD
Sbjct  270   ASQS--HNDHRHSSRRGGNYGPRGDGG----YHNNYGGRRDQDRGN--------YGSGRD  315

Query  1080  AHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSLVMPM  901
              H+Q  R P R F R PPPS     P  P+RP  +P+ YPE   +Y+   P      MP+
Sbjct  316   GHMQHQRAPPRGFPRPPPPSAHSFVPPQPVRPFVNPIGYPEF--IYFPTMPMEPFRGMPL  373

Query  900   LASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATF  721
                 PP   +        L + +++QI+YYFS+ NL+KD +L+  MDDQGWVP+ LIA F
Sbjct  374   FTHAPPPAMIMPVPEL-PLPALLLHQIDYYFSDANLVKDEFLKSNMDDQGWVPISLIAGF  432

Query  720   KKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPG-  544
              +V  LT +IQLIL ++R+ST++EVQ +K+R  N+W KWI  PS    +S+     SPG 
Sbjct  433   PRVKSLTSNIQLILDSLRSSTIVEVQDDKVRRLNEWMKWI--PS---RVSTESGILSPGA  487

Query  543   --SDVLSQHFQGVTLDDNNANEHERGNAEAH  457
               SD+L+  FQ +T+ + + N+ + GN   H
Sbjct  488   SSSDMLASSFQQITVKEESINQSKAGNVNPH  518



>ref|XP_010680405.1| PREDICTED: la-related protein 1C-like [Beta vulgaris subsp. vulgaris]
Length=534

 Score =   170 bits (430),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 171/482 (35%), Positives = 229/482 (48%), Gaps = 71/482 (15%)
 Frame = -1

Query  1731  ENSDSGNNA-VKKPAWNKPNGST---EAGP---VMG-AVSWPALSESTKASPKSATYDPL  1576
             E S++G NA  KK AWNK   +      GP   VMG A +WPALSESTKASPK ++ D  
Sbjct  72    ETSENGGNAGAKKLAWNKKPTNVAVDNGGPGPVVMGPAEAWPALSESTKASPKPSSSDSS  131

Query  1575  KTPSD-GSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvP---------------ARQ  1444
             K  +D GS+   Q TG   SS        + +  +ST                     RQ
Sbjct  132   KILADTGSISSSQVTGTESSSQSVASSVQSQSQSSSTSPKPTSSNLNHNSMPNHGRPTRQ  191

Query  1443  RSNKRAGGGNSSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRG  1264
             +S KR GGGN       +   S P +        +P      G + + R+ +   G +  
Sbjct  192   KSMKRDGGGNPQTNGGTSHQPSSPSEGSHNYNHSSPKPNFGGGSDSFGRETIQNHGNRES  251

Query  1263  GFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGAR-DQERGNQEWNANRSFGS  1087
             G  S++  G+  Q    +  +  G          H  +GG R DQ+RGN +WN  RSF  
Sbjct  252   G--SRNASGDHPQ--PRNSFRRGGGGSHSRGDGAHQNYGGRRGDQDRGNHDWNHQRSFNG  307

Query  1086  RDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSLVM  907
             RDA                    P      P   + +P   P + P +  P      LV 
Sbjct  308   RDAQ----------------RVSPRAYVRPPPAGVAAPFAAPPMRPTFINP------LVD  345

Query  906   PMLASpp-----------pgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMD  760
               L S             P P   +   DPL   +I+ QIEYYFSN+NLIKD YLR+ MD
Sbjct  346   FYLPSMTFVPSAPIVPPVPPPVFLHTGPDPL---RIMTQIEYYFSNENLIKDTYLRQNMD  402

Query  759   DQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQY  580
               GWVP+ L+A FKKV  LT +IQ IL A+R+ST +EVQG+K+R R+DW +WI+P SVQ+
Sbjct  403   GHGWVPMTLVANFKKVMELTQNIQQILDAVRSSTKVEVQGDKIRKRDDWMRWIMPASVQF  462

Query  579   --SISSPQSARSPGSDVLSQHFQGVTLDDNNANE-HERGNAEAH---LNRSSSE*KNSRV  418
               + S  QS RSP    LS H Q V LDD   ++ H +G  + +   ++RSSS   N  +
Sbjct  463   PTAASGSQSPRSPTIAALSSHIQNVKLDDKVIDQDHPKGQLDVNAVTVSRSSSGDMNVPL  522

Query  417   QS  412
             QS
Sbjct  523   QS  524



>ref|XP_010446861.1| PREDICTED: la-related protein 1C isoform X1 [Camelina sativa]
 ref|XP_010446862.1| PREDICTED: la-related protein 1C isoform X2 [Camelina sativa]
 ref|XP_010446863.1| PREDICTED: la-related protein 1C isoform X3 [Camelina sativa]
Length=530

 Score =   170 bits (430),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 146/398 (37%), Positives = 193/398 (48%), Gaps = 52/398 (13%)
 Frame = -1

Query  1710  NAVKKPAWNKP-NGST-EAGPVMGAVSWPALSE--STKASPKSATYDPLKTPSDGSVPPP  1543
             NA KKP W +P NGS+ E GPVMGA SWPALSE  ST  +P S         S G VP  
Sbjct  109   NAGKKPVWKRPSNGSSSEVGPVMGASSWPALSETTSTTKAPPSNKSSSDSLKSLGDVPSS  168

Query  1542  QGT--------GIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANG  1387
               +        GIA +S P           N  P    +RQRS KR G   S+N  ++  
Sbjct  169   SPSSSSAPVSQGIANASVP--AAPKQAARANPNPTPNHSRQRSFKRNGASGSANGTVSQ-  225

Query  1386  svsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssp  1207
                             P++ G     P S +   R   QR GF SQ+ GG +N       
Sbjct  226   ----------------PSAQGSFAELP-SHNPSPRGQNQRNGFASQTHGGADN-------  261

Query  1206  rkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpp  1027
                        +G++H +HGG R+QE GNQ W  +RSF  R+ + Q  R         P 
Sbjct  262   -LPQRDSFRNQNGNHHQSHGGRRNQEHGNQNWAYHRSFNGREGNAQSQRPAFVRHAPPPV  320

Query  1026  psppfipplmpmrp-LGSPLVY-PEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLD  853
              S P             SP+ + PE+   YY   P    L  P          VFY   D
Sbjct  321   QSIPPQFMAAQPIQPFASPVPFSPEMASSYYPRMPFMTPLQHP----------VFYHVQD  370

Query  852   PLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHA  673
             P L  K+ NQI+YYFS +NLI D+YLR  MD+ G+VP+R+IA FKKVA LTD IQ I+ A
Sbjct  371   PPLHIKLQNQIQYYFSEENLITDLYLRGFMDEDGFVPLRVIAGFKKVAELTDSIQQIVEA  430

Query  672   MRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQS  559
             ++ S ++EVQG+ +R R+ W +W++      ++SSPQ+
Sbjct  431   LQNSPVVEVQGDLIRKRHQWNQWVLQNMRTPAVSSPQA  468



>ref|XP_010437404.1| PREDICTED: la-related protein 1C-like [Camelina sativa]
Length=536

 Score =   169 bits (429),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 144/396 (36%), Positives = 196/396 (49%), Gaps = 49/396 (12%)
 Frame = -1

Query  1710  NAVKKPAWNKP-NGST-EAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGSVPPPQG  1537
             NA KKP W +P NGS+ E GPVMGA SWPALSE+T  +P S         S G VP    
Sbjct  116   NAGKKPVWKRPSNGSSSEVGPVMGASSWPALSETTTKAPPSNKSSSDSLKSLGDVPSSSP  175

Query  1536  T--------GIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsv  1381
             +        G A +S P           N  P    +RQRS KR G   S+N  ++    
Sbjct  176   SSSSLPVSQGFANASVP--AAPKQAARANPNPTPNYSRQRSFKRNGASGSANGTVSQ---  230

Query  1380  sqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprk  1201
                           P++ G     P S +   R   QR GF SQ+ GG +N         
Sbjct  231   --------------PSAQGSFAELP-SHNPSPRGQNQRNGFASQTHGGADN--------L  267

Query  1200  gngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvppps  1021
                      +G++H +HGG R+QE GNQ    +RSF  R+ + Q  R         P   
Sbjct  268   PQRDSFRNQNGNHHQSHGGRRNQEHGNQNRAYHRSFNGREGNAQSQRPAFVRHAPPPVQP  327

Query  1020  ppfipplmpmrp-LGSPLVY-PEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPL  847
              P             SP+ + PE+   YY          MP + +P P  PVFY   DP 
Sbjct  328   IPPQFMAAQPIQPFASPVPFSPEMASSYYP--------RMPFM-TPLPHGPVFYHVQDPP  378

Query  846   LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
             L  K+ NQI+YYFS +NLI D+YLR  MD++G+VP+R+IA FKKVA LTD IQ I+ A++
Sbjct  379   LHIKLQNQIQYYFSEENLITDLYLRGFMDEEGFVPLRVIAGFKKVAELTDSIQQIVEALQ  438

Query  666   TSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQS  559
              S ++EVQG+ +R R++W +W++      ++SSPQ+
Sbjct  439   NSPVVEVQGDVIRKRHEWHQWVIRKMRTPAVSSPQA  474



>ref|XP_008806121.1| PREDICTED: la-related protein 1C-like [Phoenix dactylifera]
Length=570

 Score =   170 bits (431),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 182/459 (40%), Positives = 234/459 (51%), Gaps = 44/459 (10%)
 Frame = -1

Query  1701  KKPAWN-KPNGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGSVPPPQGTGI-  1528
             KKPAWN  PNGS EAGPVMGA SWP LSEST+ SPKS++ D LK  SDGSV  P G+ I 
Sbjct  100   KKPAWNMPPNGSNEAGPVMGADSWPPLSESTRVSPKSSSSDSLKALSDGSVSAPPGSPII  159

Query  1527  APSSSPKpvhtnntttpnstpnhvPARQRSN------KRAGGGNSSNTALANGsvsqpqq  1366
             +P   P   H N  +T N        RQ+SN      +R G G  S++  +      P  
Sbjct  160   SPLQKPNSSHPNPNSTSNHAGP---VRQKSNPNPNSMRRGGAGGGSSSGSSANGGPPPPL  216

Query  1365  lqslvVEMAPNSAGKP-GVEPYSRDNVHRD------GGQRGGFGSQSIGGNENQYTrssp  1207
                   E A    GKP G EP  +D+ +R       G +  G   QS G     +     
Sbjct  217   PPQASPETAQIIPGKPSGPEPSPKDHPNRSNSNWDHGWRSSGLTPQSQGA----WDHHRG  272

Query  1206  rkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHL----Qplrvpsrpfl  1039
                + R    G GS+H  +G  RD ERG  +WN  R F  RDAH+    Q  R   R F 
Sbjct  273   YGSSRRGSSGGGGSHHGGYGSRRDHERGGYDWNPPRGFSGRDAHMPLPPQQQRGHPRSFP  332

Query  1038  rvpppsppfipplmpmrpLGSPLVYPEVHP-MYYVPGPHPDSLVM----PMLASpppgpP  874
             R P P+       + +RP  SPL + E  P M+Y   P P+  V     P +        
Sbjct  333   RPPSPASAPFISPLQVRPFMSPLGFAEFPPPMFYFGHPTPNMFVAHQVPPAVPPTMFVTA  392

Query  873   VFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDD  694
               YQ       + ++ QIEYYFS DNL KD+YLR+ MDDQGWVP+ LIA F +V  L ++
Sbjct  393   ADYQ------RTALLKQIEYYFSPDNLCKDIYLRQNMDDQGWVPISLIAGFNRVKQLANN  446

Query  693   IQLILHAMRTSTMIEVQGEKLRVRNDWKKWIV--PPSVQYSISSPQSARSPGSDVLSQHF  520
             IQ IL  +R S ++EVQGEK+R RNDW  WI+  PP+   + S   S  +P  D L+   
Sbjct  447   IQYILDTVRGSDIVEVQGEKIRRRNDWMNWILRAPPNQYSTSSGSSSPTTPNYDSLAARM  506

Query  519   QGVTLDDNNANEHERGNAEAH----LNRSSSE*KNSRVQ  415
               V L +  AN H+R   + H    L+RSSSE  N++ Q
Sbjct  507   HNVGLGEGAAN-HDRIWGQTHTEVVLSRSSSENLNNQSQ  544



>gb|KHN36006.1| La-related protein 1 [Glycine soja]
Length=332

 Score =   164 bits (416),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 118/273 (43%), Positives = 165/273 (60%), Gaps = 16/273 (6%)
 Frame = -1

Query  1302  SRDNVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERG  1123
             SR++  +D  QR GF S       N +   +  +            +HH +G  RDQE  
Sbjct  29    SRNSSPKDHTQRSGFASNDHPQQRNSFRNRNGGQHQRGDGS-----HHHNYGNRRDQE--  81

Query  1122  NQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHP-M  946
                WN NRSFGSRD H+ P RV  R     PPP+        PMRP GSP+ + E+ P +
Sbjct  82    ---WNNNRSFGSRDTHV-PPRVAPRFIRPPPPPNSAQFFHPSPMRPFGSPIGFHELAPPL  137

Query  945   YYVPGPHP--DSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLR  772
              +V  P P  DSL       P P  P+F+   DP L SKIVNQ++YYFSN+NL+KD +LR
Sbjct  138   VFVAAPPPPPDSLRGVPFVPPMPHHPLFFTGPDPQLHSKIVNQVDYYFSNENLVKDAFLR  197

Query  771   KEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPP  592
             + MDDQGWVP++LIA F KV  LTD+IQ+IL A++TS+++EVQG+K+R +NDW++WI+ P
Sbjct  198   QNMDDQGWVPIKLIAGFNKVMHLTDNIQVILDAIQTSSVVEVQGDKIRRQNDWRRWIMHP  257

Query  591   SVQYSISSPQSARSPGSDVLSQHFQGVTLDDNN  493
              VQ+S ++     +P  D L++  Q + L+ +N
Sbjct  258   PVQFSNATTIGVLNP--DKLAEQVQNIALETSN  288



>emb|CDP07362.1| unnamed protein product [Coffea canephora]
Length=527

 Score =   169 bits (427),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 163/449 (36%), Positives = 216/449 (48%), Gaps = 39/449 (9%)
 Frame = -1

Query  1767  QDAATEAQPESFENSDSGNNA-VKKPAWNKP-NGSTEAGPVMG-AVSWPALSESTKASPK  1597
             + +ATE QPES  +S +GN A  KKPAWN+P NG  E   VMG +VSWPALSEST+++ K
Sbjct  67    ESSATETQPESSSDSSNGNAARSKKPAWNRPVNGVVEGSSVMGGSVSWPALSESTRSTIK  126

Query  1596  SATYDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGG  1417
             S+   P K  SDGS    QG  I  S +P+    N     NS  NH   RQ+S K  GGG
Sbjct  127   SSLDSP-KPLSDGSASSSQGPII--SQTPQ-KQANTNANANSVANHGMTRQKSMKHRGGG  182

Query  1416  NSSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGG  1237
             ++                    V   P         P   D+  R      G   QS  G
Sbjct  183   STQGGFRPPPPPPPSMPPPFPAVIEMPAYGNYGNFVPPVLDSSIRGTRPMSGVAPQS--G  240

Query  1236  NENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrv  1057
             N++                R  G   + HGG RD +R             RD HL     
Sbjct  241   NDHSPHSQRNSSRRNNFGGRPRGDGQYHHGGRRDHDR-------------RDVHL---PN  284

Query  1056  psrpflrvpppsppfipplmpmrpLGSPLVYPEVHPM--------YYVPGPHPDSLV-MP  904
                P      P PP  PP      +  P + P V PM         YVP   P+S   MP
Sbjct  285   QFAPPPGGYMPPPPPPPPPGSASFIAPPPMRPFVGPMGFDMAPPFMYVPALPPESFRGMP  344

Query  903   MLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIAT  724
              +A   P  P+F+  +DP L + IV QI+YYFS+ NL+KD YLR  MDD+GWVP++LIA+
Sbjct  345   FIA-QAPPAPMFFPVMDPPLPALIVKQIDYYFSDANLVKDDYLRSNMDDEGWVPIKLIAS  403

Query  723   FKKVAVLTDDIQLILHAMRTSTMIEV--QGEKLRVRNDWKKWIVPPSVQYSISSPQSARS  550
             F +V  LT DI LIL ++R S ++EV  QG+K+R RN+WKKW    S     S+ Q+   
Sbjct  404   FPRVQHLTTDISLILDSLRASVVVEVKEQGDKIRRRNEWKKWTQSSSHVSLDSTSQTPGI  463

Query  549   PGSDVLSQHFQGVTLDDNNANEHERGNAE  463
                D ++   + V+L  N  +  +RG ++
Sbjct  464   SSDDTVTTSIEKVSL--NEVSSSKRGGSD  490



>ref|XP_010531117.1| PREDICTED: la-related protein 1C-like isoform X2 [Tarenaya hassleriana]
Length=497

 Score =   167 bits (424),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 158/270 (59%), Gaps = 28/270 (10%)
 Frame = -1

Query  1272  QRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSF  1093
             QR G  SQS GGN+NQ                 +G++H  HGG R QE GN  WN  R+F
Sbjct  202   QRNGLPSQSHGGNDNQ--------SQRNSYRNQNGNHHQNHGGRRIQEHGNHNWN--RNF  251

Query  1092  GSRDAHLQplrvp----srpflrvpppsppfipplmpmrpLGSPLVYPE-VHPMYYVPGP  928
              +RD H    R       R    V  P P       P++P GSP+ +PE V P+YY    
Sbjct  252   NARDGHAPQQRGTPGFVRRAPPPVQQPIPVPFMAAQPIQPFGSPVAFPELVSPIYYP---  308

Query  927   HPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGW  748
                   MP + S P   PVFYQ  D  L ++I NQI +YFS +NLIKD YLRK MDDQG+
Sbjct  309   -----RMPFI-SAPVPAPVFYQVQDIPLYTRIQNQIHFYFSEENLIKDTYLRKFMDDQGF  362

Query  747   VPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSI-S  571
             V ++LIA F+KV  LTD++Q IL A++ S ++EVQG+K+R R++W+K+++P S++  I S
Sbjct  363   VQIQLIAGFRKVVGLTDNVQHILEALQGSPVVEVQGDKVRRRHNWQKFLLPASMRTPIVS  422

Query  570   SPQSARSPGSDVLSQHFQGVTLDDNNANEH  481
             SPQSA   GS  L+   Q +TL+  NA EH
Sbjct  423   SPQSAERVGS--LATQVQTLTLEQ-NATEH  449


 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 1/36 (3%)
 Frame = -1

Query  1710  NAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKA  1606
             NA KKPAWN+P NG++E GPVMGA SWPALSE+TKA
Sbjct  111   NAGKKPAWNRPSNGASEVGPVMGAASWPALSETTKA  146



>gb|KHN09066.1| La-related protein 1B [Glycine soja]
Length=506

 Score =   167 bits (423),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 163/444 (37%), Positives = 221/444 (50%), Gaps = 60/444 (14%)
 Frame = -1

Query  1704  VKKPAWNKP--NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDG-SVPPPQGT  1534
             V KPAW KP  NG  E GPVMGA SWP LSESTK + K  +   +KT +D  S   PQG 
Sbjct  74    VVKPAWKKPEANGVAEVGPVMGAHSWPDLSESTKPTAKLTSDSSVKTAADEESTTTPQGP  133

Query  1533  GIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSN------------TALAN  1390
               +     +       +   +    +  RQRS K+ GG N +N            T    
Sbjct  134   VTSDPPQKQATANAKPSPTPAMNYGMANRQRSMKQRGGANGNNVGSGPVQNNFSGTTPNL  193

Query  1389  GsvsqpqqlqslvVEMAPNSAGKPGV------EPYSRDNVHRDGGQRGGF-------GSQ  1249
                  P     L++  +  + G PG       +PY R+N      Q GGF        S 
Sbjct  194   PPPPPPPPFPVLLMPPSTFAHGIPGAPVPTPRDPY-RNNNWDARPQHGGFMPPMNEHRSP  252

Query  1248  SIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQ  1069
             S  GN   +             PRG+G YH+++G  RDQ+R            +RDAH+ 
Sbjct  253   SHRGNAGHH-------------PRGEGPYHNSYGNRRDQDRVGYA-------NTRDAHVN  292

Query  1068  plrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSLV-MPMLAS  892
               R+P R  +R PPP+P       PMRPL +P  +PE    YY P    +    MP   +
Sbjct  293   QQRMPPRGLMRPPPPNPAPFMGPQPMRPLANPAGFPEY---YYFPTLQFEPFGGMPFF-T  348

Query  891   pppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKV  712
               P P +FY   +  L + I NQI+YYFS+ NL+KD YLR  MD+QGWVP+ LIA+F +V
Sbjct  349   HAPPPAMFYPVSETPLTNTIANQIDYYFSDANLVKDEYLRSNMDEQGWVPISLIASFPRV  408

Query  711   AVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVL  532
               LT +I+LIL ++RTST +EVQG+KLR R +W KW+  PSVQ      +S+    S+ L
Sbjct  409   RSLTSNIKLILDSLRTSTFVEVQGDKLRRRTEWMKWL--PSVQLLAKPSESS----SNNL  462

Query  531   SQHFQGVTLDDNNANEHERGNAEA  460
             +  F+ +T+DD   N     N +A
Sbjct  463   AADFEKITVDDAKVNAKPTANDDA  486



>ref|XP_004292934.1| PREDICTED: uncharacterized protein LOC101305142 [Fragaria vesca 
subsp. vesca]
Length=556

 Score =   168 bits (425),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 160/420 (38%), Positives = 214/420 (51%), Gaps = 33/420 (8%)
 Frame = -1

Query  1701  KKPAWNKPN-GSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGSVPPPQGTG--  1531
             KKPAWNKP+  + E GPVMGAV+WPALSES +ASPK       KT +D SVPPP   G  
Sbjct  108   KKPAWNKPSKDAVEVGPVMGAVAWPALSESARASPKLPADSSSKTVTDVSVPPPVSPGPV  167

Query  1530  IAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALA-----NGsvsqpqq  1366
             I PS + K +H N+  T  ++ + +PARQR  KR GGG+S+  A A     +G    P  
Sbjct  168   ITPSPNSKKLHGNHANTNPTSTHAMPARQRPTKR-GGGSSTGGANAQAHPHSGFAHPPLP  226

Query  1365  lqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRG--------GFGSQSIGGNENQYTrss  1210
                    + P   G   + P   D   RD   RG        G G Q+   N+ + +   
Sbjct  227   PPPPPFPVFPLPNGYGTLVPAMPDPSPRDPSFRGSNWDARPIGIGHQTHQVNDPRNSSRR  286

Query  1209  prkgngrprprgdgSYHHAHGGARDQE-RGNQEWNANRSFGSRDAHLQplrvpsrpflrv  1033
                G+          +H+ +G  RDQ+ RGN           RD  +  L+ P    L  
Sbjct  287   GNFGSHTRGDGP---FHNNYGSKRDQQDRGN-------FMNGRDVQMHQLQRPPPRGLVR  336

Query  1032  pppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLD  853
             P P         P+RP  +P+ +PE     Y+P    D + MP +   P           
Sbjct  337   PVPPSSAAFTPQPVRPFANPMGFPE---FVYIPTLPLDPIRMPFIPHAPHPAMFMPVAES  393

Query  852   PL--LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLIL  679
             P+  L S IVNQI+YYFS+ NLI+D YLR  MD QGWVP+ LIA F +V  LT ++QLI+
Sbjct  394   PMPSLPSLIVNQIDYYFSDTNLIRDEYLRSNMDAQGWVPISLIANFPRVKSLTTNVQLIM  453

Query  678   HAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDD  499
              ++R S+++EVQ +K+R RNDW KWI       S S   S     SD+LS  FQ +T+DD
Sbjct  454   DSLRASSIVEVQDDKVRRRNDWTKWISTSGRLASESGSSSGDVQSSDMLSTSFQKMTVDD  513



>ref|XP_009418695.1| PREDICTED: la-related protein 1C-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=424

 Score =   165 bits (418),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 155/471 (33%), Positives = 214/471 (45%), Gaps = 104/471 (22%)
 Frame = -1

Query  1824  EHMDSVSGWATGNSPLPLLQDAATEAQPESFENSDSGNNAVKK---PAWNKP-NGSTEAG  1657
             E  D+  GW T                 ES E+ + GN A  +   PAW+ P NG++EAG
Sbjct  31    ETCDAAVGWRTA----------------ESEEHRNGGNAAGDRGWTPAWSVPANGASEAG  74

Query  1656  PVMGAVSWPALSES-TKASPKSATYDPLKTPSDGSVPPPQGTGI-----APSSSPKpvht  1495
             PVMGA  WP+L ES ++ S +S++ D L   SDG                P+SSP  +  
Sbjct  75    PVMGADCWPSLPESASRVSIRSSSLDSLMALSDGPSAAAALDHDALGRQGPNSSPNLM--  132

Query  1494  nntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVEMAPNS-----  1330
                                 KR GG  SS+ A          Q    + EM P S     
Sbjct  133   --------------------KRRGGTGSSSAA---NHGPGASQEPHFISEMPPVSVDTSQ  169

Query  1329  -AGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHA  1153
              +   G+  +   N+ R   +R  F  Q   G+ NQ +     K            +H  
Sbjct  170   GSSPQGIADHGNSNLGRH--RRDEFLPQLQSGSNNQRSGYGGNKRGNA--------HHRR  219

Query  1152  HGGARDQERGNQEWNANRSFGSRDAHL------Qplrvpsrpflrvpppsppfipplmpm  991
             HG  RDQE+G  +W+  R F  RD+H+      Q  +         PP + PF+      
Sbjct  220   HGSRRDQEQGGYDWSGPRGFSGRDSHILMPLPQQRGQSQPFIRAPPPPTTAPFVGMPPYF  279

Query  990   rpLGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYY  811
             RP  SPL YP    M+  P  H                    +F+       +V QIEYY
Sbjct  280   RPFVSPLGYPA---MFLPPADH-------------------QRFM-------LVKQIEYY  310

Query  810   FSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKL  631
             FS DNL KD++LR+ MDDQGWVP+ LIA+F +V  LT D+  IL A+R ST++EVQGEK+
Sbjct  311   FSPDNLCKDLFLRRNMDDQGWVPISLIASFNRVKQLTRDMPHILDAVRGSTVVEVQGEKI  370

Query  630   RVRNDWKKWIVPPSV-QYSISS-PQSARSPGSDVLSQHFQGVTLDDNNANE  484
             R R DW KW++PP+  QY ++S  QS  +PG D +  H     LD+ +++ 
Sbjct  371   RKRGDWMKWMMPPTPNQYDLASGSQSPLTPGYDSVIAHMHTFGLDEGSSHH  421



>ref|XP_004287781.1| PREDICTED: uncharacterized protein LOC101290802 [Fragaria vesca 
subsp. vesca]
Length=337

 Score =   163 bits (412),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 126/280 (45%), Positives = 176/280 (63%), Gaps = 13/280 (5%)
 Frame = -1

Query  1317  GVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGAR  1138
             GVE    +   ++   R  FGSQ+   NE+   RSS R  NG P PRGDGS+HH +GG R
Sbjct  25    GVEVTPNNPSPKEHSHRSPFGSQTQSSNEHPQPRSSLRNRNGGPHPRGDGSHHHNYGG-R  83

Query  1137  DQERGNQEWNANRSFGSRDAHLQplrvp---srpflrvpppsppfipplmpmrpLGSPLV  967
              Q+RG+Q+WN +R+F SRD H+ P RV     RP  + P P         PMRP   P+ 
Sbjct  84    HQDRGSQDWNNHRNFNSRDNHMHPQRVSPRGMRPTHQAPAPPTAPPFFPQPMRPFAGPIG  143

Query  966   YPEVHP--MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNL  793
             + +     +Y+ PG  P   ++P +A P P   +    L   L +KI+NQI+YYFSN+NL
Sbjct  144   FGDFQGSLVYFHPGHDP---LVPFMALPQPPLNLVRPDLQ--LHTKIINQIDYYFSNENL  198

Query  792   IKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIE--VQGEKLRVRN  619
             IKD +LR+ MDDQGWV ++LIA F KV  LTD+IQ+IL A+R ST++E  VQG+K+R RN
Sbjct  199   IKDTFLRRNMDDQGWVRIKLIAGFNKVMNLTDNIQIILDALRMSTVVEVDVQGDKIRRRN  258

Query  618   DWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDD  499
             DW KW++P +   ++SS Q+    G+++LS H Q ++LD+
Sbjct  259   DWMKWVMPAAQPPTVSSSQTLGKSGNEMLSAHIQSISLDE  298



>ref|XP_009138389.1| PREDICTED: la-related protein 1C-like [Brassica rapa]
Length=494

 Score =   166 bits (421),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 160/419 (38%), Positives = 201/419 (48%), Gaps = 75/419 (18%)
 Frame = -1

Query  1761  AATEAQPESFENSDSGNNAVKKPAWNKP-NG---STEAGPVMGAVSWPALSESTKASPKS  1594
             AA E +PE         NA KKP W +P NG   ++E GPVMGA SWPALS +   S   
Sbjct  71    AAGEEKPE--------GNAGKKPVWKRPSNGGAAASEVGPVMGASSWPALSVAANKSSSD  122

Query  1593  ATYDPLKTPSDGSV---PPPQ--GTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKR  1429
             +        S G V   PPP     GIA +S P            +   +  +RQRS KR
Sbjct  123   SLK------SLGDVAPSPPPVLVSQGIANASVPSSASKPAGRANPNPTPNN-SRQRSFKR  175

Query  1428  AGGGNSSNTALANGsvsqpqqlqslvVEMAPNSAGKPGV-----EPYSRDNVHRDGGQRG  1264
              G   SS    ANG                  +A +P V     E  S +   R   QR 
Sbjct  176   NGASGSS----ANG------------------TASQPSVQGSLAESPSHNPSPRGQNQRN  213

Query  1263  GFGSQSIGGNENQYTrssprkgngrprprgdgSYHH-AHGGARDQERGNQEWNANRSFGS  1087
             GF S + GG+            + R   R    YHH +HGG R+QE GNQ W  +RSF  
Sbjct  214   GFPSHTHGGS-------GADNVSQRDSYRNQNGYHHQSHGGRRNQEHGNQNWTFSRSFNG  266

Query  1086  RD--AHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYP-EVHPMYYVPGPHPDS  916
             RD  A  Q    P+      PPP     P  M   P  SPL +P E+   YY        
Sbjct  267   RDGNAQSQRGAPPAFVRHPPPPPLQTIPPQFMAAHPFASPLPFPPELASQYY--------  318

Query  915   LVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVR  736
               MP +A P    PVFY   DP L  K+  QI YYFS +NLIKD YLR++MDDQG+VP+ 
Sbjct  319   QRMPFVA-PLSPGPVFYHVQDPPLNIKLQKQIHYYFSEENLIKDTYLRRQMDDQGFVPLP  377

Query  735   LIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQS  559
             +IA F KVA LT+ +Q I  A++ S ++EVQGE++R R  W+ W++P       SSPQS
Sbjct  378   VIAGFNKVAELTESVQQIAEALQGSPVVEVQGERIRKRYSWQHWLIP----QDPSSPQS  432



>ref|XP_010113302.1| hypothetical protein L484_026632 [Morus notabilis]
 gb|EXC35309.1| hypothetical protein L484_026632 [Morus notabilis]
Length=374

 Score =   163 bits (413),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 110/165 (67%), Gaps = 8/165 (5%)
 Frame = -1

Query  948  MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRK  769
            + YVP P P   V P L+       VFY   DP L SKIVNQI+YYFSN+NLIKD+YLR+
Sbjct  204  LVYVPTPPPFVGVAPPLSP------VFYSPADPQLPSKIVNQIDYYFSNENLIKDIYLRQ  257

Query  768  EMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPS  589
             MDDQGWVP++LIA F KV  LTD+IQ IL A+R S ++EVQG+K+R RNDW +W++PP+
Sbjct  258  NMDDQGWVPIKLIAGFNKVLHLTDNIQFILEAVRMSNVVEVQGDKVRRRNDWMRWLMPPA  317

Query  588  VQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANEHERGNAEAHL  454
               + SSP++      D L+   QG+ L++ N N     N + HL
Sbjct  318  QFSTASSPRTPGKSSHDTLAARVQGIALEERNTNIS--SNYQQHL  360



>emb|CDX69180.1| BnaC01g02730D [Brassica napus]
Length=494

 Score =   165 bits (418),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 165/468 (35%), Positives = 224/468 (48%), Gaps = 83/468 (18%)
 Frame = -1

Query  1926  KSRR---WTQIV-GESELvpvvvippqcppspstsVAQEHMDSVSGWATGNSPLPLLQDA  1759
             +SRR   W+QIV GESE        P+   S +   + +  D +   +    P P+  D 
Sbjct  17    QSRRPSPWSQIVRGESE--------PRTISSSAAPSSPQRRDPIPSASVAPPPAPVAGDD  68

Query  1758  ATEAQPESFENSDSGNNAVKKPAWNKP-NG-STEAGPVMGAVSWPALSESTKASPKSATY  1585
              +E      E+  +  NA KKP W +P NG S+EAGPVMGA SWPALSE+TKA    ++ 
Sbjct  69    RSE------ESGGAQGNAGKKPVWKRPSNGASSEAGPVMGASSWPALSETTKAPSSKSSS  122

Query  1584  DPLKTPSD-----------------GSVPPPQGTGIA-PSSSPKpvhtnntttpnstpnh  1459
             D LK+  D                  SVP P+  G A P+ +P                 
Sbjct  123   DSLKSLGDVPSSSSVVVTVSQGNANASVPAPKQGGRANPNPTPNT---------------  167

Query  1458  vPARQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRD  1279
               +RQRS KR    NS++ + ANGS SQ            P+  G P VE  S +   R 
Sbjct  168   --SRQRSFKR---NNSASGSAANGSNSQ------------PSPQG-PLVETPSHNPSPRG  209

Query  1278  GGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANR  1099
               QR G  SQ+ GG  + ++     +           S+       R+QE GNQ WN +R
Sbjct  210   QNQRNGSASQTHGGGSDSFSPRDSHRNQNGNHHHHHQSHGGR----RNQEHGNQNWNFSR  265

Query  1098  SFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPD  919
             SF  R    +      R         PP      P++P G P+ +P      Y P     
Sbjct  266   SFNGRAHSQRGAPAFVRHQPPHIQSIPPQFMAAQPIQPFGGPVPFPSELASPYYP-----  320

Query  918   SLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPV  739
                MP + SP    PVFYQ  D  L  K+  Q+ YYFS +NLI+D YLR  MDDQG+VP+
Sbjct  321   --RMPFI-SPLSPGPVFYQVQDLPLNVKLQKQVHYYFSEENLIRDTYLRGHMDDQGFVPL  377

Query  738   RLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVP  595
              +IA FKKVA LTD IQ I+ A++ S  +EVQG+++R R +W+ W++P
Sbjct  378   HVIAGFKKVAELTDSIQQIVEALQGSPFVEVQGDRIRKRYNWQHWLLP  425



>emb|CDY47040.1| BnaAnng08280D [Brassica napus]
Length=495

 Score =   165 bits (418),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 157/410 (38%), Positives = 198/410 (48%), Gaps = 67/410 (16%)
 Frame = -1

Query  1710  NAVKKPAWNKP-NG---STEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGSV---  1552
             NA KKP W +P NG   ++E GPVMGA SWPALS +   S   +        S G V   
Sbjct  81    NAGKKPVWKRPSNGGAAASEVGPVMGASSWPALSVAANKSSSDSLK------SLGDVAPS  134

Query  1551  PPPQ--GTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvs  1378
             PPP     GIA +S P            +   +  +RQRS KR G   SS    ANG   
Sbjct  135   PPPVLVSQGIANASVPSSASKPAGRANPNPTPNN-SRQRSFKRNGASGSS----ANG---  186

Query  1377  qpqqlqslvVEMAPNSAGKPGV-----EPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrs  1213
                            +A +P V     E  S +   R   QR GF S + GG+       
Sbjct  187   ---------------TASQPSVQGSLAESPSHNPSPRGQNQRNGFPSHTHGGS-------  224

Query  1212  sprkgngrprprgdgSYHH-AHGGARDQERGNQEWNANRSFGSRD--AHLQplrvpsrpf  1042
                  + R   R    YHH +HGG R+QE GNQ W  +RSF  RD  A  Q    P+   
Sbjct  225   GADNVSQRDSYRNQNGYHHQSHGGRRNQEHGNQNWTFSRSFNGRDGNAQSQRGAPPAFVR  284

Query  1041  lrvpppsppfipplmpmrpLGSPLVYP-EVHPMYYVPGPHPDSLVMPMLASpppgpPVFY  865
                PPP     P  M   P  SPL +P E+   YY          MP +A P    PVFY
Sbjct  285   HPPPPPLQTIPPQFMAAHPFASPLPFPPELASQYY--------QRMPFVA-PLSPGPVFY  335

Query  864   QFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQL  685
                DP L  K+  QI YYFS +NLIKD YLR++MDDQG+VP+ +IA F KVA LT+ +Q 
Sbjct  336   HVQDPPLNIKLQKQIHYYFSEENLIKDTYLRRQMDDQGFVPLPVIAGFNKVAELTESVQQ  395

Query  684   ILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDV  535
             I  A++ S ++EVQGE++R R  W+ W++P       SSPQS  +  S V
Sbjct  396   IAEALQGSPVVEVQGERIRKRYSWQHWLIP----QDPSSPQSVGAVASRV  441



>gb|KGN48946.1| hypothetical protein Csa_6G507200 [Cucumis sativus]
Length=303

 Score =   159 bits (403),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 96/230 (42%), Positives = 136/230 (59%), Gaps = 10/230 (4%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             +HH HG  RDQ+RGN +WN +R++G     +Q    P  P            P       
Sbjct  37    HHHNHGSRRDQDRGNHDWNPHRNYGQPQRVVQRYIRPPPPPSNATFIPSSMRPL------  90

Query  984   LGSPLVYPE-VHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYF  808
              G P+ + E V P+ YV  P  ++L      +P P   VF+   DP L ++IV+QIEYYF
Sbjct  91    -GGPMPFHEFVPPVVYVAAPPQEALRSVPFVAPMPPNAVFFPASDPQLYARIVHQIEYYF  149

Query  807   SNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR-TSTMIEVQGEKL  631
             S++NL+KD YLR+ MD+ GWVP+ L+A FK V  LTD+I +IL A+R TST++EVQG+K+
Sbjct  150   SDENLVKDTYLRRNMDEDGWVPIHLVAGFKMVRSLTDNIPVILDALRSTSTVVEVQGDKV  209

Query  630   RVRNDWKKWIVPPSVQYSIS-SPQSARSPGSDVLSQHFQGVTLDDNNANE  484
             R RND+ KWI+ PS   S   +P S  +   D+L+   Q +TL+  N+ E
Sbjct  210   RRRNDYSKWIMLPSTPTSNEVAPLSPANSSQDLLAAGVQSITLETYNSTE  259



>ref|XP_010531116.1| PREDICTED: la-related protein 1C-like isoform X1 [Tarenaya hassleriana]
Length=510

 Score =   163 bits (412),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 119/283 (42%), Positives = 158/283 (56%), Gaps = 41/283 (14%)
 Frame = -1

Query  1272  QRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSF  1093
             QR G  SQS GGN+NQ                 +G++H  HGG R QE GN  WN  R+F
Sbjct  202   QRNGLPSQSHGGNDNQ--------SQRNSYRNQNGNHHQNHGGRRIQEHGNHNWN--RNF  251

Query  1092  GSRDAHLQplrvp-----------------srpflrvpppsppfipplmpmrpLGSPLVY  964
              +RD H    R                    R    V  P P       P++P GSP+ +
Sbjct  252   NARDGHAPQQRGTPGFVGHAPQQRGTPGFVRRAPPPVQQPIPVPFMAAQPIQPFGSPVAF  311

Query  963   PE-VHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIK  787
             PE V P+YY          MP + S P   PVFYQ  D  L ++I NQI +YFS +NLIK
Sbjct  312   PELVSPIYYP--------RMPFI-SAPVPAPVFYQVQDIPLYTRIQNQIHFYFSEENLIK  362

Query  786   DMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKK  607
             D YLRK MDDQG+V ++LIA F+KV  LTD++Q IL A++ S ++EVQG+K+R R++W+K
Sbjct  363   DTYLRKFMDDQGFVQIQLIAGFRKVVGLTDNVQHILEALQGSPVVEVQGDKVRRRHNWQK  422

Query  606   WIVPPSVQYSI-SSPQSARSPGSDVLSQHFQGVTLDDNNANEH  481
             +++P S++  I SSPQSA   GS  L+   Q +TL+  NA EH
Sbjct  423   FLLPASMRTPIVSSPQSAERVGS--LATQVQTLTLEQ-NATEH  462


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 1/36 (3%)
 Frame = -1

Query  1710  NAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKA  1606
             NA KKPAWN+P NG++E GPVMGA SWPALSE+TKA
Sbjct  111   NAGKKPAWNRPSNGASEVGPVMGAASWPALSETTKA  146



>ref|XP_003527653.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like [Glycine 
max]
Length=511

 Score =   162 bits (411),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 163/443 (37%), Positives = 220/443 (50%), Gaps = 57/443 (13%)
 Frame = -1

Query  1698  KPAWNKP--NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDG-SVPPPQGTGI  1528
             KPAW KP  NG  E GPVMGA SWP LSESTK + K  +   +KT +D  S   PQG   
Sbjct  76    KPAWKKPEANGVAEVGPVMGAHSWPDLSESTKPTAKLTSDSSVKTAADEESTTTPQGPVT  135

Query  1527  APSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSN------------TALANGs  1384
             +     +       +   +    +  RQRS K+ GG N +N            T      
Sbjct  136   SDPPQKQATANAKPSPTPAMNYGMANRQRSMKQRGGANGNNVGSGPVQNNFSGTTPNLPP  195

Query  1383  vsqpqqlqslvVEMAPNSAGKPGV------EPYSRDNVHRDGGQRGGF-------GSQSI  1243
                P     L++  +  + G PG       +PY R+N      Q GGF        S S 
Sbjct  196   PPPPPPFPVLLMPPSTFAHGIPGAPVPTPRDPY-RNNNWDARPQHGGFMPPMNEHRSPSH  254

Query  1242  GGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQpl  1063
              GN   +             PRG+G YH+++G  RDQ+R            +RDAH+   
Sbjct  255   RGNAGHH-------------PRGEGPYHNSYGNRRDQDRVGYA-------NTRDAHVNQQ  294

Query  1062  rvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSLV-MPMLASpp  886
             R+P R  +R PPP+P       PMRPL +P  +PE    YY P    +    MP   +  
Sbjct  295   RMPPRGLMRPPPPNPAPFMGPQPMRPLANPAGFPEY---YYFPTLQFEPFGGMPFF-THA  350

Query  885   pgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAV  706
             P P +FY   +  L + I NQI+YYFS+ NL+KD YLR  MD+QGWVP+ LIA+F +V  
Sbjct  351   PPPAMFYPVAETPLTNTIANQIDYYFSDANLVKDEYLRSNMDEQGWVPISLIASFPRVRS  410

Query  705   LTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQ-YSISSPQSARSPGSDVLS  529
             LT +I+LIL ++RTST +EVQG+KLR R +W KW+  PSVQ  + S   S     S+ L+
Sbjct  411   LTSNIKLILDSLRTSTFVEVQGDKLRRRTEWMKWL--PSVQLLAKSGSISPSESSSNNLA  468

Query  528   QHFQGVTLDDNNANEHERGNAEA  460
               F+ +T+DD   N     N +A
Sbjct  469   ADFEKITVDDAKVNAKPTANDDA  491



>ref|XP_010941333.1| PREDICTED: LOW QUALITY PROTEIN: la-related protein 1C-like [Elaeis 
guineensis]
Length=546

 Score =   162 bits (411),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 161/439 (37%), Positives = 217/439 (49%), Gaps = 72/439 (16%)
 Frame = -1

Query  1701  KKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGSVPPPQGTGIA  1525
             KKPAWN P NG  EAGPVMGA SWP LSESTKAS K ++ D LK  SDGSV         
Sbjct  98    KKPAWNMPSNGFNEAGPVMGADSWPPLSESTKASLKLSSSDSLKAFSDGSV---------  148

Query  1524  PSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVE  1345
               S+P   ++N+    ++  +  P RQ+SN  + GG  S++  +               E
Sbjct  149   --SAPMKPNSNHRNPNSTLNHATPIRQKSNPNSHGGGGSSSGASTNDGPPTPLSPPASAE  206

Query  1344  MAP---NSAGKPGVEPY---SRDNVHRDGGQRG-GFGSQSIGGNENQYTrssprkgngrp  1186
              AP   +   +P   P    ++ N + D G R  GF  +  G  ++              
Sbjct  207   TAPIIPDKQSRPEPSPTDHPNKSNSNWDHGSRSNGFTPRQHGSGDH--------------  252

Query  1185  rprgdgSYHHAHGGARDQERGN--------------QEWNANRSFGSRDAHL-----Qpl  1063
                        HGG     RGN              ++WN  R F  RDAH+     Q  
Sbjct  253   -----------HGGYSGNRRGNSGGSGSHHGAYRSRRDWNTPRGFSGRDAHMLPPPQQHR  301

Query  1062  rvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHP-MYYVPGPHP--DSLV-MPMLA  895
               P     + PP S PF+ P   +RP  SP+ +PE+ P +YY+P  HP  +SL  MP +A
Sbjct  302   GHPRPFPRQPPPSSAPFVTPHPQVRPFLSPMGFPEIPPPVYYIPA-HPPLESLRNMPFVA  360

Query  894   SpppgpPVFYQFLDPLLLSK--IVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATF  721
                P       F+      +  ++ QIEYYFS+DNL KD+YLR++MD QGWVP+ LIA F
Sbjct  361   HQVPHAIPPTMFVPAADHQRALLLKQIEYYFSSDNLCKDIYLRQKMDVQGWVPISLIAGF  420

Query  720   KKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVP-PSVQYSISS-PQSARSP  547
              +V  LT++I  IL  +R S ++EVQGEK+R RNDW  WI+P P  QYS S+ P S  + 
Sbjct  421   NRVKQLTNNIPYILDTIRGSNIVEVQGEKIRRRNDWVNWILPSPLNQYSTSAGPSSPATS  480

Query  546   GSDVLSQHFQGVTLDDNNA  490
               D L+     V L +  A
Sbjct  481   NYDSLAARMHNVGLGEGAA  499



>ref|XP_009334716.1| PREDICTED: la-related protein 1C-like [Pyrus x bretschneideri]
Length=559

 Score =   162 bits (409),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 163/423 (39%), Positives = 213/423 (50%), Gaps = 37/423 (9%)
 Frame = -1

Query  1812  SVSGWATGNSPLPLLQDAATEAQPESFENSDSGNNAVKKPAWNKP-NGSTEAGPV--MGA  1642
             S S  A  +SP P   D  + A   +  NS++G    KKPAWNKP N   E  PV  M A
Sbjct  77    SQSSKAARSSPPPHTPDGFSAADSPNGHNSNAGR--PKKPAWNKPSNSVVEVSPVTVMDA  134

Query  1641  VSWPALSESTKASPKSATYDPLKTPSDG-----SVPPPQGTGIAPSSSPKpvhtnntttp  1477
              SWPALSES +ASPK       KT S+      SVP  QG  IA S + K    N+    
Sbjct  135   SSWPALSESARASPKLPVDPSPKTVSETIVNQESVPVSQGPVIAHSPNSKRHPANSANQN  194

Query  1476  nstpnhvPARQRSNKRAGGGNSSNTALANG---svsqpqqlqslvVEMAPNSAGK--PGV  1312
             +++ +   ARQRS KR G GN+      +G    V  P      V  + PN  G   P +
Sbjct  195   STSNHAP-ARQRSIKRGGSGNNGGGHAHSGFGHPVPPPPPPPFPVFPILPNGYGNLVPAI  253

Query  1311  -EPYSRDNVHR----DGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHG  1147
              +P  RD   R    D    GGF  Q    N+++ +R        R        YH+ HG
Sbjct  254   PDPSPRDPSFRGSNWDARPVGGFVPQPHPVNDHRNSRRGNFGPRPRGDGH----YHNNHG  309

Query  1146  GARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLV  967
             G RDQ+RGN           RD H+   R P    +R  PP+    PP        +P+ 
Sbjct  310   GKRDQDRGNY-------MHPRDVHMHQHRAPPMGLVRPLPPNNAAFPPQPARPF-ANPMG  361

Query  966   YPEVHPMYYVPG-PHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLI  790
             +PE     Y+P  P      MP   S PP P +FY   +  L S I+NQI+YYFS+ NLI
Sbjct  362   FPE---FVYIPTLPLEPIRGMPPFISQPPHPAMFYPVAESPLPSLIINQIDYYFSDANLI  418

Query  789   KDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWK  610
             KD +LR  MD QGW+P+ LIA+F +V  LT +IQLIL ++R S+++EVQ +K+R RN+W 
Sbjct  419   KDDFLRSNMDAQGWIPISLIASFPRVKSLTTNIQLILDSLRASSIVEVQDDKVRRRNEWT  478

Query  609   KWI  601
             KWI
Sbjct  479   KWI  481



>ref|XP_008359756.1| PREDICTED: la-related protein 1C-like [Malus domestica]
Length=559

 Score =   160 bits (405),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 164/423 (39%), Positives = 213/423 (50%), Gaps = 37/423 (9%)
 Frame = -1

Query  1812  SVSGWATGNSPLPLLQDAATEAQPESFENSDSGNNAVKKPAWNKP-NGSTEAGPV--MGA  1642
             S S  A  +SP P   D  + A   +  NS++G    KKPAWNKP N   E  PV  M A
Sbjct  77    SQSSKAARSSPPPHTPDGFSAADSPNGHNSNAGR--PKKPAWNKPSNSVVEVSPVTVMDA  134

Query  1641  VSWPALSESTKASPKSATYDPLKTPSDG-----SVPPPQGTGIAPSSSPKpvhtnntttp  1477
              SWPALSES +ASPK       K  S+      SVP  QG  IA S + K    N+    
Sbjct  135   SSWPALSESARASPKLPADPSPKNVSETIVNQESVPVSQGPVIAHSPNSKRHPANSANQN  194

Query  1476  nstpnhvPARQRSNKRAGGGNSSNTALANG---svsqpqqlqslvVEMAPNSAGK--PGV  1312
             +++ +   ARQRS KR GGGN+      +G    V+ P      V  + PN  G   P +
Sbjct  195   STSNHAQ-ARQRSIKRGGGGNNGGGHAHSGFGHPVTPPPPPPFPVFPILPNGYGNLVPAI  253

Query  1311  -EPYSRDNVHR----DGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHG  1147
              +P  RD   R    D    GGF  Q    N+++ TR        R        YH+ HG
Sbjct  254   PDPSPRDPSFRGSNWDARPVGGFVPQPHPVNDHRNTRRGNFGPRPRGDGH----YHNNHG  309

Query  1146  GARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLV  967
             G RDQ+RGN           RD H+   R P    +R  PP+    PP        +P+ 
Sbjct  310   GKRDQDRGNY-------MNPRDVHMHQHRAPPMALVRPLPPNNAAFPPQPARPF-ANPMG  361

Query  966   YPEVHPMYYVPG-PHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLI  790
             +PE     Y+P  P      MP   S PP P +FY   +  L S I+NQI+YYFS+ NLI
Sbjct  362   FPE---FVYIPALPLEPIRGMPPFISQPPHPAMFYPVAESPLPSLIINQIDYYFSDANLI  418

Query  789   KDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWK  610
             KD +LR  MD QGW+P+ LIA+F +V  LT +IQLIL ++R S+ +EVQ +K+R RN+W 
Sbjct  419   KDDFLRSNMDAQGWIPISLIASFPRVKSLTTNIQLILDSLRGSSNVEVQDDKVRRRNEWT  478

Query  609   KWI  601
             KWI
Sbjct  479   KWI  481



>ref|XP_006573541.1| PREDICTED: la-related protein-like isoform X2 [Glycine max]
Length=421

 Score =   157 bits (396),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 158/386 (41%), Positives = 206/386 (53%), Gaps = 49/386 (13%)
 Frame = -1

Query  1731  ENSDSGNNAVKKPAWNKP--NGSTEAG----PVMGAVSWPALSESTKASPKSATYDPLKT  1570
             E+SD+G  A++ P WNKP  NG+  A     P M A SWP  SEST+A+ KS +   L  
Sbjct  68    ESSDNGGAALR-PVWNKPSPNGAAAAASDVRPEMDANSWPLPSESTRAATKSESSKGLL-  125

Query  1569  PSDGS-VPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALA  1393
               DGS VP  QG G + S S      ++    N+T + VPARQ+S K      SSN   A
Sbjct  126   --DGSSVPQSQGLG-STSFSSSQREVSDNARTNNTNSLVPARQKSMKHHSSNASSNGGHA  182

Query  1392  NGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrs  1213
                       Q  V +++  + G       SR++  +D  QR GF S       N +   
Sbjct  183   ----------QHSVPQVSIAATG-------SRNSSPKDHTQRSGFASNDHPQQRNSF---  222

Query  1212  sprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrv  1033
               R  NG    RGDGS+HH +G  RDQE     WN NRSFGSRD H+ P   P       
Sbjct  223   --RNRNGGQHQRGDGSHHHNYGNRRDQE-----WNNNRSFGSRDTHVPPRVAPRFIRPPP  275

Query  1032  pppsppfipplmpmrp-LGSPLVYPEVHP-MYYVPGPHP--DSLVMPMLASpppgpPVFY  865
             PPP               GSP+ + E+ P + +V  P P  DSL       P P  P+F+
Sbjct  276   PPPPNSAQFFHPSPMRPFGSPIGFHELAPPLVFVAAPPPPPDSLRGVPFVPPMPHHPLFF  335

Query  864   QFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQL  685
                DP L SKIVNQ++YYFSN+NL+KD +LR+ MDDQGWVP++LIA F KV  LTD+IQ+
Sbjct  336   TGPDPQLHSKIVNQVDYYFSNENLVKDAFLRQNMDDQGWVPIKLIAGFNKVMHLTDNIQV  395

Query  684   ILHAMRTSTMIEVQGEKLRVRNDWKK  607
             IL A++TS+++EVQ        DWK+
Sbjct  396   ILDAIQTSSVVEVQ------ETDWKQ  415



>gb|KEH27598.1| ATP synthase, A subunit [Medicago truncatula]
Length=387

 Score =   155 bits (393),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 141/229 (62%), Gaps = 24/229 (10%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             +HH +G  RDQ+     WN+ R++  RD H+ P   P      +PP S PFI P      
Sbjct  121   HHHNYGNRRDQD-----WNSRRNYNGRDMHVPPRVSPRIIRPSLPPNSAPFIHPPPLRPF  175

Query  984   LGSPLVYPEVHPMYYVPGPHP--DSL-----VMPMLASpppgpPVFYQFLDPLLLSKIVN  826
              G    +    P+    GP P  DSL     V PM        P++Y   DP L SKIVN
Sbjct  176   GGHMGFHELAAPVVLFAGPPPPIDSLRGVPFVPPM--------PLYYAGPDPQLHSKIVN  227

Query  825   QIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEV  646
             QI+YYFSN+NL+KD++LRK MD QGWVP+ LIA FKKV  LTD+IQLI+ A+RTS+++EV
Sbjct  228   QIDYYFSNENLVKDIFLRKNMDAQGWVPITLIAGFKKVMDLTDNIQLIIDAIRTSSVVEV  287

Query  645   QGEKLRVRNDWKKWIVPPSVQY-SISSPQSARSPGSDVLSQHFQGVTLD  502
             QG+K+R +NDW+KWI+P  VQ+ +++SP+       D+L++  + + L+
Sbjct  288   QGDKIRRQNDWEKWIMPSPVQFPNVTSPEVL---NQDMLAEKMRNIALE  333



>ref|XP_007226751.1| hypothetical protein PRUPE_ppa018923mg [Prunus persica]
 gb|EMJ27950.1| hypothetical protein PRUPE_ppa018923mg [Prunus persica]
Length=539

 Score =   158 bits (399),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 173/433 (40%), Positives = 228/433 (53%), Gaps = 40/433 (9%)
 Frame = -1

Query  1728  NSDSGNNAV-KKPAWNKP-NGSTEAGP--VMGAVSWPALSESTKASPKSATYDPLKTPSD  1561
             N ++GN A  KKPAWNKP N   E  P  VMGAVSWPALSEST+ASPK       KT SD
Sbjct  92    NGNNGNAARPKKPAWNKPANDDVEVSPTTVMGAVSWPALSESTRASPKLPADSSSKTVSD  151

Query  1560  -----GSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTAL  1396
                  GSV   Q   I  S + K   TNN +  +++ N  PARQR +KR GG ++     
Sbjct  152   ATVTHGSVSVSQAPVITHSPNSKRHSTNNASPNSTSNNAFPARQRPSKRGGGSSTGGGHA  211

Query  1395  ANGsvsqpqqlqslvVEMAPNSAGKPG------VEPYSRDNVHR----DGGQRGGFGSQS  1246
              +G    P         + P      G       +P SRD   R    D    GGF +QS
Sbjct  212   HSGFGHPPTPPPPPPFPVFPILPNGYGNLVPTMPDPSSRDPSFRGNSWDVRPVGGFVTQS  271

Query  1245  IGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQp  1066
                N+++   ++ R+GN  P PRGDG YH+ HGG RDQ+RGN          +RDAH+  
Sbjct  272   HQVNDHR---NNSRRGNFGPHPRGDGPYHNNHGGKRDQDRGNY-------MNARDAHMHQ  321

Query  1065  lrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPG-PHPDSLVMPMLASp  889
              R P R  +R  PP+     P        +P+ +P      Y+P  P      MP + S 
Sbjct  322   HRAPPRGLVRPAPPNTAAFAPQPARPF-ANPMGFPGE--FVYIPTLPLEPMRGMPFI-SQ  377

Query  888   ppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVA  709
              P P +F    +  L S IVNQI+YYFS+ NLIKD +LR  MD QGWVP+ LIA F +V 
Sbjct  378   APHPTMFIPVAESPLPSLIVNQIDYYFSDANLIKDDFLRSNMDVQGWVPISLIANFPRVK  437

Query  708   VLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPG---SD  538
              LT +IQLIL ++R S+++EV  +K+R  N+W KWI P   Q    S  S  SPG    +
Sbjct  438   SLTTNIQLILDSLRASSIVEVHDDKVRRLNEWMKWI-PAGSQLPFESGSS--SPGVLSHN  494

Query  537   VLSQHFQGVTLDD  499
              L+  F+ +T+++
Sbjct  495   TLATSFEKMTVEE  507



>ref|XP_010547410.1| PREDICTED: la-related protein 1B-like [Tarenaya hassleriana]
Length=486

 Score =   155 bits (393),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 134/408 (33%), Positives = 196/408 (48%), Gaps = 53/408 (13%)
 Frame = -1

Query  1701  KKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDP-LKTPSDGS--VPPPQGT  1534
             KKPAWNKP N S + GPVMGA SWPALS S + S   +     LK  SDGS  +PP Q  
Sbjct  88    KKPAWNKPSNSSADVGPVMGAESWPALSVSARVSSVKSVSSESLKGLSDGSSSMPPLQAV  147

Query  1533  GIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvsqpqqlqsl  1354
              I  +S+ K    N     ++        +R+N       SS + ++             
Sbjct  148   EIPSTSTQKQSVGNTIADNHNALGQEKPFKRNN-------SSRSIIS-------------  187

Query  1353  vVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprg  1174
                 AP +  +      S+D  H    QR G    S GG   Q+  S   +         
Sbjct  188   ----APLNTIR------SKDQTH---SQRSG----SYGGGNPQHKNSYRNRNGVSYPRGD  230

Query  1173  dgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmp  994
                +   HG  R+ +  NQ      ++  RD H+Q  +             PP  P    
Sbjct  231   SV-HQQNHGNRRNYDHVNQTAFPRHNYNGRDVHMQQPQRGLGLVRPQVMMGPPSFPAGGS  289

Query  993   mrpLG-----SPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIV  829
                 G      P++YPE     Y+P P P+S+    L       P+++   DP+L +KIV
Sbjct  290   HYMAGPHLYSGPMLYPEYPSAIYMPHPPPESMA---LVGQFSPQPIYFPGYDPMLFTKIV  346

Query  828   NQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIE  649
              Q+++YFS DNL KD YLR+ MD++GWVPV LIA F+K+A LT+++Q+IL A+ +S ++E
Sbjct  347   KQVDFYFSADNLSKDKYLRQHMDEEGWVPVSLIAGFRKLAELTNNVQIILDAVISSAVVE  406

Query  648   VQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTL  505
             VQGE +R R DW K++ P  ++ + ++  SA  P +  L+ H Q + L
Sbjct  407   VQGESIRRRGDWNKYVWPRDLRETTTA--SAARPDA-TLAGHLQEMKL  451



>ref|XP_009384001.1| PREDICTED: LOW QUALITY PROTEIN: la-related protein 1C-like [Musa 
acuminata subsp. malaccensis]
Length=494

 Score =   155 bits (392),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 159/434 (37%), Positives = 227/434 (52%), Gaps = 27/434 (6%)
 Frame = -1

Query  1782  PLPLLQDAATEAQP-ESFENSDSGNNAVKKPAWNKP-NGSTEAGPVM--GAVSWPALSES  1615
             P P   D + +  P E    S S     KKPAW +P NGS +AG V+  GA SWPALSES
Sbjct  56    PFPDALDRSPQRPPVEDVAPSSSDAARGKKPAWKRPPNGSIDAGAVVMGGAASWPALSES  115

Query  1614  TKASPKSATYDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSN  1435
              K + KS + D LK  SDG +  P  + ++ +S+PKP    ++T  +  P    AR +S 
Sbjct  116   AKTTSKSPSSDALKALSDGPLSAPPESVVS-NSAPKPNSNPSSTPNHVAP----ARHKSM  170

Query  1434  KRAGGGNSSN-TALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGF  1258
             KR     +++  A ++G +S P    +       +S  +   EP     + R GG     
Sbjct  171   KRGSSSGNNSSVAQSDGGISLPSTPPTSGPVPQASSDRQAPPEPSPGSQITRGGGS----  226

Query  1257  GSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDA  1078
             GSQ+   + +       R+ N      G G  HH          GN+     R+ G RDA
Sbjct  227   GSQAHDTDSHPRGHGGNRRWNNGGGGGGGGGSHH-------NNYGNRYDGYRRNAGGRDA  279

Query  1077  HLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVH-PMYYVPGPHPDSLVMPM  901
             H+          L VPP +PPF+     +RP   P+V+P++H P++YV    P    +P 
Sbjct  280   HIPHRGARPYLRLPVPPVAPPFLTSPSQVRPY--PMVFPDMHSPVFYV-ATQPPPGGVPF  336

Query  900   LASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATF  721
             +  P   P VF   +DP   S ++ QI+YYFS+DNL KD++LR+ MD+QGWVP+ LIA F
Sbjct  337   VPHPALPPAVFIPTIDPQRAS-LLKQIDYYFSSDNLCKDVFLRQNMDEQGWVPISLIAGF  395

Query  720   KKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPP-SVQYSISSPQSARSPG  544
              +V  LT+ I  IL  ++ ST +EVQGEK+R RNDW  W++PP + Q++  S QS  +P 
Sbjct  396   NRVRQLTNSIDFILDTVQLSTEVEVQGEKIRKRNDWMNWVLPPNNNQFANISSQSPATPN  455

Query  543   SDVLSQHFQGVTLD  502
             SD L    Q V L+
Sbjct  456   SDNLXACVQSVRLE  469



>ref|XP_010095554.1| La-related protein 1B [Morus notabilis]
 gb|EXB60674.1| La-related protein 1B [Morus notabilis]
Length=553

 Score =   155 bits (392),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 139/398 (35%), Positives = 189/398 (47%), Gaps = 81/398 (20%)
 Frame = -1

Query  1677  NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGSVPPPQGTGIAPSSSPKpvh  1498
             NG  E G VMGA  WPALSES +A PK +     K  +DGSV   QG     ++SPK   
Sbjct  123   NGVVEVGSVMGADIWPALSESARAPPKQSADSSSKPLADGSVSSSQGP--VKTNSPKKHA  180

Query  1497  tnntttpnstpnhvPARQRSNKRAG-GGNSSNTALANGsvsqpqqlqslvV----EMAPN  1333
              +N    ++  +H+  RQR  KR G GG  +++  A+     P             + PN
Sbjct  181   NSNANPNSTHNHHLHNRQRPMKRGGAGGGPAHSNFAHPPPPPPPPPPPPPQFSIFPIPPN  240

Query  1332  SAGK--PGV-------------------EPYSRDNVHRDGGQRGGFGSQSIGGNENQYTr  1216
             + G   P +                   +P    N HR+  +RG F  QS G        
Sbjct  241   AYGNLMPAIPDSSPRDPSFRRPVQGLMSQPQHSVNDHRNSSRRGNFVHQSPGDGS-----  295

Query  1215  ssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGS-RDAHLQplrvpsrpfl  1039
                              YH+ +GG RDQ+RGN        FG+ RDAH+QP R P  P  
Sbjct  296   -----------------YHNNYGGRRDQDRGN--------FGNGRDAHVQPQRGPPPPPP  330

Query  1038  rvpppsppfipplmpmrpLGSPLVYPEV--HP---MYYVP-------GPHPDSLVMPMLA  895
                   PP  P             +P    +P   + YVP       GP+P  LV PM  
Sbjct  331   PRGFVRPPPPPNPAAFIAPSHARPFPNHMGYPRPDLVYVPYPFDMRGGPYPHPLVPPMYG  390

Query  894   SpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKK  715
             SP           +P L + +VNQI+YYFS+ NLI+D +LR  MDDQGWVP+ LIA+F +
Sbjct  391   SPA----------EPPLPALLVNQIDYYFSDANLIRDEFLRSNMDDQGWVPISLIASFPR  440

Query  714   VAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWI  601
             V  LT ++Q+IL ++R S+++EVQ +K+R RNDW KW+
Sbjct  441   VKNLTTNVQVILSSLRASSVVEVQDDKIRRRNDWMKWV  478



>ref|XP_004238379.1| PREDICTED: la-related protein 1C [Solanum lycopersicum]
Length=559

 Score =   153 bits (387),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 160/402 (40%), Positives = 204/402 (51%), Gaps = 50/402 (12%)
 Frame = -1

Query  1749  AQPESFENSDSGNNAVKKPAWNKP-NGSTEAGPVMG-AVSWPALSESTKASPKSATYDPL  1576
             A PES ++++      KKPAWNKP NG  EA  VMG AVSWPALSEST+ SPKSAT D  
Sbjct  103   ALPESADSNEGNVGRPKKPAWNKPVNGVVEAVSVMGGAVSWPALSESTRPSPKSAT-DSA  161

Query  1575  KTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTAL  1396
             K   DGSV   QG  I  S SP+     N  T ++     P RQRS K  G  +S     
Sbjct  162   KL-QDGSVSVSQGPII--SQSPQKQANVNANTNSNANPTTPVRQRSIKYRGSSSSGGGGG  218

Query  1395  ANGsvsqpqqlqslvVEMAPNSAG----KPGVEPYSRDNVHRDGGQR--GGFGSQSIGGN  1234
             +        +         P         P +EP  R       G R  GGF SQ  G N
Sbjct  219   SGPGAGAFIRTPPPPPPPLPPPFPVMHFPPVLEPPVR-------GARPVGGFPSQPHGVN  271

Query  1233  ENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvp  1054
             ++   R+  RKGN   RPRGDGSYH+ HGG RDQ+R             RD H+ P   P
Sbjct  272   DHSSHRNHGRKGNFGGRPRGDGSYHNNHGGRRDQDR-------------RDVHMGPPFAP  318

Query  1053  srpflrvpppsppfipplmpmrpLGSPLVYPEVH-------PMYYVPGPHPDSLVMPMLA  895
                   +  P P   P L       +P+  P V+       P +YVP   P+      + 
Sbjct  319   PPHAAFMRAPLPGSGPFLP------TPMRTPFVNQMAYDMTPFFYVPPLSPEPYSAVPII  372

Query  894   SpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKK  715
             +  P  P     +DP L S +VNQIEYYFS+ NL+KD +LR +MD++GWVP+ LIA F +
Sbjct  373   NQAPQLPQHLPLVDPNLPSSLVNQIEYYFSDANLVKDDFLRVKMDEEGWVPMHLIANFPR  432

Query  714   VAVLT-----DDIQLILHAMRTSTMIEVQGEKLRVRNDWKKW  604
             V  +T     D IQ IL+ +R ST +EVQ +K+R R+ W+KW
Sbjct  433   VKKMTEKVQSDIIQFILYCLRASTFVEVQDDKVRRRDGWRKW  474



>ref|XP_003612234.1| ATP synthase subunit a chloroplastic [Medicago truncatula]
 gb|AES95192.1| ATP synthase, A subunit [Medicago truncatula]
Length=535

 Score =   153 bits (387),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 141/229 (62%), Gaps = 24/229 (10%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             +HH +G  RDQ+     WN+ R++  RD H+ P   P      +PP S PFI P      
Sbjct  121   HHHNYGNRRDQD-----WNSRRNYNGRDMHVPPRVSPRIIRPSLPPNSAPFIHPPPLRPF  175

Query  984   LGSPLVYPEVHPMYYVPGPHP--DSL-----VMPMLASpppgpPVFYQFLDPLLLSKIVN  826
              G    +    P+    GP P  DSL     V PM        P++Y   DP L SKIVN
Sbjct  176   GGHMGFHELAAPVVLFAGPPPPIDSLRGVPFVPPM--------PLYYAGPDPQLHSKIVN  227

Query  825   QIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEV  646
             QI+YYFSN+NL+KD++LRK MD QGWVP+ LIA FKKV  LTD+IQLI+ A+RTS+++EV
Sbjct  228   QIDYYFSNENLVKDIFLRKNMDAQGWVPITLIAGFKKVMDLTDNIQLIIDAIRTSSVVEV  287

Query  645   QGEKLRVRNDWKKWIVPPSVQY-SISSPQSARSPGSDVLSQHFQGVTLD  502
             QG+K+R +NDW+KWI+P  VQ+ +++SP+       D+L++  + + L+
Sbjct  288   QGDKIRRQNDWEKWIMPSPVQFPNVTSPEVL---NQDMLAEKMRNIALE  333



>emb|CAN73670.1| hypothetical protein VITISV_031857 [Vitis vinifera]
Length=404

 Score =   151 bits (381),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 165/415 (40%), Positives = 214/415 (52%), Gaps = 86/415 (21%)
 Frame = -1

Query  1914  WTQIV-GESELvpvvvippqcppspstsVAQEHM----DSVSGWATGNSPLPLLQDAATE  1750
             WTQ+V GESE               S   +QE +    D     AT +SP      +  E
Sbjct  41    WTQVVRGESE--------SITAAPSSPVSSQEQIVVSSDCSPTKATSDSPASPEDSSQVE  92

Query  1749  AQPESFENSDSGN-NAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPL  1576
             AQ    E+SD+GN NA K+PAWNKP NG  E GPVMGA SWPALSES +AS   +  D L
Sbjct  93    AQ---LESSDNGNGNAGKRPAWNKPSNGVAEVGPVMGASSWPALSESARAS-AKSASDSL  148

Query  1575  KTPSDGSVPPP------QGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGN  1414
             K P+DGS+  P      QG+G A S S K    NN    ++  + +P RQ+S KR  G  
Sbjct  149   KGPTDGSISTPPAQVHVQGSGNASSPSHK-QVNNNPIPSSTPSHALPTRQKSMKR--GDR  205

Query  1413  SSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGN  1234
             S  ++ AN  + QP   Q  V+E+ PN++       ++  ++H +GGQRGGF  QS  GN
Sbjct  206   SGGSSSANAGLPQPAAPQGPVMEVPPNNSSP---RDHTNRSIHPEGGQRGGFVPQSHSGN  262

Query  1233  ENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvp  1054
             +  + R S RKGN  P  RGDGS+HH +GG RDQ++                        
Sbjct  263   DYPHQRGSYRKGNSGPHSRGDGSHHHGYGGRRDQDQ------------------------  298

Query  1053  srpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSL-VMPMLASpppgp  877
                                        L  P    +Y VP PH D L  +P +A  P   
Sbjct  299   ---------------------------LXSPVSQVVY-VPAPHADPLRTVPFVA--PMPH  328

Query  876   PVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKV  712
             P+F+   D  L +K+V QI+YYFSN+NLIKD+YLR+ MD+QGWVPV+LIA FKKV
Sbjct  329   PMFFXPQDHQLHAKLVAQIDYYFSNENLIKDIYLRQNMDEQGWVPVKLIAGFKKV  383



>ref|XP_008221222.1| PREDICTED: la-related protein 1C-like [Prunus mume]
Length=552

 Score =   152 bits (385),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 164/433 (38%), Positives = 217/433 (50%), Gaps = 40/433 (9%)
 Frame = -1

Query  1728  NSDSGNNAV-KKPAWNKP-NGSTEAGP--VMGAVSWPALSESTKASPKSATYDPLKTPSD  1561
             N ++GN A  KKPAWNKP N   E  P  VMGAVSWPALSEST+ASPK       KT SD
Sbjct  94    NGNNGNAARPKKPAWNKPANDVVEVSPTTVMGAVSWPALSESTRASPKLPADSSSKTVSD  153

Query  1560  -----GSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTAL  1396
                  GS+   Q   +  S + K   TNN +  +++ N  PARQR +KR GGG++     
Sbjct  154   ATVTHGSISVSQAPVVTHSPNSKRHSTNNASPNSTSNNAFPARQRPSKRGGGGSTGGGHA  213

Query  1395  ANGsvsqpqqlqslvVEMAPNSAGKPG------VEPYSRDNVHR----DGGQRGGFGSQS  1246
              +G    P         + P      G       +P SRD   R    D    GGF  QS
Sbjct  214   HSGFGHPPTPPPPPPFPVFPILPNGYGNLLPTMPDPSSRDPSFRGNSWDVRPVGGFVPQS  273

Query  1245  IGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQp  1066
                N+++        G           YH+ HGG RDQ+RGN          +RDAH+  
Sbjct  274   HQVNDHRTNSRRGNFGPHPRGDGS---YHNNHGGKRDQDRGNY-------MNARDAHMHQ  323

Query  1065  lrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPG-PHPDSLVMPMLASp  889
              R P R  +R  PP+    PP        +P+ +P      Y+P  P      MP + S 
Sbjct  324   HRAPPRGLVRPAPPNTAAFPPQPARPF-ANPMGFPGE--FVYIPTLPLEPMRGMPFI-SQ  379

Query  888   ppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVA  709
              P P +F    +  L S IVNQI+YYFS+ NLIKD +LR  MD QGWVP+ LIA F +V 
Sbjct  380   APHPAMFIPVAESPLPSLIVNQIDYYFSDANLIKDDFLRSNMDVQGWVPISLIANFPRVK  439

Query  708   VLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPG---SD  538
              LT +IQLIL ++R S+++EV  +K+R  N+W KWI P   Q    S  S   PG    +
Sbjct  440   SLTTNIQLILDSLRGSSIVEVHDDKVRRLNEWMKWI-PAGSQLPFESGSSL--PGVLSHN  496

Query  537   VLSQHFQGVTLDD  499
              L+  F+ +T+++
Sbjct  497   TLATSFEKMTVEE  509



>ref|XP_006577960.1| PREDICTED: la-related protein-like [Glycine max]
Length=520

 Score =   152 bits (384),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 152/439 (35%), Positives = 209/439 (48%), Gaps = 74/439 (17%)
 Frame = -1

Query  1698  KPAWNKP--NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGS--VPPPQGTG  1531
             KPAW KP  NG +E GPVMGA SWP LSESTK + K  +   +KT +D       PQ   
Sbjct  82    KPAWKKPESNGVSEVGPVMGAHSWPDLSESTKPTAKLTSDSSVKTAADEESLTTTPQDPV  141

Query  1530  IAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNT-----------ALANGs  1384
              + S   + +   N +   +    +  RQRS K+ GG N  N            A  N  
Sbjct  142   NSDSPQKQAIGNANPSPTPAMNYGMANRQRSMKQRGGSNGYNVGSGPVQNNFSGATQNLP  201

Query  1383  vsqpqqlqslvVEMAPNSA-GKPGV------EPYSRDN---------------VHRDGGQ  1270
                P     ++       A G PGV      +PY  +N                HR   +
Sbjct  202   PPPPPPPFPVLPMPPRTFAHGIPGVPVPTPRDPYRNNNWDARPPHGGFMPPMSEHRSPSR  261

Query  1269  RGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFG  1090
             RG  G    G                         YH+++G  RDQ+RG           
Sbjct  262   RGNAGHHPRGDGP----------------------YHNSYGSRRDQDRGGYA-------N  292

Query  1089  SRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSLV  910
             +RDAH+   R+P R  +R PPP+P       PMRP  +P  +PE    YY P    +   
Sbjct  293   TRDAHVNQQRMPPRGLMRPPPPNPAPFMGPQPMRPFANPAGFPE---FYYFPTLQFEPFG  349

Query  909   -MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRL  733
              MP   +  P P +F+   +  L + I NQI+YYFS+ NL+KD YLR  MD+QGWVP+ L
Sbjct  350   GMPFF-THAPPPAMFFPVAETPLTNTIANQIDYYFSDANLVKDEYLRSNMDEQGWVPITL  408

Query  732   IATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQY-SISSPQSA  556
             IA+F +V  LT +I+LIL ++RTST++EVQG+KLR  N+W KW+  PS Q  + S   S 
Sbjct  409   IASFPRVRSLTSNIKLILDSLRTSTVVEVQGDKLRRCNEWMKWL--PSAQLRANSGSISP  466

Query  555   RSPGSDVLSQHFQGVTLDD  499
                 S+ L+  F+ +T+D+
Sbjct  467   SGSSSNNLAADFEKITVDE  485



>ref|XP_006342071.1| PREDICTED: la-related protein 1-like [Solanum tuberosum]
Length=560

 Score =   152 bits (384),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 158/389 (41%), Positives = 199/389 (51%), Gaps = 36/389 (9%)
 Frame = -1

Query  1731  ENSDSGNNAV---KKPAWNKP-NGSTEAGPVMG-AVSWPALSESTKASPKSATYDPLKTP  1567
             E+SDS +  V   KKPAWNKP NG  EA  VMG AVSWPALSEST+ SPKSAT D  K  
Sbjct  110   ESSDSNDGNVGRPKKPAWNKPVNGVVEAVSVMGGAVSWPALSESTRPSPKSAT-DSAKPI  168

Query  1566  SDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNK-RAGGGNSSNTALAN  1390
              DGS    QG  IA   SP+     N  T ++     P RQRS K R       +   A 
Sbjct  169   PDGSASVSQGPIIA--QSPQKQANVNANTNSNANPTTPVRQRSMKYRGSSSGGGSGPGAG  226

Query  1389  GsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQR--GGFGSQSIGGNENQYTr  1216
               +  P      +    P     P +EP  R       G R  GGF SQ  G N++   R
Sbjct  227   AFIRTPPPPPPPLPPPFPVMHFPPVLEPPVR-------GVRPVGGFPSQPHGVNDHSSHR  279

Query  1215  ssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflr  1036
             +  RKGN   RPRGDGSYH+ HGG RDQ+R             RD H+ P   P      
Sbjct  280   NHGRKGNFGGRPRGDGSYHNNHGGRRDQDR-------------RDVHMGPPFAPPHAAFM  326

Query  1035  vpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFL  856
               P          PMRP     +  ++ P +YVP   P+      + +  P  P     +
Sbjct  327   RAPLPGSGPFLPTPMRPPFVNQMGYDMTPFFYVPPLSPEPYSAVPIINQAPQLPQHLPLV  386

Query  855   DPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLT-----DDI  691
             DP L S +V QIEYYFS+ NL+KD +LR +MD++GWVP+ LIA F +V  +T     D I
Sbjct  387   DPNLPSSLVTQIEYYFSDANLVKDDFLRVQMDEEGWVPMHLIANFPRVKKMTEKVQSDII  446

Query  690   QLILHAMRTSTMIEVQGEKLRVRNDWKKW  604
             Q IL+ +R ST +EVQ +K+R R+ W+KW
Sbjct  447   QFILYCLRGSTFVEVQDDKVRRRDGWRKW  475



>ref|XP_010666913.1| PREDICTED: la-related protein 1C-like [Beta vulgaris subsp. vulgaris]
Length=486

 Score =   151 bits (381),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 157/424 (37%), Positives = 215/424 (51%), Gaps = 34/424 (8%)
 Frame = -1

Query  1713  NNAVKKPAWNKPNGSTEAGP--------VMGAVSWPALSESTKASPKSATYDPLKTPSDG  1558
             +N  KKPAWN    S+   P        V+GA +WPALSEST+   K ++ D  K+  + 
Sbjct  55    SNVGKKPAWNNAISSSSTPPPPSGDQPVVIGATAWPALSESTRFPLKLSSSDSPKSTPEV  114

Query  1557  SVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvs  1378
             SVP  QG   + S  PK  + N  ++ NST      RQRS KR GGG +       G   
Sbjct  115   SVPESQGPINSHSQQPKQGNANQISSMNSTAP---TRQRSMKRGGGGGNRQGGFTRGPPP  171

Query  1377  qpqqlqslvVEMAPNSAGKPGVEPYSR-DNVHRDGGQRGGFGSQSIGGNE--NQYTrssp  1207
              P      V EM  +S  K  V P +R D+  R+    G F S  +  NE  NQ + +  
Sbjct  172   PPPLPAFPVPEMPQSSFSK--VVPAARPDSSFRETRPPGVFASHPMPSNEHPNQRSSNRR  229

Query  1206  rkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpp  1027
                    R  G  +YH   GG RDQ+ GN + +++ +F  R AH      P       PP
Sbjct  230   GNFGQHGRGDGRSNYH---GGRRDQDHGNHDRSSSSNFNGRGAH-GYPHRPHGRGFMGPP  285

Query  1026  psppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSLV-MPMLASpppgpPVFYQFLDP  850
                        +RP G+  +YP+   +Y +P   P+S   MP +  PPP       +L  
Sbjct  286   VQGAPPFTPPLVRPYGNAFLYPDPSVVYLIPSFPPESFGGMPYITGPPPP-----PYLVA  340

Query  849   LLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAM  670
                + I+NQIEYYFS  NL+KD +LR +MD+QGWVP+ LIA F +V  LTD I  IL  +
Sbjct  341   PSRASIINQIEYYFSEANLVKDAFLRSKMDEQGWVPITLIADFPRVRQLTDSIPFILDCI  400

Query  669   RTSTMIEVQGEKLRVRNDWKKWIVP-PSVQYSISSPQSARSP-GS-DVLSQHFQGVTLDD  499
             + S ++EVQG+K+R  +DW KWI P PS     S+   A+SP GS D L+   Q V+L++
Sbjct  401   KESNIVEVQGDKVRKCDDWMKWIAPQPS-----SAESGAQSPVGSFDGLTTAVQRVSLEE  455

Query  498   NNAN  487
             N  N
Sbjct  456   NQDN  459



>ref|XP_009380210.1| PREDICTED: la-related protein 1B-like [Musa acuminata subsp. 
malaccensis]
Length=478

 Score =   150 bits (379),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 138/413 (33%), Positives = 212/413 (51%), Gaps = 37/413 (9%)
 Frame = -1

Query  1728  NSDSGNNAVKKPAWNKP-NGSTEAGPVM--GAVSWPALSESTKASPKSATYDPLKTPSDG  1558
             +S      VKKP W +P NGS   G  +  GA SWPAL+ES KA+ KS   D L+  SDG
Sbjct  80    SSSEATAGVKKPVWKRPPNGSIHKGAAVMGGAASWPALAESAKAASKSQPSDALRILSDG  139

Query  1557  SVPPPQ----GTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALAN  1390
              VP P       G+  S+S       N +  ++     P RQ+S KR+G G   ++ ++ 
Sbjct  140   PVPVPSVRLPDLGLLVSNS---SPEPNPSPTSTLNYVTPERQKSMKRSGSGGGGSSGISA  196

Query  1389  GsvsqpqqlqslvVEMAPNSAGKPG------VEPYSRDNVHRDGGQRGG-FGSQSIGGNE  1231
                            M   +  K        ++  +++  + D G RGG  GSQ+ G  +
Sbjct  197   DGGMPLLSPPPTSGPMPKRNLDKQAPMELSPLDQTTKNTTNWDHGSRGGGLGSQAHGSGD  256

Query  1230  NQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNA-NRSFGSRDAHLQplrvp  1054
             +                  +   ++  G    Q    + ++  +R+ G RD H+Q     
Sbjct  257   HH------------RGYGRNRKLNNGGGAGSHQNNSGKRYDGYHRNAGGRDVHIQQQGAW  304

Query  1053  srpflrvpppsppfipplmpmrpLGSPLVYPEV-HPMYYVPGPHPDSLVMPMLASpppgp  877
                 L VPP + PF+   + ++P G+P++YP++  P++YV    P   V+P +  P   P
Sbjct  305   PHLRLPVPPVAAPFLSLPLQVQPFGNPMLYPDMPSPIFYV-ATQPPPGVVPFVPHPSIPP  363

Query  876   PVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTD  697
              +F   ++P   S ++NQI+YYFS++NL KD+YLR+ MD+QGWVP+ LIA F +V  LT+
Sbjct  364   AMFVPAINPQRAS-LLNQIDYYFSSNNLCKDVYLRQNMDEQGWVPISLIAGFPRVRQLTN  422

Query  696   DIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPS----VQYSISSPQSARS  550
             +I  IL  +R+ST +EVQGEK+R RNDW  W++PPS       S+ SP + +S
Sbjct  423   NIDFILETVRSSTEVEVQGEKIRKRNDWMNWVLPPSNNQFANISLQSPATMKS  475



>ref|XP_002531141.1| lupus la ribonucleoprotein, putative [Ricinus communis]
 gb|EEF31226.1| lupus la ribonucleoprotein, putative [Ricinus communis]
Length=471

 Score =   150 bits (379),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 118/195 (61%), Gaps = 31/195 (16%)
 Frame = -1

Query  981  GSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSN  802
            G P V   + PMY+ P P                        DP L  +I+ QIEYYFSN
Sbjct  236  GVPFVAATMPPMYF-PAP------------------------DPQLQQQIMTQIEYYFSN  270

Query  801  DNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVR  622
            +NLI+D++LR+ MDDQGWVP+ LIA+FKKV  LTD+IQLIL ++R S+++EVQ +K+R +
Sbjct  271  ENLIRDIFLRQNMDDQGWVPIILIASFKKVLNLTDNIQLILESVRNSSILEVQVDKVRRQ  330

Query  621  NDWKKWIVPPSVQY-SISSPQSARSPGSDVLSQHFQGVTLDD-----NNANEHERGNAEA  460
            NDW +W++PPS Q+ S+S P        D+L+ H Q ++L++     ++A      + EA
Sbjct  331  NDWMRWVMPPSAQFTSVSGPPFLGRSSQDMLAAHVQSISLEESVTSHSSARSQVDVHNEA  390

Query  459  HLNRSSSE*KNSRVQ  415
             L RSSS   NS+ Q
Sbjct  391  FLGRSSSGDFNSQSQ  405


 Score = 62.4 bits (150),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -1

Query  1731  ENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYD  1582
             E +D+G NA K+P WNKP NG+ E G VMGAVSWPALSES + S K +  D
Sbjct  95    EGTDNGANAGKRPVWNKPSNGAVEVGAVMGAVSWPALSESARVSGKPSQQD  145



>gb|KFK30224.1| hypothetical protein AALP_AA7G233700 [Arabis alpina]
Length=543

 Score =   151 bits (381),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 104/269 (39%), Positives = 146/269 (54%), Gaps = 21/269 (8%)
 Frame = -1

Query  1284  RDGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNA  1105
             R   QR GF SQ+ GG +N                  +G++H  HGG R+QE GNQ W  
Sbjct  249   RGQNQRNGFASQTHGGTDN--------PSPRDSYRNQNGNHHQNHGGRRNQEHGNQNWTP  300

Query  1104  NRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpL---GSPLVYPEVHPMYYVP  934
             +R+F  RD + Q  R         PPP     P  MP +P+   GSP+ +P      Y P
Sbjct  301   HRNFNGRDGNAQSQRGAPPYVRHAPPPVQTIPPQFMPAQPIPPFGSPVPFPPELAAPYYP  360

Query  933   GPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQ  754
                     MP +A P    PVFY   D  L +KI  QI YYFS +NLI+D YLR  MDDQ
Sbjct  361   -------RMPFIA-PLGPTPVFYHVQDLPLNAKIQKQIHYYFSEENLIRDTYLRGHMDDQ  412

Query  753   GWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSI  574
             G+ P+ +IA FKKV  LTD+IQ I+ A++ S  +EVQG+++R R +W+ W++P     ++
Sbjct  413   GFAPLLVIANFKKVQELTDNIQQIVDALQGSPFVEVQGDRIRKRYNWQHWLLPRVANPAV  472

Query  573   SSPQSARSPGSDVLSQHFQGVTLDDNNAN  487
             SSPQS     +D ++     +TL +++A+
Sbjct  473   SSPQSVER--ADAVASRVGNLTLGESSAD  499



>ref|XP_007160637.1| hypothetical protein PHAVU_001G004100g [Phaseolus vulgaris]
 gb|ESW32631.1| hypothetical protein PHAVU_001G004100g [Phaseolus vulgaris]
Length=511

 Score =   150 bits (378),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 161/457 (35%), Positives = 221/457 (48%), Gaps = 64/457 (14%)
 Frame = -1

Query  1776  PLLQDAATEAQPESFENSDSGNNAVKKPAWNKPNGST--EAGPVMGAVSWPALSE-STKA  1606
             P L ++ T    +S + ++   +  KKP WNKP+     E GPVMGA SWPALS  STKA
Sbjct  84    PPLDNSNTVGVADSSDGAEDNADRSKKPVWNKPSNGVVVETGPVMGAESWPALSAASTKA  143

Query  1605  SPKSATYDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRA  1426
             S K       KT +DGS+   QG  +   S  K   T N    ++T  +VP RQRS KR 
Sbjct  144   SVKLPAESSSKTVADGSLSTSQGP-VNSQSPQKQATTTNAKPNSATNYNVPGRQRSMKRV  202

Query  1425  GGGN----SSNTALANGsvsqpqqlqslvVEMAPNSAGK-PGV-EPYSRD----------  1294
             GG       S    +N     P      V  + P S G  P V EP  RD          
Sbjct  203   GGSGIVSGPSQGNFSNPPPPPPPPPPFPVYHIPPVSYGMVPFVPEPAPRDHYRNSNWDHR  262

Query  1293  ----------NVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGG  1144
                       N +R    RG FG    G   + Y                     + +G 
Sbjct  263   PMMGAFVPGMNEYRGSSHRGYFGPHPRGDGSSSY--------------------RNTYGS  302

Query  1143  ARDQERGNQEWNANRSFG-SRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLV  967
               DQ+R        R++G +RD  +   R+P R  LR PPP+        P+ P  +P+ 
Sbjct  303   RHDQDR--------RNYGNTRDTFVPQPRMPPRGLLRHPPPNSAAFVGHQPIGPFANPMG  354

Query  966   YPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIK  787
             + E +  YY P        MP   +P P P +F     PL  +KIV QIEYYFS+ NL++
Sbjct  355   FSEFY--YYQPVTMEQFTGMPYF-TPSPPPTIFPAAESPLS-NKIVRQIEYYFSDANLVR  410

Query  786   DMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKK  607
             D +LR +MD+QGWVPV LIA F +V  LT ++Q+IL +MRTST++EV G+KLR  N+W K
Sbjct  411   DEFLRSKMDEQGWVPVTLIADFPRVRSLTTNVQMILDSMRTSTIVEVLGDKLRRHNEWMK  470

Query  606   WIVPPSVQYSISSPQSA-RSPGSDVLSQHFQGVTLDD  499
             W+     +   +S  S+ R P  + L+ +FQ +TL++
Sbjct  471   WVSSTKTRSGSTSTSSSPRGPRYNNLTANFQAITLEE  507



>ref|XP_006596535.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like isoform 
X2 [Glycine max]
Length=518

 Score =   149 bits (376),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 158/455 (35%), Positives = 215/455 (47%), Gaps = 83/455 (18%)
 Frame = -1

Query  1740  ESFENSDSGNNAVKKPAWNKPNGST---EAGPVMGAV-SWPALSESTKASPKSATYDPLK  1573
             +S + ++   +  KKP WNKP+      E GPVMGA  SWP L  STK S K       K
Sbjct  96    DSSDGAEGNADCSKKPVWNKPSNGVVVVETGPVMGAAESWPTLLASTKGSAKLPAESSSK  155

Query  1572  TPSDG---SVPPPQGTGIA-PSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSN  1405
             T +D    S    Q T IA PSS+P                   +RQRS KR GG ++ +
Sbjct  156   TVTDDGSLSTSQKQATTIAKPSSAPNYNVP--------------SRQRSMKRVGGSSTGS  201

Query  1404  TA----LANGsvsqpqqlqslvVEMAPNSAGK--PGVEPYS-RD----------------  1294
                    +N   + P      V ++ P S G   PGV  ++ RD                
Sbjct  202   GPSQSNFSNPPPTPPPPPPFPVYQLPPVSYGNMVPGVPDHAPRDHYRNNNWDARPLVGGF  261

Query  1293  ----NVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARD-QE  1129
                 N +R   +RG FG    G                         YH+++G  RD Q+
Sbjct  262   VPAMNEYRGSSRRGYFGPHPRGDGS----------------------YHNSYGSRRDHQD  299

Query  1128  RGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHP  949
             RGN          +RDA L   R+P R  LR PPP+        P+ P  +P+ +PE + 
Sbjct  300   RGNY-------VNARDAFLPQPRMPPRGLLRHPPPNTAAFVGPQPIGPFANPISFPEFY-  351

Query  948   MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRK  769
              YY P        MP     PP  P F     PL  + IV QIEYYFS+ NL+KD +LR 
Sbjct  352   -YYQPVTVEQFTGMPFFTHSPPPTPFFSAAESPLS-NMIVYQIEYYFSDANLVKDAFLRS  409

Query  768   EMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPS  589
             +MD+QGWVPV LIA F +V  LT +IQLIL ++RTST++EVQG+KLR  N+W +W+ P +
Sbjct  410   KMDEQGWVPVTLIADFPRVKNLTTNIQLILDSLRTSTVVEVQGDKLRRLNEWMRWL-PSA  468

Query  588   VQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANE  484
              + S S   S      + L+ +FQ + L++  A+E
Sbjct  469   QRRSNSGSISPSGSTHNNLTANFQTIILEETTADE  503



>ref|XP_003544386.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like isoform 
X1 [Glycine max]
Length=527

 Score =   148 bits (374),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 158/452 (35%), Positives = 219/452 (48%), Gaps = 68/452 (15%)
 Frame = -1

Query  1740  ESFENSDSGNNAVKKPAWNKPNGST---EAGPVMGAV-SWPALSESTKASPKSATYDPLK  1573
             +S + ++   +  KKP WNKP+      E GPVMGA  SWP L  STK S K       K
Sbjct  96    DSSDGAEGNADCSKKPVWNKPSNGVVVVETGPVMGAAESWPTLLASTKGSAKLPAESSSK  155

Query  1572  TPSD-GSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTA-  1399
             T +D GS+   Q      S SP+   T      ++   +VP+RQRS KR GG ++ +   
Sbjct  156   TVTDDGSLSTSQWPMT--SQSPQKQATTIAKPSSAPNYNVPSRQRSMKRVGGSSTGSGPS  213

Query  1398  ---LANGsvsqpqqlqslvVEMAPNSAGK--PGVEPYS-RD-------------------  1294
                 +N   + P      V ++ P S G   PGV  ++ RD                   
Sbjct  214   QSNFSNPPPTPPPPPPFPVYQLPPVSYGNMVPGVPDHAPRDHYRNNNWDARPLVGGFVPA  273

Query  1293  -NVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARD-QERGN  1120
              N +R   +RG FG    G                         YH+++G  RD Q+RGN
Sbjct  274   MNEYRGSSRRGYFGPHPRGDGS----------------------YHNSYGSRRDHQDRGN  311

Query  1119  QEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYY  940
                       +RDA L   R+P R  LR PPP+        P+ P  +P+ +PE +  YY
Sbjct  312   Y-------VNARDAFLPQPRMPPRGLLRHPPPNTAAFVGPQPIGPFANPISFPEFY--YY  362

Query  939   VPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMD  760
              P        MP     PP  P F     PL  + IV QIEYYFS+ NL+KD +LR +MD
Sbjct  363   QPVTVEQFTGMPFFTHSPPPTPFFSAAESPLS-NMIVYQIEYYFSDANLVKDAFLRSKMD  421

Query  759   DQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQY  580
             +QGWVPV LIA F +V  LT +IQLIL ++RTST++EVQG+KLR  N+W +W+ P + + 
Sbjct  422   EQGWVPVTLIADFPRVKNLTTNIQLILDSLRTSTVVEVQGDKLRRLNEWMRWL-PSAQRR  480

Query  579   SISSPQSARSPGSDVLSQHFQGVTLDDNNANE  484
             S S   S      + L+ +FQ + L++  A+E
Sbjct  481   SNSGSISPSGSTHNNLTANFQTIILEETTADE  512



>ref|XP_010550483.1| PREDICTED: la-related protein 1B [Tarenaya hassleriana]
 ref|XP_010550485.1| PREDICTED: la-related protein 1B [Tarenaya hassleriana]
Length=184

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 104/159 (65%), Gaps = 3/159 (2%)
 Frame = -1

Query  975  PLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDN  796
            P++YPE     Y+P P P+S+    L       P+++   DP+L +KIV Q+++YFS DN
Sbjct  25   PVLYPEYPSAIYMPHPPPESM---SLVGQCSPQPIYFPGFDPILFTKIVKQVDFYFSADN  81

Query  795  LIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRND  616
            L KD YLR+ MDD+GWVPV L A F+K+A LT+++Q+IL A+++S  +EVQGE +R R D
Sbjct  82   LSKDKYLRQHMDDEGWVPVSLKAGFRKLAELTNNVQIILDAVKSSAFVEVQGESIRRRGD  141

Query  615  WKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDD  499
            W+K++ P  +  + ++  +A +   D L+ H Q + L D
Sbjct  142  WQKYVWPRDLTVTATAQPAAGATKDDTLAAHLQNIKLSD  180



>emb|CDX75537.1| BnaA01g01650D [Brassica napus]
Length=500

 Score =   147 bits (372),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 141/393 (36%), Positives = 185/393 (47%), Gaps = 51/393 (13%)
 Frame = -1

Query  1731  ENSDSGNNAVKKPAWNKP-NGSTE--AGPVMGAVSWPALSESTKASPKSATYDPLKTPSD  1561
             E S +  NA KKP W +P NG++    GPVMGA SWP LSE+TKA    ++ D LK+  D
Sbjct  76    EESGAQGNAGKKPVWKRPSNGASSEVGGPVMGASSWPTLSETTKAPSSKSSSDSLKSLGD  135

Query  1560  -------GSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNT  1402
                      V   QG   A + +PK     N            +RQRS KR    NS++ 
Sbjct  136   VASSSSVVVVTVSQGNSNASAPAPKQGGRANPNPTPYN-----SRQRSFKR---NNSASG  187

Query  1401  ALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQY  1222
             + ANG+VSQ                  P VE  S +   R   QR G  S + GG  + +
Sbjct  188   STANGTVSQG-----------------PVVETPSHNPSPRGQNQRNGSASHTHGGGSDNF  230

Query  1221  TrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRD--AHLQplrvpsr  1048
             +     +             H      R QE+GNQ WN  RSF  RD  AH Q       
Sbjct  231   SPRDSHRNQNGNHHHHHHQSHGG---RRSQEQGNQNWNFCRSFSGRDGNAHSQRGAPAFV  287

Query  1047  pflrvpppsp--pfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpP  874
                     S    F+         G     PE+   YY          MP + SP    P
Sbjct  288   RHQPPTMQSIPPQFMAAQPIQPFGGPVPFPPELASPYYP--------RMPFI-SPLSPGP  338

Query  873   VFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDD  694
             V+YQ  DP L  K+  QI+YYFS +NLI+D YLR  MDD G+VP+ +IA FKKVA LTD 
Sbjct  339   VYYQVQDPPLNVKLQKQIQYYFSEENLIRDTYLRGHMDDHGFVPLHVIAGFKKVAELTDS  398

Query  693   IQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVP  595
             IQ I+ A++ S  +EVQG+++R R +W+ W++P
Sbjct  399   IQQIVEALQGSPFVEVQGDRIRKRYNWQHWLLP  431



>ref|XP_009148977.1| PREDICTED: la-related protein 1C-like [Brassica rapa]
Length=499

 Score =   147 bits (371),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 141/393 (36%), Positives = 186/393 (47%), Gaps = 52/393 (13%)
 Frame = -1

Query  1731  ENSDSGNNAVKKPAWNKP-NGSTE--AGPVMGAVSWPALSESTKASPKSATYDPLKTPSD  1561
             E S +  NA KKP W +P NG++    GPVMGA SWPALSE+TKA    ++ D LK+  D
Sbjct  76    EESGAQGNAGKKPVWKRPSNGASSEVGGPVMGASSWPALSETTKAPSSKSSSDSLKSLGD  135

Query  1560  -------GSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNT  1402
                      V   QG   A + +PK     N            +RQRS KR    NS++ 
Sbjct  136   VASSSSVVVVTVSQGNSNASAPAPKQGGRANPNPTPYN-----SRQRSFKR---NNSASG  187

Query  1401  ALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQY  1222
             + ANG+VSQ                  P VE  S +   R   QR G  SQ  GG  + +
Sbjct  188   STANGTVSQG-----------------PVVETPSHNPSPRGQNQRNGSASQPHGGGSDNF  230

Query  1221  TrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRD--AHLQplrvpsr  1048
             +     +            +        +QE GNQ WN +RSF  RD  AH Q       
Sbjct  231   SPRDSHRNQNGNHHHHHQGHGGRR----NQEHGNQNWNFSRSFNGRDGNAHSQRGAPAFV  286

Query  1047  pflrvpppsp--pfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpP  874
                     S    F+         G     PE+   YY          MP +  P    P
Sbjct  287   RHQPPTMQSIPPQFMAAQPIQPFGGPVPFPPELASPYYP--------RMPFIG-PLSPGP  337

Query  873   VFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDD  694
             V+YQ  DP L  K+  QI+YYFS +NLI+D YLR  MDDQG+VP+ +IA FKKVA LTD 
Sbjct  338   VYYQVQDPPLNVKLQKQIQYYFSEENLIRDTYLRGLMDDQGFVPLHVIAGFKKVAELTDS  397

Query  693   IQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVP  595
             IQ I+ A++ S  +EVQG+++R R +W+ W++P
Sbjct  398   IQQIVEALQGSPFVEVQGDRIRKRYNWQHWLLP  430



>ref|NP_201411.2| LA RELATED PROTEIN 1B [Arabidopsis thaliana]
 sp|Q8RWR2.1|LRP1B_ARATH RecName: Full=La-related protein 1B; Short=AtLARP1b [Arabidopsis 
thaliana]
 gb|AAM10313.1| AT5g66100/K2A18_18 [Arabidopsis thaliana]
 gb|AAN31109.1| At5g66100/K2A18_18 [Arabidopsis thaliana]
 gb|AED98159.1| LA RELATED PROTEIN 1B [Arabidopsis thaliana]
Length=453

 Score =   145 bits (365),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/225 (38%), Positives = 134/225 (60%), Gaps = 14/225 (6%)
 Frame = -1

Query  1152  HGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpp------psppfipplmpm  991
             HG  R+ E GNQ   ++R++  RD HLQP R       ++         S         +
Sbjct  230   HGNRRNYEHGNQSGFSHRNYSGRDMHLQPQRGVGMIRPQMLMGPPSFPASSAQYMAAPQL  289

Query  990   rpLGSPLVYPEVHPMYYVPGPHPDSLVMPM-LASpppgpPVFYQFLDPLLLSKIVNQIEY  814
                G P++YP+     ++P P PD    PM L  P P  P++++  D +L +KI+ Q+EY
Sbjct  290   GSYGGPIIYPDYAQHVFMPHPSPD----PMGLVGPFPLQPMYFRNFDAILYNKILTQVEY  345

Query  813   YFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEK  634
             YFS DNL +D +LR +M+D+GWVPVR+IA F+++A LT++IQ IL A+R+S ++E+QGE 
Sbjct  346   YFSADNLSRDEHLRDQMNDEGWVPVRVIAAFRRLAELTNNIQTILEALRSSEVVEIQGET  405

Query  633   LRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDD  499
             LR R DW K+++P   + S S P +  S  + ++SQ  + +TL +
Sbjct  406   LRRRGDWDKYLLP--REPSRSGPAAGASNNASLVSQ-IESMTLSE  447



>ref|XP_009401898.1| PREDICTED: la-related protein 1B-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=536

 Score =   144 bits (364),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 154/461 (33%), Positives = 215/461 (47%), Gaps = 72/461 (16%)
 Frame = -1

Query  1743  PESFENSDSGNNAVKKPAWNKP-NGSTEAGPVM--GAVSWPALSESTKASPKSATY--DP  1579
             PE    S S     KKPAW +P NG  EAGP +  GA SWPALSES K++  + +   D 
Sbjct  81    PEDVAPSSSEAARGKKPAWKRPINGEIEAGPAVMGGAASWPALSESAKSASGTRSSSSDA  140

Query  1578  LKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTA  1399
              K  SDG +  P+   + PSS+P  V                A +R      GG S N A
Sbjct  141   SKPLSDGPLAVPR-PNLNPSSTPNHV----------------ASERHQSMNQGGGSGNGA  183

Query  1398  LANGsvsqpqqlqslvVEMAPNSAGKPGV-----------EPYSRDNVHR--DGGQRG-G  1261
             LA          ++ +    P SA  P V           E  ++D      D G  G G
Sbjct  184   LA--------VREAALPSPPPTSAPLPQVNLANQTPQAPPELSTQDQAASTLDHGSWGLG  235

Query  1260  FGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRD  1081
              GSQ+  G ++  +    R+ N          ++  +G  RDQERG  +    R+ G RD
Sbjct  236   LGSQTYNGGDHHRSYGGNRRWNNGGGSGS---HNSNYGNRRDQERGGYD-GYRRNTGGRD  291

Query  1080  AHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVH-PMYYVPGPHPDSLVMP  904
              ++Q                     P +     G+P++YP++  P+ YV         +P
Sbjct  292   FNMQQRGARPYFRPPHVVNPYLRPLPQVRPF--GNPMMYPDMSSPVIYVA--TQPPPGVP  347

Query  903   MLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIAT  724
              +  P   P ++   +DP   + ++ QI+YYFS+DNL KD+YLR+ MDDQGWVP+ +IA 
Sbjct  348   FVPHPVVPPAMYIPAIDPQR-AALLKQIDYYFSSDNLCKDIYLRQNMDDQGWVPLSVIAQ  406

Query  723   FKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPG  544
             F +V  LT+    IL  +R ST +EVQGEK+R RNDW  WI+P        S QS  +  
Sbjct  407   FNRVRQLTNSTDYILDTVRLSTEVEVQGEKIRKRNDWMNWILP--------SGQSTGTSN  458

Query  543   SDVLSQHFQGVTLDDNNANEHERGN------AEAHLNRSSS  439
             SD LS   + V L+ N      RGN      +E  L+RS+S
Sbjct  459   SDNLSARLRTVDLEGNTL----RGNTGVPNYSEVVLSRSAS  495



>ref|XP_009401897.1| PREDICTED: la-related protein 1C-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=556

 Score =   144 bits (362),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 154/466 (33%), Positives = 220/466 (47%), Gaps = 62/466 (13%)
 Frame = -1

Query  1743  PESFENSDSGNNAVKKPAWNKP-NGSTEAGPVM--GAVSWPALSESTKASPKSATY--DP  1579
             PE    S S     KKPAW +P NG  EAGP +  GA SWPALSES K++  + +   D 
Sbjct  81    PEDVAPSSSEAARGKKPAWKRPINGEIEAGPAVMGGAASWPALSESAKSASGTRSSSSDA  140

Query  1578  LKTPSDGSVPPPQGTGIA-----PSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGN  1414
              K  SDG +  P+   I+     P+S+P      N    ++  +    R +S  + GG  
Sbjct  141   SKPLSDGPLAVPREPAISTASPKPNSNPSLTPKPNLNPSSTPNHVASERHQSMNQGGG--  198

Query  1413  SSNTALANGsvsqpqqlqslvVEMAPNSAGKPGV-----------EPYSRDNVHR--DGG  1273
             S N ALA          ++ +    P SA  P V           E  ++D      D G
Sbjct  199   SGNGALA--------VREAALPSPPPTSAPLPQVNLANQTPQAPPELSTQDQAASTLDHG  250

Query  1272  QRG-GFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRS  1096
               G G GSQ+  G ++  +    R+ N          ++  +G  RDQERG  +    R+
Sbjct  251   SWGLGLGSQTYNGGDHHRSYGGNRRWNNGGGSGS---HNSNYGNRRDQERGGYD-GYRRN  306

Query  1095  FGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVH-PMYYVPGPHPD  919
              G RD ++Q                     P +     G+P++YP++  P+ YV      
Sbjct  307   TGGRDFNMQQRGARPYFRPPHVVNPYLRPLPQVRPF--GNPMMYPDMSSPVIYVA--TQP  362

Query  918   SLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPV  739
                +P +  P   P ++   +DP   + ++ QI+YYFS+DNL KD+YLR+ MDDQGWVP+
Sbjct  363   PPGVPFVPHPVVPPAMYIPAIDPQR-AALLKQIDYYFSSDNLCKDIYLRQNMDDQGWVPL  421

Query  738   RLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQS  559
              +IA F +V  LT+    IL  +R ST +EVQGEK+R RNDW  WI+P        S QS
Sbjct  422   SVIAQFNRVRQLTNSTDYILDTVRLSTEVEVQGEKIRKRNDWMNWILP--------SGQS  473

Query  558   ARSPGSDVLSQHFQGVTLDDNNANEHERGN------AEAHLNRSSS  439
               +  SD LS   + V L+ N      RGN      +E  L+RS+S
Sbjct  474   TGTSNSDNLSARLRTVDLEGNTL----RGNTGVPNYSEVVLSRSAS  515



>ref|XP_006473702.1| PREDICTED: protein enabled homolog [Citrus sinensis]
Length=547

 Score =   141 bits (355),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 145/251 (58%), Gaps = 34/251 (14%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             Y++  GG  DQ+RGN          +RDAH+QP R P R F+R PPP+     P  PMRP
Sbjct  297   YNNNFGGRHDQDRGNYS-------NARDAHVQPQRGPPRGFVRPPPPNAAAFAPPQPMRP  349

Query  984   LGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFL----------DPLLLSK  835
               +P+ +PE     Y+P        MP+ A+   G      F+          +P L + 
Sbjct  350   FPNPMGFPE---FIYIP-------PMPVEAAALRGVTGMPPFIPPAPVLMPVPEPSLAAM  399

Query  834   IVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTM  655
             +++QI+YYFS+ NL+KD +L+  MDDQGWVP+ LIA+F +V  LT +IQLIL ++RTST+
Sbjct  400   LIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTV  459

Query  654   IEVQGEKLRVRNDWKKWIVPP---SVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANE  484
             +EVQ +K+R RN+W KWI  P   S +  +SSP  +     DVL+  FQ +T+ +   N+
Sbjct  460   VEVQDDKVRRRNEWMKWIATPGRVSTESGLSSPAGS---SVDVLAPSFQNITVKEGAVNQ  516

Query  483   HE-RGNAEAHL  454
                 GNA +H 
Sbjct  517   RSLTGNANSHC  527



>ref|XP_003550435.2| PREDICTED: la-related protein-like [Glycine max]
Length=518

 Score =   140 bits (353),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 155/471 (33%), Positives = 220/471 (47%), Gaps = 78/471 (17%)
 Frame = -1

Query  1776  PLLQDAATEAQPESFENSDSGNNAVKKPAWNKPNGST--EAGPVMGAV-SWPALSESTKA  1606
             P + ++ T    +S + ++   +  KK  WNKP+     E GPVMGA  SWP L  STK 
Sbjct  74    PEVDNSNTVGDVDSSDGAEGNADRSKKLVWNKPSNGVVVETGPVMGAAESWPTLLASTKG  133

Query  1605  S----PKSATYDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRS  1438
             S    P+S++   +   S  + P     G   S SP+   T N    ++   +VP RQRS
Sbjct  134   SAKLPPESSSNTVIDYGSLSTSP----QGPMASQSPQKQATTNAKPNSAPNYNVPGRQRS  189

Query  1437  NKRAGGGNSSNTALANGsvsqpqqlqslvV----EMAPNSAGK--PGV-EPYSRD-----  1294
              KR GG +S+ +  + G+ S P            ++ P S     PGV +P  RD     
Sbjct  190   MKRVGGSSSTVSDPSQGNFSNPPPPPPPPPFPVYQLPPVSYCNMVPGVPDPAPRDHYRNN  249

Query  1293  ---------------NVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYH  1159
                            N +R   +RG FG    G                         YH
Sbjct  250   NWDAGPMVGGFVPAMNGYRGSSRRGYFGPHPRGDGS----------------------YH  287

Query  1158  HAHGGARD-QERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpp--psppfipplmpmr  988
             +++G  RD Q+RGN          +RDA +   R+P R   R  P   +        P+ 
Sbjct  288   NSYGSRRDHQDRGNY-------VNTRDAFVPQPRMPPRGLPRHTPPPTTAAAFVGPQPIG  340

Query  987   pLGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYF  808
             P   P+ +PE +  YY P        M   A  PP  P F     PL  + IV QIEYYF
Sbjct  341   PFAKPIGFPEFY--YYQPVTVEQFTGMSFFAHSPPPTPFFSAAESPLS-NMIVYQIEYYF  397

Query  807   SNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLR  628
             S+ NL+KD +LR +MD+QGWVPV LIA F +V  LT +IQLIL ++RTS ++EVQG+KLR
Sbjct  398   SDANLVKDAFLRSKMDEQGWVPVTLIADFPRVKSLTTNIQLILDSIRTSAIVEVQGDKLR  457

Query  627   VRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANEHER  475
               N+WK+W+   S Q   +SP  +R    + L+ + Q + L++   +E  R
Sbjct  458   RLNEWKRWLS--STQRGSTSPIGSR---YNNLTTNLQTIKLEETIKDEDPR  503



>gb|KDO84933.1| hypothetical protein CISIN_1g008981mg [Citrus sinensis]
Length=547

 Score =   140 bits (354),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 99/251 (39%), Positives = 143/251 (57%), Gaps = 34/251 (14%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             Y++  GG  DQ+RGN          +RDAH+QP R P R F+R  PP+     P  PMRP
Sbjct  297   YNNNFGGRHDQDRGNYS-------NARDAHVQPQRGPPRGFVRPAPPNAAAFAPPQPMRP  349

Query  984   LGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFL----------DPLLLSK  835
               +P+ +PE     Y+P        MP+ A+   G      F+          +P L + 
Sbjct  350   FPNPMGFPE---FIYIP-------PMPVEAAALRGVTGMPPFIPPAPVLMPVPEPSLAAM  399

Query  834   IVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTM  655
             +++QI+YYFS+ NL+KD +L+  MDDQGWVP+ LIA+F +V  LT +IQLIL ++RTST+
Sbjct  400   LIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTV  459

Query  654   IEVQGEKLRVRNDWKKWIVPP---SVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANE  484
             +EVQ +++R RN+W KWI  P   S +  +SSP  +     DVL+  FQ +T+ +   N+
Sbjct  460   VEVQDDRVRRRNEWMKWIATPGRISTESGLSSPAGS---SVDVLAPSFQNITVKEGAVNQ  516

Query  483   HE-RGNAEAHL  454
                 GNA  H 
Sbjct  517   RSLTGNANCHC  527



>ref|XP_006435231.1| hypothetical protein CICLE_v10000767mg [Citrus clementina]
 gb|ESR48471.1| hypothetical protein CICLE_v10000767mg [Citrus clementina]
Length=538

 Score =   140 bits (353),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 99/251 (39%), Positives = 143/251 (57%), Gaps = 34/251 (14%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             Y++  GG  DQ+RGN          +RDAH+QP R P R F+R  PP+     P  PMRP
Sbjct  288   YNNNFGGRHDQDRGNYS-------NARDAHVQPQRGPPRGFVRPAPPNAAAFAPPQPMRP  340

Query  984   LGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFL----------DPLLLSK  835
               +P+ +PE     Y+P        MP+ A+   G      F+          +P L + 
Sbjct  341   FPNPMGFPE---FIYIP-------PMPVEAAALRGVTGMPPFIPPAPVLMPVPEPSLAAM  390

Query  834   IVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTM  655
             +++QI+YYFS+ NL+KD +L+  MDDQGWVP+ LIA+F +V  LT +IQLIL ++RTST+
Sbjct  391   LIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTV  450

Query  654   IEVQGEKLRVRNDWKKWIVPP---SVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANE  484
             +EVQ +++R RN+W KWI  P   S +  +SSP  +     DVL+  FQ +T+ +   N+
Sbjct  451   VEVQDDRVRRRNEWMKWIATPGRISTESGLSSPAGS---SVDVLAPSFQNITVKEGAVNQ  507

Query  483   HE-RGNAEAHL  454
                 GNA  H 
Sbjct  508   RSLTGNANCHC  518



>ref|XP_009382039.1| PREDICTED: la-related protein 1B-like [Musa acuminata subsp. 
malaccensis]
Length=541

 Score =   140 bits (353),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 97/245 (40%), Positives = 138/245 (56%), Gaps = 11/245 (4%)
 Frame = -1

Query  1161  HHAHGGAR-DQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             HH + G+R DQERG  E    R+ G RD H+Q            PP +PPF+ P   + P
Sbjct  262   HHNNFGSRYDQERGGYE-GYRRNAGGRDIHMQQRGARPYLRPPAPPVTPPFLSPPPQVLP  320

Query  984   LGSPLVYPEVH-PMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYF  808
              G+ +V+P++  P++YV    P    +P +  P     +F   +DP   S ++ QI+YYF
Sbjct  321   YGNQIVFPDMSSPIFYV-ATQPPPEGVPFVPHPAVPSAMFIPAIDPQCAS-LLKQIDYYF  378

Query  807   SNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLR  628
             S+DNL +D++LR  MD++GWVP+ LIA F +V  LT  I  IL  +R ST++EVQG+K+R
Sbjct  379   SSDNLCRDVFLRNNMDEKGWVPISLIAGFNRVRQLTTSIDFILDTLRLSTVVEVQGDKVR  438

Query  627   VRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANEHER--GNAEAHL  454
              RNDW  W++PPS      S QS  +  SD L+   Q V LD        R   + E  L
Sbjct  439   KRNDWMNWVLPPSN----VSGQSPATLNSDNLAACLQSVGLDGAAVWSSTRVPNHGERFL  494

Query  453   NRSSS  439
             +RS+S
Sbjct  495   SRSAS  499



>ref|XP_006435232.1| hypothetical protein CICLE_v10000767mg [Citrus clementina]
 gb|ESR48472.1| hypothetical protein CICLE_v10000767mg [Citrus clementina]
Length=547

 Score =   140 bits (352),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/251 (39%), Positives = 143/251 (57%), Gaps = 34/251 (14%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             Y++  GG  DQ+RGN          +RDAH+QP R P R F+R  PP+     P  PMRP
Sbjct  297   YNNNFGGRHDQDRGNYS-------NARDAHVQPQRGPPRGFVRPAPPNAAAFAPPQPMRP  349

Query  984   LGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFL----------DPLLLSK  835
               +P+ +PE     Y+P        MP+ A+   G      F+          +P L + 
Sbjct  350   FPNPMGFPE---FIYIP-------PMPVEAAALRGVTGMPPFIPPAPVLMPVPEPSLAAM  399

Query  834   IVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTM  655
             +++QI+YYFS+ NL+KD +L+  MDDQGWVP+ LIA+F +V  LT +IQLIL ++RTST+
Sbjct  400   LIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTV  459

Query  654   IEVQGEKLRVRNDWKKWIVPP---SVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANE  484
             +EVQ +++R RN+W KWI  P   S +  +SSP  +     DVL+  FQ +T+ +   N+
Sbjct  460   VEVQDDRVRRRNEWMKWIATPGRISTESGLSSPAGS---SVDVLAPSFQNITVKEGAVNQ  516

Query  483   HE-RGNAEAHL  454
                 GNA  H 
Sbjct  517   RSLTGNANCHC  527



>ref|XP_006435234.1| hypothetical protein CICLE_v10000767mg [Citrus clementina]
 gb|ESR48474.1| hypothetical protein CICLE_v10000767mg [Citrus clementina]
Length=355

 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/251 (39%), Positives = 143/251 (57%), Gaps = 34/251 (14%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             Y++  GG  DQ+RGN          +RDAH+QP R P R F+R  PP+     P  PMRP
Sbjct  105   YNNNFGGRHDQDRGNYS-------NARDAHVQPQRGPPRGFVRPAPPNAAAFAPPQPMRP  157

Query  984   LGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFL----------DPLLLSK  835
               +P+ +PE     Y+P        MP+ A+   G      F+          +P L + 
Sbjct  158   FPNPMGFPE---FIYIP-------PMPVEAAALRGVTGMPPFIPPAPVLMPVPEPSLAAM  207

Query  834   IVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTM  655
             +++QI+YYFS+ NL+KD +L+  MDDQGWVP+ LIA+F +V  LT +IQLIL ++RTST+
Sbjct  208   LIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTV  267

Query  654   IEVQGEKLRVRNDWKKWIVPP---SVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANE  484
             +EVQ +++R RN+W KWI  P   S +  +SSP  +     DVL+  FQ +T+ +   N+
Sbjct  268   VEVQDDRVRRRNEWMKWIATPGRISTESGLSSPAGS---SVDVLAPSFQNITVKEGAVNQ  324

Query  483   HE-RGNAEAHL  454
                 GNA  H 
Sbjct  325   RSLTGNANCHC  335



>gb|KDP36886.1| hypothetical protein JCGZ_08177 [Jatropha curcas]
Length=425

 Score =   138 bits (348),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 110/293 (38%), Positives = 154/293 (53%), Gaps = 44/293 (15%)
 Frame = -1

Query  1293  NVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQE  1114
             N HR   +RG FGS+  G                        +YHH  GG RDQ+RG+  
Sbjct  151   NDHRHSSRRGNFGSRGDG------------------------TYHHNFGGRRDQDRGH--  184

Query  1113  WNANRSFGS-RDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYV  937
                   +G+ RDA +Q  R P       PP +  F+PP        +P+ +P+V    Y+
Sbjct  185   ------YGNVRDAPVQQQRSPRGFVRPPPPNTTTFVPPQPVRPF-ANPIGFPDV---VYI  234

Query  936   PGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDD  757
             P    +        +  P P +     +P L + +V+QIEYYFS+ NLIKD +L+  MDD
Sbjct  235   PTLPLEPFRGVPFITHAPAPGIIVPVPEPPLPAMLVHQIEYYFSDANLIKDDFLKSNMDD  294

Query  756   QGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYS  577
             QGWV + LIA F +V  +T D+QLIL ++RTST++EVQ EK+R RNDW KWI P S + S
Sbjct  295   QGWVSITLIAGFNRVKSMTKDVQLILDSLRTSTILEVQEEKVRRRNDWMKWI-PGSSRLS  353

Query  576   ISS-PQSARSPGSDVLSQHFQGVTLDDNNANE-----HERGNAEAHLNRSSSE  436
             I S  QS  SP   +L+  FQ +T+++  +N+     +   N E    RSSSE
Sbjct  354   IDSGLQSFNSPSQGMLTNSFQKMTVEEVTSNQISTPANPLPNPEDTSIRSSSE  406



>dbj|BAJ53096.1| JHL20J20.1 [Jatropha curcas]
Length=536

 Score =   139 bits (350),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 110/293 (38%), Positives = 154/293 (53%), Gaps = 44/293 (15%)
 Frame = -1

Query  1293  NVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQE  1114
             N HR   +RG FGS+  G                        +YHH  GG RDQ+RG+  
Sbjct  262   NDHRHSSRRGNFGSRGDG------------------------TYHHNFGGRRDQDRGH--  295

Query  1113  WNANRSFGS-RDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYV  937
                   +G+ RDA +Q  R P       PP +  F+PP        +P+ +P+V    Y+
Sbjct  296   ------YGNVRDAPVQQQRSPRGFVRPPPPNTTTFVPPQPVRPF-ANPIGFPDV---VYI  345

Query  936   PGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDD  757
             P    +        +  P P +     +P L + +V+QIEYYFS+ NLIKD +L+  MDD
Sbjct  346   PTLPLEPFRGVPFITHAPAPGIIVPVPEPPLPAMLVHQIEYYFSDANLIKDDFLKSNMDD  405

Query  756   QGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYS  577
             QGWV + LIA F +V  +T D+QLIL ++RTST++EVQ EK+R RNDW KWI P S + S
Sbjct  406   QGWVSITLIAGFNRVKSMTKDVQLILDSLRTSTILEVQEEKVRRRNDWMKWI-PGSSRLS  464

Query  576   ISS-PQSARSPGSDVLSQHFQGVTLDDNNANE-----HERGNAEAHLNRSSSE  436
             I S  QS  SP   +L+  FQ +T+++  +N+     +   N E    RSSSE
Sbjct  465   IDSGLQSFNSPSQGMLTNSFQKMTVEEVTSNQISTPANPLPNPEDTSIRSSSE  517



>emb|CDX72562.1| BnaC07g45840D [Brassica napus]
Length=504

 Score =   138 bits (348),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 143/382 (37%), Positives = 187/382 (49%), Gaps = 43/382 (11%)
 Frame = -1

Query  1710  NAVKKPAWNKP-NG---STEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGSVPPP  1543
             NA KKP W +P NG   ++E GPVMGA SWPALSE+   S   +    L      S P P
Sbjct  86    NAGKKPVWKRPSNGGAAASEVGPVMGASSWPALSEAANKSSSDSLKS-LGDVVAPSPPVP  144

Query  1542  QGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvsqpqql  1363
                GIA +S P    +      N  P    +RQRS KR G   S+    ANG+ SQP  L
Sbjct  145   VSQGIANASVP---ASKPVGRANPNPTPNNSRQRSFKRNGASGSA----ANGTASQPSGL  197

Query  1362  qslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNENQYTrssprkgngrpr  1183
              SL              E  S +   R   QR GF SQ+   +       +         
Sbjct  198   SSL-------------AESPSHNPSPRGQNQRNGFPSQT---HGGSGGGGADNVSQRDSY  241

Query  1182  prgdgSYHHAHGGARDQER-GNQEWNANRSFGSRD--AHLQplrvpsrpflrvpppsppf  1012
                +G++H  HGG R+QE+ GNQ W  +RSF  R+  A  Q    P+      PP     
Sbjct  242   RNQNGNHHQTHGGRRNQEQHGNQNWTFSRSFNGREGNAQSQRGAPPAFVRHPPPPSVQTI  301

Query  1011  ipplmpmrpLGSPLVYP-EVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSK  835
              P  M  +P  SPL +P E+   YY          MP +A P    PVFY   DP L  K
Sbjct  302   PPQFMAAQPFASPLPFPPELASQYY--------QRMPFVA-PLSPGPVFYHVQDPPLNIK  352

Query  834   IVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILH--AMRTS  661
             +  QI YYFS +NLIKD YLR++MDDQG+VP+ +IA F KVA LTD +Q I     ++  
Sbjct  353   LQKQIHYYFSEENLIKDTYLRRQMDDQGFVPLPVIAGFNKVAELTDSVQQIAEDLLLKFR  412

Query  660   TMIEVQGEKLRVRNDWKKWIVP  595
               + + GE++R R +W+ W++P
Sbjct  413   YFLSMCGERIRKRYNWQLWLIP  434



>ref|XP_006435233.1| hypothetical protein CICLE_v10000767mg [Citrus clementina]
 gb|ESR48473.1| hypothetical protein CICLE_v10000767mg [Citrus clementina]
Length=385

 Score =   136 bits (343),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 99/251 (39%), Positives = 143/251 (57%), Gaps = 34/251 (14%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             Y++  GG  DQ+RGN          +RDAH+QP R P R F+R  PP+     P  PMRP
Sbjct  135   YNNNFGGRHDQDRGNYS-------NARDAHVQPQRGPPRGFVRPAPPNAAAFAPPQPMRP  187

Query  984   LGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFL----------DPLLLSK  835
               +P+ +PE     Y+P        MP+ A+   G      F+          +P L + 
Sbjct  188   FPNPMGFPE---FIYIPP-------MPVEAAALRGVTGMPPFIPPAPVLMPVPEPSLAAM  237

Query  834   IVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTM  655
             +++QI+YYFS+ NL+KD +L+  MDDQGWVP+ LIA+F +V  LT +IQLIL ++RTST+
Sbjct  238   LIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTV  297

Query  654   IEVQGEKLRVRNDWKKWIVPP---SVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANE  484
             +EVQ +++R RN+W KWI  P   S +  +SSP  +     DVL+  FQ +T+ +   N+
Sbjct  298   VEVQDDRVRRRNEWMKWIATPGRISTESGLSSPAGS---SVDVLAPSFQNITVKEGAVNQ  354

Query  483   HE-RGNAEAHL  454
                 GNA  H 
Sbjct  355   RSLTGNANCHC  365



>ref|XP_008811609.1| PREDICTED: la-related protein 1C-like [Phoenix dactylifera]
Length=567

 Score =   136 bits (343),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 107/262 (41%), Positives = 146/262 (56%), Gaps = 17/262 (6%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHL-----Qplrvpsrpflrvpppsppfippl  1000
             +H A+   RD ERG  +WN  R F  RDAH+     Q    P     + PP   PF+ P 
Sbjct  284   HHGAYRSWRDHERGGYDWNPLRGFSGRDAHMLLPPQQHRGHPRPFPRQPPPSPAPFVSPP  343

Query  999   mpmrpLGSPLVYPEV-HPMYYVPGPHP--DSLV-MPMLASpppgpPVFYQFLDPLLLSK-  835
               +RP  SP+ + E+  P+YY+P  HP  +SL  MP +A   P       F++     + 
Sbjct  344   PHVRPFLSPMGFAEIPAPVYYIPA-HPPLESLRNMPFVAHQVPHAIPPTMFVNGADHQRA  402

Query  834   -IVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTST  658
              ++ QIEYYFS+DNL KD+YLR+ MD  GWV + LIA F +V  LT++I  IL  +R S 
Sbjct  403   LLLKQIEYYFSSDNLCKDIYLRQRMDGHGWVHISLIAGFNRVKQLTNNIPYILDTIRGSD  462

Query  657   MIEVQGEKLRVRNDWKKWIVPPSV-QYSISS-PQSARSPGSDVLSQHFQGVTLDDNNAN-  487
             ++EVQGE +R RNDW  WI+P    QYS SS P S  +   D L+     V L +  AN 
Sbjct  463   IVEVQGENIRRRNDWVNWILPSRPNQYSTSSRPSSPATSNYDSLAAGMHNVGLGERAANP  522

Query  486   EHERGN--AEAHLNRSSSE*KN  427
             ++ RG   AE  L+RS+S  +N
Sbjct  523   DNTRGQTWAEEVLSRSASGHQN  544



>ref|XP_010033527.1| PREDICTED: la-related protein 1B-like [Eucalyptus grandis]
Length=347

 Score =   133 bits (334),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 91/135 (67%), Gaps = 8/135 (6%)
 Frame = -1

Query  981  GSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSN  802
            G+PL YPE+ P ++ P PHPD       ++PPP       F       +I+ QIEYYFS 
Sbjct  213  GNPLAYPEMAPHFF-PTPHPDIQASGPFSAPPPPVYSPLHF-------EILKQIEYYFSK  264

Query  801  DNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVR  622
            +NLIKD++ RKE D+QGWV + +IA FKKV+ +T DI LIL A+R+STM+E+QGE +R R
Sbjct  265  ENLIKDLHFRKEWDEQGWVHISIIAAFKKVSSMTRDINLILDAIRSSTMLEIQGEMVRKR  324

Query  621  NDWKKWIVPPSVQYS  577
            +DWK WIVP   + S
Sbjct  325  DDWKPWIVPKDFKVS  339



>ref|NP_001049009.1| Os03g0156500 [Oryza sativa Japonica Group]
 gb|AAM51838.1|AC105730_12 Unknown protein [Oryza sativa Japonica Group]
 gb|ABF94058.1| La domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10923.1| Os03g0156500 [Oryza sativa Japonica Group]
 gb|EAZ25636.1| hypothetical protein OsJ_09464 [Oryza sativa Japonica Group]
Length=481

 Score =   134 bits (338),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 111/185 (60%), Gaps = 6/185 (3%)
 Frame = -1

Query  981  GSPLVYPEVHP-MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFS  805
            G+P+ +PE+ P +YY   P      +P +  P   P +     DPL  ++++ QIEYYFS
Sbjct  262  GAPIGFPEIAPHVYYFTSPLEGVQALPFVPHPASPPAMLIPQFDPLR-AELLKQIEYYFS  320

Query  804  NDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRV  625
            +DNL KD++LR+ MDDQGWVP+ LIA F +V  LT+++Q IL  +  ST++EVQG+KLR 
Sbjct  321  DDNLCKDIFLRRHMDDQGWVPLPLIAGFNQVKKLTNNVQFILETVLQSTVVEVQGDKLRK  380

Query  624  RNDWKKWIVPPSVQYSISSPQSARSPGS---DVLSQHFQGVTLDDNNANEHERGNAEAHL  454
            R  W+ W++ P   YS  +   + SP +   D L+  FQ V L+    +  +    EA L
Sbjct  381  RERWEIWLL-PKQGYSAGNSSGSLSPVTSNIDSLASQFQSVGLEGAGYHASQGMPGEALL  439

Query  453  NRSSS  439
             RS++
Sbjct  440  TRSAT  444



>gb|EAY88604.1| hypothetical protein OsI_10079 [Oryza sativa Indica Group]
Length=481

 Score =   134 bits (337),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 111/185 (60%), Gaps = 6/185 (3%)
 Frame = -1

Query  981  GSPLVYPEVHP-MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFS  805
            G+P+ +PE+ P +YY   P      +P +  P   P +     DPL  ++++ QIEYYFS
Sbjct  262  GAPIGFPEIAPHVYYFTSPLEGVQALPFVPHPASPPAMLIPQFDPLR-AELLKQIEYYFS  320

Query  804  NDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRV  625
            +DNL KD++LR+ MDDQGWVP+ LIA F +V  LT+++Q IL  +  ST++EVQG+KLR 
Sbjct  321  DDNLCKDIFLRRHMDDQGWVPLPLIAGFNQVKKLTNNVQFILETVLQSTVVEVQGDKLRK  380

Query  624  RNDWKKWIVPPSVQYSISSPQSARSPGS---DVLSQHFQGVTLDDNNANEHERGNAEAHL  454
            R  W+ W++ P   YS  +   + SP +   D L+  FQ V L+    +  +    EA L
Sbjct  381  RERWEIWLL-PKQGYSAGNSSGSLSPVTSNIDSLASQFQSVGLEGAGYHASQGMPGEALL  439

Query  453  NRSSS  439
             RS++
Sbjct  440  TRSAT  444



>emb|CDY18588.1| BnaA09g08070D [Brassica napus]
Length=386

 Score =   132 bits (332),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 97/130 (75%), Gaps = 3/130 (2%)
 Frame = -1

Query  981  GSPLVYPEVHPMY-YVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFS  805
            G P++YP  + ++ ++P P P+S+ +  + + PP PP+++   DP+L +KI+ Q+EYYFS
Sbjct  243  GGPMLYPADYALHVFMPHPPPESIAL--VGNFPPPPPIYFPSFDPMLSNKILTQVEYYFS  300

Query  804  NDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRV  625
             DNL KD +LR +M+D GWVPVR+IA F+++  LTD+IQ IL A+R+S ++E++GE LR 
Sbjct  301  ADNLSKDEHLRGQMNDDGWVPVRIIAGFRRLTELTDNIQTILEALRSSEVVEIKGEALRR  360

Query  624  RNDWKKWIVP  595
            R DW K+++P
Sbjct  361  RGDWDKYLLP  370



>emb|CAA18483.1| putative protein [Arabidopsis thaliana]
 emb|CAA21475.1| putative protein [Arabidopsis thaliana]
 emb|CAB81498.1| putative protein [Arabidopsis thaliana]
Length=472

 Score =   133 bits (335),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 132/427 (31%), Positives = 195/427 (46%), Gaps = 101/427 (24%)
 Frame = -1

Query  1740  ESFENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYD------  1582
             E  E S   +NA KKP W +P NG++E GPVMGA SWPALSE+TKA    ++ D      
Sbjct  99    EKSEASGGQDNAGKKPVWKRPSNGASEVGPVMGASSWPALSETTKAPSNKSSSDSLKSLG  158

Query  1581  --PLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSS  1408
               P  + +  SVP  QG   A   +PK          N  P    +RQRS K+  G + S
Sbjct  159   DVPSSSSASSSVPVTQGIANASVPAPK-----QAGRANPNPTPNHSRQRSFKQRNGASGS  213

Query  1407  NTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSIGGNEN  1228
                 ANG+VSQ            P++ G    E  S +   R   Q+ GF SQ+ GG EN
Sbjct  214   ----ANGTVSQ------------PSAQGS-FTELPSHNPSPRGQNQKNGFASQNHGGTEN  256

Query  1227  QYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsr  1048
                               +G++H +HGG R+QE GNQ W   RSF  R+ + Q       
Sbjct  257   --------PSQRDSYRNQNGNHHQSHGGRRNQEHGNQNWTFQRSFNGREGNAQ-------  301

Query  1047  pflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVF  868
                                   G+P               HP   V P+           
Sbjct  302   -------------------SQRGTPAFV-----------RHPSPTVQPIP----------  321

Query  867   YQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQ  688
              QF+            + + S+     D+YLR  M+++G+VP+R++A FKKVA LTD+IQ
Sbjct  322   -QFM----------AAQPFPSHIPFPTDIYLRGFMNNEGFVPLRVVAGFKKVAELTDNIQ  370

Query  687   LILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVT  508
              I+ A++ S  +EVQG+ +R R++W+ W++      + S PQS     +D +++    ++
Sbjct  371   QIVEALQNSPHVEVQGDFIRKRDNWQNWVL--RRNPTGSGPQSVDR--ADAVAKRLGNLS  426

Query  507   LDDNNAN  487
             +D ++A+
Sbjct  427   VDQSSAD  433



>gb|KCW53214.1| hypothetical protein EUGRSUZ_J02483 [Eucalyptus grandis]
Length=188

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 91/135 (67%), Gaps = 8/135 (6%)
 Frame = -1

Query  981  GSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSN  802
            G+PL YPE+ P ++ P PHPD       ++PPP       F       +I+ QIEYYFS 
Sbjct  54   GNPLAYPEMAPHFF-PTPHPDIQASGPFSAPPPPVYSPLHF-------EILKQIEYYFSK  105

Query  801  DNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVR  622
            +NLIKD++ RKE D+QGWV + +IA FKKV+ +T DI LIL A+R+STM+E+QGE +R R
Sbjct  106  ENLIKDLHFRKEWDEQGWVHISIIAAFKKVSSMTRDINLILDAIRSSTMLEIQGEMVRKR  165

Query  621  NDWKKWIVPPSVQYS  577
            +DWK WIVP   + S
Sbjct  166  DDWKPWIVPKDFKVS  180



>ref|XP_004136486.1| PREDICTED: uncharacterized protein LOC101220887 [Cucumis sativus]
 ref|XP_004162569.1| PREDICTED: uncharacterized LOC101220887 [Cucumis sativus]
 gb|KGN60052.1| hypothetical protein Csa_3G873810 [Cucumis sativus]
Length=540

 Score =   133 bits (335),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 102/257 (40%), Positives = 135/257 (53%), Gaps = 38/257 (15%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             YH+  GG R Q+RG         F +RDAH Q  R  +R F+R  PP     P       
Sbjct  288   YHNNRGGKRGQDRG-------IYFNARDAHFQQHRPHTRGFMRPLPPFTGQFPQG-----  335

Query  984   LGSPLVYPEVHPMYYVPGPHPDSLVMPML--------ASpppgpPVFYQFLDPLLLSKIV  829
                  V P ++PM      HP+ + +P L            P P + Y  +DP L + IV
Sbjct  336   -----VRPHLNPMA-----HPEFVYVPTLPLEAYRGGLPFMPRPAMNYPTVDPTLSASIV  385

Query  828   NQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIE  649
              QIEYYFS+ NL+KD YLR +MDDQGWVP+ LIATF  V  LT++IQ I+ ++RTST +E
Sbjct  386   KQIEYYFSDGNLVKDDYLRSQMDDQGWVPISLIATFPMVLSLTNNIQWIVESLRTSTEVE  445

Query  648   VQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGS--DVLSQHFQGVTLDDNN----AN  487
             VQ  K+R RN+WKKW       +  +   S+ S GS  D L+  FQ V +D+       N
Sbjct  446   VQDYKIRRRNEWKKWTT--KSNWFRTDLVSSASSGSTHDSLATSFQRVRVDEGTNQSMTN  503

Query  486   EHERGNAEAHLNRSSSE  436
             + +  NAE      SSE
Sbjct  504   DTDPHNAERTTELQSSE  520


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 45/70 (64%), Gaps = 3/70 (4%)
 Frame = -1

Query  1737  SFENSDS--GNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTP  1567
             S EN D+  GN A KK AWNKP NG  E G VMGA SWPAL+ES +ASPK     P K  
Sbjct  87    SSENCDANDGNAASKKQAWNKPTNGVVEGGSVMGADSWPALAESARASPKLTVDSPPKVT  146

Query  1566  SDGSVPPPQG  1537
              + +VPP QG
Sbjct  147   VEVAVPPSQG  156



>ref|XP_010061089.1| PREDICTED: la-related protein 1B-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW67985.1| hypothetical protein EUGRSUZ_F01675 [Eucalyptus grandis]
Length=551

 Score =   132 bits (332),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 107/174 (61%), Gaps = 9/174 (5%)
 Frame = -1

Query  975  PLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDN  796
            P+ +P++ P +Y+P    +         PPP  P+F    DP L S IV QIEYYFS+DN
Sbjct  361  PMSFPDISPQFYIPALPVEPYSGGPFFPPPPSTPMFMPVSDPSLPSHIVRQIEYYFSDDN  420

Query  795  LIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRND  616
            L+KD +L+  MD +GWVP+ LIATF++V  LT+ IQLIL ++R ST++EVQ  K+R +N+
Sbjct  421  LVKDEFLKSNMDTEGWVPISLIATFRRVTNLTNSIQLILESLRDSTVVEVQDNKVRRQNE  480

Query  615  WKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANEHE-RGNAEAH  457
            W KWI          SP S RS   + L+  F+ +T  +  AN+++  G A+ H
Sbjct  481  WAKWIY-------RGSPAS-RSLSDEELAASFEKMTAQEIPANQNDTTGEADVH  526


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 76/130 (58%), Gaps = 19/130 (15%)
 Frame = -1

Query  1746  QPE--SFENSD-SGNNAV----KKPAWNKPNG-STEAGPVMG-AVSWPALSESTKASPKS  1594
             QPE  S E+ D SG N V    +KPAWNKP+  + +AGPVMG AVSWPALSES +ASPKS
Sbjct  78    QPEGGSEESLDWSGGNVVSVQPRKPAWNKPSSEAVDAGPVMGDAVSWPALSESARASPKS  137

Query  1593  ATYD-------PLKTP--SDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQR  1441
              + D       P+++   S   V  P G  +   S  K   +N+    +++ N   ARQ+
Sbjct  138   PSVDASSSKAVPVESVSISQARVEIPSGPPVM-HSPQKQAASNSLNANSTSNNSPTARQK  196

Query  1440  SNKRAGGGNS  1411
              N+R GGGNS
Sbjct  197   INRRGGGGNS  206



>ref|XP_011011174.1| PREDICTED: la-related protein 1C-like isoform X2 [Populus euphratica]
Length=416

 Score =   130 bits (327),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 147/378 (39%), Positives = 199/378 (53%), Gaps = 55/378 (15%)
 Frame = -1

Query  1764  DAATEAQPESF------ENSDSGNNAVKKPAWNKP----NGSTEAGPVMGAVSWPALSES  1615
             +A+TEA+  +       E+ +S NN  K+P WNKP    NG  E G VMGA SWP LSES
Sbjct  65    NASTEAEQAAAVFVAEKESVESENNVSKRPVWNKPSTAGNGLVEIGSVMGADSWPDLSES  124

Query  1614  TK--ASPKSATYDPLK-TPSDGSVPPP---QGTGIAPSSSPKpvhtnntttpnstpnhvP  1453
                 +S   ++ D LK    DGS       QGT  A SSS K V+               
Sbjct  125   AARVSSLTKSSADSLKGLLFDGSSSSVSVSQGTETASSSSQKQVNNTANPNSTPNNAVP-  183

Query  1452  ARQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGG  1273
             ARQ+S K  G   +SN                     +P S    G E +  ++  RD  
Sbjct  184   ARQKSMKCKGVNTASNGGT-----------------HSPGSQSAAG-EGHLNNSSSRDHA  225

Query  1272  QRGGFGSQSIGGNEN-QYTrssprkgngrprprgdgSYHHAHGGAR-DQERGNQEWNANR  1099
             Q+    SQS G N++ Q  R+S R  NG    RGDGS+HH +GG R D +  N +WNA+ 
Sbjct  226   QKS---SQSRGSNDHPQQQRTSFRNCNGGLHSRGDGSHHHGYGGRRNDLDLANHDWNAHP  282

Query  1098  SFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLV-------YPEVH-PMY  943
             +F SRD H+QPL   +   +R  PP PP       +     P V       +P++  P+Y
Sbjct  283   NF-SRDGHMQPLPRVAPRHMRHQPPPPPTPATSPFI---APPPVRPFGLVGFPDMGLPLY  338

Query  942   YVPGPHPDSLV-MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKE  766
             YV  PHP S+  +P++A+P P   VF+   DP L  +I++QI+YYFSN+NL+KD+YLR+ 
Sbjct  339   YV-SPHPGSMRGVPIIAAPVPTHTVFFPS-DPQLHIRILHQIDYYFSNENLVKDIYLRRN  396

Query  765   MDDQGWVPVRLIATFKKV  712
             MDDQGWVP++LIA+F K 
Sbjct  397   MDDQGWVPIKLIASFNKT  414



>gb|KFK28269.1| hypothetical protein AALP_AA8G494800 [Arabis alpina]
Length=444

 Score =   130 bits (328),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 116/192 (60%), Gaps = 9/192 (5%)
 Frame = -1

Query  1152  HGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpp------psppfipplmpm  991
             HG  R+ E GNQ    +R++  RD HLQP R       ++P        +         +
Sbjct  193   HGHRRNYEHGNQNGFPHRNYNGRDMHLQPQRGFGMMRPQMPMGPPSFPATSAQYMAAPHI  252

Query  990   rpLGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYY  811
                G P++YP+  P   +P P P S+    L  P P  P++   +D +L S+I+ Q+EYY
Sbjct  253   GSYGGPMIYPDYAPHILMPPPPPGSMA---LVGPFPPLPMYLPSIDAMLYSRILTQVEYY  309

Query  810   FSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKL  631
             FS DNL  D +L+++M+D+GWVPVR+IA F+++A +T+DIQ IL A+R+S ++E++GE +
Sbjct  310   FSADNLSTDKHLKEQMNDEGWVPVRVIAGFRRLAEMTNDIQTILEALRSSEVVEIKGEAI  369

Query  630   RVRNDWKKWIVP  595
             R R DW K+++P
Sbjct  370   RRRGDWDKYLLP  381



>ref|XP_009112277.1| PREDICTED: la-related protein 1B [Brassica rapa]
Length=339

 Score =   129 bits (324),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 97/130 (75%), Gaps = 3/130 (2%)
 Frame = -1

Query  981  GSPLVYPEVHPMY-YVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFS  805
            G P++YP  + ++ ++  P P+S+ +  + + PP PP+++   DP+L +KI+ Q+EYYFS
Sbjct  191  GGPMLYPADYALHVFMRHPPPESIAL--VGNFPPPPPIYFPSFDPMLSNKILTQVEYYFS  248

Query  804  NDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRV  625
             DNL KD +LR +M+D GWVPVR+IA F+++A LTD++Q IL A+R+S ++E++GE LR 
Sbjct  249  ADNLSKDEHLRGQMNDDGWVPVRIIAGFRRLAELTDNMQTILEALRSSEVVEIKGEALRR  308

Query  624  RNDWKKWIVP  595
            R DW K+++P
Sbjct  309  RGDWDKYLLP  318



>ref|XP_010465945.1| PREDICTED: la-related protein 1B-like [Camelina sativa]
Length=458

 Score =   130 bits (328),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 124/222 (56%), Gaps = 16/222 (7%)
 Frame = -1

Query  1152  HGGARDQERG-NQEWNANRSFGSRDAHLQplrvpsrpflrvpp---psppfipplmpmrp  985
             HG  R  E G NQ   ++R+   RD HLQP R        +       P      M    
Sbjct  243   HGNRRHYEHGGNQSGFSHRNHTGRDMHLQPQRGIGMMRPHMLMGPPSFPATSAQYMAAPQ  302

Query  984   LGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFS  805
              G P+++P+     ++P P P  LV P         P    + D +L +KI  Q+EYYFS
Sbjct  303   YGGPMLFPDYAQHVFMP-PEPIGLVGPF--------PPLPLYFDAMLYNKIFTQVEYYFS  353

Query  804   NDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRV  625
              DNL +D +LR  M+D+GWVPVR+IA F+++A LT++IQ IL A+++S ++E++GE LR 
Sbjct  354   ADNLSRDKHLRDHMNDEGWVPVRVIAGFRRLAELTNNIQTILEALKSSQVVEIEGEALRR  413

Query  624   RNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDD  499
             R DW K+ +P   + S+S P +A S  + ++SQ  + +TL +
Sbjct  414   RGDWNKYRLP--RESSMSGPAAAASDNASLVSQ-LESITLSE  452



>ref|XP_008466467.1| PREDICTED: la-related protein 1C-like [Cucumis melo]
Length=547

 Score =   131 bits (329),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 101/256 (39%), Positives = 134/256 (52%), Gaps = 36/256 (14%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             YH+  GG R Q+RG           +RDAH Q  R  +R F+R  PP     P       
Sbjct  295   YHNNRGGKRGQDRGIYP-------NARDAHFQQHRPHTRGFMRPLPPFAGQFPQG-----  342

Query  984   LGSPLVYPEVHPMYYVPGPHPDSLVMPML--------ASpppgpPVFYQFLDPLLLSKIV  829
                  V P V+PM      HP+ + +P L            P P + Y  +DP+L + I+
Sbjct  343   -----VRPHVNPMA-----HPEFVYVPTLPLEAYRGSMPFMPRPAMNYPTVDPILSASIL  392

Query  828   NQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIE  649
              QIEYYFS+ NL+KD YLR +MDDQGWVP+ LIATF  V  LT++IQ I+ ++R ST +E
Sbjct  393   KQIEYYFSDGNLVKDDYLRSQMDDQGWVPISLIATFPMVLSLTNNIQWIIESLRASTEVE  452

Query  648   VQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGS-DVLSQHFQGVTLDDNN----ANE  484
             VQ  K+R RN+WKKW    S  +      SA S  S D L+  FQ V +D+       N+
Sbjct  453   VQDNKIRRRNEWKKWTT-KSNWFRTDLVSSATSGSSHDSLATSFQRVRVDEGTNQSMTND  511

Query  483   HERGNAEAHLNRSSSE  436
             ++  NAE      SSE
Sbjct  512   NDPHNAERTTELQSSE  527


 Score = 61.2 bits (147),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 44/72 (61%), Gaps = 5/72 (7%)
 Frame = -1

Query  1737  SFENSDSGNN----AVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLK  1573
             S EN D+ +     A KK AWNKP NG  E G VMGA SWPAL+ES +ASPK     P K
Sbjct  87    SSENCDTNDGNATAASKKQAWNKPTNGVVEGGSVMGADSWPALAESARASPKLTVDSPPK  146

Query  1572  TPSDGSVPPPQG  1537
                + +VPP QG
Sbjct  147   VTVEVAVPPSQG  158



>ref|XP_011074705.1| PREDICTED: la-related protein 1B-like [Sesamum indicum]
Length=530

 Score =   130 bits (328),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 110/180 (61%), Gaps = 2/180 (1%)
 Frame = -1

Query  948  MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRK  769
            ++YVP   P+SL    L  PPP         +PL  + IV QI++YFS+DNL+KD +LR 
Sbjct  334  LFYVPAMPPESLRPMPLVPPPPPMLFPPANENPLT-NLIVKQIDFYFSDDNLVKDNFLRS  392

Query  768  EMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPS  589
            +MD+ GWVP+ LIA+F++V  LT DI +IL ++R ST++EVQG+K+R RN+W KW+   +
Sbjct  393  KMDEHGWVPITLIASFRRVQQLTKDIPVILESLRYSTVVEVQGDKVRRRNEWSKWLHSSA  452

Query  588  VQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANEH-ERGNAEAHLNRSSSE*KNSRVQS  412
                 S P + R+   +VL+   Q V+LDD+  N +  +   E H +   S  + S  QS
Sbjct  453  RPSLDSGPHTPRAAPENVLATSLQEVSLDDSMTNANGNKATMEGHTDTGRSFPEESTSQS  512


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 54/86 (63%), Gaps = 4/86 (5%)
 Frame = -1

Query  1773  LLQDAATEAQPESFE-NSDSGNNAVKKPAWNKP-NGSTEAGPVMG-AVSWPALSESTKAS  1603
             L++ + +E QPES + N D+     ++PAWN+P NG  E   VMG AVSWPALSE+T+  
Sbjct  73    LIESSGSEPQPESSDVNGDNNAGRPRRPAWNRPLNGVVEPASVMGGAVSWPALSETTRPI  132

Query  1602  PKSATYDPLKTPSDGSVPPPQGTGIA  1525
             P+S + D  +  SDGS  P Q   I+
Sbjct  133   PRS-SLDTSRPISDGSASPSQAPIIS  157



>ref|XP_008807133.1| PREDICTED: la-related protein 1C-like [Phoenix dactylifera]
Length=464

 Score =   129 bits (324),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 138/359 (38%), Positives = 188/359 (52%), Gaps = 26/359 (7%)
 Frame = -1

Query  1701  KKPAWNKP-NGSTEAGPVMGAVSWPALSESTKASPKSATYDPLKTPSDGSVPPPQGTGIA  1525
             KKPAW +P NG  E GPVMGA SWP LS STKASPKS++ D  K  SD ++  P G  I+
Sbjct  114   KKPAWQRPSNGWIEVGPVMGA-SWPPLSLSTKASPKSSSSDTSKGSSDITISSPPGPVIS  172

Query  1524  PSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNSSNTALANGsvsqpqqlqslvVE  1345
              + SPKP   N            PARQ+ NKR  GG SS+   ANG  +      +  V 
Sbjct  173   -TPSPKPNSNNINLDSTPDLVVPPARQKPNKRGSGGGSSSATPANGIPALQSLPPASAVG  231

Query  1344  MAPNSAGKPGVEPYSRDNVHRD--------GGQRGGFGSQSIGGNENQYTrssprkgngr  1189
                  A +   EP  RD  +R+        G    GF  Q  G N++       R+G G 
Sbjct  232   TQITPAKQTTPEPSPRDLPNRNSSNSNWEHGTGGSGFAPQQHGRNDHHRGYGGNRRGGGG  291

Query  1188  prprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfi  1009
                 G      + G  RDQERGN EW ++R F SRDA++Q  +         PPP     
Sbjct  292   ASHHG------SFGSRRDQERGNYEW-SHRGFSSRDANVQQHQQRGVRPYPRPPPPVAPP  344

Query  1008  pplmpmrpLG---SPLVYPEVHPMYYVPG--PHPDSLV-MPMLASpppgpPVFYQFLDPL  847
             P + P   +    +P+ Y ++ PMYYV    P P++L  +P +A P   P +F+  ++P 
Sbjct  345   PFIGPPPQVRPFVNPMGYSDIPPMYYVTAAPPPPETLRGLPFVAHPAAPPAMFFPAIEP-  403

Query  846   LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAM  670
               + ++ QI YYFS +NL KD+YLR+ MD+QGWVP+ LIA F +V+ L   + L+L+ M
Sbjct  404   QRAMLLKQINYYFSTENLCKDIYLRQNMDEQGWVPISLIAGFNRVSYL-GTLSLLLYHM  461



>ref|XP_002866774.1| hypothetical protein ARALYDRAFT_497006 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43033.1| hypothetical protein ARALYDRAFT_497006 [Arabidopsis lyrata subsp. 
lyrata]
Length=437

 Score =   129 bits (323),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 91/129 (71%), Gaps = 5/129 (4%)
 Frame = -1

Query  981  GSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSN  802
            G P++YP+     ++P P P +LV P      P  PV++   D +L +KI+ Q+EYYFS 
Sbjct  279  GGPMIYPDYAQHVFMPPPDPMALVGPF-----PPLPVYFPSYDAMLYNKILTQVEYYFSA  333

Query  801  DNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVR  622
            DNL +D +LR +M+D+GWVPVR+IA F+++A LT++I  IL A+++S ++E++GE LR R
Sbjct  334  DNLSRDEHLRDQMNDEGWVPVRVIAGFRRLAELTNNIHTILEALKSSEVVEIKGETLRRR  393

Query  621  NDWKKWIVP  595
             DW K+++P
Sbjct  394  GDWDKYLLP  402



>ref|XP_010531118.1| PREDICTED: la-related protein 1C-like isoform X3 [Tarenaya hassleriana]
Length=411

 Score =   128 bits (321),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 121/229 (53%), Gaps = 37/229 (16%)
 Frame = -1

Query  1272  QRGGFGSQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSF  1093
             QR G  SQS GGN+NQ                 +G++H  HGG R QE GN  WN  R+F
Sbjct  202   QRNGLPSQSHGGNDNQ--------SQRNSYRNQNGNHHQNHGGRRIQEHGNHNWN--RNF  251

Query  1092  GSRDAHLQplrvp-----------------srpflrvpppsppfipplmpmrpLGSPLVY  964
              +RD H    R                    R    V  P P       P++P GSP+ +
Sbjct  252   NARDGHAPQQRGTPGFVGHAPQQRGTPGFVRRAPPPVQQPIPVPFMAAQPIQPFGSPVAF  311

Query  963   PE-VHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIK  787
             PE V P+YY          MP + S P   PVFYQ  D  L ++I NQI +YFS +NLIK
Sbjct  312   PELVSPIYYP--------RMPFI-SAPVPAPVFYQVQDIPLYTRIQNQIHFYFSEENLIK  362

Query  786   DMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQG  640
             D YLRK MDDQG+V ++LIA F+KV  LTD++Q IL A++ S ++EVQG
Sbjct  363   DTYLRKFMDDQGFVQIQLIAGFRKVVGLTDNVQHILEALQGSPVVEVQG  411


 Score = 59.3 bits (142),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 1/36 (3%)
 Frame = -1

Query  1710  NAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTKA  1606
             NA KKPAWN+P NG++E GPVMGA SWPALSE+TKA
Sbjct  111   NAGKKPAWNRPSNGASEVGPVMGAASWPALSETTKA  146



>ref|XP_010446307.1| PREDICTED: la-related protein 1B-like [Camelina sativa]
Length=441

 Score =   128 bits (321),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 127/219 (58%), Gaps = 8/219 (4%)
 Frame = -1

Query  1152  HGGARDQER-GNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGS  976
             HG  R  +  GNQ   ++R+   RD HLQ  +      L  PP  P      +     G 
Sbjct  224   HGNRRHYDHEGNQSGFSHRNHTGRDMHLQ-PQRGIGMMLMGPPSFPATSAQYLAAPQYGG  282

Query  975   PLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDN  796
             P++Y +  P  ++P P P+ +    L  P P  P+F    D +L +KI+ Q+EYYFS DN
Sbjct  283   PMLYSDYAPHVFMPHPSPEPI---GLVGPFPPLPLFLSSFDAILYNKILTQVEYYFSADN  339

Query  795   LIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRND  616
             L +D +LR +M+D+GWVPVR+IA F+++A LT++IQ IL A+++S ++E+ GE LR R D
Sbjct  340   LSRDKHLRDQMNDEGWVPVRVIAGFRRLAELTNNIQTILEALKSSQVVEINGETLRRRGD  399

Query  615   WKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDD  499
             W K+ +    + S S P +A S  + ++SQ  + +TL +
Sbjct  400   WDKYRL--HRESSESGPAAAASDNASLVSQ-LESITLSE  435



>ref|XP_003629259.1| La-related protein 1B [Medicago truncatula]
 gb|AET03735.1| LA-related protein 6 LA RNA-binding domain protein [Medicago 
truncatula]
Length=455

 Score =   127 bits (319),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 140/437 (32%), Positives = 208/437 (48%), Gaps = 65/437 (15%)
 Frame = -1

Query  1740  ESFENSDSGNNAVKKPAWNKPNGSTEAGPVMGAVSWPALSESTKASPKSATY------DP  1579
             E+ E++D+ +   K+P W+KP+ +  A  VM A SWPALSES KA  KS         + 
Sbjct  49    EAAEDTDNTSGG-KRPVWSKPSNAA-ASSVMDADSWPALSESAKAPAKSPPPPPSPPQEL  106

Query  1578  LKTPSD-GSVPPPQGTGI---APSSSPKpvhtnntttpnstpnhvPARQRSNKRAGGGNS  1411
             +K   D  ++P  QGTG    +P    K    N+  T   T      R  SN  + GG  
Sbjct  107   VKLSLDLSTLPQSQGTGSMLHSPQKQVKDTAGNSNVTSVPTHQKPFRRSNSNASSNGGRQ  166

Query  1410  -SNTALANGsvsq---pqqlqslvVEMAPNSAGKPGVEPYSRDNVHRDGGQRGGFGSQSI  1243
                 ++  G V+         S  ++  P +   P  +P  R++       R G G Q  
Sbjct  167   PPQMSVPQGFVAVPPGSHNHNSAQIDHLPRAGFVPNDQPQRRNSFR----NRNGGGLQPR  222

Query  1242  GGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNA-NRSFGSRDAHL--  1072
             G   + +                        G  RDQ+RGNQ+WNA NR+F +RD +   
Sbjct  223   GDGSHHFNS----------------------GSRRDQDRGNQDWNAHNRNFNNRDNYRSP  260

Query  1071  QplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPH---PDSL--VM  907
             + +    RP            PP      +GS   +     M Y P  H   P S+  V 
Sbjct  261   RFVPQFVRPPPPTNHAQYYPPPPPPIPPYMGSYGYHDLTLQMMYGPPLHVEPPRSVPFVQ  320

Query  906   PMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIA  727
             P+ ++      +F+   D  L +KIVNQI+YYFS+ NL  D YL++ MDDQGWVP+ LIA
Sbjct  321   PISSA------IFFPPPDSELQTKIVNQIDYYFSDLNLNNDTYLKRNMDDQGWVPLNLIA  374

Query  726   TFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSP  547
              F KV +LTD+IQ+++ A+RTS+++EVQ +K+R RN    WI   S  ++++  Q A   
Sbjct  375   GFNKVKLLTDNIQIVVDAVRTSSVVEVQDDKIRRRN----WITLSSQFHNVNGSQIAAQ-  429

Query  546   GSDVLSQHFQGVTLDDN  496
                 L+++ Q + L+ N
Sbjct  430   ----LAKNIQNIDLETN  442



>ref|XP_009414439.1| PREDICTED: la-related protein 1B-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=499

 Score =   127 bits (320),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 97/240 (40%), Positives = 132/240 (55%), Gaps = 19/240 (8%)
 Frame = -1

Query  1161  HHAHGGAR-DQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             HH   G R D +RG  +WN+ R F  R+ H + + +  +     P   PP  PP M    
Sbjct  228   HHGRYGTRHDHDRGGYDWNSPRGFSGRNPH-RSIPLAQQWGQSRPFIRPPPPPPAMAQFL  286

Query  984   LGSPLVYPEVHPMYY--------VPGPHPDSL-VMPML---ASpppgpPVFYQFLDPLLL  841
                P ++P V PM Y        +P P PD+L  MP +    SP     +F+  +D    
Sbjct  287   SMPPHIWPFVSPMGYPEIPPIYYLPPPPPDTLGSMPFITHQVSPVNPSAMFHPSVDHKSF  346

Query  840   SKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTS  661
               +V QIEYYFS DNL KD +LR+ MDDQGWVPV LIA F +V  LT+DI  IL A++ S
Sbjct  347   -MLVKQIEYYFSPDNLCKDSFLRRNMDDQGWVPVSLIAGFNRVKQLTEDIPYILDAVQGS  405

Query  660   TMIEVQGEKLRVRNDWKKWIVPPSV--QYSI-SSPQSARSPGSDVLSQHFQGVTLDDNNA  490
             T++EVQGEK+R R DW +W +  S+  QY I SS QS R+P  D +        L++ ++
Sbjct  406   TVVEVQGEKIRRRGDWMRWTL-SSIPHQYEIASSAQSPRTPDHDSVIAQMHAFGLEEGSS  464



>ref|XP_009414437.1| PREDICTED: la-related protein 1B-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=529

 Score =   127 bits (320),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 130/237 (55%), Gaps = 19/237 (8%)
 Frame = -1

Query  1161  HHAHGGAR-DQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             HH   G R D +RG  +WN+ R F  R+ H + + +  +     P   PP  PP M    
Sbjct  258   HHGRYGTRHDHDRGGYDWNSPRGFSGRNPH-RSIPLAQQWGQSRPFIRPPPPPPAMAQFL  316

Query  984   LGSPLVYPEVHPMYY--------VPGPHPDSL-VMPML---ASpppgpPVFYQFLDPLLL  841
                P ++P V PM Y        +P P PD+L  MP +    SP     +F+  +D    
Sbjct  317   SMPPHIWPFVSPMGYPEIPPIYYLPPPPPDTLGSMPFITHQVSPVNPSAMFHPSVDHKSF  376

Query  840   SKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTS  661
               +V QIEYYFS DNL KD +LR+ MDDQGWVPV LIA F +V  LT+DI  IL A++ S
Sbjct  377   -MLVKQIEYYFSPDNLCKDSFLRRNMDDQGWVPVSLIAGFNRVKQLTEDIPYILDAVQGS  435

Query  660   TMIEVQGEKLRVRNDWKKWIVPPSV--QYSI-SSPQSARSPGSDVLSQHFQGVTLDD  499
             T++EVQGEK+R R DW +W +  S+  QY I SS QS R+P  D +        L++
Sbjct  436   TVVEVQGEKIRRRGDWMRWTL-SSIPHQYEIASSAQSPRTPDHDSVIAQMHAFGLEE  491



>ref|XP_006280466.1| hypothetical protein CARUB_v10026401mg [Capsella rubella]
 gb|EOA13364.1| hypothetical protein CARUB_v10026401mg [Capsella rubella]
Length=445

 Score =   126 bits (317),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 112/193 (58%), Gaps = 11/193 (6%)
 Frame = -1

Query  1152  HGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpp------psppfipplmpm  991
             HG  R  E GNQ   ++R+   RD HLQP R       ++         +         +
Sbjct  221   HGNRRSYEHGNQSGFSHRNLSGRDMHLQPQRGIGMMRPQMLMGPPSFPATSAQYMAAPQI  280

Query  990   rpLGSPLVYPEVHPMYYVPGPHPDSLVMPM-LASpppgpPVFYQFLDPLLLSKIVNQIEY  814
                G P++YP+     +VP P P+    PM L  P P  P+++   D +L +KI+ Q+EY
Sbjct  281   GSYGGPMLYPDYAQHVFVPHPPPE----PMGLVGPFPPLPMYFPSFDAMLYNKILTQVEY  336

Query  813   YFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEK  634
             YFS DNL +D +LR +M+++GWV VR+IA F+++A LT++IQ IL A+  S ++E++GE 
Sbjct  337   YFSADNLSRDEHLRDQMNNEGWVNVRVIAGFRRLAELTNNIQTILEALGGSEVVEIKGET  396

Query  633   LRVRNDWKKWIVP  595
             LR R DW K+++P
Sbjct  397   LRRRGDWDKYLLP  409



>gb|AES59797.2| LA-related protein 6 LA RNA-binding domain protein [Medicago 
truncatula]
Length=546

 Score =   127 bits (318),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 151/443 (34%), Positives = 207/443 (47%), Gaps = 79/443 (18%)
 Frame = -1

Query  1701  KKPAWNKP--NG-STEAGPVMGAVSWPALSESTKAS---PKSATYDPLKTPS--DGSVPP  1546
             KKPAWNK   NG + E GPVMGA SWPALSES K     P  ++   +  P+  DGS   
Sbjct  130   KKPAWNKQPLNGVAVEIGPVMGAESWPALSESAKIPGKLPPESSSSKIAPPAAVDGSPST  189

Query  1545  PQGTGIAPSSSP-KpvhtnntttpnstpnhvPARQRSNKRAGGGN----SSNTALANGsv  1381
              QG  I  S SP +   T+NT + +   N++P R R  +R  G N     + ++L+N   
Sbjct  190   SQGPII--SHSPQRQGSTSNTKSSSMANNNLPNRPRPMRRISGSNIGPCPAQSSLSNPPT  247

Query  1380  sqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRD-------------GG--QRGGFGSQS  1246
               P     +     P +   P + P   D+  RD             GG  +RG FGS  
Sbjct  248   PPPLPPYPVY--QLPPAVSYPNMLPSIPDSSPRDHHRNNNWDARPFVGGSSRRGHFGSHP  305

Query  1245  IGGNENQYTrssprkgngrprprgdgSYH-HAHGGARDQERGNQEWNANRSFGSRDAHLQ  1069
              G                         YH +++   R+ +RGN          +RDAH  
Sbjct  306   RGDGS----------------------YHQNSYSSRREHDRGNYA-------NTRDAHAP  336

Query  1068  plrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSL----VMPM  901
               R+P R  LR PPPS         + P  +P+ YP+    YY P    D      V P 
Sbjct  337   QPRMPPRGILRPPPPSTAAFLGPQTIGPFPAPVAYPD---FYYFPTVPLDPFRGMPVFPH  393

Query  900   LASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATF  721
             + SP      F+   +  L + IVNQI+YYFS+ NL  D +L+  MD++GWVP+ LIA F
Sbjct  394   MPSPA----TFFPAAESSLSNVIVNQIDYYFSDINLANDEFLKSNMDEEGWVPITLIANF  449

Query  720   KKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSIS--SPQSARSP  547
              +V  LT +IQLIL +MR S +++VQG+KLR RN W   +    VQ      SP  +R  
Sbjct  450   PRVKNLTSNIQLILDSMRNSNVVDVQGDKLRRRN-WIDRLTSAQVQADAGSVSPIESR--  506

Query  546   GSDVLSQHFQGVTLDDNNANEHE  478
               +  +  FQ +TLD    +E E
Sbjct  507   -DNSFTADFQTITLDKTTKDEGE  528



>ref|XP_009619448.1| PREDICTED: la-related protein 1C-like [Nicotiana tomentosiformis]
Length=550

 Score =   126 bits (316),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 95/142 (67%), Gaps = 9/142 (6%)
 Frame = -1

Query  861  FLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLI  682
             +DP L + +V QIEYYFS+DNL+KD +LR +MD++GWVP+ LIA F +V  LT++IQ I
Sbjct  377  VVDPNLPALLVKQIEYYFSDDNLVKDDFLRSKMDEEGWVPIELIANFPRVRHLTNNIQFI  436

Query  681  LHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPG---SDVLSQHFQGV  511
            L  +R ST++EVQ +K+R R+DWKKWI        +++   +++PG    + L   FQ +
Sbjct  437  LDCLRASTLVEVQDDKVRRRDDWKKWI---HTSGHLTADSGSQTPGESTENALMSSFQEI  493

Query  510  TLDD---NNANEHERGNAEAHL  454
            +LD+   + +N+ +R + +  +
Sbjct  494  SLDESGNDKSNDVDRRDVQVEV  515



>gb|KHN12624.1| La-related protein 1B [Glycine soja]
Length=436

 Score =   123 bits (309),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 101/167 (60%), Gaps = 8/167 (5%)
 Frame = -1

Query  975  PLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDN  796
            P+ +PE +  YY P        M   A  PP  P F     PL  + IV QIEYYFS+ N
Sbjct  263  PIGFPEFY--YYQPVTVEQFTGMSFFAHSPPPTPFFSAAESPLS-NMIVYQIEYYFSDAN  319

Query  795  LIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRND  616
            L+KD +LR +MD+QGWVPV LIA F +V  LT +IQLIL ++RTS ++EVQG+KLR  N+
Sbjct  320  LVKDAFLRSKMDEQGWVPVTLIADFPRVKSLTTNIQLILDSIRTSAIVEVQGDKLRRLNE  379

Query  615  WKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANEHER  475
            WK+W+   S Q   +SP  +R    + L+ + Q + L++   +E  R
Sbjct  380  WKRWLS--STQRGSTSPIGSR---YNNLTTNLQTIKLEETIKDEDPR  421



>ref|XP_002510581.1| lupus la ribonucleoprotein, putative [Ricinus communis]
 gb|EEF52768.1| lupus la ribonucleoprotein, putative [Ricinus communis]
Length=449

 Score =   123 bits (309),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 86/131 (66%), Gaps = 1/131 (1%)
 Frame = -1

Query  873  VFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDD  694
            V     +P L   +V QIEYYFS+ NL+KD +L+  MDDQGWVP+ LIA+F +V  +T+D
Sbjct  282  VMMPVSEPPLPDILVRQIEYYFSDGNLVKDDFLKSNMDDQGWVPITLIASFNRVRKMTND  341

Query  693  IQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQG  514
            I L+L ++RTST +EVQ +K+R RNDW +WI P S +    S Q   S  +  L   FQ 
Sbjct  342  IHLVLDSLRTSTFLEVQDDKVRRRNDWTQWI-PNSSRLPTDSSQQTLSASNHNLLTTFQT  400

Query  513  VTLDDNNANEH  481
            +T+++  AN++
Sbjct  401  MTVEEVAANQN  411



>ref|XP_009769236.1| PREDICTED: la-related protein 1C-like [Nicotiana sylvestris]
Length=548

 Score =   124 bits (311),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 95/142 (67%), Gaps = 9/142 (6%)
 Frame = -1

Query  861  FLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLI  682
             +DP L + +V QIEYYFS+DNL+KD +LR +MD++GWVP+ LIA F +V  LT++IQ I
Sbjct  375  VVDPNLPALLVKQIEYYFSDDNLVKDDFLRSKMDEEGWVPIELIANFPRVRHLTNNIQFI  434

Query  681  LHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPG---SDVLSQHFQGV  511
            L  +R ST++EVQ +K+R R+DWKKWI        +++   +++PG    + L+  FQ V
Sbjct  435  LDCLRASTLVEVQDDKVRRRDDWKKWI---HTSGHLTADSGSQTPGGSTENALTSSFQEV  491

Query  510  TLDD---NNANEHERGNAEAHL  454
            +L +   + +N+ +R + +  +
Sbjct  492  SLGESGNDKSNDVDRRDVQVEV  513



>ref|XP_006842028.1| hypothetical protein AMTR_s00203p00014740 [Amborella trichopoda]
 gb|ERN03703.1| hypothetical protein AMTR_s00203p00014740 [Amborella trichopoda]
Length=543

 Score =   122 bits (307),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 121/220 (55%), Gaps = 9/220 (4%)
 Frame = -1

Query  1143  ARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVY  964
             +RD  R N +WN+ R+F  RD        P       PP  PP     +P    G     
Sbjct  253   SRDHGRFNHQWNSQRNFNGRDFQTTQNFGPRNFSRPQPPQPPPPPYLNLPAHFGGHISFA  312

Query  963   PEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDP----LLLSKIVNQIEYYFSNDN  796
              ++H   +   P P   V PM  +    P V     +P     L S+++ QI++YFS++N
Sbjct  313   GDMHNQVFFAVPPP---VDPMRGTSFVYPSVPPTIYNPAQDAYLRSQLIAQIDHYFSSEN  369

Query  795   LIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRND  616
             L KD++LR  MD++GWVP+ LI TF +V  LT+++ LI+ A++TS+++EVQG+K+R R D
Sbjct  370   LCKDVFLRGNMDEEGWVPLSLIMTFNRVRKLTNNMHLIIDALQTSSVVEVQGDKVRRRVD  429

Query  615   WKKWIVPPSVQ-YSISSPQSARSPGSDVLSQHFQGVTLDD  499
             W+ W++PP    Y I+S QS  S   D+L+     + LD+
Sbjct  430   WRNWLLPPQGGIYPITS-QSRNSSNEDLLTSSIYSLELDE  468


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 3/78 (4%)
 Frame = -1

Query  1755  TEAQPESFENSDSGNNAVKKPAWNKPNGST-EAGPVMGAVSWPALSESTKASPKSATYDP  1579
              + +P S   +   + A KKPAWNKP  +  E GPVMGAVSWPALS++ KA+  S+  DP
Sbjct  62    VKGEPSSPNVASESSEASKKPAWNKPQSNEGEVGPVMGAVSWPALSDAAKAAKPSS--DP  119

Query  1578  LKTPSDGSVPPPQGTGIA  1525
             L  P     PP +G  +A
Sbjct  120   LPKPLKEGDPPQKGHLLA  137



>ref|XP_004499300.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Cicer arietinum]
Length=514

 Score =   122 bits (306),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 99/180 (55%), Gaps = 7/180 (4%)
 Frame = -1

Query  972  LVYPEVHPMYYVPGPHPDSLV-MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDN  796
            + YPE   +YY P    D    MP     P     F     PL  + IVNQI+YYFS+ N
Sbjct  336  VAYPE---LYYFPTVTMDPFRGMPFFPHSPSPATFFPAAESPLS-NMIVNQIDYYFSDTN  391

Query  795  LIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRND  616
            LIKD +LR  MD++GWVP+ LIA F +V  LT ++QLIL ++R ST+++V  +KLR RND
Sbjct  392  LIKDEFLRSNMDEEGWVPITLIANFPRVRNLTSNVQLILDSLRGSTVVDVHDDKLRRRND  451

Query  615  WKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANEHERGNAEAHLNRSSSE  436
            W  W+  PS Q  I S   +       L+  FQ +TL+     +    + ++ L+  S +
Sbjct  452  WMNWL--PSSQVKIESSSVSSGSRYSNLTDDFQTITLEKTTREDEGESSRQSPLSNGSED  509


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 50/95 (53%), Gaps = 15/95 (16%)
 Frame = -1

Query  1776  PLLQDAATEAQPESFENSDSGNNAVKKPAWNKP-NGSTEAGPVMGAVSWPALSESTK---  1609
             PL+ +  T A     + SD      KK  WNKP NG  E GPVMGA  WPALSESTK   
Sbjct  92    PLVDNLITIAS----DVSDGNAGHSKKSVWNKPSNGVVETGPVMGAELWPALSESTKFSG  147

Query  1608  -----ASPKSATYDPLKTPSDGSVP--PPQGTGIA  1525
                  +SPK+A  D   + S GSV   PPQ  G +
Sbjct  148   KLPAESSPKTAAVDGSPSTSQGSVISHPPQRQGTS  182



>gb|KHN45947.1| La-related protein 1B [Glycine soja]
Length=491

 Score =   121 bits (303),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 87/126 (69%), Gaps = 3/126 (2%)
 Frame = -1

Query  873  VFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDD  694
            +F+   +  L + I NQI+YYFS+ NL+KD YLR  MD+QGWVP+ LIA+F +V  LT +
Sbjct  333  MFFPVAETPLTNTIANQIDYYFSDANLVKDEYLRSNMDEQGWVPITLIASFPRVRSLTSN  392

Query  693  IQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQY-SISSPQSARSPGSDVLSQHFQ  517
            I+LIL ++RTST++EVQG+KLR  N+W KW+  PS Q  + S   S     S+ L+  F+
Sbjct  393  IKLILDSLRTSTVVEVQGDKLRRCNEWMKWL--PSAQLRANSGSISPSGSSSNNLAADFE  450

Query  516  GVTLDD  499
             +T+D+
Sbjct  451  KITVDE  456



>ref|XP_009393945.1| PREDICTED: la-related protein 1B-like [Musa acuminata subsp. 
malaccensis]
Length=532

 Score =   121 bits (304),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 105/192 (55%), Gaps = 10/192 (5%)
 Frame = -1

Query  1140  RDQERGNQEWNANRSFGSRDAHL------QplrvpsrpflrvpppsppfipplmpmrpLG  979
             +D E G  +WNA++ F  RD H+      Q              P P    P      +G
Sbjct  262   QDHEWGGYDWNASQGFNGRDPHMTTPLVPQWGYSRPFLQQSPYTPVPFIGIPPHVQPFVG  321

Query  978   SPLVYPEVHPMYYV-PGPHPDSL-VMPMLASpppgpPVFYQFLDPLLLSK--IVNQIEYY  811
              P+ +P+V  +YYV P P  D +  +P ++   P       FL PL  ++  ++ QIEYY
Sbjct  322   GPMGFPDVRSVYYVAPVPPFDPMGNVPSVSHQAPTAARPTVFLSPLDHTRNMLMRQIEYY  381

Query  810   FSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKL  631
             FS +NL KD +LR  MDDQGW+PV LIA+F +V  L+  I  IL ++R S ++EVQ E++
Sbjct  382   FSRENLCKDSFLRVHMDDQGWIPVSLIASFNRVRQLSSSIPFILDSIRGSLVVEVQDERV  441

Query  630   RVRNDWKKWIVP  595
             R R+DW  WI+P
Sbjct  442   RRRSDWMDWILP  453



>ref|XP_004985649.1| PREDICTED: la-related protein-like [Setaria italica]
Length=475

 Score =   119 bits (299),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 108/185 (58%), Gaps = 10/185 (5%)
 Frame = -1

Query  981  GSPLVYPEVHP-MYYVP-GPHPDSLV-MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYY  811
            G+P+ +P++ P +YY P  P  + +  +P +  P     +    +DPL    +V QI+YY
Sbjct  255  GAPMGFPDIVPHVYYFPVSPSTEGIQGLPFVPHPASPQAML---VDPLRKELLV-QIDYY  310

Query  810  FSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKL  631
            FS+DNL KD +LR+ MDDQGWVP+ LIA F+KV  LT++IQ IL  +  ST++EVQG+KL
Sbjct  311  FSDDNLCKDTFLRQHMDDQGWVPLSLIAGFRKVKDLTNNIQFILETVMLSTVVEVQGDKL  370

Query  630  RVRNDWKKWIVPPSVQYSISSP--QSARSPGSDVLSQHFQGVTLDDNNANEHERGN-AEA  460
            R R  W  W++P    Y+ SS    S  +   D L   F  V L+    + + +G   EA
Sbjct  371  RKRGTWGNWLLPKPNHYAGSSSGLLSPVTSSIDSLVSQFHSVGLEGATYHGNMQGMPGEA  430

Query  459  HLNRS  445
             L RS
Sbjct  431  LLTRS  435



>ref|XP_009757102.1| PREDICTED: la-related protein 1C-like [Nicotiana sylvestris]
Length=564

 Score =   120 bits (301),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 83/232 (36%), Positives = 121/232 (52%), Gaps = 20/232 (9%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             YH+ HGG RDQ+R +    A + FG   A                    PF         
Sbjct  304   YHNNHGGRRDQDRRDVHMAAPQ-FGPPHAAFMRPPPAGSGPFLPHTSLRPFPV-------  355

Query  984   LGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFS  805
                P+ Y ++   YYVP   P+S     + +  P  P  +  +DP L   +VNQIEYYFS
Sbjct  356   ---PMGY-DMGQFYYVPL-SPESFSSVPIINQAPPLPQLFPLVDPNLPPSLVNQIEYYFS  410

Query  804   NDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLT-----DDIQLILHAMRTSTMIEVQG  640
             + NL+KD +LR +MD++GWVP++LIA F +V  LT     D+IQ I + + TS ++EVQ 
Sbjct  411   DANLVKDNFLRLKMDEEGWVPIKLIAEFPRVKSLTDKVQFDNIQFISYCLATSMLVEVQD  470

Query  639   EKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSD-VLSQHFQGVTLDDNNAN  487
             EK+R R+DW+KW    S  ++  S  SA    +D  L+   Q V+L+++  N
Sbjct  471   EKIRRRDDWRKWTH-TSSPFAADSGSSAPVASTDGALTTSLQNVSLNESTTN  521


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 52/83 (63%), Gaps = 3/83 (4%)
 Frame = -1

Query  1767  QDAATEAQPESFENSDSGNNAVKKPAWNKP-NGSTEAGPVMG-AVSWPALSESTKASPKS  1594
             +++ ++A PES  ++D      KKPAWNKP NG  EA  VMG A+SWPALSEST+  PKS
Sbjct  93    ENSTSDALPESSGSNDGNVGRPKKPAWNKPLNGVVEAVTVMGGALSWPALSESTRPGPKS  152

Query  1593  ATYDPLKTPSDGSVPPPQGTGIA  1525
             +  D  K   DGS    QG  I+
Sbjct  153   SA-DSSKPIPDGSTSVSQGPIIS  174



>ref|XP_009605222.1| PREDICTED: la-related protein 1C-like [Nicotiana tomentosiformis]
Length=564

 Score =   119 bits (298),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 86/235 (37%), Positives = 123/235 (52%), Gaps = 26/235 (11%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             YH+ HGG RDQ+R             RD H+ P +        + PP     P L     
Sbjct  304   YHNNHGGRRDQDR-------------RDVHMAPPQFGPPHAAFMRPPPAGSGPFLPHTSL  350

Query  984   LGSPLVYPEVHPM---YYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEY  814
                P   P  + M   YYVP   P+S     + +  P  P  +  +DP L   +VNQIEY
Sbjct  351   R--PFPVPMGYDMGQFYYVPL-SPESFTSVPIINQAPPLPQPFPLVDPNLPPSLVNQIEY  407

Query  813   YFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLT-----DDIQLILHAMRTSTMIE  649
             YFS+ NL+KD +LR +MD++GWVP++LIA F +V  LT     D+IQ I + + TS ++E
Sbjct  408   YFSDANLVKDNFLRLKMDEEGWVPIKLIAEFPRVKSLTDKVQFDNIQFISYCLATSMLVE  467

Query  648   VQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSD-VLSQHFQGVTLDDNNAN  487
             VQ EK+R R+DW+KW    S  ++  S  SA    +D  L+   Q V+L+++  N
Sbjct  468   VQDEKIRRRDDWRKWTH-TSSPFAADSGSSAPVASTDGALTTSLQNVSLNESATN  521


 Score = 53.1 bits (126),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -1

Query  1767  QDAATEAQPESFENSDSGNNAVKKPAWNKP-NGSTEAGPVMG-AVSWPALSESTKASPKS  1594
             +++ ++A PES  ++D      KK AWNKP NG  EA  VMG A+SWPALSEST+  PKS
Sbjct  93    ENSTSDALPESSGSNDGNVGRPKKHAWNKPLNGVVEAVTVMGGALSWPALSESTRPGPKS  152

Query  1593  ATYDPLKTPSDGSVPPPQGTGIA  1525
             +  D  K   DGS    QG  I+
Sbjct  153   SA-DSSKPIPDGSTSVSQGPIIS  174



>ref|XP_011003070.1| PREDICTED: la-related protein 1B-like [Populus euphratica]
Length=503

 Score =   117 bits (294),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = -1

Query  828  NQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIE  649
            NQIEYYFS+ NL  D +L+ +MDD+GWVP+ LIA F +V ++T++IQ IL  +RTST++E
Sbjct  360  NQIEYYFSDLNLSNDGFLKSKMDDEGWVPITLIAGFNRVRIMTNNIQFILECLRTSTLLE  419

Query  648  VQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANE  484
            VQ +K+R RNDW  W+   ++  +    QS+    SD L+  FQ ++++D  A++
Sbjct  420  VQDDKVRRRNDWMNWLPSSTMPRTDLGFQSSGVSSSDTLTTSFQKISMEDVAADQ  474


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 67/119 (56%), Gaps = 6/119 (5%)
 Frame = -1

Query  1773  LLQDAATEAQPESFENSDSGNNAVKKPAWNKP--NGSTE-AGPVMGAVSWPALSESTKAS  1603
             +L+ +   A  ES ++        KKPAWNKP  NG  E   PVM A SWPALSESTK S
Sbjct  45    MLEQSNDWAAIESSDSKKGNAGKAKKPAWNKPTSNGVAEITSPVMDATSWPALSESTKPS  104

Query  1602  PK-SATYDPLKTPSDGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNKR  1429
             PK S      K  SDGS+P  QG  IA  +SPK    +N  + +ST + +P RQR  +R
Sbjct  105   PKPSPAESSSKIVSDGSIPTSQGPMIA--NSPKKQSNSNAKSISSTNHTMPVRQRPVRR  161



>tpg|DAA43433.1| TPA: hypothetical protein ZEAMMB73_264797 [Zea mays]
Length=417

 Score =   116 bits (290),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 110/189 (58%), Gaps = 15/189 (8%)
 Frame = -1

Query  981  GSPLVYPEVHP-MYYVPGPHPDSLV-MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYF  808
            G+P+ +P++ P +YY   P  + +  +P ++ P     V    +DP     +++QIEYYF
Sbjct  199  GTPMGFPDMAPQVYYYAAPTSEGIQGLPFMSHPASPQAVL---IDPFR-KGLLDQIEYYF  254

Query  807  SNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLR  628
            S+ NL KD+YLR+ MDDQGWVP+ LIA F +V  +T++IQ IL  +  S ++EVQG+KLR
Sbjct  255  SDANLCKDLYLRQRMDDQGWVPLPLIAGFPQVQKITNNIQFILETVMLSNVVEVQGDKLR  314

Query  627  VRNDWKKWIVPPSVQYSISSPQSARSPGS---DVLSQHFQGVTLDDNNANEHER---GNA  466
             R  W+ W++ P   YS  S   +  P +   D L+  F+ V L+   A  H      + 
Sbjct  315  RRGAWENWLL-PKQNYSAGSSSGSLPPVTSNIDSLTSQFRFVGLE--GATYHATMPVMHG  371

Query  465  EAHLNRSSS  439
            EA L RS++
Sbjct  372  EALLTRSAT  380



>ref|XP_008651177.1| PREDICTED: la-related protein 1B-like isoform X2 [Zea mays]
Length=472

 Score =   116 bits (290),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 110/189 (58%), Gaps = 15/189 (8%)
 Frame = -1

Query  981  GSPLVYPEVHP-MYYVPGPHPDSLV-MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYF  808
            G+P+ +P++ P +YY   P  + +  +P ++ P     V    +DP     +++QIEYYF
Sbjct  254  GTPMGFPDMAPQVYYYAAPTSEGIQGLPFMSHPASPQAVL---IDPFR-KGLLDQIEYYF  309

Query  807  SNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLR  628
            S+ NL KD+YLR+ MDDQGWVP+ LIA F +V  +T++IQ IL  +  S ++EVQG+KLR
Sbjct  310  SDANLCKDLYLRQRMDDQGWVPLPLIAGFPQVQKITNNIQFILETVMLSNVVEVQGDKLR  369

Query  627  VRNDWKKWIVPPSVQYSISSPQSARSPGS---DVLSQHFQGVTLDDNNANEHER---GNA  466
             R  W+ W++ P   YS  S   +  P +   D L+  F+ V L+   A  H      + 
Sbjct  370  RRGAWENWLL-PKQNYSAGSSSGSLPPVTSNIDSLTSQFRFVGLE--GATYHATMPVMHG  426

Query  465  EAHLNRSSS  439
            EA L RS++
Sbjct  427  EALLTRSAT  435



>ref|XP_002468481.1| hypothetical protein SORBIDRAFT_01g046660 [Sorghum bicolor]
 gb|EER95479.1| hypothetical protein SORBIDRAFT_01g046660 [Sorghum bicolor]
Length=470

 Score =   114 bits (286),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 107/187 (57%), Gaps = 12/187 (6%)
 Frame = -1

Query  981  GSPLVYPEVHP-MYYVPGPHPDSLV-MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYF  808
            G+P+ +P++ P +YY   P  + +  +P +    P   +   F   LL      QIEYYF
Sbjct  253  GAPMGFPDIAPHVYYFAAPTSEGIQGLPFVHPASPQAVLIDPFRKGLL-----EQIEYYF  307

Query  807  SNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLR  628
            S+ NL KD+YLR+ MDDQGWVP+ LIA F +V  +T++IQ IL  +  S ++EVQG+KLR
Sbjct  308  SDANLCKDLYLRQRMDDQGWVPLSLIAGFPQVQKITNNIQFILETVMLSNVVEVQGDKLR  367

Query  627  VRNDWKKWIVPPSVQYSISSPQSARSPGS---DVLSQHFQGVTLDDNNANEHERG-NAEA  460
             R  W+ W++ P   YS  S   + SP +   D L+  F+ V  +    + +  G + EA
Sbjct  368  RRGAWENWLL-PKQNYSAGSSSGSLSPVTSNIDSLASQFRSVGFEGATYHANMPGMHGEA  426

Query  459  HLNRSSS  439
             L RS++
Sbjct  427  LLTRSAT  433



>dbj|BAB10415.1| unnamed protein product [Arabidopsis thaliana]
Length=431

 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/224 (33%), Positives = 116/224 (52%), Gaps = 34/224 (15%)
 Frame = -1

Query  1152  HGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpp------psppfipplmpm  991
             HG  R+ E GNQ   ++R++  RD HLQP R       ++         S         +
Sbjct  230   HGNRRNYEHGNQSGFSHRNYSGRDMHLQPQRGVGMIRPQMLMGPPSFPASSAQYMAAPQL  289

Query  990   rpLGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYY  811
                G P++YP+     ++P P PD + +                + P  L  I       
Sbjct  290   GSYGGPIIYPDYAQHVFMPHPSPDPMGL----------------VGPFPLQPIA------  327

Query  810   FSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKL  631
                DNL +D +LR +M+D+GWVPVR+IA F+++A LT++IQ IL A+R+S ++E+QGE L
Sbjct  328   ---DNLSRDEHLRDQMNDEGWVPVRVIAAFRRLAELTNNIQTILEALRSSEVVEIQGETL  384

Query  630   RVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDD  499
             R R DW K+++P   + S S P +  S  + ++SQ  + +TL +
Sbjct  385   RRRGDWDKYLLP--REPSRSGPAAGASNNASLVSQ-IESMTLSE  425



>ref|XP_002299786.2| hypothetical protein POPTR_0001s22740g [Populus trichocarpa]
 gb|EEE84591.2| hypothetical protein POPTR_0001s22740g [Populus trichocarpa]
Length=700

 Score =   114 bits (285),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 81/144 (56%), Gaps = 19/144 (13%)
 Frame = -1

Query  981  GSPLVYPEVHPMYYVPGPHPDSLV-------MPMLASpppgpPVFYQFLDPLLLSKIVNQ  823
            G P+ Y  V     + GPHP   V        PML                 L + I+ Q
Sbjct  267  GPPICYIPVASPGSLRGPHPPRFVPYPINPGAPMLPQEIQT-----------LRASIIRQ  315

Query  822  IEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQ  643
            IEYYFS++NL+ D YL   MDDQGWVP+  IA FK+V  +T DI LIL A+++S  IEVQ
Sbjct  316  IEYYFSDENLLNDHYLISLMDDQGWVPISTIAEFKRVKKMTTDISLILDALQSSGSIEVQ  375

Query  642  GEKLRVRNDWKKWIVPPSVQYSIS  571
            GEK+R R+ W KWI P S Q ++S
Sbjct  376  GEKIRKRDYWSKWI-PASSQQAMS  398



>ref|XP_004980963.1| PREDICTED: transcription activator BRG1-like [Setaria italica]
Length=467

 Score =   112 bits (280),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = -1

Query  840  SKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTS  661
            +K++NQIE+YFS +NL  D+YLR++MD QGWV + LIA FKKV  LT+D+Q +   +++S
Sbjct  318  AKLLNQIEFYFSKENLCSDVYLRQQMDGQGWVDISLIAGFKKVLELTNDLQYVKETVKSS  377

Query  660  TMIEVQGEKLRVRNDWKKWIVPPSVQYSI-SSPQSARSPGSDVLSQHFQGVTLDD  499
            +++E+QG+K+R +NDW+KW++P      I SS  S   P  + L+    G+ L +
Sbjct  378  SILEMQGDKIRKQNDWEKWVIPRESNPDIPSSSASVPRPNVNHLAARLGGMGLHE  432



>ref|XP_006652050.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3-like [Oryza brachyantha]
Length=393

 Score =   111 bits (277),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 79/116 (68%), Gaps = 7/116 (6%)
 Frame = -1

Query  840  SKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTS  661
            + ++ QIE+YFS DNL  D+YLR+ MDDQGWV + LIA FKKV   T D+Q I   +++S
Sbjct  243  ANLLKQIEFYFSKDNLCTDVYLRRNMDDQGWVHIALIAGFKKVKESTGDLQYIKDTIQSS  302

Query  660  TMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDV--LSQHFQGVTLDD  499
            +++E+QG+K+R +NDW KW++P       S P S+ +P  ++  L++H  G+ L +
Sbjct  303  SILEMQGDKIRRQNDWNKWVIP-----RESKPGSSTAPNPNINNLTEHLGGMGLQE  353



>ref|XP_006836151.1| hypothetical protein AMTR_s00101p00028940 [Amborella trichopoda]
 gb|ERM99004.1| hypothetical protein AMTR_s00101p00028940 [Amborella trichopoda]
Length=1032

 Score =   114 bits (286),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 85/148 (57%), Gaps = 5/148 (3%)
 Frame = -1

Query  951  PMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDP---LLLSKIVNQIEYYFSNDNLIKDM  781
            PMY++  P PD +  P     P  P V    L P    L + +V QIEYYFS DNL +D 
Sbjct  331  PMYFLHAPPPDPMRAPRYFPHPTPPGVV--MLAPETHQLRANVVKQIEYYFSVDNLCRDF  388

Query  780  YLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWI  601
            +LR +MDDQGWVP+ +IA F +V  +T +I  IL A+R S  +E+QG+K+R R+D   W 
Sbjct  389  FLRSKMDDQGWVPISIIANFNRVKKMTTNIPFILDALRNSDEVELQGDKIRKRHDGPSWH  448

Query  600  VPPSVQYSISSPQSARSPGSDVLSQHFQ  517
            +PP    SI S  + + P     + H +
Sbjct  449  LPPDHCKSILSNYAPQGPVDGKAADHLK  476



>ref|XP_010484684.1| PREDICTED: la-related protein 1B-like [Camelina sativa]
Length=346

 Score =   110 bits (276),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -1

Query  873  VFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDD  694
            ++    D +L +KI+ Q+EY FS DNL +D +LR +M+D+GWVPVR+IA F+++A LT++
Sbjct  213  LYLSSFDAILYNKILTQVEYCFSADNLSRDKHLRDQMNDEGWVPVRVIAGFRRLAELTNN  272

Query  693  IQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVP  595
            IQ IL A+++S ++E++GE LR R DW K+ +P
Sbjct  273  IQTILEALKSSQVVEIKGETLRRRGDWDKYRLP  305



>ref|XP_010229179.1| PREDICTED: la-related protein 1B-like isoform X2 [Brachypodium 
distachyon]
Length=481

 Score =   112 bits (279),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 111/198 (56%), Gaps = 19/198 (10%)
 Frame = -1

Query  981  GSPLVYPEVHP-MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPL--LLSKIVNQIEYY  811
            G P+ +PE+ P +YY   P  D L   +   PPP  P     + P   L  +++ QIEYY
Sbjct  249  GPPMSFPEMAPHVYYFAVPPSDGLQA-LPFVPPPPTPPPAMLISPFEHLQRQLLVQIEYY  307

Query  810  FSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVA----------VLTDDIQLILHAMRTS  661
            FS++NL KD+YLR+ MDDQGWVP+ LIA F +V            LT+ +Q IL  +R S
Sbjct  308  FSDENLCKDIYLRQHMDDQGWVPISLIACFNQVKNFLYRIAQVRKLTNTLQFILDTVRQS  367

Query  660  TMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGS---DVLSQHFQGVTLDDNNA  490
             ++EVQG+K+R R  W+ W++P S  YS  +   + SP +   D L   FQ V L+    
Sbjct  368  LVVEVQGDKIRRRARWEIWLLPRS-NYSAGNTSGSLSPVTSNIDSLVSQFQSVGLEGTAY  426

Query  489  NEHERG-NAEAHLNRSSS  439
            + + +   ++A L RS++
Sbjct  427  HPNMQAMPSQAFLARSAT  444



>ref|XP_008651176.1| PREDICTED: la-related protein 1C-like isoform X1 [Zea mays]
Length=473

 Score =   111 bits (278),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 110/190 (58%), Gaps = 16/190 (8%)
 Frame = -1

Query  981  GSPLVYP-EVHP-MYYVPGPHPDSLV-MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYY  811
            G+P+ +P ++ P +YY   P  + +  +P ++ P     V    +DP     +++QIEYY
Sbjct  254  GTPMGFPADMAPQVYYYAAPTSEGIQGLPFMSHPASPQAVL---IDPFR-KGLLDQIEYY  309

Query  810  FSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKL  631
            FS+ NL KD+YLR+ MDDQGWVP+ LIA F +V  +T++IQ IL  +  S ++EVQG+KL
Sbjct  310  FSDANLCKDLYLRQRMDDQGWVPLPLIAGFPQVQKITNNIQFILETVMLSNVVEVQGDKL  369

Query  630  RVRNDWKKWIVPPSVQYSISSPQSARSPGS---DVLSQHFQGVTLDDNNANEHER---GN  469
            R R  W+ W++ P   YS  S   +  P +   D L+  F+ V L+   A  H      +
Sbjct  370  RRRGAWENWLL-PKQNYSAGSSSGSLPPVTSNIDSLTSQFRFVGLE--GATYHATMPVMH  426

Query  468  AEAHLNRSSS  439
             EA L RS++
Sbjct  427  GEALLTRSAT  436



>ref|XP_011006050.1| PREDICTED: la-related protein 1A isoform X1 [Populus euphratica]
Length=889

 Score =   113 bits (283),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 87/166 (52%), Gaps = 19/166 (11%)
 Frame = -1

Query  981  GSPLVYPEVHPMYYVPGPHPDSLV-------MPMLASpppgpPVFYQFLDPLLLSKIVNQ  823
            G P+ Y  V P   + GPHP   V        PML                 L + I+ Q
Sbjct  267  GPPICYIPVAPPGSLRGPHPPRFVPYPINPGAPMLPQEIQT-----------LKASIIRQ  315

Query  822  IEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQ  643
            IEYYFS++NL KD YL   MDDQGWVP+  IA F +V  +  DI LIL A+++S +IEVQ
Sbjct  316  IEYYFSDENLSKDHYLISLMDDQGWVPISTIAEFNRVKKMMTDISLILDALQSSGLIEVQ  375

Query  642  GEKLRVRNDWKKWIVPPSVQ-YSISSPQSARSPGSDVLSQHFQGVT  508
            GEK+R R+ W KWI   S Q  S+ +  S   PG +       G++
Sbjct  376  GEKIRKRDYWSKWIPAASQQAMSLKAQTSEGQPGKNAEEDSTSGLS  421



>ref|XP_011006051.1| PREDICTED: la-related protein 1A isoform X2 [Populus euphratica]
Length=817

 Score =   113 bits (282),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 87/166 (52%), Gaps = 19/166 (11%)
 Frame = -1

Query  981  GSPLVYPEVHPMYYVPGPHPDSLV-------MPMLASpppgpPVFYQFLDPLLLSKIVNQ  823
            G P+ Y  V P   + GPHP   V        PML                 L + I+ Q
Sbjct  195  GPPICYIPVAPPGSLRGPHPPRFVPYPINPGAPMLPQEIQT-----------LKASIIRQ  243

Query  822  IEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQ  643
            IEYYFS++NL KD YL   MDDQGWVP+  IA F +V  +  DI LIL A+++S +IEVQ
Sbjct  244  IEYYFSDENLSKDHYLISLMDDQGWVPISTIAEFNRVKKMMTDISLILDALQSSGLIEVQ  303

Query  642  GEKLRVRNDWKKWIVPPSVQ-YSISSPQSARSPGSDVLSQHFQGVT  508
            GEK+R R+ W KWI   S Q  S+ +  S   PG +       G++
Sbjct  304  GEKIRKRDYWSKWIPAASQQAMSLKAQTSEGQPGKNAEEDSTSGLS  349



>ref|XP_002299785.2| hypothetical protein POPTR_0001s22740g [Populus trichocarpa]
 gb|EEE84590.2| hypothetical protein POPTR_0001s22740g [Populus trichocarpa]
Length=889

 Score =   112 bits (281),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 81/144 (56%), Gaps = 19/144 (13%)
 Frame = -1

Query  981  GSPLVYPEVHPMYYVPGPHPDSLV-------MPMLASpppgpPVFYQFLDPLLLSKIVNQ  823
            G P+ Y  V     + GPHP   V        PML                 L + I+ Q
Sbjct  267  GPPICYIPVASPGSLRGPHPPRFVPYPINPGAPMLPQEIQT-----------LRASIIRQ  315

Query  822  IEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQ  643
            IEYYFS++NL+ D YL   MDDQGWVP+  IA FK+V  +T DI LIL A+++S  IEVQ
Sbjct  316  IEYYFSDENLLNDHYLISLMDDQGWVPISTIAEFKRVKKMTTDISLILDALQSSGSIEVQ  375

Query  642  GEKLRVRNDWKKWIVPPSVQYSIS  571
            GEK+R R+ W KWI P S Q ++S
Sbjct  376  GEKIRKRDYWSKWI-PASSQQAMS  398



>gb|KHG10712.1| La-related 1 [Gossypium arboreum]
Length=923

 Score =   112 bits (279),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 78/121 (64%), Gaps = 2/121 (2%)
 Frame = -1

Query  846  LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
            L + IV QIEYYFS++NL  D YL   MDDQGWVPV  IA FK+V  ++ DIQ IL A++
Sbjct  301  LRANIVKQIEYYFSDENLQNDHYLISLMDDQGWVPVSTIADFKRVKRMSTDIQFILDALQ  360

Query  666  TSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNAN  487
            +S+ +EVQG+K+R R++W KWI   S   S  +P +   P  +V      G  L+++N+ 
Sbjct  361  SSSTVEVQGDKIRRRDEWSKWIPVGSTTLSSEAPATQYQPKENVTDSC--GNYLNEDNSK  418

Query  486  E  484
            +
Sbjct  419  D  419



>ref|XP_002272083.3| PREDICTED: la-related protein 1A [Vitis vinifera]
Length=953

 Score =   111 bits (277),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 98/169 (58%), Gaps = 13/169 (8%)
 Frame = -1

Query  972  LVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNL  793
            L Y    P   + GPHP   + P L+   P PP   Q     L + IV QIEYYFS+ NL
Sbjct  279  LYYHPPAPTGSIRGPHP-RFIPPSLSPGAPIPPSETQ----ALRANIVKQIEYYFSDGNL  333

Query  792  IKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDW  613
              D YL   MDDQGWVP+ +IA FK+V  ++ D+Q IL A+++ST +EVQ +++R R++W
Sbjct  334  QNDHYLISLMDDQGWVPISIIADFKRVKKMSTDLQFILDALQSSTTVEVQCDRIRRRDEW  393

Query  612  KKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANEHERGNA  466
             +WI P S+++ +  P  A SP   V+ +     T+ D+  NE  + N 
Sbjct  394  SRWI-PASIEHGL--PLKANSPQDRVVEK-----TVIDHENNESNKDNT  434



>ref|XP_007016697.1| Lupus la ribonucleoprotein, putative isoform 4 [Theobroma cacao]
 gb|EOY34316.1| Lupus la ribonucleoprotein, putative isoform 4 [Theobroma cacao]
Length=756

 Score =   110 bits (275),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 81/136 (60%), Gaps = 7/136 (5%)
 Frame = -1

Query  972  LVYPEVHPMYYVPGPHPDSLV-MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDN  796
            + Y  + P   + GPHP   V  P+           Y      L + IV QIEYYFS++N
Sbjct  256  VCYMPIPPPGSIRGPHPPRFVPYPI-----NPGTAMYPPETATLRANIVKQIEYYFSDEN  310

Query  795  LIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRND  616
            L  D YL   MDDQGWVP+  IA FK+V  ++ DI+ IL A+ +S+ +EVQG+K+R R++
Sbjct  311  LQTDHYLISLMDDQGWVPISAIADFKRVKRMSTDIKFILDALLSSSTVEVQGDKIRRRDE  370

Query  615  WKKWIVPPSVQYSISS  568
            W KWI P S + S+SS
Sbjct  371  WSKWI-PASSKTSLSS  385



>emb|CAN73529.1| hypothetical protein VITISV_006639 [Vitis vinifera]
Length=662

 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 98/169 (58%), Gaps = 13/169 (8%)
 Frame = -1

Query  972  LVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNL  793
            L Y    P   + GPHP   + P L+   P PP   Q     L + IV QIEYYFS+ NL
Sbjct  356  LYYHPPAPTGSIRGPHP-RFIPPSLSPGAPIPPSETQ----ALRANIVKQIEYYFSDGNL  410

Query  792  IKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDW  613
              D YL   MDDQGWVP+ +IA FK+V  ++ D+Q IL A+++ST +EVQ +++R R++W
Sbjct  411  QNDHYLISLMDDQGWVPISIIADFKRVKKMSTDLQFILDALQSSTTVEVQCDRIRRRDEW  470

Query  612  KKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANEHERGNA  466
             +WI P S+++ +  P  A SP   V+ +     T+ D+  NE  + N 
Sbjct  471  SRWI-PASIEHGL--PLKANSPQDRVVEK-----TVIDHENNESNKDNT  511



>ref|XP_009126508.1| PREDICTED: la-related protein 1A-like [Brassica rapa]
Length=814

 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 80/121 (66%), Gaps = 7/121 (6%)
 Frame = -1

Query  948  MYYVPGPHPDSL--VMPMLASpppgpPVFYQFLDPL---LLSKIVNQIEYYFSNDNLIKD  784
            +YY+PGP P ++    P     P       Q L P    L  +++ QIEYYFS++NL  D
Sbjct  235  VYYLPGPPPGAIRGYPPRFGPYPGNQGP--QALSPEQLDLKDRVIKQIEYYFSDENLQND  292

Query  783  MYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKW  604
             YL   MD+QGWVP+++IA FK+V ++T D++ I++A+R ST +EVQG+K+R R++W KW
Sbjct  293  QYLISLMDEQGWVPIKIIADFKRVKMMTMDVEFIVYALRFSTSVEVQGDKIRKRDEWSKW  352

Query  603  I  601
            +
Sbjct  353  V  353



>ref|XP_002313496.2| hypothetical protein POPTR_0009s02330g [Populus trichocarpa]
 gb|EEE87451.2| hypothetical protein POPTR_0009s02330g [Populus trichocarpa]
Length=910

 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 82/151 (54%), Gaps = 20/151 (13%)
 Frame = -1

Query  975  PLVYPEVHPMYYVPGPHPDSLV-------MPMLASpppgpPVFYQFLDPLLLSKIVNQIE  817
            P+ Y  V P   + GP P   V        P+L                 L + I  QIE
Sbjct  272  PICYVSVAPPGSLRGPQPSCFVPYPINSGAPVLPQETLA-----------LRASIAGQIE  320

Query  816  YYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGE  637
            YYFS++NL  D YL   MDDQGWVPV  IA FK+V  +T DI  IL A++ S  IEVQG+
Sbjct  321  YYFSDENLQNDHYLISLMDDQGWVPVSTIAEFKRVKKMTLDISFILDALQCSGSIEVQGD  380

Query  636  KLRVRNDWKKWIVPPSVQYSISSPQSARSPG  544
            K+R R+DW KWI P S Q ++ SP++  S G
Sbjct  381  KVRKRDDWSKWI-PASSQQAV-SPKAQTSEG  409



>ref|XP_010229178.1| PREDICTED: la-related protein 1B-like isoform X1 [Brachypodium 
distachyon]
Length=482

 Score =   108 bits (269),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 90/150 (60%), Gaps = 15/150 (10%)
 Frame = -1

Query  846  LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVA----------VLTD  697
            L  +++ QIEYYFS++NL KD+YLR+ MDDQGWVP+ LIA F +V            LT+
Sbjct  297  LQRQLLVQIEYYFSDENLCKDIYLRQHMDDQGWVPISLIACFNQVKNFLYRIAQVRKLTN  356

Query  696  DIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGS---DVLSQ  526
             +Q IL  +R S ++EVQG+K+R R  W+ W++P S  YS  +   + SP +   D L  
Sbjct  357  TLQFILDTVRQSLVVEVQGDKIRRRARWEIWLLPRS-NYSAGNTSGSLSPVTSNIDSLVS  415

Query  525  HFQGVTLDDNNANEHERG-NAEAHLNRSSS  439
             FQ V L+    + + +   ++A L RS++
Sbjct  416  QFQSVGLEGTAYHPNMQAMPSQAFLARSAT  445



>ref|NP_001146038.1| uncharacterized protein LOC100279569 [Zea mays]
 gb|ACL53078.1| unknown [Zea mays]
 gb|AFW66908.1| hypothetical protein ZEAMMB73_904616 [Zea mays]
Length=449

 Score =   107 bits (267),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 76/116 (66%), Gaps = 3/116 (3%)
 Frame = -1

Query  837  KIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTST  658
            K++ QIE+YFS +NL  D+YLR++MDDQGWV + LIA FKKV  L  D+Q I   +++S+
Sbjct  299  KLLKQIEFYFSKENLCSDVYLRQQMDDQGWVDISLIAGFKKVQGLKKDLQYIKETVQSSS  358

Query  657  MIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDV--LSQHFQGVTLDDN  496
            ++E++  K+R  +DW KW++P      + S  SA  P  DV  L+ H  G+ L D+
Sbjct  359  ILEMKDNKIRKHDDWVKWVIPRESNPDVPS-SSASVPRPDVNNLTAHLGGMDLQDS  413



>ref|XP_010229180.1| PREDICTED: la-related protein 1B-like isoform X3 [Brachypodium 
distachyon]
Length=463

 Score =   107 bits (268),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 90/150 (60%), Gaps = 15/150 (10%)
 Frame = -1

Query  846  LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVA----------VLTD  697
            L  +++ QIEYYFS++NL KD+YLR+ MDDQGWVP+ LIA F +V            LT+
Sbjct  278  LQRQLLVQIEYYFSDENLCKDIYLRQHMDDQGWVPISLIACFNQVKNFLYRIAQVRKLTN  337

Query  696  DIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGS---DVLSQ  526
             +Q IL  +R S ++EVQG+K+R R  W+ W++P S  YS  +   + SP +   D L  
Sbjct  338  TLQFILDTVRQSLVVEVQGDKIRRRARWEIWLLPRS-NYSAGNTSGSLSPVTSNIDSLVS  396

Query  525  HFQGVTLDDNNANEHERG-NAEAHLNRSSS  439
             FQ V L+    + + +   ++A L RS++
Sbjct  397  QFQSVGLEGTAYHPNMQAMPSQAFLARSAT  426



>ref|XP_007016695.1| Lupus la ribonucleoprotein, putative isoform 2 [Theobroma cacao]
 gb|EOY34314.1| Lupus la ribonucleoprotein, putative isoform 2 [Theobroma cacao]
Length=777

 Score =   109 bits (273),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 81/136 (60%), Gaps = 7/136 (5%)
 Frame = -1

Query  972  LVYPEVHPMYYVPGPHPDSLV-MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDN  796
            + Y  + P   + GPHP   V  P+           Y      L + IV QIEYYFS++N
Sbjct  256  VCYMPIPPPGSIRGPHPPRFVPYPI-----NPGTAMYPPETATLRANIVKQIEYYFSDEN  310

Query  795  LIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRND  616
            L  D YL   MDDQGWVP+  IA FK+V  ++ DI+ IL A+ +S+ +EVQG+K+R R++
Sbjct  311  LQTDHYLISLMDDQGWVPISAIADFKRVKRMSTDIKFILDALLSSSTVEVQGDKIRRRDE  370

Query  615  WKKWIVPPSVQYSISS  568
            W KWI P S + S+SS
Sbjct  371  WSKWI-PASSKTSLSS  385



>ref|XP_007016696.1| Lupus la ribonucleoprotein, putative isoform 3 [Theobroma cacao]
 gb|EOY34315.1| Lupus la ribonucleoprotein, putative isoform 3 [Theobroma cacao]
Length=893

 Score =   109 bits (272),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 81/136 (60%), Gaps = 7/136 (5%)
 Frame = -1

Query  972  LVYPEVHPMYYVPGPHPDSLV-MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDN  796
            + Y  + P   + GPHP   V  P+           Y      L + IV QIEYYFS++N
Sbjct  256  VCYMPIPPPGSIRGPHPPRFVPYPI-----NPGTAMYPPETATLRANIVKQIEYYFSDEN  310

Query  795  LIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRND  616
            L  D YL   MDDQGWVP+  IA FK+V  ++ DI+ IL A+ +S+ +EVQG+K+R R++
Sbjct  311  LQTDHYLISLMDDQGWVPISAIADFKRVKRMSTDIKFILDALLSSSTVEVQGDKIRRRDE  370

Query  615  WKKWIVPPSVQYSISS  568
            W KWI P S + S+SS
Sbjct  371  WSKWI-PASSKTSLSS  385



>gb|KEH40236.1| LA-related protein 6 LA RNA-binding domain protein [Medicago 
truncatula]
Length=518

 Score =   107 bits (268),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 181/386 (47%), Gaps = 73/386 (19%)
 Frame = -1

Query  1701  KKPAWNKP--NG-STEAGPVMGAVSWPALSESTKAS---PKSATYDPLKTPS--DGSVPP  1546
             KKPAWNK   NG + E GPVMGA SWPALSES K     P  ++   +  P+  DGS   
Sbjct  130   KKPAWNKQPLNGVAVEIGPVMGAESWPALSESAKIPGKLPPESSSSKIAPPAAVDGSPST  189

Query  1545  PQGTGIAPSSSP-KpvhtnntttpnstpnhvPARQRSNKRAGGGN----SSNTALANGsv  1381
              QG  I  S SP +   T+NT + +   N++P R R  +R  G N     + ++L+N   
Sbjct  190   SQGPII--SHSPQRQGSTSNTKSSSMANNNLPNRPRPMRRISGSNIGPCPAQSSLSNPPT  247

Query  1380  sqpqqlqslvVEMAPNSAGKPGVEPYSRDNVHRD-------------GG--QRGGFGSQS  1246
               P     +     P +   P + P   D+  RD             GG  +RG FGS  
Sbjct  248   PPPLPPYPVY--QLPPAVSYPNMLPSIPDSSPRDHHRNNNWDARPFVGGSSRRGHFGSHP  305

Query  1245  IGGNENQYTrssprkgngrprprgdgSYH-HAHGGARDQERGNQEWNANRSFGSRDAHLQ  1069
              G                         YH +++   R+ +RGN          +RDAH  
Sbjct  306   RGDGS----------------------YHQNSYSSRREHDRGNYA-------NTRDAHAP  336

Query  1068  plrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMYYVPGPHPDSL----VMPM  901
               R+P R  LR PPPS         + P  +P+ YP+    YY P    D      V P 
Sbjct  337   QPRMPPRGILRPPPPSTAAFLGPQTIGPFPAPVAYPD---FYYFPTVPLDPFRGMPVFPH  393

Query  900   LASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATF  721
             + SP      F+   +  L + IVNQI+YYFS+ NL  D +L+  MD++GWVP+ LIA F
Sbjct  394   MPSPA----TFFPAAESSLSNVIVNQIDYYFSDINLANDEFLKSNMDEEGWVPITLIANF  449

Query  720   KKVAVLTDDIQLILHAMRTSTMIEVQ  643
              +V  LT +IQLIL +MR S +++VQ
Sbjct  450   PRVKNLTSNIQLILDSMRNSNVVDVQ  475



>ref|XP_007016694.1| Lupus la ribonucleoprotein, putative isoform 1 [Theobroma cacao]
 gb|EOY34313.1| Lupus la ribonucleoprotein, putative isoform 1 [Theobroma cacao]
Length=858

 Score =   108 bits (271),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 81/136 (60%), Gaps = 7/136 (5%)
 Frame = -1

Query  972  LVYPEVHPMYYVPGPHPDSLV-MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDN  796
            + Y  + P   + GPHP   V  P+           Y      L + IV QIEYYFS++N
Sbjct  256  VCYMPIPPPGSIRGPHPPRFVPYPI-----NPGTAMYPPETATLRANIVKQIEYYFSDEN  310

Query  795  LIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRND  616
            L  D YL   MDDQGWVP+  IA FK+V  ++ DI+ IL A+ +S+ +EVQG+K+R R++
Sbjct  311  LQTDHYLISLMDDQGWVPISAIADFKRVKRMSTDIKFILDALLSSSTVEVQGDKIRRRDE  370

Query  615  WKKWIVPPSVQYSISS  568
            W KWI P S + S+SS
Sbjct  371  WSKWI-PASSKTSLSS  385



>ref|XP_006446392.1| hypothetical protein CICLE_v10014180mg [Citrus clementina]
 gb|ESR59632.1| hypothetical protein CICLE_v10014180mg [Citrus clementina]
Length=740

 Score =   108 bits (270),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 88/158 (56%), Gaps = 25/158 (16%)
 Frame = -1

Query  981  GSPLVYPEVHPMYYVPGPHPD-------SLVMPMLASpppgpPVFYQFLDPLLLSKIVNQ  823
            G+ L Y  V P   + GPHP        +L  PML                 L + IV Q
Sbjct  258  GAALCYVPVVPPGSIRGPHPQRFFPYPVNLGAPMLPPETLA-----------LKANIVKQ  306

Query  822  IEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQ  643
            IEYYFS++NL  D YL   MD QGWVP+ +IA FK+V  ++ D+  IL A++ S+ +E Q
Sbjct  307  IEYYFSDENLQNDHYLISLMDAQGWVPIAIIADFKRVKRMSTDLPFILDALQNSSTVEAQ  366

Query  642  GEKLRVRNDWKKWIVPPSVQYSISSP------QSARSP  547
            G+K+R R++W KWI P SV+ ++SS       QSA +P
Sbjct  367  GDKVRRRDEWSKWI-PASVEQTMSSTAQTSQSQSAENP  403



>ref|XP_010270255.1| PREDICTED: la-related protein 1B-like [Nelumbo nucifera]
Length=502

 Score =   107 bits (266),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -1

Query  855  DPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILH  676
            D  L +KI  QIEYYFS +NL+ D YLR EM+ +GWV + LIA F++V  +T+DI LI+ 
Sbjct  357  DVELCTKIQKQIEYYFSEENLVNDFYLRGEMNGEGWVSINLIAGFRRVKAMTNDIGLIVR  416

Query  675  AMRTSTMIEVQGEKLRVRNDWKKWIVP  595
            ++  ST++EV+ +K+R R DW  WI+P
Sbjct  417  SLTASTVVEVKDDKVRRRGDWSTWILP  443



>ref|XP_011003847.1| PREDICTED: la-related protein 1A-like isoform X1 [Populus euphratica]
Length=468

 Score =   106 bits (265),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 78/135 (58%), Gaps = 5/135 (4%)
 Frame = -1

Query  975  PLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDN  796
            P+ Y  V P   + GP P   V   + S      V  Q    L  S I  QIEYYFS++N
Sbjct  271  PICYVSVAPPGSLRGPQPSCFVPYPINSGAS---VLPQETIALRAS-IAGQIEYYFSDEN  326

Query  795  LIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRND  616
            L  D YL   MDDQGWVPV  IA FK+V  +T DI  IL A++ S  IEV+G+K+R R++
Sbjct  327  LKNDHYLISLMDDQGWVPVSTIAEFKRVKKMTVDISFILDALKCSGSIEVKGDKVRKRDN  386

Query  615  WKKWIVPPSVQYSIS  571
            W KWI P S Q ++S
Sbjct  387  WSKWI-PASSQQAVS  400



>ref|XP_010943274.1| PREDICTED: la-related protein 1A-like isoform X5 [Elaeis guineensis]
Length=905

 Score =   108 bits (270),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 86/138 (62%), Gaps = 5/138 (4%)
 Frame = -1

Query  948  MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPL-LLSKIVNQIEYYFSNDNLIKDMYLR  772
            MYYVP    + +  P   S PP PP      +PL L + IV QIEYYFS++NL KD YL 
Sbjct  313  MYYVPAAPLEMVRGPRFFSHPPPPPYPVLTQEPLDLRANIVKQIEYYFSDENLQKDHYLI  372

Query  771  KEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPP  592
              +D+QGWV +  IA F +V  +T +I LIL A+ +S +IEV+ +K+R RNDW KWI P 
Sbjct  373  SLLDEQGWVSISKIADFNRVRKMTTNISLILDALWSSELIEVEDDKIRRRNDWSKWI-PA  431

Query  591  SVQYSI---SSPQSARSP  547
            S Q+++   S P   +SP
Sbjct  432  SSQHAVLTKSQPTEGQSP  449



>gb|KDO66353.1| hypothetical protein CISIN_1g008506mg [Citrus sinensis]
Length=437

 Score =   105 bits (263),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 81/145 (56%), Gaps = 19/145 (13%)
 Frame = -1

Query  981  GSPLVYPEVHPMYYVPGPHPDSLV-------MPMLASpppgpPVFYQFLDPLLLSKIVNQ  823
            G+ L Y  V P   + GPHP            PML                 L + IV Q
Sbjct  132  GAALCYVPVVPPGSIRGPHPQRFFPYPVNSGAPMLPPETLA-----------LKANIVKQ  180

Query  822  IEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQ  643
            IEYYFS++NL  D YL   MD QGWVP+ +IA FK+V  ++ D+  IL A++ S+ +E Q
Sbjct  181  IEYYFSDENLQNDHYLISLMDAQGWVPIAIIADFKRVKRMSTDLPFILDALQNSSTVEAQ  240

Query  642  GEKLRVRNDWKKWIVPPSVQYSISS  568
            G+K+R R++W KWI P SV+ ++SS
Sbjct  241  GDKVRRRDEWSKWI-PASVEQTMSS  264



>ref|XP_011003848.1| PREDICTED: la-related protein 1A-like isoform X2 [Populus euphratica]
Length=458

 Score =   106 bits (264),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 99/184 (54%), Gaps = 5/184 (3%)
 Frame = -1

Query  1122  NQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPEVHPMY  943
             N  W+  R+FGSRD       +  RP +R P  + P    + P  P   P+ Y  V P  
Sbjct  222   NPTWHHQRAFGSRDNIPLQQVMGPRPLVRPPFLAAPPGYMIGPTFPGPPPICYVSVAPPG  281

Query  942   YVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEM  763
              + GP P   V   + S      V  Q    L  S I  QIEYYFS++NL  D YL   M
Sbjct  282   SLRGPQPSCFVPYPINSGAS---VLPQETIALRAS-IAGQIEYYFSDENLKNDHYLISLM  337

Query  762   DDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQ  583
             DDQGWVPV  IA FK+V  +T DI  IL A++ S  IEV+G+K+R R++W KWI P S Q
Sbjct  338   DDQGWVPVSTIAEFKRVKKMTVDISFILDALKCSGSIEVKGDKVRKRDNWSKWI-PASSQ  396

Query  582   YSIS  571
              ++S
Sbjct  397   QAVS  400



>ref|XP_010943270.1| PREDICTED: la-related protein 1A-like isoform X2 [Elaeis guineensis]
Length=1000

 Score =   108 bits (269),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 86/138 (62%), Gaps = 5/138 (4%)
 Frame = -1

Query  948  MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPL-LLSKIVNQIEYYFSNDNLIKDMYLR  772
            MYYVP    + +  P   S PP PP      +PL L + IV QIEYYFS++NL KD YL 
Sbjct  313  MYYVPAAPLEMVRGPRFFSHPPPPPYPVLTQEPLDLRANIVKQIEYYFSDENLQKDHYLI  372

Query  771  KEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPP  592
              +D+QGWV +  IA F +V  +T +I LIL A+ +S +IEV+ +K+R RNDW KWI P 
Sbjct  373  SLLDEQGWVSISKIADFNRVRKMTTNISLILDALWSSELIEVEDDKIRRRNDWSKWI-PA  431

Query  591  SVQYSI---SSPQSARSP  547
            S Q+++   S P   +SP
Sbjct  432  SSQHAVLTKSQPTEGQSP  449



>ref|NP_001051966.1| Os03g0859300 [Oryza sativa Japonica Group]
 gb|AAP44746.1| putative extensin [Oryza sativa Japonica Group]
 gb|ABG00008.1| La domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13880.1| Os03g0859300 [Oryza sativa Japonica Group]
 dbj|BAG97184.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE60339.1| hypothetical protein OsJ_13448 [Oryza sativa Japonica Group]
Length=383

 Score =   105 bits (261),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 75/118 (64%), Gaps = 5/118 (4%)
 Frame = -1

Query  840  SKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTS  661
            + ++ QIE+YFS DNL  D++LR+ MDDQGWV + LIA F KV   TDD+Q I   +++S
Sbjct  237  ANLLKQIEFYFSKDNLCTDVFLRRNMDDQGWVNIALIAGFNKVQESTDDLQYIKDTIQSS  296

Query  660  TMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNAN  487
            +++E+Q +K+R +NDW KW++P      +       SP  + L+ H   V L ++ A+
Sbjct  297  SILEMQDDKIRRQNDWNKWVIPRESNTDV-----LPSPNINNLTAHLGSVGLQESAAS  349



>gb|ABG00009.1| La domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=381

 Score =   105 bits (261),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 75/118 (64%), Gaps = 5/118 (4%)
 Frame = -1

Query  840  SKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTS  661
            + ++ QIE+YFS DNL  D++LR+ MDDQGWV + LIA F KV   TDD+Q I   +++S
Sbjct  235  ANLLKQIEFYFSKDNLCTDVFLRRNMDDQGWVNIALIAGFNKVQESTDDLQYIKDTIQSS  294

Query  660  TMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNAN  487
            +++E+Q +K+R +NDW KW++P      +       SP  + L+ H   V L ++ A+
Sbjct  295  SILEMQDDKIRRQNDWNKWVIPRESNTDV-----LPSPNINNLTAHLGSVGLQESAAS  347



>ref|XP_010251686.1| PREDICTED: la-related protein 1A [Nelumbo nucifera]
 ref|XP_010251687.1| PREDICTED: la-related protein 1A [Nelumbo nucifera]
 ref|XP_010251688.1| PREDICTED: la-related protein 1A [Nelumbo nucifera]
Length=1065

 Score =   108 bits (269),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 91/168 (54%), Gaps = 12/168 (7%)
 Frame = -1

Query  948  MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDP---LLLSKIVNQIEYYFSNDNLIKDMY  778
            MYY+P   P+++  P        P   +    P    L + IV QIEYYFS++NL KD Y
Sbjct  332  MYYLPAAPPETIRGPPPRFIAHPPHHVFPIPTPETVALRANIVKQIEYYFSDENLQKDHY  391

Query  777  LRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIV  598
            L   MDDQGWV +  IA F +V  +T ++  IL A+R+S +IEVQG+K+R R+DW KW+ 
Sbjct  392  LISLMDDQGWVLISKIADFNRVKKMTTNVLFILDALRSSAIIEVQGDKIRRRDDWTKWL-  450

Query  597  PPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNANEHERGNAEAHL  454
            P   Q+  SS    +   S       +   L  N  N +ERG +E  +
Sbjct  451  PAYRQHVFSSKSDEKGAAS------LKNTEL--NEGNVYERGISEGCM  490



>ref|XP_010943269.1| PREDICTED: la-related protein 1A-like isoform X1 [Elaeis guineensis]
Length=1035

 Score =   108 bits (269),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 86/138 (62%), Gaps = 5/138 (4%)
 Frame = -1

Query  948  MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPL-LLSKIVNQIEYYFSNDNLIKDMYLR  772
            MYYVP    + +  P   S PP PP      +PL L + IV QIEYYFS++NL KD YL 
Sbjct  313  MYYVPAAPLEMVRGPRFFSHPPPPPYPVLTQEPLDLRANIVKQIEYYFSDENLQKDHYLI  372

Query  771  KEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPP  592
              +D+QGWV +  IA F +V  +T +I LIL A+ +S +IEV+ +K+R RNDW KWI P 
Sbjct  373  SLLDEQGWVSISKIADFNRVRKMTTNISLILDALWSSELIEVEDDKIRRRNDWSKWI-PA  431

Query  591  SVQYSI---SSPQSARSP  547
            S Q+++   S P   +SP
Sbjct  432  SSQHAVLTKSQPTEGQSP  449



>ref|XP_009402440.1| PREDICTED: la-related protein 1A-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1006

 Score =   108 bits (269),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 79/128 (62%), Gaps = 4/128 (3%)
 Frame = -1

Query  948  MYYVPGPHPDSLVMPMLASpppgpPVFYQFLD-PLLLSKIVNQIEYYFSNDNLIKDMYLR  772
            M+ +  P P+ L +P      P      Q  D  +L + +V QIEYYFSN NL  D YL 
Sbjct  322  MHSLSAPRPEKLQVPCFYPHAPRYS--NQTADMKVLRANLVKQIEYYFSNGNLQTDQYLI  379

Query  771  KEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPP  592
              MD+QGWV +  IATF++V  +T DI LIL A+R+S +IEVQG ++R R+DW KW VP 
Sbjct  380  SLMDEQGWVSISEIATFRRVKKMTSDISLILDALRSSHLIEVQGNQIRTRSDWSKW-VPA  438

Query  591  SVQYSISS  568
            S Q  +S+
Sbjct  439  SRQPVVSA  446



>ref|XP_010943271.1| PREDICTED: la-related protein 1A-like isoform X3 [Elaeis guineensis]
Length=967

 Score =   108 bits (269),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 86/138 (62%), Gaps = 5/138 (4%)
 Frame = -1

Query  948  MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPL-LLSKIVNQIEYYFSNDNLIKDMYLR  772
            MYYVP    + +  P   S PP PP      +PL L + IV QIEYYFS++NL KD YL 
Sbjct  313  MYYVPAAPLEMVRGPRFFSHPPPPPYPVLTQEPLDLRANIVKQIEYYFSDENLQKDHYLI  372

Query  771  KEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPP  592
              +D+QGWV +  IA F +V  +T +I LIL A+ +S +IEV+ +K+R RNDW KWI P 
Sbjct  373  SLLDEQGWVSISKIADFNRVRKMTTNISLILDALWSSELIEVEDDKIRRRNDWSKWI-PA  431

Query  591  SVQYSI---SSPQSARSP  547
            S Q+++   S P   +SP
Sbjct  432  SSQHAVLTKSQPTEGQSP  449



>ref|XP_010943273.1| PREDICTED: la-related protein 1A-like isoform X4 [Elaeis guineensis]
Length=916

 Score =   107 bits (268),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 86/138 (62%), Gaps = 5/138 (4%)
 Frame = -1

Query  948  MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPL-LLSKIVNQIEYYFSNDNLIKDMYLR  772
            MYYVP    + +  P   S PP PP      +PL L + IV QIEYYFS++NL KD YL 
Sbjct  194  MYYVPAAPLEMVRGPRFFSHPPPPPYPVLTQEPLDLRANIVKQIEYYFSDENLQKDHYLI  253

Query  771  KEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPP  592
              +D+QGWV +  IA F +V  +T +I LIL A+ +S +IEV+ +K+R RNDW KWI P 
Sbjct  254  SLLDEQGWVSISKIADFNRVRKMTTNISLILDALWSSELIEVEDDKIRRRNDWSKWI-PA  312

Query  591  SVQYSI---SSPQSARSP  547
            S Q+++   S P   +SP
Sbjct  313  SSQHAVLTKSQPTEGQSP  330



>gb|KDO66352.1| hypothetical protein CISIN_1g008506mg [Citrus sinensis]
Length=563

 Score =   106 bits (265),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 81/145 (56%), Gaps = 19/145 (13%)
 Frame = -1

Query  981  GSPLVYPEVHPMYYVPGPHPDSLV-------MPMLASpppgpPVFYQFLDPLLLSKIVNQ  823
            G+ L Y  V P   + GPHP            PML                 L + IV Q
Sbjct  258  GAALCYVPVVPPGSIRGPHPQRFFPYPVNSGAPMLPPETLA-----------LKANIVKQ  306

Query  822  IEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQ  643
            IEYYFS++NL  D YL   MD QGWVP+ +IA FK+V  ++ D+  IL A++ S+ +E Q
Sbjct  307  IEYYFSDENLQNDHYLISLMDAQGWVPIAIIADFKRVKRMSTDLPFILDALQNSSTVEAQ  366

Query  642  GEKLRVRNDWKKWIVPPSVQYSISS  568
            G+K+R R++W KWI P SV+ ++SS
Sbjct  367  GDKVRRRDEWSKWI-PASVEQTMSS  390



>ref|XP_008805342.1| PREDICTED: LOW QUALITY PROTEIN: la-related protein 1A-like [Phoenix 
dactylifera]
Length=1038

 Score =   107 bits (268),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 92/158 (58%), Gaps = 14/158 (9%)
 Frame = -1

Query  951  PMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPL-LLSKIVNQIEYYFSNDNLIKDMYL  775
            PMYYVP    + +  P   S PP P       +PL L + IV QIEYYFS++NL KD YL
Sbjct  312  PMYYVPAAPLEMMRGPXFFSHPPPPTYPVVTQEPLDLRANIVKQIEYYFSDENLQKDHYL  371

Query  774  RKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVP  595
               +D+QGWV +  IA F +V  +T +I LIL A+R+S +IE++ +K+R RNDW KWI P
Sbjct  372  ISLLDEQGWVSISKIADFNRVRKMTTNISLILDALRSSELIEIEDDKIRRRNDWSKWI-P  430

Query  594  PSVQYSISS---PQSARSPGSDVLSQHFQGVTLDDNNA  490
               Q ++S+   P   +SP S         +  DDNN 
Sbjct  431  ALAQQAVSTKSQPTEGQSPVS---------MEKDDNNG  459



>ref|XP_006446391.1| hypothetical protein CICLE_v10014180mg [Citrus clementina]
 gb|ESR59631.1| hypothetical protein CICLE_v10014180mg [Citrus clementina]
Length=933

 Score =   107 bits (267),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 88/158 (56%), Gaps = 25/158 (16%)
 Frame = -1

Query  981  GSPLVYPEVHPMYYVPGPHPD-------SLVMPMLASpppgpPVFYQFLDPLLLSKIVNQ  823
            G+ L Y  V P   + GPHP        +L  PML                 L + IV Q
Sbjct  256  GAALCYVPVVPPGSIRGPHPQRFFPYPVNLGAPMLPPETLA-----------LKANIVKQ  304

Query  822  IEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQ  643
            IEYYFS++NL  D YL   MD QGWVP+ +IA FK+V  ++ D+  IL A++ S+ +E Q
Sbjct  305  IEYYFSDENLQNDHYLISLMDAQGWVPIAIIADFKRVKRMSTDLPFILDALQNSSTVEAQ  364

Query  642  GEKLRVRNDWKKWIVPPSVQYSISSP------QSARSP  547
            G+K+R R++W KWI P SV+ ++SS       QSA +P
Sbjct  365  GDKVRRRDEWSKWI-PASVEQTMSSTAQTSQSQSAENP  401



>ref|XP_008385592.1| PREDICTED: la-related protein 1A [Malus domestica]
Length=918

 Score =   107 bits (267),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 79/140 (56%), Gaps = 2/140 (1%)
 Frame = -1

Query  978  SPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSND  799
            +P+ Y  V P+  V GPHP S +   L    P PP     L   L   I+ QIEYYFS++
Sbjct  249  APICYLPVPPLGAVRGPHPPSFMPHPLNPGAPLPPSETHTLS--LRDNIIKQIEYYFSDE  306

Query  798  NLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRN  619
            NL  D YL   MDDQGWVP+  IA FK+V  +  DI  IL ++  ST +EVQ  K+R R+
Sbjct  307  NLKNDRYLISLMDDQGWVPITTIADFKRVKKMCTDIAFILDSLLGSTTVEVQANKIRRRD  366

Query  618  DWKKWIVPPSVQYSISSPQS  559
            +W KWI   +     S PQ+
Sbjct  367  EWSKWIADSADSMLTSKPQT  386



>ref|XP_009350498.1| PREDICTED: la-related protein 1A-like [Pyrus x bretschneideri]
 ref|XP_009350499.1| PREDICTED: la-related protein 1A-like [Pyrus x bretschneideri]
Length=919

 Score =   107 bits (267),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 79/140 (56%), Gaps = 2/140 (1%)
 Frame = -1

Query  978  SPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSND  799
            +P+ Y  V P+  + GPHP S +   L    P PP     L   L   I+ QIEYYFS++
Sbjct  250  APICYLPVPPLGAIRGPHPPSFMPHPLNPGAPLPPSETHTLS--LRDNIIKQIEYYFSDE  307

Query  798  NLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRN  619
            NL  D YL   MDDQGWVP+  IA FK+V  +  DI  IL ++  ST +EVQ  K+R R+
Sbjct  308  NLKNDRYLISMMDDQGWVPITTIADFKRVKKMCTDIAFILDSLLGSTTVEVQANKIRRRD  367

Query  618  DWKKWIVPPSVQYSISSPQS  559
            +W KWI   +     S PQ+
Sbjct  368  EWSKWIADSADSMLTSKPQT  387



>ref|XP_009402441.1| PREDICTED: la-related protein 1A-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=988

 Score =   107 bits (267),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = -1

Query  849  LLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAM  670
            +L + +V QIEYYFSN NL  D YL   MD+QGWV +  IATF++V  +T DI LIL A+
Sbjct  336  VLRANLVKQIEYYFSNGNLQTDQYLISLMDEQGWVSISEIATFRRVKKMTSDISLILDAL  395

Query  669  RTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISS  568
            R+S +IEVQG ++R R+DW KW VP S Q  +S+
Sbjct  396  RSSHLIEVQGNQIRTRSDWSKW-VPASRQPVVSA  428



>ref|XP_006470432.1| PREDICTED: la-related protein 1B-like [Citrus sinensis]
Length=936

 Score =   107 bits (267),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 86/158 (54%), Gaps = 25/158 (16%)
 Frame = -1

Query  981  GSPLVYPEVHPMYYVPGPHPDSLV-------MPMLASpppgpPVFYQFLDPLLLSKIVNQ  823
            G+ L Y  V P   + GPHP            PML                 L + IV Q
Sbjct  259  GAALCYVPVIPPGSIRGPHPQRFFPYPVNSGAPMLPPETLA-----------LKANIVKQ  307

Query  822  IEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQ  643
            IEYYFS++NL  D YL   MD QGWVP+ +IA FK+V  ++ D+  IL A++ S+ +E Q
Sbjct  308  IEYYFSDENLQNDHYLISLMDAQGWVPIAIIADFKRVKRMSTDLPFILDALQNSSTVEAQ  367

Query  642  GEKLRVRNDWKKWIVPPSVQYSISSP------QSARSP  547
            G+K+R R++W KWI P SV+ ++SS       QSA +P
Sbjct  368  GDKVRRRDEWSKWI-PASVEQTMSSTAQTSQSQSAENP  404



>ref|XP_001269282.1| La domain family [Aspergillus clavatus NRRL 1]
 gb|EAW07856.1| La domain family [Aspergillus clavatus NRRL 1]
Length=779

 Score =   106 bits (265),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 93/156 (60%), Gaps = 20/156 (13%)
 Frame = -1

Query  873  VFYQ-FLDPL-LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLT  700
            V YQ +++P  L+S I  Q+EYYFS DNL KD++LRK+MD QG+V + +IA+FK+V  LT
Sbjct  592  VPYQPYMEPFSLMSMISMQLEYYFSVDNLCKDLFLRKQMDSQGFVALSVIASFKRVKTLT  651

Query  699  DDIQLILHAMRTSTMIEVQG-----EKLRVRNDWKKWIVP-----PSVQYSISSPQSARS  550
            +D +L+ HA R    IE Q      ++LR R  W++W++P     PS Q     P SA +
Sbjct  652  EDFELLRHAARQVRNIEYQAGEDGVDRLRPREKWEQWVLPVEQRDPSAQNE-GPPPSADA  710

Query  549  PGSDVLSQHFQGVTLDDNNANEHERGNAEAHLNRSS  442
              SD  + H +G T      N    G AE+H +++S
Sbjct  711  GKSDEQN-HVEGAT------NGLPNGTAESHASKTS  739



>ref|XP_010268999.1| PREDICTED: la-related protein 1B-like [Nelumbo nucifera]
Length=472

 Score =   105 bits (261),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -1

Query  846  LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
            L ++I  QIEYYFS +NL+ D YLR EM+++GWVP+ LIA F++V  +T D+ +I+ +++
Sbjct  348  LCNRIQKQIEYYFSAENLVNDFYLRGEMNNEGWVPISLIAGFRRVKAMTSDVSMIMKSLK  407

Query  666  TSTMIEVQGEKLRVRNDWKKWIV  598
             S+++EV+  K+R R DW  WI+
Sbjct  408  ISSIVEVKDNKVRKRGDWMNWIL  430



>ref|XP_002519615.1| lupus la ribonucleoprotein, putative [Ricinus communis]
 gb|EEF42760.1| lupus la ribonucleoprotein, putative [Ricinus communis]
Length=867

 Score =   106 bits (265),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 85/138 (62%), Gaps = 6/138 (4%)
 Frame = -1

Query  981  GSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSN  802
            G P+ Y  V P     G HP ++ MP   SP    P      +  L   I+ QIEYYFS+
Sbjct  247  GPPICYFPVAPPGSFRGGHP-AVFMPYPTSPGAPIPP----QESSLRDDIIRQIEYYFSD  301

Query  801  DNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVR  622
            +NL  D +L   MDDQGWVP+  IA FK+V  +T D+ +IL A+++S+ IEVQG+K+R R
Sbjct  302  ENLRTDHFLISLMDDQGWVPISAIAKFKRVKKMTTDVVIILDALQSSSTIEVQGDKIRRR  361

Query  621  NDWKKWIVPPSVQYSISS  568
            ++W KWI   S+++++ S
Sbjct  362  DEWSKWIA-ASIEHTLPS  378



>ref|XP_002463470.1| hypothetical protein SORBIDRAFT_01g000420 [Sorghum bicolor]
 gb|EER90468.1| hypothetical protein SORBIDRAFT_01g000420 [Sorghum bicolor]
Length=449

 Score =   104 bits (259),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = -1

Query  837  KIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTST  658
            K++ QIE+YFS +NL  D+YLR++MD QGWV + LIA FKKV  L  D+Q I   +++S+
Sbjct  304  KLLKQIEFYFSKENLCSDVYLRQQMDGQGWVDISLIAGFKKVQGLKKDLQYIKETVQSSS  363

Query  657  MIEVQGEKLRVRNDWKKWIVP-PSVQYSISSPQSARSPGSDVLSQHFQGVTL  505
            ++E++ +K+R  NDW+KW++P  S   + SS  S   P  + L+ H  G+ L
Sbjct  364  ILEMKDDKIRKHNDWEKWVIPRESNPDAPSSSASVPRPNVNNLTAHLGGMRL  415



>ref|XP_001264789.1| La domain family [Neosartorya fischeri NRRL 181]
 gb|EAW22892.1| La domain family [Neosartorya fischeri NRRL 181]
Length=783

 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 86/136 (63%), Gaps = 23/136 (17%)
 Frame = -1

Query  969  VYP---EVHPMY-YVPGPHPDSLVMPMLASpppgpPVFYQ-FLDPL-LLSKIVNQIEYYF  808
            VYP   +++ MY Y P P       PM A       V YQ +++P  L+S I  Q+EYYF
Sbjct  573  VYPFPADINTMYGYQPIP-----AGPMTA-------VPYQPYMEPFSLMSMISMQLEYYF  620

Query  807  SNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQ-GE--  637
            S DNL KD++LRK+MD QG+VP+ +IA+FK+V  LT+D +++ HA R    +E Q GE  
Sbjct  621  SVDNLCKDLFLRKQMDSQGFVPLSVIASFKRVKTLTEDFEMLRHACRQVRNVEYQTGEDG  680

Query  636  --KLRVRNDWKKWIVP  595
              +LR R+ W++W++P
Sbjct  681  IDRLRPRDKWEQWVLP  696



>ref|XP_010943673.1| PREDICTED: la-related protein 1A-like isoform X2 [Elaeis guineensis]
Length=883

 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 80/132 (61%), Gaps = 1/132 (1%)
 Frame = -1

Query  948  MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLL-SKIVNQIEYYFSNDNLIKDMYLR  772
            MYYV     + +  P   S PP PP      + L L + IV QIEYYFSN+NL KD YL 
Sbjct  314  MYYVSAAPLEMMRGPHFVSHPPPPPYPIPTPEALALRASIVKQIEYYFSNENLQKDPYLI  373

Query  771  KEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPP  592
              +D+QGWV +  IA F +V  +T +I LIL A+++S +IEVQ +K+R RNDW KWI   
Sbjct  374  SLLDEQGWVSIYKIADFNRVKKMTTNISLILDALQSSELIEVQDDKIRRRNDWSKWIPAS  433

Query  591  SVQYSISSPQSA  556
            ++Q   +  QS 
Sbjct  434  ALQAVSTKSQST  445



>ref|XP_010064987.1| PREDICTED: la-related protein 1B-like [Eucalyptus grandis]
Length=547

 Score =   105 bits (262),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 90/134 (67%), Gaps = 4/134 (3%)
 Frame = -1

Query  846  LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
            L + +V+QIEYYFS+DNL+KD++LR  MD++GWV + +IA F++V  +T D++LIL +++
Sbjct  382  LPTSLVDQIEYYFSDDNLVKDVFLRSNMDEEGWVSIEIIAKFRRVQEMTRDVKLILDSLK  441

Query  666  TSTMIEVQGEKLRVR-NDWKKW--IVPPSVQYSISSPQSARSP-GSDVLSQHFQGVTLDD  499
             S ++EVQ +K+R R +DWKK+  I  P+ Q +I +   + S  G + L+   +  T+++
Sbjct  442  ASRIVEVQDQKVRRRGSDWKKFFRIDEPNKQVAIETDSPSPSGYGHNKLATTLEKFTMEE  501

Query  498  NNANEHERGNAEAH  457
               +++    A+ H
Sbjct  502  AETDDNVAVEADLH  515



>ref|XP_008804063.1| PREDICTED: la-related protein 1A-like isoform X1 [Phoenix dactylifera]
Length=1058

 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (69%), Gaps = 4/103 (4%)
 Frame = -1

Query  867  YQFLDP---LLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTD  697
            Y  L P    L ++IV QIEYYFS++NL KD YL   +D+QGWV +  IA F +V  +T 
Sbjct  347  YPILTPEALALRARIVKQIEYYFSDENLQKDPYLISLLDEQGWVSISKIADFNRVKKMTT  406

Query  696  DIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISS  568
            +I LIL A+++S +IEVQ +K+R RNDW KWI P S Q ++S+
Sbjct  407  NISLILDALQSSELIEVQDDKIRRRNDWSKWI-PASAQQAVST  448



>ref|XP_008804064.1| PREDICTED: la-related protein 1A-like isoform X2 [Phoenix dactylifera]
Length=1057

 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (69%), Gaps = 4/103 (4%)
 Frame = -1

Query  867  YQFLDP---LLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTD  697
            Y  L P    L ++IV QIEYYFS++NL KD YL   +D+QGWV +  IA F +V  +T 
Sbjct  347  YPILTPEALALRARIVKQIEYYFSDENLQKDPYLISLLDEQGWVSISKIADFNRVKKMTT  406

Query  696  DIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISS  568
            +I LIL A+++S +IEVQ +K+R RNDW KWI P S Q ++S+
Sbjct  407  NISLILDALQSSELIEVQDDKIRRRNDWSKWI-PASAQQAVST  448



>ref|XP_008804065.1| PREDICTED: la-related protein 1A-like isoform X3 [Phoenix dactylifera]
Length=1054

 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (69%), Gaps = 4/103 (4%)
 Frame = -1

Query  867  YQFLDP---LLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTD  697
            Y  L P    L ++IV QIEYYFS++NL KD YL   +D+QGWV +  IA F +V  +T 
Sbjct  347  YPILTPEALALRARIVKQIEYYFSDENLQKDPYLISLLDEQGWVSISKIADFNRVKKMTT  406

Query  696  DIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISS  568
            +I LIL A+++S +IEVQ +K+R RNDW KWI P S Q ++S+
Sbjct  407  NISLILDALQSSELIEVQDDKIRRRNDWSKWI-PASAQQAVST  448



>ref|XP_008804066.1| PREDICTED: la-related protein 1A-like isoform X4 [Phoenix dactylifera]
Length=1053

 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (69%), Gaps = 4/103 (4%)
 Frame = -1

Query  867  YQFLDP---LLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTD  697
            Y  L P    L ++IV QIEYYFS++NL KD YL   +D+QGWV +  IA F +V  +T 
Sbjct  347  YPILTPEALALRARIVKQIEYYFSDENLQKDPYLISLLDEQGWVSISKIADFNRVKKMTT  406

Query  696  DIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISS  568
            +I LIL A+++S +IEVQ +K+R RNDW KWI P S Q ++S+
Sbjct  407  NISLILDALQSSELIEVQDDKIRRRNDWSKWI-PASAQQAVST  448



>ref|XP_010943672.1| PREDICTED: la-related protein 1A-like isoform X1 [Elaeis guineensis]
Length=1026

 Score =   106 bits (264),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 80/132 (61%), Gaps = 1/132 (1%)
 Frame = -1

Query  948  MYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLL-SKIVNQIEYYFSNDNLIKDMYLR  772
            MYYV     + +  P   S PP PP      + L L + IV QIEYYFSN+NL KD YL 
Sbjct  314  MYYVSAAPLEMMRGPHFVSHPPPPPYPIPTPEALALRASIVKQIEYYFSNENLQKDPYLI  373

Query  771  KEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVPP  592
              +D+QGWV +  IA F +V  +T +I LIL A+++S +IEVQ +K+R RNDW KWI   
Sbjct  374  SLLDEQGWVSIYKIADFNRVKKMTTNISLILDALQSSELIEVQDDKIRRRNDWSKWIPAS  433

Query  591  SVQYSISSPQSA  556
            ++Q   +  QS 
Sbjct  434  ALQAVSTKSQST  445



>emb|CBI24386.3| unnamed protein product [Vitis vinifera]
Length=841

 Score =   105 bits (263),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 83/133 (62%), Gaps = 6/133 (5%)
 Frame = -1

Query  972  LVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDNL  793
            L Y    P   + GPHP   + P L+   P PP   Q     L + IV QIEYYFS+ NL
Sbjct  277  LYYHPPAPTGSIRGPHP-RFIPPSLSPGAPIPPSETQ----ALRANIVKQIEYYFSDGNL  331

Query  792  IKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDW  613
              D YL   MDDQGWVP+ +IA FK+V  ++ D+Q IL A+++ST +EVQ +++R R++W
Sbjct  332  QNDHYLISLMDDQGWVPISIIADFKRVKKMSTDLQFILDALQSSTTVEVQCDRIRRRDEW  391

Query  612  KKWIVPPSVQYSI  574
             +WI P S+++ +
Sbjct  392  SRWI-PASIEHGL  403



>gb|KDO84934.1| hypothetical protein CISIN_1g008981mg [Citrus sinensis]
Length=471

 Score =   103 bits (258),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 108/184 (59%), Gaps = 27/184 (15%)
 Frame = -1

Query  1164  YHHAHGGARDQERGNQEWNANRSFGSRDAHLQplrvpsrpflrvpppsppfipplmpmrp  985
             Y++  GG  DQ+RGN          +RDAH+QP R P R F+R  PP+     P  PMRP
Sbjct  297   YNNNFGGRHDQDRGNYS-------NARDAHVQPQRGPPRGFVRPAPPNAAAFAPPQPMRP  349

Query  984   LGSPLVYPEVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFL----------DPLLLSK  835
               +P+ +PE     Y+P        MP+ A+   G      F+          +P L + 
Sbjct  350   FPNPMGFPE---FIYIP-------PMPVEAAALRGVTGMPPFIPPAPVLMPVPEPSLAAM  399

Query  834   IVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTM  655
             +++QI+YYFS+ NL+KD +L+  MDDQGWVP+ LIA+F +V  LT +IQLIL ++RTST+
Sbjct  400   LIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTV  459

Query  654   IEVQ  643
             +EVQ
Sbjct  460   VEVQ  463



>gb|EYU46157.1| hypothetical protein MIMGU_mgv1a000957mg [Erythranthe guttata]
Length=933

 Score =   105 bits (262),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 75/124 (60%), Gaps = 17/124 (14%)
 Frame = -1

Query  846  LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
            L + +V QIEYYFS++NL  D YL   MD+QGWVP+ +IA FK+V  +  DI LIL A++
Sbjct  310  LRANVVKQIEYYFSDENLQNDHYLISLMDNQGWVPISVIAAFKRVQRMNADIPLILDALQ  369

Query  666  TSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNAN  487
             S  +EVQGE++R RN+W KWI                 P SD+ +      T+ ++N N
Sbjct  370  ASETVEVQGERVRRRNEWSKWI-----------------PVSDISTSSLVPDTVKNDNLN  412

Query  486  EHER  475
            ++E+
Sbjct  413  KNEK  416



>ref|XP_011090202.1| PREDICTED: la-related protein 1A-like [Sesamum indicum]
Length=923

 Score =   105 bits (262),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = -1

Query  846  LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
            L + I+ QIEYYFS++NL  D YL   MDDQGWVP+ +IA FK+V  +  +I  IL A++
Sbjct  312  LKANIIKQIEYYFSDENLQNDHYLISLMDDQGWVPISVIADFKRVKRMNAEIPFILDALQ  371

Query  666  TSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSP  565
             S  IEVQG+K+R RN+W +WI  P+ + S SSP
Sbjct  372  ASGTIEVQGDKVRRRNEWSRWI--PASRMSKSSP  403



>emb|CDP09681.1| unnamed protein product [Coffea canephora]
Length=922

 Score =   105 bits (261),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 73/125 (58%), Gaps = 19/125 (15%)
 Frame = -1

Query  972  LVYPEVHPMYYV-PGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDN  796
            + YP   P++ + PGP       PM+ S               L   IV QIEYYFS++N
Sbjct  274  MPYPPFFPLHPLSPGP-------PMVPSATVS-----------LRGSIVKQIEYYFSDEN  315

Query  795  LIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRND  616
            L  D YL   MDD GWVP+ +IA FK+V  ++ DI  IL A++ ST IE+QG+K+R R++
Sbjct  316  LQNDHYLLSLMDDHGWVPISIIADFKRVKKMSTDISFILDALQASTTIEIQGDKVRRRDE  375

Query  615  WKKWI  601
            W KWI
Sbjct  376  WSKWI  380



>gb|KCW70527.1| hypothetical protein EUGRSUZ_F03731 [Eucalyptus grandis]
 gb|KCW70528.1| hypothetical protein EUGRSUZ_F03731 [Eucalyptus grandis]
 gb|KCW70529.1| hypothetical protein EUGRSUZ_F03731 [Eucalyptus grandis]
Length=457

 Score =   103 bits (256),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 90/134 (67%), Gaps = 4/134 (3%)
 Frame = -1

Query  846  LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
            L + +V+QIEYYFS+DNL+KD++LR  MD++GWV + +IA F++V  +T D++LIL +++
Sbjct  292  LPTSLVDQIEYYFSDDNLVKDVFLRSNMDEEGWVSIEIIAKFRRVQEMTRDVKLILDSLK  351

Query  666  TSTMIEVQGEKLRVR-NDWKKW--IVPPSVQYSISSPQSARSP-GSDVLSQHFQGVTLDD  499
             S ++EVQ +K+R R +DWKK+  I  P+ Q +I +   + S  G + L+   +  T+++
Sbjct  352  ASRIVEVQDQKVRRRGSDWKKFFRIDEPNKQVAIETDSPSPSGYGHNKLATTLEKFTMEE  411

Query  498  NNANEHERGNAEAH  457
               +++    A+ H
Sbjct  412  AETDDNVAVEADLH  425



>emb|CDX81414.1| BnaC09g08250D [Brassica napus]
Length=180

 Score = 99.0 bits (245),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -1

Query  813  YFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEK  634
            Y S DNL KD +LR +M+D+GWVPVR+IA F+++A LTD+IQ IL A+R+S ++E++GE 
Sbjct  79   YHSADNLSKDKHLRGQMNDEGWVPVRIIAGFRRLAELTDNIQTILEALRSSEVVEIKGEA  138

Query  633  LRVRNDWKKWIVP  595
            LR R DW K+++P
Sbjct  139  LRRRGDWDKYLLP  151



>ref|XP_009416371.1| PREDICTED: la-related protein 1A [Musa acuminata subsp. malaccensis]
Length=990

 Score =   105 bits (261),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = -1

Query  846  LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
            L S IV QIEYYFS++NL KD YL   +D+QGWV +  IA FK+V  +T +I LIL A+R
Sbjct  310  LRSNIVKQIEYYFSDENLQKDQYLISLLDEQGWVSISKIADFKRVKTMTTNIPLILDALR  369

Query  666  TSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARS  550
            +S+++EVQ +K+R   DW KWI   +     + PQS  S
Sbjct  370  SSSLVEVQDDKIRRHGDWSKWIRASAHSIVSTQPQSTES  408



>ref|XP_752344.1| La domain family [Aspergillus fumigatus Af293]
 gb|EAL90306.1| La domain family [Aspergillus fumigatus Af293]
 gb|EDP56214.1| La domain family [Aspergillus fumigatus A1163]
Length=786

 Score =   104 bits (260),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 85/136 (63%), Gaps = 23/136 (17%)
 Frame = -1

Query  969  VYP---EVHPMY-YVPGPHPDSLVMPMLASpppgpPVFYQ-FLDPL-LLSKIVNQIEYYF  808
            VYP   +++ MY Y P P       PM A       V YQ +++P  L+S I  Q+EYYF
Sbjct  576  VYPFPADINTMYGYQPIP-----AGPMTA-------VPYQPYMEPFSLMSMISMQLEYYF  623

Query  807  SNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIE-VQGE--  637
            S DNL KD++LRK+MD QG+VP+ +IA FK+V  LT+D +++ HA R    IE + GE  
Sbjct  624  SVDNLCKDLFLRKQMDSQGFVPLSVIAGFKRVKTLTEDFEMLRHACRQVRNIEYLTGEDG  683

Query  636  --KLRVRNDWKKWIVP  595
              +LR R+ W++W++P
Sbjct  684  IDRLRPRDKWEQWVLP  699



>ref|XP_002889049.1| hypothetical protein ARALYDRAFT_895473 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65308.1| hypothetical protein ARALYDRAFT_895473 [Arabidopsis lyrata subsp. 
lyrata]
Length=124

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -1

Query  858  LDPLLLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLIL  679
            LD  L S +V QI+YYFS++NL KD YLR +MD+QGWV + +IA F ++  +T+DI+ IL
Sbjct  38   LDSNLSSFMVFQIDYYFSDENLAKDNYLRSQMDNQGWVNIFIIAEFPRIKSMTNDIEFIL  97

Query  678  HAMRTSTMIEVQGEKLRVRNDWKKWI  601
             +MR+S  +E+Q  KLR R  W++WI
Sbjct  98   RSMRSSATVEIQNHKLRKRYGWQRWI  123



>gb|KDP46005.1| hypothetical protein JCGZ_14912 [Jatropha curcas]
Length=908

 Score =   104 bits (259),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 86/147 (59%), Gaps = 23/147 (16%)
 Frame = -1

Query  981  GSPLVYPEV---------HPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIV  829
            G P+ Y  V         HP  ++P  +P S   PML          ++ L   L   I+
Sbjct  246  GPPICYVPVAPPGSFRGGHPPRFMP--YPTSPGAPMLP---------HEML--ALRDNII  292

Query  828  NQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIE  649
             QI+YYFS++NL  D YL   MD+QGWVP+  IA F +V  +T DI  IL A+++S+ +E
Sbjct  293  RQIDYYFSDENLKTDHYLISLMDEQGWVPISTIADFNRVKKMTTDIPFILDALQSSSTVE  352

Query  648  VQGEKLRVRNDWKKWIVPPSVQYSISS  568
            VQG+K+R R++W KWI P S++++ SS
Sbjct  353  VQGDKIRRRDEWSKWI-PASMEHTSSS  378



>ref|XP_002560965.1| Pc16g06290 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP93299.1| Pc16g06290 [Penicillium rubens Wisconsin 54-1255]
Length=814

 Score =   103 bits (258),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 86/143 (60%), Gaps = 15/143 (10%)
 Frame = -1

Query  948  MYYVPGPHPDSLVM----PMLASpppgpPVFYQFLDPL-LLSKIVNQIEYYFSNDNLIKD  784
            MY V  P P  +      P + S P     + Q+++P  L++ +  Q+EYYFS DN+ KD
Sbjct  538  MYGVVYPFPGDINTMYGYPAVNSAPMSAIPYQQYMEPFSLMNMLSMQLEYYFSVDNMCKD  597

Query  783  MYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQ-GE----KLRVRN  619
            M+LRK+MD QG+VP+ ++A+FK+V  LT+D +L+ H  R    +E Q GE    +LR R 
Sbjct  598  MFLRKQMDSQGFVPLNVLASFKRVKSLTEDFELLRHVARQLRNVECQTGEDGVDRLRPRE  657

Query  618  DWKKWIVP-----PSVQYSISSP  565
             W++W++P     P+ Q+  ++P
Sbjct  658  KWQQWVLPVDQREPAAQHDGAAP  680



>gb|KEY76231.1| hypothetical protein BA78_4655 [Aspergillus fumigatus var. RP-2014]
Length=786

 Score =   103 bits (257),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 85/136 (63%), Gaps = 23/136 (17%)
 Frame = -1

Query  969  VYP---EVHPMY-YVPGPHPDSLVMPMLASpppgpPVFYQ-FLDPL-LLSKIVNQIEYYF  808
            VYP   +++ MY Y P P       PM A       V YQ +++P  L+S I  Q+EYYF
Sbjct  576  VYPFPADINIMYGYQPIP-----AGPMTA-------VPYQPYMEPFSLMSMISMQLEYYF  623

Query  807  SNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIE-VQGE--  637
            S DNL KD++LRK+MD QG+VP+ +IA FK+V  LT+D +++ HA R    IE + GE  
Sbjct  624  SVDNLCKDLFLRKQMDSQGFVPLSVIAGFKRVKTLTEDFEMLRHACRQVRNIEYLTGEDG  683

Query  636  --KLRVRNDWKKWIVP  595
              +LR R+ W++W++P
Sbjct  684  IDRLRPRDKWEQWVLP  699



>ref|XP_003603810.1| La-related protein 1B [Medicago truncatula]
 gb|AES74061.1| LA-related protein 6 LA RNA-binding domain protein [Medicago 
truncatula]
Length=471

 Score =   102 bits (253),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 125/406 (31%), Positives = 171/406 (42%), Gaps = 63/406 (16%)
 Frame = -1

Query  1722  DSGNNAV----KKPAW-NKPNG--STEAGPVMGAVSWPALSESTKASPKSATYDPLKTPS  1564
             D  NN V    KKPAW N  NG    E  PVMGAVSWPALS    A   S +   +    
Sbjct  77    DKINNVVNANPKKPAWKNTSNGLVVAEVSPVMGAVSWPALSAKPSAKLTSDSISAVD--G  134

Query  1563  DGSVPPPQGTGIAPSSSPKpvhtnntttpnstpnhvPARQRSNK------RAGGGNSSNT  1402
              GS+   QG  I  S+SP+   T        TP    +   SN+      R GG N+   
Sbjct  135   AGSISISQGPVI--SNSPQKQATATAANARHTPPMNHSHSVSNRQQKPMERGGGNNNEPG  192

Query  1401  ALANGsvsqpqqlqslvV-------EMAPNSAGKPGVEPYSRDNVHRDGGQRGGFG----  1255
              L+N   + PQ      V       ++ PN+    GV+ Y  +N        GG+G    
Sbjct  193   PLSNNLSNPPQVNHQPSVAPPFPVLQITPNTFLVDGVQSYKNNNGWGPRSPAGGYGLPVD  252

Query  1254  SQSIGGNENQYTrssprkgngrprprgdgSYHHAHGGARDQERGNQEWNANRSFGSRDAH  1075
               S  GN                         + +G  R+Q+ GN       +  +RDAH
Sbjct  253   EHSHRGNYGHRP-------------------RNNYGTRRNQDPGN-------TMNTRDAH  286

Query  1074  LQplrvpsrpflrvpppsppfipplmpmrpLGSPLVYPE-VHPMYYVPGPHPDSL-VMPM  901
                             P+ P    L        P + P   H  YY P    +    MP 
Sbjct  287   ---PPQHRMHSEGFLRPTLPNSAYLGSQPMPMRPFLNPAGFHEFYYYPTLQFEPFGGMPF  343

Query  900   LASpppgpPVFYQFLDPLLLSKIVNQI----EYYFSNDNLIKDMYLRKEMDDQGWVPVRL  733
             L  PPP    F    +    +   N I    +YYFS+ NL  D +L+  MD+ GWVPV L
Sbjct  344   LTHPPPPAMFFPVAEETPPTTPPTNIILKQIDYYFSDVNLTNDEFLKSNMDEHGWVPVSL  403

Query  732   IATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRNDWKKWIVP  595
             IA F +V  LT++I+LIL ++R S+++EV G+KLR R +W +++ P
Sbjct  404   IANFPRVKNLTNNIELILDSLRNSSVVEVNGDKLRKRKEWARFLSP  449



>ref|XP_006347270.1| PREDICTED: la-related protein 1-like [Solanum tuberosum]
Length=898

 Score =   103 bits (257),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 76/123 (62%), Gaps = 10/123 (8%)
 Frame = -1

Query  846  LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
            L   I+ QIEYYFS+ NL  D YL   MDDQGWVP+ +IA FK+V  ++ DI  I+ A++
Sbjct  311  LRESILKQIEYYFSDQNLQNDHYLLSLMDDQGWVPISIIADFKRVKKMSTDIAFIIDALQ  370

Query  666  TSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNAN  487
             S+ +EV+G+KLR R++W KW+   + Q S        SP + V  +H  G  + ++  N
Sbjct  371  ASSTVEVKGDKLRRRDEWSKWVSASADQKS--------SPSTPV--EHSVGKVIKNDEVN  420

Query  486  EHE  478
            E++
Sbjct  421  ENK  423



>ref|XP_011080478.1| PREDICTED: la-related protein 1A [Sesamum indicum]
Length=928

 Score =   103 bits (256),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -1

Query  846  LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
            L + IV QIEYYFS++NL  D YL   MD QGWVP+  IA FK+V  +  DI  IL A++
Sbjct  305  LRANIVKQIEYYFSDENLQNDPYLISLMDKQGWVPISFIADFKRVKRMNADIPFILEALQ  364

Query  666  TSTMIEVQGEKLRVRNDWKKWIV  598
             S  IEVQGE +R RN+W KWI 
Sbjct  365  ASETIEVQGENIRRRNEWSKWIA  387



>ref|XP_009591974.1| PREDICTED: la-related protein 1A [Nicotiana tomentosiformis]
 ref|XP_009591975.1| PREDICTED: la-related protein 1A [Nicotiana tomentosiformis]
Length=895

 Score =   102 bits (255),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 81/138 (59%), Gaps = 13/138 (9%)
 Frame = -1

Query  846  LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
            L   I+ QIEYYFS+ NL  D YL   MDDQGWVP+ +IA FK+V  ++ DI  I+ A++
Sbjct  308  LRESIIKQIEYYFSDQNLQNDHYLLSLMDDQGWVPISIIAGFKRVKKMSTDIAFIIDALQ  367

Query  666  TSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQG-VTLDDNNA  490
             S+ +EV+G+KLR R++W KW+   + Q S        SP S V  +H  G V LD    
Sbjct  368  ASSTVEVKGDKLRRRDEWSKWVSASADQKS--------SPLSPV--EHLVGKVVLDIK--  415

Query  489  NEHERGNAEAHLNRSSSE  436
            NE  + N E     +SS+
Sbjct  416  NEEVKENKEDGTQVTSSQ  433



>gb|EYU35969.1| hypothetical protein MIMGU_mgv1a001057mg [Erythranthe guttata]
Length=901

 Score =   102 bits (255),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 16/129 (12%)
 Frame = -1

Query  846  LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
            L ++IV QIEYYFS+ NL  D YL   MDDQGWVP+ +IA FK +  L  +I  IL +++
Sbjct  311  LRARIVKQIEYYFSDKNLQGDHYLISLMDDQGWVPISIIAGFKMIRRLNVEIPFILDSLQ  370

Query  666  TSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNAN  487
             S  IEVQGEK+R RN+W KWI    V  S S  + A                ++++++N
Sbjct  371  VSETIEVQGEKVRRRNEWSKWIPVSLVSKSSSHVRDA----------------VNNDDSN  414

Query  486  EHERGNAEA  460
            E++R N E 
Sbjct  415  ENKRDNKET  423



>gb|KHG06515.1| La-related [Gossypium arboreum]
Length=904

 Score =   102 bits (255),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 77/135 (57%), Gaps = 15/135 (11%)
 Frame = -1

Query  948  MYYVP--------GPHPDSLV-MPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYFSNDN  796
            +YY+P        GPHP   V  PM           +      L + IV QIEYYFS+ N
Sbjct  257  VYYMPVAPPGSIRGPHPPRFVPYPM-----NPGTAMFPPETVTLRANIVKQIEYYFSDAN  311

Query  795  LIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKLRVRND  616
            L  D YL   MDD GWVP+  IA FK+V  ++ DIQ IL A+  S+ IEVQG+K+R R++
Sbjct  312  LRNDHYLISLMDDLGWVPIYKIADFKRVKRMSTDIQFILDALLVSSTIEVQGDKIRRRDE  371

Query  615  WKKWIVPPSVQYSIS  571
            W KW VP S + ++S
Sbjct  372  WSKW-VPASSKTALS  385



>ref|XP_001623976.1| predicted protein [Nematostella vectensis]
 gb|EDO31876.1| predicted protein [Nematostella vectensis]
Length=216

 Score = 97.4 bits (241),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 79/143 (55%), Gaps = 19/143 (13%)
 Frame = -1

Query  834  IVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTM  655
            I  QIEYYFS  NL KD +LRK+MDD+G++P+ LIA+F +V  LT D+ LIL  M+ S +
Sbjct  29   IKRQIEYYFSEANLHKDFFLRKQMDDEGYIPIALIASFYRVQALTHDMNLILETMKDSEI  88

Query  654  IEVQGEKLRVRNDWKKWIVPPSV-----------------QYSISSPQSARSPGS-DVLS  529
            +E+ G KLR + +   W +PP+                  QY+   P SA  PGS D  S
Sbjct  89   VELNGTKLRKKENPSVWPLPPNSPLTVQNTAIYSMPIGVDQYASGDPNSAY-PGSYDASS  147

Query  528  QHFQGVTLDDNNANEHERGNAEA  460
            Q+F      +   + HE  + EA
Sbjct  148  QNFSQEMEVEAVESTHEEASPEA  170



>emb|CDM30230.1| Winged helix-turn-helix transcription repressor DNA-binding [Penicillium 
roqueforti FM164]
Length=951

 Score =   102 bits (254),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 83/135 (61%), Gaps = 22/135 (16%)
 Frame = -1

Query  972  LVYP---EVHPMYYVPGPHPDSLVMPMLASpppgpPVFYQFLDPL-LLSKIVNQIEYYFS  805
            +VYP   +++ MY  P         PM A        + Q+++P  L++ +  Q+EYYFS
Sbjct  549  VVYPFPGDINTMYGYP-------AAPMSA------VPYQQYVEPFSLMNMLSMQLEYYFS  595

Query  804  NDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQ-GE---  637
             DN+ KDM+LRK+MD QG+VP+ ++A+FK+V  LT+D +LI H  R    +E Q GE   
Sbjct  596  VDNMCKDMFLRKQMDSQGFVPLNVLASFKRVKSLTEDFELIRHVSRQLRNVECQTGEDGV  655

Query  636  -KLRVRNDWKKWIVP  595
             +LR R+ W++W++P
Sbjct  656  DRLRPRDKWQQWVLP  670



>ref|XP_005650093.1| hypothetical protein COCSUDRAFT_65296 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25549.1| hypothetical protein COCSUDRAFT_65296 [Coccomyxa subellipsoidea 
C-169]
Length=1271

 Score =   102 bits (254),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 75/133 (56%), Gaps = 21/133 (16%)
 Frame = -1

Query  975  PLVYPEVHPMYYVPG----PHPDSLVMPMLASpppgpPVFYQFLDPLLLSKIVNQIEYYF  808
            PL +P V  MYY P     P   ++  P L                 +   +  QIEYYF
Sbjct  483  PLFFPTVSQMYYPPTAYGLPVTPAVNAPSLGQ---------------IEEAVRRQIEYYF  527

Query  807  SNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMRTSTMIEVQGEKL-  631
            S +NL KDM+LRK+MD +GW+P  +IA+F +V +LT D+ +IL A+R S ++E   +++ 
Sbjct  528  SVENLCKDMFLRKKMDGEGWIPTAVIASFNRVRMLTPDLAIILRALRGSPVVETSADQMS  587

Query  630  -RVRNDWKKWIVP  595
             R R+ W+ W++P
Sbjct  588  IRARDTWRNWVLP  600



>ref|XP_010093802.1| hypothetical protein L484_022514 [Morus notabilis]
 gb|EXB54653.1| hypothetical protein L484_022514 [Morus notabilis]
Length=856

 Score =   102 bits (253),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 78/137 (57%), Gaps = 2/137 (1%)
 Frame = -1

Query  846  LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
            L + I+ QIEYYFS++NL  D YL   MDDQGWVP+  IA FK+V  ++ DI  IL A+ 
Sbjct  306  LRAHIIKQIEYYFSDENLQNDHYLISLMDDQGWVPISTIADFKRVKKMSTDIPFILDALY  365

Query  666  TSTMIEVQGEKLRVRNDWKKWIVPPSVQYSISSPQSARSPGSDVLSQHFQGVTLDDNNAN  487
             S  +EV G+K+R R++W +WI P S   +++S +     G       F G   +D+N  
Sbjct  366  ASNTVEVLGDKIRRRDEWARWI-PASADSTLTS-KPVTLQGQLSQKPAFTGSDGNDDNKK  423

Query  486  EHERGNAEAHLNRSSSE  436
            +  + N +   N   SE
Sbjct  424  DTSKENVDLSRNDEKSE  440



>ref|XP_010535758.1| PREDICTED: la-related protein 1A [Tarenaya hassleriana]
Length=804

 Score =   101 bits (252),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -1

Query  846  LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
            L S+I+ Q+EYYFS++NL +D YL   MDD GWV    +A F+++  +T DIQ IL+A+R
Sbjct  269  LRSRIIKQVEYYFSDENLQRDRYLIALMDDYGWVLASKVAEFRRIKAMTTDIQFILYALR  328

Query  666  TSTMIEVQGEKLRVRNDWKKWI  601
             S+ +EVQG+K+R R+ W KWI
Sbjct  329  FSSSVEVQGDKMRRRDHWSKWI  350



>ref|XP_002455416.1| hypothetical protein SORBIDRAFT_03g010440 [Sorghum bicolor]
 gb|EES00536.1| hypothetical protein SORBIDRAFT_03g010440 [Sorghum bicolor]
Length=951

 Score =   101 bits (252),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -1

Query  846  LLSKIVNQIEYYFSNDNLIKDMYLRKEMDDQGWVPVRLIATFKKVAVLTDDIQLILHAMR  667
            L S I+ Q+EYYFS+ NL  D +L+  MD+ GWVPV  +A FK++  +T+DI LIL A+ 
Sbjct  325  LRSNILTQVEYYFSDTNLEHDDFLKSLMDEHGWVPVSKLADFKRLKKMTEDIHLILDALA  384

Query  666  TSTMIEVQGEKLRVRNDWKKWI  601
            +S+++EVQ EK+R R+DW KW+
Sbjct  385  SSSLLEVQDEKIRRRSDWSKWV  406



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7064379936204