BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14556_g1_i2 len=1381 path=[1:0-764 766:765-794 4642:795-849
851:850-1380]

Length=1381
                                                                      Score     E

emb|CDP01995.1|  unnamed protein product                                518   2e-180   
ref|XP_008452092.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    508   7e-177   
ref|XP_002282021.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    507   3e-176   Vitis vinifera
ref|XP_010102071.1|  hypothetical protein L484_009014                   506   7e-176   
gb|KDP38527.1|  hypothetical protein JCGZ_04452                         503   9e-175   
gb|KHG23300.1|  hypothetical protein F383_08437                         503   1e-174   
ref|XP_002510412.1|  Protein yrdA, putative                             502   2e-174   Ricinus communis
ref|XP_010029770.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    501   4e-174   
ref|XP_004146498.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    501   5e-174   
ref|XP_007046882.1|  Gamma carbonic anhydrase 1, CA1                    501   6e-174   
ref|XP_006878532.1|  hypothetical protein AMTR_s00011p00224870          501   7e-174   
ref|XP_008444737.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    501   9e-174   
ref|XP_009391607.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    500   1e-173   
ref|XP_010061298.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    499   2e-173   
gb|KHG00707.1|  hypothetical protein F383_22748                         499   3e-173   
ref|XP_010265678.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    499   3e-173   
gb|KDP38522.1|  hypothetical protein JCGZ_04447                         499   3e-173   
ref|XP_009588225.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    499   4e-173   
ref|XP_004152688.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    499   5e-173   
ref|XP_002510411.1|  Protein yrdA, putative                             498   6e-173   Ricinus communis
ref|XP_010263617.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    498   7e-173   
ref|XP_004160973.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    498   1e-172   
ref|XP_006346962.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    498   1e-172   
ref|XP_009772840.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    497   1e-172   
ref|XP_010922032.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    497   3e-172   
ref|XP_006466826.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    496   6e-172   
ref|XP_007017577.1|  Gamma carbonic anhydrase 1, CA1                    496   9e-172   
ref|XP_006425642.1|  hypothetical protein CICLE_v10026267mg             495   1e-171   
ref|XP_010931534.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    496   4e-171   
ref|XP_002302024.1|  transcription factor APFI family protein           493   7e-171   Populus trichocarpa [western balsam poplar]
ref|XP_011074556.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    493   8e-171   
ref|XP_006435021.1|  hypothetical protein CICLE_v10002155mg             493   1e-170   
ref|XP_008786862.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    493   1e-170   
ref|XP_006386210.1|  hypothetical protein POPTR_0002s03550g             493   2e-170   
ref|XP_010113421.1|  hypothetical protein L484_026755                   492   2e-170   
ref|XP_009386943.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    492   2e-170   
ref|XP_002306878.1|  transcription factor APFI family protein           491   4e-170   Populus trichocarpa [western balsam poplar]
ref|XP_004233530.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    491   4e-170   
ref|XP_007204711.1|  hypothetical protein PRUPE_ppa009928mg             491   7e-170   
ref|XP_009399949.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    491   8e-170   
ref|XP_004291863.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    490   1e-169   
ref|XP_011007461.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    489   2e-169   
ref|XP_008241708.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    488   9e-169   
ref|XP_008788543.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    487   2e-168   
emb|CDP07494.1|  unnamed protein product                                488   2e-168   
ref|XP_008338249.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    486   3e-168   
ref|XP_007222873.1|  hypothetical protein PRUPE_ppa009923mg             487   3e-168   
ref|XP_009799511.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    486   3e-168   
gb|KCW68228.1|  hypothetical protein EUGRSUZ_F01883                     486   4e-168   
ref|XP_009340721.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    486   4e-168   
ref|NP_001275071.1|  transcription factor APFI-like                     486   4e-168   
ref|XP_006383176.1|  hypothetical protein POPTR_0005s12280g             486   6e-168   
ref|XP_008220827.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    486   6e-168   
gb|AFK48594.1|  unknown                                                 485   1e-167   
ref|XP_009590737.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    484   4e-167   
ref|XP_008338081.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    483   5e-167   
ref|XP_003523810.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    483   6e-167   
ref|XP_010538097.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    483   1e-166   
gb|AFK46651.1|  unknown                                                 482   1e-166   
ref|XP_009365039.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    482   2e-166   
ref|XP_010679758.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    482   2e-166   
ref|XP_009336133.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    482   2e-166   
ref|XP_009371625.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    480   1e-165   
ref|XP_008810436.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    479   2e-165   
gb|AFK45344.1|  unknown                                                 479   3e-165   
ref|XP_011011740.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    479   4e-165   
ref|XP_009365536.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    478   5e-165   
ref|XP_004232424.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    478   6e-165   
ref|XP_008388037.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    477   1e-164   
ref|XP_006340643.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    477   1e-164   
ref|XP_009799510.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    478   2e-164   
ref|XP_008364986.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    475   1e-163   
ref|NP_001241093.1|  uncharacterized protein LOC100805278               472   2e-162   
ref|XP_011083663.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    469   1e-161   
ref|NP_564091.1|  gamma carbonic anhydrase 1                            469   2e-161   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43151.1|  unknown protein                                        468   7e-161   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61583.1|  unknown                                                 468   8e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011083204.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    466   2e-160   
ref|XP_004287879.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    465   8e-160   
ref|XP_010523601.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    465   1e-159   
dbj|BAD44607.1|  unknown protein                                        464   2e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305516.1|  hypothetical protein CARUB_v10009987mg             457   8e-157   
ref|XP_002890347.1|  F18O14.34                                          456   8e-156   
ref|XP_009612501.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    455   8e-156   
gb|KFK44104.1|  hypothetical protein AALP_AA1G216400                    454   1e-155   
ref|XP_006393603.1|  hypothetical protein EUTSA_v10011707mg             454   2e-155   
gb|AAF79435.1|AC025808_17  F18O14.34                                    454   3e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003517218.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    453   5e-155   
gb|KEH36170.1|  gamma carbonic anhydrase-like protein                   452   2e-154   
ref|XP_009771198.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    451   2e-154   
ref|XP_003567426.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    450   4e-154   
gb|KHN36089.1|  Hypothetical protein glysoja_003212                     450   7e-154   
ref|XP_004238283.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    449   1e-153   
gb|ACU23675.1|  unknown                                                 449   2e-153   Glycine max [soybeans]
ref|XP_002455477.1|  hypothetical protein SORBIDRAFT_03g011540          448   2e-153   Sorghum bicolor [broomcorn]
gb|AFK41197.1|  unknown                                                 448   3e-153   
ref|XP_003537599.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    448   4e-153   
ref|XP_006341958.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    447   8e-153   
ref|XP_010459631.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    447   8e-153   
gb|ACU19296.1|  unknown                                                 447   9e-153   Glycine max [soybeans]
gb|EYU45182.1|  hypothetical protein MIMGU_mgv1a011728mg                447   1e-152   
ref|NP_001066265.1|  Os12g0169700                                       446   2e-152   Oryza sativa Japonica Group [Japonica rice]
emb|CDX83758.1|  BnaC08g18870D                                          446   3e-152   
emb|CDY67628.1|  BnaCnng55730D                                          446   3e-152   
ref|XP_010477178.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    446   3e-152   
emb|CDM82924.1|  unnamed protein product                                445   4e-152   
ref|XP_010498381.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    445   5e-152   
emb|CDY47592.1|  BnaC08g04620D                                          444   1e-151   
ref|XP_009110271.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    444   2e-151   
emb|CDX96658.1|  BnaA08g22010D                                          444   2e-151   
ref|XP_007156970.1|  hypothetical protein PHAVU_002G032600g             444   2e-151   
ref|XP_008655471.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    443   2e-151   
ref|XP_003612060.1|  Transcription factor APFI-like protein             443   5e-151   
ref|NP_175159.1|  gamma carbonic anhydrase 2                            443   6e-151   Arabidopsis thaliana [mouse-ear cress]
emb|CDY17034.1|  BnaA08g03980D                                          442   8e-151   
ref|XP_006644073.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    442   9e-151   
ref|XP_006663861.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    442   1e-150   
ref|XP_002463275.1|  hypothetical protein SORBIDRAFT_02g041030          441   2e-150   Sorghum bicolor [broomcorn]
gb|EAZ04886.1|  hypothetical protein OsI_27068                          441   3e-150   Oryza sativa Indica Group [Indian rice]
ref|NP_001169012.1|  uncharacterized protein LOC100382844               440   7e-150   Zea mays [maize]
ref|XP_010500247.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    440   1e-149   
ref|XP_009145039.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    439   1e-149   
ref|XP_009107430.1|  PREDICTED: LOW QUALITY PROTEIN: gamma carbon...    439   1e-149   
ref|XP_004512067.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    439   1e-149   
gb|AAK28403.1|AF249876_1  transcription factor APFI                     439   3e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004958498.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    438   4e-149   
ref|XP_003562574.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    437   6e-149   
gb|EEC70424.1|  hypothetical protein OsI_01428                          437   7e-149   Oryza sativa Indica Group [Indian rice]
ref|XP_004967660.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    437   7e-149   
ref|XP_006304043.1|  hypothetical protein CARUB_v10009842mg             438   8e-149   
ref|NP_001042763.1|  Os01g0283100                                       437   9e-149   Oryza sativa Japonica Group [Japonica rice]
gb|KFK36155.1|  hypothetical protein AALP_AA4G085200                    437   9e-149   
ref|NP_001060439.1|  Os07g0642900                                       435   4e-148   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010679759.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    434   7e-148   
emb|CDY23649.1|  BnaA05g17800D                                          435   8e-148   
ref|XP_008672300.1|  PREDICTED: uncharacterized protein LOC100217...    431   2e-146   
gb|ACG35255.1|  transcription factor APFI                               427   5e-145   Zea mays [maize]
gb|ABK26184.1|  unknown                                                 425   4e-144   Picea sitchensis
gb|EPS62312.1|  hypothetical protein M569_12479                         424   6e-144   
gb|KCW68230.1|  hypothetical protein EUGRSUZ_F01883                     422   2e-143   
gb|EYU31197.1|  hypothetical protein MIMGU_mgv1a012119mg                422   3e-143   
ref|XP_010550419.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    423   3e-143   
gb|EPS71345.1|  hypothetical protein M569_03414                         421   1e-142   
dbj|BAK01732.1|  predicted protein                                      409   4e-138   
ref|XP_010484635.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    407   3e-137   
ref|XP_010444788.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    407   3e-137   
ref|XP_006393845.1|  hypothetical protein EUTSA_v10004794mg             403   1e-135   
dbj|BAB39954.1|  OSJNBa0004B13.8                                        403   1e-135   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010465384.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    402   4e-135   
ref|NP_569036.1|  gamma carbonic anhydrase 3                            401   6e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865062.1|  gamma CA3                                          396   9e-133   
gb|AFK09615.1|  gamma carbonic anhydrase 3                              395   1e-132   
ref|NP_001078808.1|  gamma carbonic anhydrase 3                         393   2e-131   Arabidopsis thaliana [mouse-ear cress]
gb|AFK09616.1|  gamma carbonic anhydrase 3                              391   1e-130   
ref|XP_002894036.1|  hypothetical protein ARALYDRAFT_891497             389   3e-130   
tpg|DAA63887.1|  TPA: hypothetical protein ZEAMMB73_753225              389   3e-130   
gb|AFK09618.1|  gamma carbonic anhydrase 3                              389   6e-130   
ref|XP_009103523.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    386   4e-129   
emb|CDY45234.1|  BnaA07g12560D                                          385   7e-129   
gb|ADQ43216.1|  GAMMA CA3/carbonate dehydratase                         383   9e-128   
emb|CDY50984.1|  BnaC02g48920D                                          382   2e-127   
gb|KFK28325.1|  hypothetical protein AALP_AA8G501300                    379   3e-126   
gb|EMT05784.1|  hypothetical protein F775_31542                         377   5e-126   
emb|CDY30772.1|  BnaC07g16720D                                          378   8e-126   
gb|ACG33606.1|  transcription factor APFI                               377   1e-125   Zea mays [maize]
gb|ACJ85087.1|  unknown                                                 375   4e-125   Medicago truncatula
ref|XP_006305517.1|  hypothetical protein CARUB_v10009987mg             371   2e-123   
gb|ACU22925.1|  unknown                                                 370   2e-123   Glycine max [soybeans]
ref|XP_002968991.1|  hypothetical protein SELMODRAFT_145865             368   1e-121   
emb|CDY55089.1|  BnaA02g34770D                                          366   3e-121   
gb|AFW79497.1|  hypothetical protein ZEAMMB73_562884                    361   6e-120   
emb|CBI17490.3|  unnamed protein product                                359   9e-119   
gb|KHG18626.1|  Protein YrdA                                            343   5e-113   
gb|KCW68231.1|  hypothetical protein EUGRSUZ_F01883                     338   9e-111   
ref|XP_007204710.1|  hypothetical protein PRUPE_ppa009928mg             330   3e-108   
gb|KDO84603.1|  hypothetical protein CISIN_1g0242241mg                  327   8e-107   
ref|XP_001776500.1|  predicted protein                                  328   3e-106   
ref|XP_007136608.1|  hypothetical protein PHAVU_009G0592001g            324   7e-106   
ref|XP_003612061.1|  Transcription factor APFI-like protein             322   5e-105   
ref|XP_008672301.1|  PREDICTED: uncharacterized protein LOC100217...    322   2e-104   
ref|XP_001758123.1|  predicted protein                                  322   1e-103   
dbj|BAB10927.1|  ferripyochelin-binding protein-like                    319   2e-103   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001137016.1|  uncharacterized protein LOC100217184               319   2e-103   Zea mays [maize]
ref|XP_001754319.1|  predicted protein                                  320   4e-103   
ref|NP_001185039.1|  gamma carbonic anhydrase 1                         318   4e-103   
tpg|DAA54233.1|  TPA: hypothetical protein ZEAMMB73_935334              318   6e-103   
ref|XP_002504597.1|  predicted protein                                  313   2e-100   Micromonas commoda
ref|XP_003059787.1|  predicted protein                                  298   1e-94    
ref|XP_010463232.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    294   6e-94    
gb|KHN45864.1|  Hypothetical protein glysoja_023087                     283   2e-89    
gb|AFK40628.1|  unknown                                                 277   3e-87    
gb|ACV52585.1|  transcription factor APFI-like protein                  271   1e-85    Nicotiana benthamiana
ref|XP_005644680.1|  gamma-carbonic anhydrase                           256   2e-78    
gb|KFM25989.1|  Uncharacterized protein F751_3627                       254   6e-78    
ref|XP_005847553.1|  hypothetical protein CHLNCDRAFT_35390              254   1e-77    
ref|XP_006416491.1|  hypothetical protein EUTSA_v10008724mg             250   2e-76    
ref|XP_005649920.1|  trimeric LpxA-like protein                         248   6e-76    
ref|XP_007136607.1|  hypothetical protein PHAVU_009G0592001g            242   1e-74    
ref|XP_006279533.1|  hypothetical protein CARUB_v10028265mg             242   4e-74    
ref|XP_010649292.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    236   1e-71    
gb|AFK37757.1|  unknown                                                 233   8e-71    
ref|XP_008871299.1|  hypothetical protein H310_07655                    233   9e-70    
ref|XP_005703463.1|  hypothetical protein Gasu_55130                    233   2e-69    
ref|XP_005536976.1|  transcription factor APFI                          231   4e-68    
ref|XP_009831264.1|  hypothetical protein H257_07436                    228   9e-68    
ref|XP_008608997.1|  hypothetical protein SDRG_05080                    228   1e-67    
gb|KDO22056.1|  hypothetical protein SPRG_12043                         228   1e-67    
gb|AAU93943.1|  gamma-carbonic anhydrase                                226   7e-67    Helicosporidium sp. ex Simulium jonesi
ref|XP_002673591.1|  gamma carbonic dehydratase                         225   2e-66    Naegleria gruberi strain NEG-M
emb|CCI47075.1|  unnamed protein product                                223   1e-65    
ref|XP_009149442.1|  PREDICTED: LOW QUALITY PROTEIN: gamma carbon...    219   7e-65    
ref|XP_005850191.1|  hypothetical protein CHLNCDRAFT_20587              218   4e-64    
gb|KDD73982.1|  hypothetical protein H632_c1679p0                       217   2e-63    
ref|XP_009523979.1|  hypothetical protein PHYSODRAFT_285582             216   4e-63    
emb|CCA20868.1|  conserved hypothetical protein                         215   8e-63    
ref|XP_001696746.1|  gamma carbonic anhydrase                           217   1e-62    Chlamydomonas reinhardtii
ref|XP_002908534.1|  conserved hypothetical protein                     214   1e-62    
ref|XP_008890951.1|  hypothetical protein PPTG_01107                    214   2e-62    
ref|XP_010461522.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    209   7e-62    
ref|XP_002956125.1|  hypothetical protein VOLCADRAFT_83469              214   1e-61    
dbj|GAM24838.1|  hypothetical protein SAMD00019534_080130               212   2e-61    
gb|ETI49161.1|  hypothetical protein F443_06919                         209   2e-60    
ref|XP_009516211.1|  hypothetical protein PHYSODRAFT_537494             209   3e-60    
ref|XP_008903478.1|  hypothetical protein PPTG_09984                    208   5e-60    
ref|XP_009821152.1|  hypothetical protein H257_00264                    206   2e-59    
gb|KFM26034.1|  Uncharacterized protein F751_3672                       205   4e-59    
ref|XP_008610617.1|  hypothetical protein SDRG_06605                    204   2e-58    
ref|XP_008862851.1|  hypothetical protein H310_01513                    204   2e-58    
ref|XP_002997211.1|  conserved hypothetical protein                     204   3e-58    
ref|WP_025898515.1|  carbonic anhydrase                                 199   1e-57    
ref|WP_002727628.1|  carbonic anhydrase                                 197   1e-56    
ref|WP_021132357.1|  carbonic anhydrase/acetyltransferase               197   1e-56    
gb|KDD72217.1|  hypothetical protein H632_c3683p0                       198   2e-56    
ref|XP_005713311.1|  carbonic anhydrase, gamma type                     198   5e-56    
emb|CCA17668.1|  conserved hypothetical protein                         197   9e-56    
emb|CCI50078.1|  unnamed protein product                                194   9e-55    
ref|WP_007091625.1|  MULTISPECIES: carbonic anhydrase                   191   2e-54    
dbj|GAM26691.1|  hypothetical protein SAMD00019534_098660               193   2e-54    
dbj|BAF32946.1|  putative gamma-type carbonic anhydrase                 192   3e-54    Pleurochrysis haptonemofera
ref|WP_028096230.1|  carbonic anhydrase                                 190   6e-54    
ref|XP_005766975.1|  gamma carbonic anhydrase                           190   2e-53    
ref|WP_008890933.1|  carbonic anhydrase                                 188   3e-53    
ref|WP_033067257.1|  carbonic anhydrase                                 188   3e-53    
emb|CBN79571.1|  gamma carbonic anhydrase                               192   4e-53    
ref|WP_028791231.1|  carbonic anhydrase                                 187   4e-53    
ref|WP_024080899.1|  putative hexapeptide repeat acetyltransferase      187   4e-53    
emb|CBK21456.2|  unnamed protein product                                187   1e-52    
ref|XP_002948065.1|  hypothetical protein VOLCADRAFT_73531              188   1e-52    
ref|XP_636871.1|  trimeric LpxA-like domain-containing protein          187   4e-52    Dictyostelium discoideum AX4
ref|XP_004351419.1|  trimeric LpxA-like domain-containing protein       187   5e-52    
ref|WP_011384197.1|  carbonic anhydrase                                 184   6e-52    
ref|WP_008614991.1|  carbonic anhydrase/acetyltransferase               184   6e-52    
gb|EWM27773.1|  Trimeric LpxA                                           186   1e-51    
ref|XP_001703237.1|  gamma carbonic anhydrase                           185   1e-51    Chlamydomonas reinhardtii
ref|WP_014102582.1|  carbonic anhydrase                                 183   2e-51    
ref|WP_008944647.1|  carbonic anhydrase                                 180   2e-50    
ref|XP_003289169.1|  hypothetical protein DICPUDRAFT_48414              182   3e-50    
gb|EWM28838.1|  Trimeric LpxA                                           182   5e-50    
ref|WP_038012874.1|  carbonic anhydrase                                 179   6e-50    
ref|WP_015467349.1|  carbonic anhydrase, family 3                       179   6e-50    
ref|XP_005706870.1|  hypothetical protein Gasu_22590                    181   7e-50    
ref|XP_004333657.1|  GAMMA CA3 (GAMMA CARBONIC ANHYDRASE 3), puta...    182   9e-50    
dbj|BAP00364.1|  hexapeptide transferase family protein                 178   1e-49    
ref|WP_029013145.1|  carbonic anhydrase                                 177   3e-49    
gb|AIL65550.1|  Gamma carbonic anhydrase-like protein                   177   3e-49    
ref|WP_011451453.1|  carbonic anhydrase                                 177   3e-49    
emb|CDR78889.1|  hexapeptide transferase family protein,hypotheti...    177   4e-49    
ref|XP_002179677.1|  predicted protein                                  177   4e-49    Phaeodactylum tricornutum CCAP 1055/1
ref|WP_010962614.1|  MULTISPECIES: carbonic anhydrase                   177   4e-49    
ref|WP_038604664.1|  hypothetical protein                               176   5e-49    
ref|WP_007548882.1|  MULTISPECIES: carbonic anhydrase                   176   5e-49    
gb|EFA76939.1|  trimeric LpxA-like domain-containing protein            178   5e-49    Heterostelium album PN500
ref|WP_027289020.1|  carbonic anhydrase                                 177   6e-49    
ref|WP_015838795.1|  acetyltransferase                                  176   7e-49    
ref|WP_015718917.1|  acetyltransferase                                  176   7e-49    
ref|WP_012779440.1|  carbonic anhydrase                                 176   9e-49    
ref|WP_012531949.1|  acetyltransferase                                  176   1e-48    
gb|AHX05058.1|  hexapeptide transferase family protein                  176   1e-48    
ref|WP_014857207.1|  acetyltransferase                                  176   1e-48    
ref|WP_026842119.1|  transferase                                        176   1e-48    
ref|WP_028794944.1|  carbonic anhydrase                                 175   1e-48    
ref|WP_015588968.1|  Hexapeptide transferase family protein             175   1e-48    
ref|WP_020593264.1|  hypothetical protein                               176   2e-48    
ref|WP_009542213.1|  carbonic anhydrase, family 3                       175   2e-48    
ref|WP_014074422.1|  carbonic anhydrase                                 174   5e-48    
ref|WP_007302594.1|  MULTISPECIES: carbonic anhydrase                   174   5e-48    
ref|WP_034842867.1|  carbonic anhydrase                                 173   8e-48    
ref|WP_011390173.1|  carbonic anhydrase                                 174   8e-48    
ref|WP_038251016.1|  carbonic anhydrase                                 173   1e-47    
emb|CEI84790.1|  Transferase hexapeptide repeat                         172   1e-47    
ref|WP_038538794.1|  hypothetical protein                               172   2e-47    
ref|WP_007547159.1|  acetyltransferase                                  172   2e-47    
ref|WP_019644631.1|  hypothetical protein                               172   2e-47    
ref|WP_012459916.1|  acetyltransferase                                  172   2e-47    
ref|WP_024072448.1|  carbonic anhydrase                                 171   3e-47    
ref|WP_014804134.1|  acetyltransferase                                  172   3e-47    
gb|AAL08813.1|AF308663_1  hypothetical ferripyochelin binding pro...    171   4e-47    
emb|CCQ74394.1|  Conserved hypothetical protein yrdA                    171   5e-47    
ref|WP_011256488.1|  carbonic anhydrase                                 171   5e-47    
ref|WP_011451237.1|  carbonic anhydrase                                 171   5e-47    
ref|WP_011155500.1|  carbonic anhydrase                                 171   6e-47    
pdb|3IXC|A  Chain A, Crystal Structure Of Hexapeptide Transferase...    171   6e-47    
dbj|GAK32523.1|  gamma carbonic anhydrase 2, mitochondrial              171   6e-47    
ref|WP_015588396.1|  Hexapeptide transferase family protein             171   7e-47    
ref|WP_006961722.1|  carbonic anhydrase, family 3                       171   8e-47    
ref|WP_020849118.1|  carbonic anhydrase                                 171   8e-47    
ref|WP_017532531.1|  carbonic anhydrase                                 171   9e-47    
ref|XP_007136612.1|  hypothetical protein PHAVU_009G0594001g            167   1e-46    
ref|WP_006012476.1|  carbonic anhydrase                                 171   1e-46    
ref|XP_007136610.1|  hypothetical protein PHAVU_009G0592000g            167   1e-46    
gb|ETO91753.1|  carbonic anhydrases/acetyltransferase, isoleucine...    170   1e-46    
ref|WP_017184183.1|  hypothetical protein                               171   1e-46    
emb|CBN75766.1|  putative carbonic anhydrase                            171   1e-46    
ref|WP_014745465.1|  carbonic anhydrase                                 171   1e-46    
ref|WP_038528172.1|  carbonic anhydrase                                 170   2e-46    
ref|WP_035673275.1|  carbonic anhydrase                                 170   2e-46    
ref|WP_012675364.1|  acetyltransferase                                  170   2e-46    
ref|WP_026149599.1|  carbonic anhydrase                                 170   2e-46    
ref|WP_014415395.1|  carbonic anhydrase                                 170   2e-46    
gb|EZQ08771.1|  carbonic anhydrase                                      170   2e-46    
ref|WP_010404888.1|  carbonic anhydrase                                 170   2e-46    
ref|WP_039455831.1|  hypothetical protein                               169   2e-46    
emb|CEG20404.1|  Carbonic anhydrases/Acetyltransferase, isoleucin...    169   2e-46    
ref|WP_011255915.1|  carbonic anhydrase                                 169   2e-46    
ref|XP_002290563.1|  predicted protein                                  173   2e-46    
ref|WP_014240250.1|  carbonic anhydrase                                 169   3e-46    
ref|WP_019014984.1|  hypothetical protein                               169   3e-46    
ref|WP_006010492.1|  carbonic anhydrase                                 169   3e-46    
gb|KDO84602.1|  hypothetical protein CISIN_1g0242242mg                  166   3e-46    
ref|WP_012674376.1|  acetyltransferase                                  168   6e-46    
ref|WP_039673101.1|  acetyltransferase                                  168   6e-46    
ref|WP_022679800.1|  carbonic anhydrase                                 168   6e-46    
ref|WP_028465013.1|  carbonic anhydrase                                 168   9e-46    
ref|WP_007673447.1|  carbonic anhydrase                                 167   2e-45    
ref|WP_028167811.1|  carbonic anhydrase                                 167   2e-45    
ref|WP_026873762.1|  carbonic anhydrase                                 167   2e-45    
ref|WP_006312037.1|  carbonic anhydrase, family 3                       167   2e-45    
emb|CAI45895.1|  putative transcription factor APF1-like protein        170   2e-45    
ref|WP_012525566.1|  acetyltransferase                                  166   3e-45    
ref|XP_004368305.1|  gamma carbonic anhydrase                           169   3e-45    
ref|WP_012632885.1|  acetyltransferase                                  166   4e-45    
ref|WP_014967886.1|  hypothetical protein                               166   4e-45    
ref|WP_014187883.1|  carbonic anhydrase                                 166   4e-45    
ref|WP_037959567.1|  acetyltransferase                                  166   4e-45    
ref|WP_037263136.1|  carbonic anhydrase                                 166   4e-45    
ref|WP_026986265.1|  carbonic anhydrase                                 166   5e-45    
ref|WP_002579471.1|  hypothetical protein                               166   5e-45    
ref|WP_012976601.1|  carbonic anhydrase                                 167   5e-45    
ref|WP_029522898.1|  transferase                                        166   5e-45    
ref|WP_011304966.1|  carbonic anhydrase                                 166   5e-45    
ref|WP_038558699.1|  carbonic anhydrase                                 166   6e-45    
ref|WP_035762541.1|  transferase                                        165   6e-45    
ref|WP_022726936.1|  carbonic anhydrase                                 166   8e-45    
ref|WP_013275402.1|  hypothetical protein                               165   1e-44    
ref|WP_008289121.1|  acetyltransferase                                  165   1e-44    
ref|WP_023839484.1|  carbonic anhydrase                                 166   1e-44    
ref|WP_028951275.1|  transferase                                        165   1e-44    
ref|WP_011421405.1|  acetyltransferase                                  164   2e-44    
ref|WP_015459439.1|  carbonic anhydrase                                 165   2e-44    
ref|WP_029520498.1|  transferase                                        164   2e-44    
ref|WP_021802336.1|  hexapeptide repeat-containing transferase          164   2e-44    
ref|WP_026893964.1|  hypothetical protein                               163   4e-44    
ref|WP_008069326.1|  carbonic anhydrase                                 164   4e-44    
ref|WP_034879021.1|  anhydrase                                          164   4e-44    
ref|WP_012975468.1|  carbonic anhydrase                                 164   4e-44    
ref|WP_031556442.1|  carbonic anhydrase                                 164   4e-44    
ref|WP_033926467.1|  carbonic anhydrase                                 164   4e-44    
ref|WP_011443735.1|  carbonic anhydrase                                 164   4e-44    
ref|WP_011312944.1|  hypothetical protein                               164   5e-44    
ref|XP_005850061.1|  hypothetical protein CHLNCDRAFT_34352              165   5e-44    
ref|WP_017670191.1|  hypothetical protein                               163   6e-44    
ref|WP_023388735.1|  carbonic anhydrase                                 163   6e-44    
gb|EXS70289.1|  carbonic anhydrase                                      163   7e-44    
gb|AHJ13495.1|  hexapeptide repeat-containing transferase               162   8e-44    
gb|EJK68540.1|  hypothetical protein THAOC_10267                        166   9e-44    
ref|WP_027308041.1|  hypothetical protein                               162   1e-43    
ref|WP_030572426.1|  anhydrase                                          162   1e-43    
ref|WP_010881079.1|  acetyltransferase                                  162   1e-43    
ref|XP_976599.2|  hypothetical protein TTHERM_00541460                  164   1e-43    
ref|WP_013779035.1|  hypothetical protein                               162   1e-43    
ref|WP_029009955.1|  carbonic anhydrase                                 162   1e-43    
ref|WP_011951931.1|  MULTISPECIES: carbonic anhydrase                   162   1e-43    
ref|WP_035291537.1|  hypothetical protein                               162   2e-43    
ref|XP_004031346.1|  transcription factor apfi, putative                167   2e-43    
gb|EMT05904.1|  hypothetical protein F775_31226                         159   2e-43    
ref|WP_030358647.1|  MULTISPECIES: anhydrase                            162   2e-43    
ref|WP_011937143.1|  acetyltransferase                                  162   2e-43    
ref|WP_028262838.1|  hypothetical protein                               162   2e-43    
ref|WP_011480697.1|  hypothetical protein                               161   2e-43    
gb|EMT05905.1|  hypothetical protein F775_31227                         158   3e-43    
ref|WP_004212025.1|  hypothetical protein                               162   3e-43    
ref|WP_008102791.1|  carbonic anhydrase                                 161   3e-43    
ref|WP_008518447.1|  anhydrase                                          161   3e-43    
ref|WP_035161340.1|  acetyltransferase                                  161   3e-43    
ref|WP_037456495.1|  carbonic anhydrase                                 161   3e-43    
ref|WP_010127464.1|  carbonic anhydrase                                 161   3e-43    
ref|WP_029665451.1|  MULTISPECIES: hypothetical protein                 160   3e-43    
ref|WP_012857370.1|  acetyltransferase                                  160   4e-43    
ref|WP_022678453.1|  carbonic anhydrase                                 161   4e-43    
ref|WP_035921995.1|  carbonic anhydrase                                 160   5e-43    
ref|WP_020399040.1|  hypothetical protein                               161   6e-43    
ref|WP_005007542.1|  putative Transferase, hexapeptide repeat pro...    160   6e-43    
ref|WP_020403893.1|  hypothetical protein                               160   6e-43    
ref|WP_029134829.1|  anhydrase                                          160   6e-43    
ref|WP_020968974.1|  MULTISPECIES: hypothetical protein                 160   7e-43    
ref|WP_006156211.1|  carbonic anhydrase                                 160   7e-43    
ref|WP_018843658.1|  hypothetical protein                               160   8e-43    
ref|WP_037331584.1|  anhydrase                                          160   8e-43    
ref|WP_017442977.1|  carbonic anhydrase                                 160   8e-43    
gb|KFM29265.1|  Gamma carbonic anhydrase-like 1, mitochondrial          163   9e-43    
ref|WP_037507860.1|  carbonic anhydrase                                 160   9e-43    
gb|AIR97075.1|  transferase hexapeptide repeat protein                  160   9e-43    
gb|KEI43879.1|  anhydrase                                               159   1e-42    
ref|WP_021343479.1|  anhydrase                                          160   1e-42    
ref|WP_011876861.1|  anhydrase                                          159   1e-42    
ref|WP_024021755.1|  carbonic anhydrase                                 160   1e-42    
ref|WP_033236431.1|  anhydrase                                          160   1e-42    
ref|WP_037672466.1|  anhydrase                                          159   1e-42    
ref|WP_027769996.1|  anhydrase                                          160   1e-42    
ref|XP_005831500.1|  hypothetical protein GUITHDRAFT_152983             162   1e-42    
ref|WP_017502329.1|  carbonic anhydrase                                 160   1e-42    
ref|WP_008599387.1|  carbonic anhydrase, family 3                       159   1e-42    
ref|WP_012151920.1|  carbonic anhydrase                                 159   1e-42    
ref|WP_010337969.1|  carbonic anhydrase                                 160   1e-42    
ref|WP_029209748.1|  carbonic anhydrase                                 159   1e-42    
ref|WP_011713109.1|  anhydrase                                          159   1e-42    
ref|WP_037466843.1|  carbonic anhydrase                                 160   2e-42    
ref|WP_004451262.1|  hypothetical protein                               159   2e-42    
ref|WP_037475946.1|  carbonic anhydrase                                 160   2e-42    
ref|WP_007473220.1|  acetyltransferase                                  159   2e-42    
ref|WP_039333376.1|  carbonic anhydrase                                 159   2e-42    
ref|WP_018853077.1|  anhydrase                                          159   2e-42    
ref|WP_027767659.1|  anhydrase                                          159   2e-42    
ref|WP_039594985.1|  carbonic anhydrase                                 159   2e-42    
ref|WP_011190955.1|  carbonic anhydrase                                 159   2e-42    
ref|WP_015027264.1|  acetyltransferase                                  159   3e-42    
ref|WP_008286511.1|  acetyltransferase                                  159   3e-42    
ref|WP_022969448.1|  carbonic anhydrase                                 159   3e-42    
ref|WP_014189001.1|  carbonic anhydrase                                 159   3e-42    
ref|WP_010203259.1|  anhydrase                                          159   3e-42    
ref|WP_027279711.1|  carbonic anhydrase                                 159   3e-42    
ref|WP_028862390.1|  anhydrase                                          159   3e-42    
ref|WP_034212652.1|  carbonic anhydrase                                 158   3e-42    
ref|WP_037232718.1|  anhydrase                                          159   3e-42    
ref|WP_030678503.1|  anhydrase                                          158   4e-42    
ref|WP_015888890.1|  anhydrase                                          158   4e-42    
ref|WP_028071120.1|  acetyltransferase                                  158   4e-42    
ref|WP_028970913.1|  carbonic anhydrase                                 158   4e-42    
ref|WP_035867665.1|  anhydrase                                          158   4e-42    
ref|WP_034327444.1|  acetyltransferase                                  157   5e-42    
dbj|GAF45864.1|  hypothetical protein RW1_027_00030                     158   5e-42    
ref|WP_003941993.1|  MULTISPECIES: anhydrase                            158   6e-42    
ref|WP_013459351.1|  acetyltransferase                                  158   6e-42    
ref|WP_003449781.1|  hypothetical protein                               157   6e-42    
ref|WP_007706893.1|  carbonic anhydrase                                 158   6e-42    
ref|WP_037741391.1|  anhydrase                                          157   7e-42    
ref|WP_030052744.1|  anhydrase                                          157   7e-42    
ref|WP_014273487.1|  carbonic anhydrase                                 157   8e-42    
ref|WP_010933557.1|  acetyltransferase                                  157   8e-42    
ref|WP_011271028.1|  carbonic anhydrase                                 157   8e-42    
ref|WP_018128352.1|  hypothetical protein                               157   8e-42    
ref|WP_023508154.1|  Gamma carbonic anhydrase-like                      157   9e-42    
ref|WP_003988790.1|  anhydrase                                          157   9e-42    
ref|WP_013638500.1|  acetyltransferase                                  157   9e-42    
ref|WP_007278575.1|  anhydrase                                          157   1e-41    
ref|WP_034224390.1|  carbonic anhydrase                                 157   1e-41    
ref|WP_031077244.1|  anhydrase                                          157   1e-41    
gb|KIH77451.1|  hypothetical protein GFER_01605                         157   1e-41    
ref|WP_006802971.1|  acetyltransferase                                  157   1e-41    
ref|WP_003478224.1|  hypothetical protein                               156   1e-41    
ref|WP_012344944.1|  hypothetical protein                               156   1e-41    
ref|XP_009033998.1|  hypothetical protein AURANDRAFT_21261              158   1e-41    
ref|WP_036212108.1|  carbonic anhydrase                                 157   1e-41    
ref|XP_009042543.1|  hypothetical protein AURANDRAFT_34918              157   1e-41    
ref|WP_014769836.1|  acetyltransferase                                  157   1e-41    
ref|WP_009603885.1|  carbonic anhydrase                                 157   1e-41    
ref|WP_007286262.1|  hypothetical protein                               157   2e-41    
ref|WP_028640743.1|  carbonic anhydrase                                 157   2e-41    
ref|WP_025648232.1|  hypothetical protein                               156   2e-41    
ref|XP_004034789.1|  hypothetical protein IMG5_113400                   158   2e-41    
ref|WP_027852014.1|  anhydrase                                          157   2e-41    
ref|WP_037711077.1|  anhydrase                                          156   2e-41    
ref|WP_016420685.1|  hypothetical protein                               156   2e-41    
ref|WP_012991920.1|  acetyltransferase                                  156   2e-41    
ref|WP_028428544.1|  anhydrase                                          156   2e-41    
ref|WP_033917060.1|  acetyltransferase                                  156   2e-41    
ref|WP_011631675.1|  carbonic anhydrase                                 156   2e-41    
ref|WP_021626927.1|  bacterial transferase hexapeptide repeat pro...    156   2e-41    
ref|WP_018837814.1|  anhydrase                                          156   2e-41    
ref|WP_019548812.1|  hypothetical protein                               157   2e-41    
ref|XP_002670954.1|  predicted protein                                  161   2e-41    
ref|WP_004461421.1|  hypothetical protein                               156   2e-41    
ref|WP_008580447.1|  MULTISPECIES: carbonic anhydrase                   156   2e-41    
emb|CDY29419.1|  BnaA06g13770D                                          156   2e-41    
ref|WP_021194724.1|  hypothetical protein                               156   2e-41    
ref|WP_002680075.1|  acetyltransferase                                  155   2e-41    
ref|WP_012663737.1|  acetyltransferase                                  156   2e-41    
ref|WP_036137613.1|  carbonic anhydrase                                 156   2e-41    
ref|WP_008907439.1|  hypothetical protein                               155   3e-41    
ref|WP_034724826.1|  acetyltransferase                                  155   3e-41    



>emb|CDP01995.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   518 bits (1333),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 246/271 (91%), Positives = 257/271 (95%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MGSLGRA YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGSLGRAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASI+GDVQVGR SSIWYGCVLRGDVNSISIG GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIVGDVQVGRSSSIWYGCVLRGDVNSISIGTGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EEIAFISQSA NYSNLAQVHA ENAK FDEIEFEKVLRKKFARKDE
Sbjct  181   WGGNPAKFLRKLTDEEIAFISQSALNYSNLAQVHAAENAKGFDEIEFEKVLRKKFARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLGVVRETP ELILPDN+LPDKA KA+
Sbjct  241   EYDSMLGVVRETPPELILPDNVLPDKAPKAS  271



>ref|XP_008452092.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Cucumis 
melo]
Length=271

 Score =   508 bits (1309),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 238/271 (88%), Positives = 257/271 (95%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P ++++AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVINKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRMSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCT+EDEAFVGMGATLLDGV VEK+AMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTIEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEE+AFISQSA NYSNL+QVHA EN KSFDEIEFEKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEEEMAFISQSAINYSNLSQVHAAENVKSFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             DYDSMLGVVRETP ELILPDNIL DK AK++
Sbjct  241   DYDSMLGVVRETPSELILPDNILADKVAKSS  271



>ref|XP_002282021.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Vitis vinifera]
 emb|CAN79636.1| hypothetical protein VITISV_014473 [Vitis vinifera]
 emb|CBI19719.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   507 bits (1305),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 240/271 (89%), Positives = 256/271 (94%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQ+SRHR LMNLFDK P V ++AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFLEQISRHRTLMNLFDKAPIVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDG +VEK+AMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGSIVEKHAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EEIAFISQSA NYSNLAQVHA ENAK FDEIEFEKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTDEEIAFISQSAINYSNLAQVHAAENAKPFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             DYDSMLGVVRETP ELILPDNILPDKA K +
Sbjct  241   DYDSMLGVVRETPPELILPDNILPDKAPKVS  271



>ref|XP_010102071.1| hypothetical protein L484_009014 [Morus notabilis]
 gb|EXB91921.1| hypothetical protein L484_009014 [Morus notabilis]
Length=272

 Score =   506 bits (1303),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 240/271 (89%), Positives = 255/271 (94%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVN ISIGAGTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNGISIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPFGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEE+AF+SQSA NYSNLAQVHA ENAK FDEIEFEKVLRKKFA +DE
Sbjct  181   WGGNPAKFLRKLTEEEMAFVSQSATNYSNLAQVHAAENAKPFDEIEFEKVLRKKFAHRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLGVVRETP EL+LPDNILPDKA KA+
Sbjct  241   EYDSMLGVVRETPPELVLPDNILPDKAPKAS  271



>gb|KDP38527.1| hypothetical protein JCGZ_04452 [Jatropha curcas]
Length=271

 Score =   503 bits (1295),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 240/270 (89%), Positives = 255/270 (94%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+F+K P V +EAF
Sbjct  1     MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFNKAPVVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVN+ISIGAGTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNNISIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             ++G+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   LVGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPAGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA FLRKLT+EEIAFISQSA NYSNLAQVHA ENAK FDEIEFEKVLRKKFAR+DE
Sbjct  181   WGGNPANFLRKLTDEEIAFISQSAINYSNLAQVHAAENAKPFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRETP ELILPDN+LPDKA KA
Sbjct  241   EYDSMLGVVRETPPELILPDNVLPDKAPKA  270



>gb|KHG23300.1| hypothetical protein F383_08437 [Gossypium arboreum]
Length=271

 Score =   503 bits (1294),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 238/269 (88%), Positives = 254/269 (94%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQ LDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQTLDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPVVDRDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVGR SSIWYGCVLRGDVN+ISIG+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVQVGRGSSIWYGCVLRGDVNNISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEE+AFISQSA NYSNLAQVHA ENAKSFDEIEFEK+LRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEEEMAFISQSALNYSNLAQVHAAENAKSFDEIEFEKMLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLGVVRETP ELILPDNILP+K  K
Sbjct  241   EYDSMLGVVRETPPELILPDNILPNKVPK  269



>ref|XP_002510412.1| Protein yrdA, putative [Ricinus communis]
 gb|EEF52599.1| Protein yrdA, putative [Ricinus communis]
Length=271

 Score =   502 bits (1293),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 236/270 (87%), Positives = 254/270 (94%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y++GFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAIYSIGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR +SIWYGCVLRGDVNSISIG+GTNIQDN+LVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGASIWYGCVLRGDVNSISIGSGTNIQDNTLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMG TLLDGVVVEKNAMVAAGALVRQNT+IP GEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGTTLLDGVVVEKNAMVAAGALVRQNTKIPAGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLT+EEIAFI QSA NYSNLAQVHA ENAK FDEIEFEKVLRKKFAR+DE
Sbjct  181   WGGNPARFLRKLTDEEIAFIMQSATNYSNLAQVHATENAKPFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRETP ELILPDN+LPDKA KA
Sbjct  241   EYDSMLGVVRETPPELILPDNVLPDKAPKA  270



>ref|XP_010029770.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Eucalyptus 
grandis]
 gb|KCW56730.1| hypothetical protein EUGRSUZ_I02417 [Eucalyptus grandis]
Length=271

 Score =   501 bits (1291),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 236/271 (87%), Positives = 255/271 (94%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A Y+VGFWIRETGQALDRLGCRLQG+YYF EQLSRHR LMN+FDK P + ++ F
Sbjct  1     MGTLGKAIYSVGFWIRETGQALDRLGCRLQGSYYFQEQLSRHRTLMNVFDKAPVIDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGD+Q+GR SSIWYGCVLRGDVN+ISIGAGTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDIQIGRGSSIWYGCVLRGDVNNISIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AMVAAGALVRQNTR+PCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRVPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEE+AFISQSA NYSNLAQVHA ENAKSFDEIEFEKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEEEMAFISQSAVNYSNLAQVHAAENAKSFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLGVVRETP ELILPDNIL DK  KAT
Sbjct  241   EYDSMLGVVRETPPELILPDNILQDKLQKAT  271



>ref|XP_004146498.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis 
sativus]
 gb|KGN53299.1| hypothetical protein Csa_4G046620 [Cucumis sativus]
Length=271

 Score =   501 bits (1290),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 235/271 (87%), Positives = 254/271 (94%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCT+EDEAFVGMGATLLDGV VEK+AMVAAGALVRQNTR+PCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTIEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRVPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEE+ FISQSA NYSNL+QVHA EN KSFDEIE EKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEEEMVFISQSAINYSNLSQVHAAENVKSFDEIELEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             DYDSMLGVVRETP EL+LPDNIL DK AK++
Sbjct  241   DYDSMLGVVRETPPELVLPDNILADKVAKSS  271



>ref|XP_007046882.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
 gb|EOX91039.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
Length=271

 Score =   501 bits (1290),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 239/269 (89%), Positives = 254/269 (94%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+F+K P V R+AF
Sbjct  1     MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFNKAPVVDRDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVNSISIG+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEE+AFISQSA NYSNLAQVHA ENAKSFDEIEFEKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEEEMAFISQSALNYSNLAQVHAAENAKSFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLGVVRE P ELILPDNIL DK +K
Sbjct  241   EYDSMLGVVREMPPELILPDNILADKVSK  269



>ref|XP_006878532.1| hypothetical protein AMTR_s00011p00224870 [Amborella trichopoda]
 gb|ERM94677.1| hypothetical protein AMTR_s00011p00224870 [Amborella trichopoda]
Length=273

 Score =   501 bits (1290),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 236/271 (87%), Positives = 253/271 (93%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDKVP V ++AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKVPHVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDV+VG  SSIWYGCVLRGDVNSIS+G GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVKVGHGSSIWYGCVLRGDVNSISVGTGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+ MVAAGALVRQNT+IPCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTKIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEEIAFISQSA NY NLAQVHA ENAK F+EIEFEKVLRKKFARKDE
Sbjct  181   WGGNPAKFLRKLTEEEIAFISQSATNYMNLAQVHAAENAKPFEEIEFEKVLRKKFARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
              YDSMLG+VRE P EL+LPDNILPDKA KA+
Sbjct  241   AYDSMLGIVREVPPELVLPDNILPDKAKKAS  271



>ref|XP_008444737.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Cucumis 
melo]
Length=273

 Score =   501 bits (1289),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 236/269 (88%), Positives = 253/269 (94%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLGCRLQG Y+F EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAIYTVGFWIRETGQAIDRLGCRLQGRYFFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAV+HGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNT+IP GEV
Sbjct  121   IIGDNVTIGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTKIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EEIAFISQSA NY NLAQVHA ENAKSFDEIEFEKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTDEEIAFISQSATNYLNLAQVHAAENAKSFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             DYDSMLG+VRETP ELILPDNILPDK  K
Sbjct  241   DYDSMLGIVRETPPELILPDNILPDKDPK  269



>ref|XP_009391607.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=274

 Score =   500 bits (1288),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 234/271 (86%), Positives = 256/271 (94%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDKVP+VH++AF
Sbjct  1     MGTLGRAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKVPNVHKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG+ SSIWYGCVLRGDVNSI +G+GTNIQDNSLVHVAKSNL GKVL T
Sbjct  61    VAPSASVIGDVQVGQGSSIWYGCVLRGDVNSIHVGSGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGH+AVLHGCTVEDE FVGMG+ LLDGVVVEK+ MVAAGALVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHNAVLHGCTVEDETFVGMGSVLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EEIAFISQSA NY+NLAQVHA ENAKSFDEIEFEKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTDEEIAFISQSATNYANLAQVHAAENAKSFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLGVVRE PQELILPDNILP+K+ K +
Sbjct  241   EYDSMLGVVREVPQELILPDNILPNKSPKPS  271



>ref|XP_010061298.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Eucalyptus 
grandis]
 gb|KCW68229.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=273

 Score =   499 bits (1286),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 236/269 (88%), Positives = 252/269 (94%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAIYTVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+ MVA GALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAGGALVRQNTRIPAGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEE+AFI+QSA NYSNLAQVHA ENAK FDEIEFEKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEEEVAFITQSATNYSNLAQVHAAENAKPFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLGVVRETP ELILPDN+LP KA K
Sbjct  241   EYDSMLGVVRETPPELILPDNVLPGKAPK  269



>gb|KHG00707.1| hypothetical protein F383_22748 [Gossypium arboreum]
Length=271

 Score =   499 bits (1286),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 236/270 (87%), Positives = 253/270 (94%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPIVDRDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDV+VGR SSIWYGCVLRGDVNSISIG+GTNIQDNSLVHVAKSNL+ KVL T
Sbjct  61    VAPSASVIGDVKVGRSSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSRKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEE+ FISQSA NY+NLAQVHA ENAKSFDEIE E +LRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEEEMTFISQSALNYTNLAQVHAAENAKSFDEIELEMMLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRETP ELILPDNI+PDKA KA
Sbjct  241   EYDSMLGVVRETPPELILPDNIIPDKAPKA  270



>ref|XP_010265678.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Nelumbo 
nucifera]
Length=271

 Score =   499 bits (1285),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 234/271 (86%), Positives = 254/271 (94%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDTF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AMVAAGALVRQNTRIPCGE+
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPCGEI  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEEIAFISQSA NYSNLAQ HA ENAK+FDEIE EKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEEEIAFISQSAINYSNLAQAHAAENAKTFDEIELEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLGVVRE P +LILPD+ILP ++ KA+
Sbjct  241   EYDSMLGVVREVPPQLILPDSILPKESTKAS  271



>gb|KDP38522.1| hypothetical protein JCGZ_04447 [Jatropha curcas]
Length=272

 Score =   499 bits (1285),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 237/270 (88%), Positives = 253/270 (94%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQALDRLGCR QGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1     MGTLGKAIYTVGFWIRETGQALDRLGCRFQGNYYFQEQLSRHRTLMNIFDKAPVVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SS+WYGCVLRGDVNSIS+GAGTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSVWYGCVLRGDVNSISVGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVFVEKHAMVAAGALVRQNTRIPAGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EEIAFISQSAANYSNLAQVHA ENAK FDEIEFEK+LRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTDEEIAFISQSAANYSNLAQVHAAENAKPFDEIEFEKLLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRETP ELILPD +LP+KA  A
Sbjct  241   EYDSMLGVVRETPPELILPDKVLPNKAPLA  270



>ref|XP_009588225.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=268

 Score =   499 bits (1284),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 237/268 (88%), Positives = 252/268 (94%), Gaps = 0/268 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHE LSRHR LMNLFDKVP V ++AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQAMDRLGCRLQGNYYFHEHLSRHRTLMNLFDKVPMVAKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDV VGR++SIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASLIGDVHVGRNASIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG VVEKNAMVAAGALVRQ TRIPCGEV
Sbjct  121   IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGAVVEKNAMVAAGALVRQKTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTEEEIAFISQSAANY+NLAQVHA ENAKSFD IEFEKVLRKKFARKDE
Sbjct  181   WGGNPARFLRKLTEEEIAFISQSAANYTNLAQVHAAENAKSFDAIEFEKVLRKKFARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAA  301
             +YDSMLGV R+TP ELILPDNI   KA+
Sbjct  241   EYDSMLGVDRQTPPELILPDNIQAPKAS  268



>ref|XP_004152688.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis 
sativus]
 ref|XP_004167040.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis 
sativus]
 gb|KGN62616.1| hypothetical protein Csa_2G361800 [Cucumis sativus]
Length=273

 Score =   499 bits (1284),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 235/269 (87%), Positives = 253/269 (94%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQA+DRLGCRLQG Y+F EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGRYFFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAV+HGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNT+IP GEV
Sbjct  121   IIGDNVTIGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTKIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EEIAFISQSA NY NL+QVHA ENAKSFDEIEFEKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTDEEIAFISQSATNYLNLSQVHAAENAKSFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             DYDSMLGVVRETP ELILPDNILPDK  K
Sbjct  241   DYDSMLGVVRETPPELILPDNILPDKDPK  269



>ref|XP_002510411.1| Protein yrdA, putative [Ricinus communis]
 gb|EEF52598.1| Protein yrdA, putative [Ricinus communis]
Length=271

 Score =   498 bits (1283),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 235/270 (87%), Positives = 253/270 (94%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQALDRLGCR QG+YYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAIYTVGFWIRETGQALDRLGCRFQGSYYFQEQLSRHRTLMNIFDKAPMVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVG+ +SIWYGCVLRGDVNSIS+GAGTNIQDNSLVHVAKSNL+GKV+ T
Sbjct  61    VAPSASIIGDVQVGKGASIWYGCVLRGDVNSISVGAGTNIQDNSLVHVAKSNLSGKVIPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+ MVAAGALVRQNT+IP GEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTKIPAGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EEIAFISQSA NYSNLAQVHA ENAK FDEIEFEKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTDEEIAFISQSATNYSNLAQVHAAENAKPFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRETP ELILPDN+LPDK  KA
Sbjct  241   EYDSMLGVVRETPPELILPDNVLPDKEQKA  270



>ref|XP_010263617.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Nelumbo 
nucifera]
Length=271

 Score =   498 bits (1283),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 235/271 (87%), Positives = 254/271 (94%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLHGCTVEDEAFVGMGA LLDGVVVEKN+MVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTIGHSAVLHGCTVEDEAFVGMGAVLLDGVVVEKNSMVAAGALVRQNTRIPYGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEEIAFISQSA NYSNLAQVHA ENAK+FDEIE EKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEEEIAFISQSAINYSNLAQVHAAENAKTFDEIELEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLGVVRE P +LILPDNILP ++ KA+
Sbjct  241   EYDSMLGVVREVPPQLILPDNILPKESPKAS  271



>ref|XP_004160973.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis 
sativus]
Length=271

 Score =   498 bits (1281),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 234/271 (86%), Positives = 252/271 (93%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V  +AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDMDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCT+EDEAFVGMGATLLDGV VEK+AMVAAGALVRQNTR+PCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTIEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRVPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEE+ FI QSA NYSNL+QVHA EN KSFDEIE EKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEEEMVFICQSAINYSNLSQVHAAENVKSFDEIELEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             DYDSMLGVVRETP EL+LPDNIL DK AK++
Sbjct  241   DYDSMLGVVRETPPELVLPDNILADKVAKSS  271



>ref|XP_006346962.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X1 [Solanum tuberosum]
 ref|XP_006346963.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X2 [Solanum tuberosum]
 ref|XP_006346964.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X3 [Solanum tuberosum]
Length=268

 Score =   498 bits (1281),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 236/267 (88%), Positives = 253/267 (95%), Gaps = 0/267 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHEQLSRHR LMNLF+K P V ++AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFHEQLSRHRTLMNLFNKAPMVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDV VGR++SIWYGCVLRGDVNSISIGAG+NIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASLIGDVHVGRNASIWYGCVLRGDVNSISIGAGSNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG VVEKNAMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGAVVEKNAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLT+EEIAFIS+SAANYSNLAQVHA ENAKSFD IEFEKVLRKKFARKDE
Sbjct  181   WGGNPARFLRKLTQEEIAFISESAANYSNLAQVHAGENAKSFDAIEFEKVLRKKFARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKA  304
             +YDSMLGVVRETP EL+LPDNI   KA
Sbjct  241   EYDSMLGVVRETPPELVLPDNIQAPKA  267



>ref|XP_009772840.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
sylvestris]
Length=268

 Score =   497 bits (1280),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 237/268 (88%), Positives = 252/268 (94%), Gaps = 0/268 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHE LSRHR LMNLFDKVP V ++AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQAMDRLGCRLQGNYYFHEHLSRHRTLMNLFDKVPMVAKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDV VGR++SIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASLIGDVHVGRNASIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG VVEKNAMVAAGALVRQNTRIP GEV
Sbjct  121   IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGAVVEKNAMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTEEEIAFISQSAANY+NLAQVHA ENAKSFD IEFEKVLRKKFARKDE
Sbjct  181   WGGNPARFLRKLTEEEIAFISQSAANYTNLAQVHAAENAKSFDAIEFEKVLRKKFARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAA  301
             +YDSMLGV R+TP ELILPDNI   KA+
Sbjct  241   EYDSMLGVDRQTPPELILPDNIQAPKAS  268



>ref|XP_010922032.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Elaeis 
guineensis]
Length=272

 Score =   497 bits (1279),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 232/271 (86%), Positives = 255/271 (94%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR  MN++DKVP+V ++AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTFMNIYDKVPNVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVGR SSIWYGCVLRGDVNSI +G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVQVGRGSSIWYGCVLRGDVNSIHVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEK+ MVAAGALVRQNT+IPCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGAVLLDGVVVEKHGMVAAGALVRQNTKIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEEIAFISQSA NYSNLAQVHA ENAK+FDEIEFEKVLRKK+AR+DE
Sbjct  181   WGGNPAKFLRKLTEEEIAFISQSATNYSNLAQVHAAENAKTFDEIEFEKVLRKKYARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLGVVRE P ELILPDNILP+K+ K +
Sbjct  241   EYDSMLGVVREVPPELILPDNILPNKSPKPS  271



>ref|XP_006466826.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Citrus 
sinensis]
 gb|KDO70974.1| hypothetical protein CISIN_1g024153mg [Citrus sinensis]
Length=271

 Score =   496 bits (1277),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 233/269 (87%), Positives = 254/269 (94%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V+++ F
Sbjct  1     MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVNKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             +APSASIIGDVQVGR SSIWYGCVLRGDVNSISIG+GTNIQDNSLVHVAKSNLAGKVL T
Sbjct  61    LAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AMVAAGALVRQNT+IPCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTKIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTEEE+AFISQSA NYSNLA+VHA ENAKSFDEIEFEK+LRKKFAR+DE
Sbjct  181   WGGNPARFLRKLTEEEMAFISQSAINYSNLARVHAAENAKSFDEIEFEKLLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLGVVRETP ELILPDN++ DK  K
Sbjct  241   EYDSMLGVVRETPAELILPDNVMQDKVPK  269



>ref|XP_007017577.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
 gb|EOY14802.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
Length=273

 Score =   496 bits (1276),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 233/271 (86%), Positives = 255/271 (94%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQALDRLGCRLQG+Y F EQ+SRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGKAVYTVGFWIRETGQALDRLGCRLQGSYLFQEQISRHRTLMNIFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVGR SSIWYG VLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVQVGRGSSIWYGSVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AMVAAGALVRQNTRIP GE+
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPTGEI  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EEIAFISQSA NYSNLAQVHA ENAK+FDEIEFEKVLRKKFA +DE
Sbjct  181   WGGNPAKFLRKLTDEEIAFISQSATNYSNLAQVHAAENAKAFDEIEFEKVLRKKFAHRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLGVVRETP ELILPDN+LPDKA K++
Sbjct  241   EYDSMLGVVRETPPELILPDNVLPDKAQKSS  271



>ref|XP_006425642.1| hypothetical protein CICLE_v10026267mg [Citrus clementina]
 gb|ESR38882.1| hypothetical protein CICLE_v10026267mg [Citrus clementina]
Length=271

 Score =   495 bits (1275),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 233/269 (87%), Positives = 253/269 (94%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             +APSASIIGDVQVGR SSIWYGCVLRGDVNSISIG+GTNIQDNSLVHVAKSNLAGKVL T
Sbjct  61    LAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AMVAAGALVRQNT+IPCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTKIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTEEE+AFISQSA NYSNLA+VHA ENAKSFDEIEFEK+LRKKFAR+DE
Sbjct  181   WGGNPARFLRKLTEEEMAFISQSAINYSNLARVHAAENAKSFDEIEFEKLLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLGVVRETP ELILPDN++ DK  K
Sbjct  241   EYDSMLGVVRETPAELILPDNVMQDKVPK  269



>ref|XP_010931534.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Elaeis 
guineensis]
Length=325

 Score =   496 bits (1277),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 232/271 (86%), Positives = 254/271 (94%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDKVP V ++AF
Sbjct  54    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNIFDKVPQVDKDAF  113

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG  SSIWYGCVLRGDVNSI +G+GTN+QDNSLVHVAKSN++GKVL T
Sbjct  114   VAPSASVIGDVQVGGGSSIWYGCVLRGDVNSIRVGSGTNVQDNSLVHVAKSNISGKVLPT  173

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEK+ MVAAGALVRQNT+IPCGEV
Sbjct  174   IIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKHGMVAAGALVRQNTKIPCGEV  233

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEEIAFISQSA NYSNLAQVHA ENAK+FDEIEFEKVLRKK+AR+DE
Sbjct  234   WGGNPAKFLRKLTEEEIAFISQSATNYSNLAQVHAAENAKTFDEIEFEKVLRKKYARRDE  293

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLGVVRE P ELILPDNILPDK+ K +
Sbjct  294   EYDSMLGVVREVPPELILPDNILPDKSPKPS  324



>ref|XP_002302024.1| transcription factor APFI family protein [Populus trichocarpa]
 ref|XP_011028863.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Populus 
euphratica]
 gb|ABK95146.1| unknown [Populus trichocarpa]
 gb|EEE81297.1| transcription factor APFI family protein [Populus trichocarpa]
Length=271

 Score =   493 bits (1270),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 234/270 (87%), Positives = 253/270 (94%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQALDRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAIYTVGFWIRETGQALDRLGGRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG+ SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVQVGKGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVVHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPTGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EEIAFI+QSA NYSNLAQVHA ENAK FDEIEFEKVLRKKFA+KDE
Sbjct  181   WGGNPAKFLRKLTDEEIAFIAQSATNYSNLAQVHAAENAKPFDEIEFEKVLRKKFAKKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRE P ELILP+N+LPDK  KA
Sbjct  241   EYDSMLGVVRELPPELILPNNVLPDKEHKA  270



>ref|XP_011074556.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Sesamum 
indicum]
Length=272

 Score =   493 bits (1270),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 232/270 (86%), Positives = 253/270 (94%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MGSLGRA YT+G W+RETGQA+DRLGCRLQGNYYF EQLSRHR LMNLFDK P V R+AF
Sbjct  1     MGSLGRAVYTLGLWVRETGQAMDRLGCRLQGNYYFQEQLSRHRTLMNLFDKSPVVDRDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG+ SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASLIGDVQVGQGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAV+HGCT+EDEAFVGMGATLLDGVVVE+NAMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTIGHSAVIHGCTIEDEAFVGMGATLLDGVVVERNAMVAAGALVRQNTRIPFGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFISQSA NY NLA+VHA ENAKSFDEIEFEKVLRKKFAR+DE
Sbjct  181   WAGNPAKFLRKLTDEEIAFISQSATNYINLAKVHAAENAKSFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGV RETP EL+LPDNILP+KA KA
Sbjct  241   EYDSMLGVHRETPPELVLPDNILPNKAQKA  270



>ref|XP_006435021.1| hypothetical protein CICLE_v10002155mg [Citrus clementina]
 ref|XP_006473528.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Citrus 
sinensis]
 gb|ESR48261.1| hypothetical protein CICLE_v10002155mg [Citrus clementina]
Length=270

 Score =   493 bits (1268),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 233/267 (87%), Positives = 252/267 (94%), Gaps = 0/267 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P+V ++AF
Sbjct  1     MGTLGRAVYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPAVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
              IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVE++ MVAAG+LVRQNTRIP GEV
Sbjct  121   TIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVERHGMVAAGSLVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EEIAFISQSA NYSNLAQVHA ENAKSFDEIEFEKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTDEEIAFISQSATNYSNLAQVHAAENAKSFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKA  304
             +YDSMLGVVRETPQE+I+PD+I   K+
Sbjct  241   EYDSMLGVVRETPQEIIVPDSIKDPKS  267



>ref|XP_008786862.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=272

 Score =   493 bits (1268),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 230/271 (85%), Positives = 253/271 (93%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDK+P V ++AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNIFDKLPKVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG  SSIWYGCVLRGDVNSI +G GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVQVGGGSSIWYGCVLRGDVNSIRVGTGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLHGCTVEDEAFVGMGA LLDGVVVEK+ MVAAG+LVRQN +IPCGEV
Sbjct  121   IIGDNVTIGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKHGMVAAGSLVRQNAKIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHA ENAK+FDEIEFEKVLRKK+AR+DE
Sbjct  181   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAAENAKTFDEIEFEKVLRKKYARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLGVVRE P ELILPDNILP+K+ K +
Sbjct  241   EYDSMLGVVREVPPELILPDNILPNKSPKPS  271



>ref|XP_006386210.1| hypothetical protein POPTR_0002s03550g [Populus trichocarpa]
 gb|ERP64007.1| hypothetical protein POPTR_0002s03550g [Populus trichocarpa]
Length=285

 Score =   493 bits (1269),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 234/270 (87%), Positives = 253/270 (94%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQALDRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  15    MGTLGRAIYTVGFWIRETGQALDRLGGRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  74

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG+ SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  75    VAPSASVIGDVQVGKGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  134

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AMVAAGALVRQNTRIP GEV
Sbjct  135   IIGDNVTVGHSAVVHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPTGEV  194

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EEIAFI+QSA NYSNLAQVHA ENAK FDEIEFEKVLRKKFA+KDE
Sbjct  195   WGGNPAKFLRKLTDEEIAFIAQSATNYSNLAQVHAAENAKPFDEIEFEKVLRKKFAKKDE  254

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRE P ELILP+N+LPDK  KA
Sbjct  255   EYDSMLGVVRELPPELILPNNVLPDKEHKA  284



>ref|XP_010113421.1| hypothetical protein L484_026755 [Morus notabilis]
 gb|EXC35448.1| hypothetical protein L484_026755 [Morus notabilis]
Length=271

 Score =   492 bits (1267),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 232/271 (86%), Positives = 255/271 (94%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNY+F EQLSRHR LMN+FDK P+V ++AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYHFQEQLSRHRTLMNVFDKAPAVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVGR SSIWYGCVLRGDVNSISIG+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGH+AVLHGCTVEDEAFVGMGATLLDGV VE++AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHAAVLHGCTVEDEAFVGMGATLLDGVFVERHAMVAAGALVRQNTRIPYGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEEIAFIS+SA NY+NLA VHA EN+KSFDEIEFEKVLRKKFA +DE
Sbjct  181   WGGNPAKFLRKLTEEEIAFISESAVNYTNLALVHAAENSKSFDEIEFEKVLRKKFAHRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YD MLGVVRETP ELILPDN+LPDK AKA+
Sbjct  241   EYDLMLGVVRETPPELILPDNVLPDKVAKAS  271



>ref|XP_009386943.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=272

 Score =   492 bits (1267),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 230/271 (85%), Positives = 252/271 (93%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLGCRLQGNY F EQLSRHR LMN+FDKVP+VH+ AF
Sbjct  1     MGTLGRAIYTVGFWIRETGQAIDRLGCRLQGNYLFQEQLSRHRTLMNIFDKVPNVHKGAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAP AS+IGDVQVG+ SSIWYGCVLRGDVNSI +G+ TNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPGASVIGDVQVGQGSSIWYGCVLRGDVNSIHVGSSTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHS VLHGCTVEDEAFVGMGA LLDGVVVEK+ MVAAGALVRQNTRIPCGEV
Sbjct  121   IIGDNVTIGHSVVLHGCTVEDEAFVGMGAVLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTEEE+AFISQSA NY+NLAQVHAVENAKSFDEIEFEKVL KKFAR+DE
Sbjct  181   WGGNPARFLRKLTEEEVAFISQSATNYTNLAQVHAVENAKSFDEIEFEKVLHKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLGVVRE P ELILPDN+LPDK+ K +
Sbjct  241   EYDSMLGVVREVPPELILPDNVLPDKSPKPS  271



>ref|XP_002306878.1| transcription factor APFI family protein [Populus trichocarpa]
 gb|EEE93874.1| transcription factor APFI family protein [Populus trichocarpa]
Length=271

 Score =   491 bits (1265),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 232/270 (86%), Positives = 250/270 (93%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y VGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAIYAVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAP AS+IGDV VGR SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPGASVIGDVLVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPTGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EE+AFI+QSA NYSNLAQVHA ENAK FDEIEFEKVLRKKFA+KDE
Sbjct  181   WGGNPAKFLRKLTDEEVAFIAQSATNYSNLAQVHAAENAKPFDEIEFEKVLRKKFAKKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRE P ELILP N+LPDK  KA
Sbjct  241   EYDSMLGVVRELPPELILPKNVLPDKEPKA  270



>ref|XP_004233530.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Solanum 
lycopersicum]
Length=268

 Score =   491 bits (1264),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 233/267 (87%), Positives = 251/267 (94%), Gaps = 0/267 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHEQLSRHR LMNLF+K P+V ++AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFHEQLSRHRTLMNLFNKTPTVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDV VGR++SIWYGCVLRGDVNSISIGAG+NIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASLIGDVHVGRNASIWYGCVLRGDVNSISIGAGSNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG VVEKNAMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGAVVEKNAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLT+EEIAFIS+SAANYSNLAQVHA ENAKSFD IEFEK LRKKFA KDE
Sbjct  181   WGGNPARFLRKLTQEEIAFISESAANYSNLAQVHAGENAKSFDAIEFEKALRKKFAHKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKA  304
             +YDSMLGVVRETP EL+LP NI   KA
Sbjct  241   EYDSMLGVVRETPPELVLPVNIQAPKA  267



>ref|XP_007204711.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
 gb|EMJ05910.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
Length=271

 Score =   491 bits (1263),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 232/269 (86%), Positives = 248/269 (92%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASI+G VQVGR SSIWYGCVLRGDVNSISIG+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIVGQVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             VIG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AMVAAGALVRQNTRIPCGEV
Sbjct  121   VIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEE+AFISQSA NYSNLAQ HA ENAKS DEIEFEKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEEEMAFISQSAINYSNLAQAHAAENAKSLDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLG+VRETP E+ LPDN+LP K  K
Sbjct  241   EYDSMLGIVRETPAEITLPDNVLPGKVPK  269



>ref|XP_009399949.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=272

 Score =   491 bits (1263),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 231/271 (85%), Positives = 252/271 (93%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y VG WIRETGQA+DRLGCRLQGNY F EQLSRHR LMN+FDKVP+VH++AF
Sbjct  1     MGTLGRAIYAVGCWIRETGQAIDRLGCRLQGNYLFQEQLSRHRTLMNIFDKVPNVHKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDV VG+ SSIWYGCVLRGDVNSI IG+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVHVGQGSSIWYGCVLRGDVNSIHIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDG VVEK+ MVAAGALVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGAVLLDGAVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EE+AFIS+SAANY+NLAQVHA EN KSFDEIEFEKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTDEEVAFISESAANYANLAQVHAAENVKSFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLGVVRE P ELILPDNILPDK+ K +
Sbjct  241   EYDSMLGVVREVPPELILPDNILPDKSRKPS  271



>ref|XP_004291863.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   490 bits (1262),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 233/270 (86%), Positives = 251/270 (93%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLG RLQG+YYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAIYTVGFWIRETGQAVDRLGSRLQGSYYFKEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG+ SSIWYGCVLRGDVN+I IGAGTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVQVGKGSSIWYGCVLRGDVNNIVIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVVHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFISQSA NY NLAQVHA EN KSFDEIEFEKVLRKKFAR+DE
Sbjct  181   WAGNPAKFLRKLTDEEIAFISQSATNYVNLAQVHAAENGKSFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRE P ELILPDN+LPDKA KA
Sbjct  241   EYDSMLGVVREIPPELILPDNVLPDKALKA  270



>ref|XP_011007461.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
Length=271

 Score =   489 bits (1260),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 232/270 (86%), Positives = 249/270 (92%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y VGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAIYAVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAP AS+IGDV VGR SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPGASVIGDVLVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKHAMVAAGALVRQNTRIPTGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EEIAFI+QSA NYSNLAQVHA ENAK FDEIEFEKVLRKKFA+KDE
Sbjct  181   WGGNPAKFLRKLTDEEIAFIAQSATNYSNLAQVHAAENAKPFDEIEFEKVLRKKFAKKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRE P ELILP N+LPDK  KA
Sbjct  241   EYDSMLGVVRELPPELILPKNVLPDKEPKA  270



>ref|XP_008241708.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Prunus 
mume]
Length=271

 Score =   488 bits (1256),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 231/269 (86%), Positives = 247/269 (92%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASI+G VQVGR SSIWYGCVLRGDVNSISIG+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIVGQVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             VIG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AMVAAGALVRQNTRIPCGEV
Sbjct  121   VIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEE+ FISQSA NYSNLAQ HA ENAKS DEIEFEKVL+KKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEEEMTFISQSAINYSNLAQAHAAENAKSLDEIEFEKVLQKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLGVVRETP E+ LPDN+LP K  K
Sbjct  241   EYDSMLGVVRETPAEITLPDNVLPGKVPK  269



>ref|XP_008788543.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=272

 Score =   487 bits (1254),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 227/271 (84%), Positives = 251/271 (93%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDKVP V ++AF
Sbjct  1     MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNIFDKVPIVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG+ SSIWYGCVLRGDVN I +G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVQVGQGSSIWYGCVLRGDVNRIRVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLHGCTVEDE FVGMGA LLDGVVVEK+ MVAAGALVRQNT+IPCGEV
Sbjct  121   IIGDNVTIGHSAVLHGCTVEDETFVGMGAVLLDGVVVEKHGMVAAGALVRQNTKIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEEIAFISQSA NYSNLAQVHA ENAK+FD+IE EK LRKK+AR+DE
Sbjct  181   WGGNPAKFLRKLTEEEIAFISQSATNYSNLAQVHAAENAKAFDDIELEKGLRKKYARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             DYDSMLGVVRE P ELILPDNILP+K+ + +
Sbjct  241   DYDSMLGVVREVPPELILPDNILPNKSPRPS  271



>emb|CDP07494.1| unnamed protein product [Coffea canephora]
Length=279

 Score =   488 bits (1255),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 231/278 (83%), Positives = 252/278 (91%), Gaps = 7/278 (3%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1     MGTLGRAVYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPLVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVNSI++G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSITVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGE-  568
             +IG+NVT+GHSAVLHGCTVEDEAFVGMGA LLDG V+EK+AMVAAGALVRQN RIP G+ 
Sbjct  121   IIGDNVTIGHSAVLHGCTVEDEAFVGMGAALLDGAVLEKHAMVAAGALVRQNMRIPSGQA  180

Query  567   ------VWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRK  406
                   VWGGNPAKFLRKL++EEIAFISQSA NY NLAQVHA ENAKSFDEIEFEKVLRK
Sbjct  181   IILIFRVWGGNPAKFLRKLSDEEIAFISQSATNYCNLAQVHAAENAKSFDEIEFEKVLRK  240

Query  405   KFARKDEDYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             K++R+DE+YDSMLGV+RETP EL+LPDNILPDK  K T
Sbjct  241   KYSRRDEEYDSMLGVIRETPPELVLPDNILPDKPQKGT  278



>ref|XP_008338249.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Malus domestica]
Length=268

 Score =   486 bits (1252),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 230/268 (86%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1     MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIG VQVGR SSIWYGCVLRGDVNSISIG+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGQVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTE+E+AFISQSA NYSNLAQVHA ENAK  DEIEFEK LRKKF R+DE
Sbjct  181   WGGNPAKFLRKLTEDEMAFISQSALNYSNLAQVHAAENAKPLDEIEFEKALRKKFGRRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAA  301
             +YDSMLGV RETP E+ LPDN+LP K+A
Sbjct  241   EYDSMLGVTRETPAEITLPDNVLPPKSA  268



>ref|XP_007222873.1| hypothetical protein PRUPE_ppa009923mg [Prunus persica]
 gb|EMJ24072.1| hypothetical protein PRUPE_ppa009923mg [Prunus persica]
Length=272

 Score =   487 bits (1253),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 229/269 (85%), Positives = 250/269 (93%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGR  YTVGFWIRETGQA+DRLG RLQG+YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGRVIYTVGFWIRETGQAVDRLGSRLQGSYYFKEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVGR SSIWYGCVLRGDVN+I +G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EE AFISQSA NY+NLAQVHA EN KSFDEIEFEKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTDEEKAFISQSATNYTNLAQVHAAENGKSFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLGVVRE P ELILPDN+LPDKA+K
Sbjct  241   EYDSMLGVVREIPPELILPDNVLPDKASK  269



>ref|XP_009799511.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=271

 Score =   486 bits (1252),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 223/271 (82%), Positives = 248/271 (92%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MGS G+A YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMNLFDKVP V ++AF
Sbjct  1     MGSAGKAIYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNLFDKVPVVEKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASI+GDV +GR +SIWYGCVLRGDVN++SIGAGTN+QDNSL+HVAKSN++G+VL T
Sbjct  61    VAPSASIVGDVHIGRSASIWYGCVLRGDVNNVSIGAGTNVQDNSLIHVAKSNISGRVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
              IG NVT+GHSAVLHGCTVEDEAF+G GAT+LDG VVEKN+MVAAGALVRQNTRIPCGEV
Sbjct  121   TIGKNVTIGHSAVLHGCTVEDEAFIGTGATVLDGAVVEKNSMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTEEEI FISQSA NYSNLAQ HA ENAK  D+IEFEKVLRKKF RK+E
Sbjct  181   WGGNPARFLRKLTEEEIMFISQSAMNYSNLAQAHAAENAKKLDDIEFEKVLRKKFTRKEE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLG VR+TP E +LPDN+LPDKA KA+
Sbjct  241   EYDSMLGGVRDTPPEFVLPDNVLPDKAPKAS  271



>gb|KCW68228.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=269

 Score =   486 bits (1251),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 232/269 (86%), Positives = 248/269 (92%), Gaps = 4/269 (1%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAIYTVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTV    VLHGCTVEDEAFVGMGATLLDGVVVEK+ MVA GALVRQNTRIP GEV
Sbjct  121   IIGDNVTV----VLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAGGALVRQNTRIPAGEV  176

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEE+AFI+QSA NYSNLAQVHA ENAK FDEIEFEKVLRKKFAR+DE
Sbjct  177   WGGNPAKFLRKLTEEEVAFITQSATNYSNLAQVHAAENAKPFDEIEFEKVLRKKFARRDE  236

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLGVVRETP ELILPDN+LP KA K
Sbjct  237   EYDSMLGVVRETPPELILPDNVLPGKAPK  265



>ref|XP_009340721.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Pyrus x 
bretschneideri]
Length=268

 Score =   486 bits (1251),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 230/268 (86%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1     MGTLGRAVYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIG VQVGR SSIWYGCVLRGDVNSISIG+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGQVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTE+E+AFISQSA NYSNLAQVHA ENAK  DEIEFEK LRKKF R+DE
Sbjct  181   WGGNPAKFLRKLTEDEMAFISQSALNYSNLAQVHAAENAKPLDEIEFEKALRKKFGRRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAA  301
             +YDSMLGV RETP E+ LPDN+LP K+A
Sbjct  241   EYDSMLGVTRETPAEITLPDNVLPPKSA  268



>ref|NP_001275071.1| transcription factor APFI-like [Solanum tuberosum]
 gb|ABB86281.1| transcription factor APFI-like [Solanum tuberosum]
Length=268

 Score =   486 bits (1251),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 230/267 (86%), Positives = 249/267 (93%), Gaps = 0/267 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHEQLSRHR LMNLF+K P V ++AF
Sbjct  1     MGTLGKASYTVGFWIRETGQAIDRLGCRLQGNYYFHEQLSRHRTLMNLFNKAPMVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDV VGR++SIWYGCVLRGDVNSISIGAG+NIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASLIGDVHVGRNASIWYGCVLRGDVNSISIGAGSNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLT+EE+ ++    ANYSNLAQVHA ENAKSFD IEFEKVLRKKFARKDE
Sbjct  181   WGGNPARFLRKLTQEELLYLGSQPANYSNLAQVHAGENAKSFDAIEFEKVLRKKFARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKA  304
             +YDSMLGVVRETP EL+LPDNI   KA
Sbjct  241   EYDSMLGVVRETPPELVLPDNIQAPKA  267



>ref|XP_006383176.1| hypothetical protein POPTR_0005s12280g [Populus trichocarpa]
 gb|ERP60973.1| hypothetical protein POPTR_0005s12280g [Populus trichocarpa]
Length=271

 Score =   486 bits (1250),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 229/270 (85%), Positives = 250/270 (93%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPVVEKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASI G+V VGR SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASITGNVHVGRSSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NV+VGHSAVLHGCTVEDEAFVG GATLLDGV VEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVSVGHSAVLHGCTVEDEAFVGTGATLLDGVCVEKHAMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEE+AFISQSA NY+NLAQVHA ENAK FDEIEFEKVL KKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEEEMAFISQSALNYANLAQVHAAENAKGFDEIEFEKVLHKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +Y+SMLGVVRETP ELILP+N++PDK  KA
Sbjct  241   EYESMLGVVRETPPELILPNNMMPDKMPKA  270



>ref|XP_008220827.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Prunus 
mume]
Length=272

 Score =   486 bits (1250),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 229/269 (85%), Positives = 249/269 (93%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGR  YTVGFWIRETGQA+DRLG RLQG+YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGRVIYTVGFWIRETGQAVDRLGSRLQGSYYFKEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVGR SSIWYGCVLRGDVN+I +G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EE AFISQSA NY+NLAQVHA EN KSFDEIEFEKVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTDEEKAFISQSATNYTNLAQVHAAENGKSFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLGVVRE P ELILPDN+LPDKA K
Sbjct  241   EYDSMLGVVREIPPELILPDNVLPDKAPK  269



>gb|AFK48594.1| unknown [Lotus japonicus]
Length=273

 Score =   485 bits (1249),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 227/270 (84%), Positives = 248/270 (92%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y+VGFWIRETGQA+DRLG RLQG Y+  EQLSRHR LMN+FDK P+V ++ F
Sbjct  1     MGTLGRAIYSVGFWIRETGQAIDRLGSRLQGGYFIQEQLSRHRTLMNIFDKAPTVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG+ SSIWYG VLRGDVNSI +G+GTNIQDNSLVHVAKSNL GKVL T
Sbjct  61    VAPSASVIGDVQVGKGSSIWYGTVLRGDVNSIRVGSGTNIQDNSLVHVAKSNLGGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAMVAAGALVRQNT++P GEV
Sbjct  121   IIGNNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTKVPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFISQSA NY+NLAQVHA EN+KSFDEIEFEKVLRKKFAR+DE
Sbjct  181   WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             DYDSM+GVVRE P ELILPDN+LPDKA KA
Sbjct  241   DYDSMIGVVREIPPELILPDNVLPDKADKA  270



>ref|XP_009590737.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=271

 Score =   484 bits (1245),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 224/271 (83%), Positives = 246/271 (91%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MGS G+A YTVGFWIRETGQALDRLGCRLQGNYYFHE LSRHR LMNLFDKVP V ++AF
Sbjct  1     MGSAGKAIYTVGFWIRETGQALDRLGCRLQGNYYFHEHLSRHRTLMNLFDKVPVVEKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASI+GDV +GR +SIWYGCVLRGDVNS+ IGAGTN+QDNSL+HVAKSN++G+VL T
Sbjct  61    VAPSASIVGDVHIGRSASIWYGCVLRGDVNSVIIGAGTNVQDNSLIHVAKSNVSGRVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
              IG NVT+GHSAVLHGCTVEDEAF+GMGAT+LDG VVEKN+MVAAGALVRQ TRIPCGEV
Sbjct  121   TIGKNVTIGHSAVLHGCTVEDEAFIGMGATVLDGAVVEKNSMVAAGALVRQKTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTEEEI FISQSA NYSNLAQ HA ENAK  DEIEFEKVLRKKF RK+E
Sbjct  181   WGGNPARFLRKLTEEEIMFISQSAMNYSNLAQAHAAENAKKLDEIEFEKVLRKKFIRKEE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLG VR+TP EL+LPDN LPDKA KA+
Sbjct  241   EYDSMLGGVRDTPPELVLPDNALPDKAPKAS  271



>ref|XP_008338081.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Malus domestica]
Length=268

 Score =   483 bits (1244),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 230/268 (86%), Positives = 243/268 (91%), Gaps = 0/268 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1     MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIG VQVGR SSIWYGCVLRGD NSISIG+GTNIQDNSLVHVAKSNL GKVL T
Sbjct  61    VAPSASIIGQVQVGRGSSIWYGCVLRGDANSISIGSGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTE+E+AFISQSA NYSNLAQVHA ENAK  DEIEF+KVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEDEMAFISQSALNYSNLAQVHAAENAKPLDEIEFQKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAA  301
             +YDSMLGV RETP E  LPDN  P KAA
Sbjct  241   EYDSMLGVTRETPAETTLPDNASPPKAA  268



>ref|XP_003523810.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Glycine 
max]
 gb|KHN45863.1| Hypothetical protein glysoja_023086 [Glycine soja]
Length=276

 Score =   483 bits (1244),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 229/270 (85%), Positives = 247/270 (91%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y+VG WIRETGQA+DRLG RLQG YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGRAIYSVGNWIRETGQAIDRLGSRLQGGYYFQEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+GR SSIWYG VLRGDVNSI +G GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVQLGRGSSIWYGVVLRGDVNSIRVGNGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVEDEAFVGMGA LLDGVVVEKNAMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVIHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFISQSA NY+NLAQVHA EN+KSFDEIEFEKVLRKKFARKDE
Sbjct  181   WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSFDEIEFEKVLRKKFARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRE P ELILPDN+LPDKA KA
Sbjct  241   EYDSMLGVVREIPPELILPDNVLPDKAEKA  270



>ref|XP_010538097.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Tarenaya 
hassleriana]
Length=277

 Score =   483 bits (1242),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 227/268 (85%), Positives = 249/268 (93%), Gaps = 0/268 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MGSLGRA YTVGFWIRETGQALDRLGCRLQGN+YF EQLSRHR LMN+FDK PSV ++AF
Sbjct  1     MGSLGRAIYTVGFWIRETGQALDRLGCRLQGNHYFREQLSRHRTLMNVFDKAPSVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+G  SSIWYGCVLRGDVN IS+G+ TNIQDNSLVHVAKSN++GKVL T
Sbjct  61    VAPSASVIGDVQIGGGSSIWYGCVLRGDVNGISVGSWTNIQDNSLVHVAKSNISGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLHGCT+EDEAFVGMGATLLDGVVVEK+AMVAAGALVRQNT IP GEV
Sbjct  121   IIGDNVTIGHSAVLHGCTIEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTIIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLT+EEIAFI QSA NYSNLAQVHA ENAK FDEIEFEK LRKK+ARKDE
Sbjct  181   WGGNPARFLRKLTDEEIAFICQSATNYSNLAQVHAAENAKPFDEIEFEKALRKKYARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAA  301
             DYDSMLG+VRETP +LILPDN+LP KA+
Sbjct  241   DYDSMLGIVRETPPQLILPDNVLPGKAS  268



>gb|AFK46651.1| unknown [Lotus japonicus]
Length=273

 Score =   482 bits (1241),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 226/270 (84%), Positives = 248/270 (92%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y+VGFWIRETGQA+DRLG RLQG Y+  EQLSRHR LMN+FDK P+V ++ F
Sbjct  1     MGTLGRAIYSVGFWIRETGQAIDRLGSRLQGGYFILEQLSRHRTLMNIFDKAPTVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG+ SSIWYG VLRGDV+SI +G+GTNIQDNSLVHVAKSNL GKVL T
Sbjct  61    VAPSASVIGDVQVGKGSSIWYGTVLRGDVSSIRVGSGTNIQDNSLVHVAKSNLGGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAMVAAGALVRQNT++P GEV
Sbjct  121   IIGNNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTKVPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFISQSA NY+NLAQVHA EN+KSFDEIEFEKVLRKKFAR+DE
Sbjct  181   WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSFDEIEFEKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             DYDSM+GVVRE P ELILPDN+LPDKA KA
Sbjct  241   DYDSMIGVVREIPPELILPDNVLPDKADKA  270



>ref|XP_009365039.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=272

 Score =   482 bits (1241),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 228/269 (85%), Positives = 246/269 (91%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLG  LQG YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGGYYFKEQLSRHRTLMNVFDKAPVVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVN+I +G+GTNIQDNSLVHVAKSNL GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AMVAAG+LVRQNT+IP GEV
Sbjct  121   IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTKIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFISQSA NY+NLAQVHA EN KSFDEIEFEK LRKKFA KDE
Sbjct  181   WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENVKSFDEIEFEKALRKKFAHKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLGVVRE P ELILPDN+LPDKAAK
Sbjct  241   EYDSMLGVVREIPPELILPDNVLPDKAAK  269



>ref|XP_010679758.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=272

 Score =   482 bits (1241),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 224/271 (83%), Positives = 253/271 (93%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDK P + ++ F
Sbjct  1     MGTLGRAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNVFDKKPLIDKQTF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+G  SSIWYGCVLRGDVN+ISIG+GTNIQDNSLVHVAK+N+AGKVL T
Sbjct  61    VAPSASVIGDVQIGCGSSIWYGCVLRGDVNNISIGSGTNIQDNSLVHVAKTNVAGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSA+LHGCTV+DEAFVGMGATLLDGVVVEK+AMVAAGALVRQNTRIP G+V
Sbjct  121   IIGDNVTVGHSAILHGCTVDDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPSGQV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLR LTEEEIAFI++SA NYSNLA+VHA EN K F+EIEFEKVLRKK+ARKDE
Sbjct  181   WGGNPAKFLRNLTEEEIAFIAESATNYSNLARVHAAENDKGFEEIEFEKVLRKKYARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSM+G+VRETP ELILPDNILP+KAA+ +
Sbjct  241   EYDSMIGIVRETPPELILPDNILPEKAAQKS  271



>ref|XP_009336133.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=272

 Score =   482 bits (1240),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 227/269 (84%), Positives = 246/269 (91%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLG  LQG YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGGYYFKEQLSRHRTLMNVFDKAPVVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVN+I +G+GTNIQDNSLVHVAKSNL GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVV+EK+AMVAAG+LVRQNT+IP GEV
Sbjct  121   IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVIEKHAMVAAGSLVRQNTKIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFISQSA NY+NLAQVHA EN KSFDEIEFEK LRKKFA KDE
Sbjct  181   WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENVKSFDEIEFEKALRKKFAHKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLGVVRE P ELILPDN+LPDKAAK
Sbjct  241   EYDSMLGVVREIPPELILPDNVLPDKAAK  269



>ref|XP_009371625.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=268

 Score =   480 bits (1235),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 227/268 (85%), Positives = 244/268 (91%), Gaps = 0/268 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1     MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIG VQVGR SSIWYGCVLRGD NS+SIG+GTNIQDNSLVHVAKSNL GKVL T
Sbjct  61    VAPSASIIGQVQVGRGSSIWYGCVLRGDANSVSIGSGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVG+ ATLLDGV VEK+AMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGVAATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTE+E+AFISQSA NYSNLAQVHA ENAK  DEIEF+KVLRKKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEDEMAFISQSALNYSNLAQVHAAENAKPLDEIEFQKVLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAA  301
             +YDSMLGV+RETP E  LPDN  P +AA
Sbjct  241   EYDSMLGVIRETPAETTLPDNASPPRAA  268



>ref|XP_008810436.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=272

 Score =   479 bits (1234),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 223/271 (82%), Positives = 251/271 (93%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y VGFWIRETGQA+DRLGCR QGNYYF EQLSRHR LMN+FDKVP+VH++AF
Sbjct  1     MGTLGRAIYAVGFWIRETGQAIDRLGCRFQGNYYFQEQLSRHRTLMNIFDKVPNVHKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS++GDVQVG+ SSIWYGCVLRGDVNSI IG+GTNIQDNSLVHVAKSN++G+VL T
Sbjct  61    VAPSASVMGDVQVGQGSSIWYGCVLRGDVNSIRIGSGTNIQDNSLVHVAKSNVSGRVLRT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVG+GATLLDGVVVEK+ MVAAGALVRQNT+IP  EV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTKIPGREV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEEIAFISQSA NYSNLAQVHA ENAK FD+IEF+KVL KKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEEEIAFISQSATNYSNLAQVHAAENAKPFDDIEFKKVLHKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLGV+ E P ELILPD+++PDK+ K +
Sbjct  241   EYDSMLGVIHEVPPELILPDDVMPDKSPKPS  271



>gb|AFK45344.1| unknown [Medicago truncatula]
 gb|KEH40168.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=272

 Score =   479 bits (1232),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 224/271 (83%), Positives = 248/271 (92%), Gaps = 0/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A Y+VGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGKAIYSVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             +APSAS+IGDV +GR SSIWYGCV+RGDVN+IS+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    IAPSASVIGDVHIGRGSSIWYGCVMRGDVNNISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AMVAAGALVRQN+RIP GEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNSRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLR+LT EEI FISQSA NYSNLAQVHA ENAK FDEIEFEKVLRKKFARKDE
Sbjct  181   WAGNPAKFLRELTAEEILFISQSAINYSNLAQVHAAENAKPFDEIEFEKVLRKKFARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLGVVRE P ELILPDN+LP +   +T
Sbjct  241   EYDSMLGVVREIPPELILPDNVLPKQTKVST  271



>ref|XP_011011740.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
 ref|XP_011011741.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
 ref|XP_011011742.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
Length=271

 Score =   479 bits (1232),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 226/270 (84%), Positives = 248/270 (92%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAIYSVGFWIRETGQALDRLGCRLQGNYYFKEQLSRHRTLMNVFDKAPVVEKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASI G+V VGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASITGNVHVGRGSSIWYGCVLRGDVNSVSVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NV+VGHSAVLHGCTVED +FVG GATLLDGV VEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVSVGHSAVLHGCTVEDASFVGPGATLLDGVCVEKHAMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTEEE+AFISQSA NY+NLAQVHA ENAK FDEIEFEKVL KKFAR+DE
Sbjct  181   WGGNPAKFLRKLTEEEMAFISQSALNYANLAQVHAAENAKGFDEIEFEKVLCKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLG VRETP ELILP+N++PDK  KA
Sbjct  241   EYDSMLGAVRETPPELILPNNMMPDKIPKA  270



>ref|XP_009365536.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Pyrus x 
bretschneideri]
Length=272

 Score =   478 bits (1231),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 225/269 (84%), Positives = 246/269 (91%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLG  LQG+YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGSYYFKEQLSRHRTLMNVFDKAPVVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVGR SSIWYGCVLRGDVN+I +G+GTNIQDNSLVHVAKSNL+GK L T
Sbjct  61    VAPSASVIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLSGKALPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AMVAAG+LVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EE AFISQSA NY+NLAQVHA EN KSFDEIEFEK LRKK+A KDE
Sbjct  181   WAGNPAKFLRKLTDEEKAFISQSATNYTNLAQVHAAENVKSFDEIEFEKALRKKYAHKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLGVVRE P ELILPDN+LPDKAAK
Sbjct  241   EYDSMLGVVREIPPELILPDNVLPDKAAK  269



>ref|XP_004232424.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Solanum 
lycopersicum]
Length=270

 Score =   478 bits (1231),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 226/271 (83%), Positives = 247/271 (91%), Gaps = 1/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MGS  +A YTVGFWIRETGQALDRLGCRLQGNYYF E LSRHR LMNLFDKVP V ++AF
Sbjct  1     MGSAMKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEHLSRHRTLMNLFDKVPVVEKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDV +GR +SIWYGCVLRGDVNS+SIGAGTN+QDNSL+HVAKSN++GKVL T
Sbjct  61    VAPSASIIGDVHIGRSASIWYGCVLRGDVNSVSIGAGTNVQDNSLIHVAKSNISGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG NVT+GHSAVLHGCTVEDEAF+GMGAT+LDG VVEKNAMVAAGA VRQNTRIP GEV
Sbjct  121   IIGKNVTIGHSAVLHGCTVEDEAFIGMGATVLDGAVVEKNAMVAAGAHVRQNTRIPFGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTEEEIAFIS+SAANYSNLAQVHA ENAK  D+IEFEKVLRKK ARKDE
Sbjct  181   WGGNPARFLRKLTEEEIAFISESAANYSNLAQVHAAENAKELDKIEFEKVLRKKLARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLG V ETP EL+LPD+ LPDKA KA+
Sbjct  241   EYDSMLG-VSETPPELVLPDSSLPDKAPKAS  270



>ref|XP_008388037.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Malus domestica]
Length=272

 Score =   477 bits (1228),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 225/269 (84%), Positives = 247/269 (92%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLG  LQG+YYF EQLS+HR LMN+F+K P V ++ F
Sbjct  1     MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGSYYFKEQLSQHRTLMNVFNKAPVVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDVQVGR SSIWYGCVLRGDVN+I +G GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVQVGRGSSIWYGCVLRGDVNNIVVGYGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AMVAAG+LVRQNT+IP GEV
Sbjct  121   IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTKIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFI+QSA NY+NLAQVHA EN KSFDEIEFEK LRKKFA KDE
Sbjct  181   WAGNPAKFLRKLTDEEIAFITQSATNYTNLAQVHAAENVKSFDEIEFEKALRKKFAHKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLGVVRE P ELILPDN+LPDKAAK
Sbjct  241   EYDSMLGVVREIPPELILPDNVLPDKAAK  269



>ref|XP_006340643.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like isoform 
X1 [Solanum tuberosum]
Length=270

 Score =   477 bits (1228),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 226/271 (83%), Positives = 247/271 (91%), Gaps = 1/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MGS  +A YTVGFWIRETGQALDRLGCRLQGNYYF E LSRHR LMNLFDKVP V ++AF
Sbjct  1     MGSAMKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEHLSRHRTLMNLFDKVPVVEKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDV +GR +SIWYGCVLRGDVNS+SIGAGTN+QDNSL+HVAKSN++GKVL T
Sbjct  61    VAPSASIIGDVHIGRSASIWYGCVLRGDVNSVSIGAGTNVQDNSLIHVAKSNISGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG NVT+GHSAVLHGCTVEDEAF+GMGAT+LDG VVEKNAMVAAGA VRQNTRIP GEV
Sbjct  121   IIGKNVTIGHSAVLHGCTVEDEAFIGMGATVLDGAVVEKNAMVAAGAHVRQNTRIPFGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTEEEIAFIS+SAANYSNLAQVHA ENAK  D+IEFEKVLRKK ARKDE
Sbjct  181   WGGNPARFLRKLTEEEIAFISESAANYSNLAQVHAAENAKELDKIEFEKVLRKKLARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             +YDSMLG V ETP EL+LPD+ LPDKA KA+
Sbjct  241   EYDSMLG-VGETPPELVLPDSSLPDKAPKAS  270



>ref|XP_009799510.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like isoform 
X1 [Nicotiana sylvestris]
Length=284

 Score =   478 bits (1229),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 223/284 (79%), Positives = 248/284 (87%), Gaps = 13/284 (5%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MGS G+A YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMNLFDKVP V ++AF
Sbjct  1     MGSAGKAIYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNLFDKVPVVEKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASI+GDV +GR +SIWYGCVLRGDVN++SIGAGTN+QDNSL+HVAKSN++G+VL T
Sbjct  61    VAPSASIVGDVHIGRSASIWYGCVLRGDVNNVSIGAGTNVQDNSLIHVAKSNISGRVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVED-------------EAFVGMGATLLDGVVVEKNAMVAAGA  604
              IG NVT+GHSAVLHGCTVED             EAF+G GAT+LDG VVEKN+MVAAGA
Sbjct  121   TIGKNVTIGHSAVLHGCTVEDEAFIGTGATVLDXEAFIGTGATVLDGAVVEKNSMVAAGA  180

Query  603   LVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEF  424
             LVRQNTRIPCGEVWGGNPA+FLRKLTEEEI FISQSA NYSNLAQ HA ENAK  D+IEF
Sbjct  181   LVRQNTRIPCGEVWGGNPARFLRKLTEEEIMFISQSAMNYSNLAQAHAAENAKKLDDIEF  240

Query  423   EKVLRKKFARKDEDYDSMLGVVRETPQELILPDNILPDKAAKAT  292
             EKVLRKKF RK+E+YDSMLG VR+TP E +LPDN+LPDKA KA+
Sbjct  241   EKVLRKKFTRKEEEYDSMLGGVRDTPPEFVLPDNVLPDKAPKAS  284



>ref|XP_008364986.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Malus 
domestica]
Length=272

 Score =   475 bits (1223),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 224/269 (83%), Positives = 245/269 (91%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLG  LQG+YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGSYYFKEQLSRHRTLMNVFDKAPVVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVGR SSIWYGCVLRGDVN+I +G+GTNIQDNSLVHVAKSNL GKVL T
Sbjct  61    VAPSASVIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLNGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AMVAAG+LVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLR LT+EE +FISQSA NY+NLAQVHA EN KSFDEIEFEK LRKK+A KDE
Sbjct  181   WAGNPAKFLRXLTDEEKSFISQSATNYTNLAQVHAAENVKSFDEIEFEKALRKKYAHKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLGVVRE P ELILPDN+LPDKAAK
Sbjct  241   EYDSMLGVVREIPPELILPDNVLPDKAAK  269



>ref|NP_001241093.1| uncharacterized protein LOC100805278 [Glycine max]
 gb|ACU23511.1| unknown [Glycine max]
 gb|KHN22241.1| Hypothetical protein glysoja_021997 [Glycine soja]
Length=273

 Score =   472 bits (1214),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 224/270 (83%), Positives = 243/270 (90%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y+VG WIR TGQA+DRLG  LQG YY  EQLSRHR LM++FDK P V  + F
Sbjct  1     MGTLGRAIYSVGNWIRGTGQAIDRLGSLLQGGYYVQEQLSRHRTLMDIFDKAPVVDEDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+GR SSIWYG VLRGDVNSI +G GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVQLGRGSSIWYGVVLRGDVNSIRVGTGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAV+HGCTVEDEAFVGMGA LLDGVVVEKNAMVAAGALVRQNTRIP GEV
Sbjct  121   IIGNNVTVGHSAVIHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFISQSA NY+NLAQVHA EN+KS+DEIEFEKVLRKK+ARKDE
Sbjct  181   WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHASENSKSYDEIEFEKVLRKKYARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRE P ELILPDN+LPDKA KA
Sbjct  241   EYDSMLGVVREIPPELILPDNVLPDKAEKA  270



>ref|XP_011083663.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Sesamum 
indicum]
Length=272

 Score =   469 bits (1208),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 220/270 (81%), Positives = 247/270 (91%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MGSLGRA YT+G WIR TGQA+DR+GCRLQG+YYF EQLSRHR LM+L DK P V ++AF
Sbjct  1     MGSLGRAIYTLGNWIRVTGQAVDRVGCRLQGSYYFQEQLSRHRTLMDLLDKSPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             +AP AS+IGDVQVG+ SSIWYG VLRGDVNSI +G+GTNIQDNSLVHVAKSNL GK L T
Sbjct  61    IAPGASVIGDVQVGQGSSIWYGSVLRGDVNSIHVGSGTNIQDNSLVHVAKSNLGGKELPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVT+GHSAV+HGCT+EDEAFVGMGATLLDGVVVEK+AMVAAG+LVRQNTR+P GEV
Sbjct  121   IIGNNVTIGHSAVIHGCTIEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTRVPYGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFISQSA NY NLA+VHA ENAKSF+EIEFEK+LRKKFAR+DE
Sbjct  181   WAGNPAKFLRKLTDEEIAFISQSATNYINLAKVHAAENAKSFEEIEFEKMLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSM+GVVRETP ELILPDNILPDK+ KA
Sbjct  241   EYDSMIGVVRETPPELILPDNILPDKSQKA  270



>ref|NP_564091.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
 sp|Q9FWR5.1|GCA1_ARATH RecName: Full=Gamma carbonic anhydrase 1, mitochondrial; Short=AtCA1; 
Short=GAMMA CA1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF98404.1|AC024609_5 Unknown protein [Arabidopsis thaliana]
 dbj|BAD44650.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01128.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29870.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
Length=275

 Score =   469 bits (1207),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 221/269 (82%), Positives = 243/269 (90%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V +EAF
Sbjct  1     MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDV +GR SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ MVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLT+EEIAFISQSA NYSNLAQ HA ENAK  + IEFEKVLRKK A KDE
Sbjct  181   WGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNVIEFEKVLRKKHALKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLG+VRETP EL LP+NILPDK  K
Sbjct  241   EYDSMLGIVRETPPELNLPNNILPDKETK  269



>dbj|BAD43151.1| unknown protein [Arabidopsis thaliana]
Length=275

 Score =   468 bits (1204),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 220/269 (82%), Positives = 243/269 (90%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V +EAF
Sbjct  1     MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDV +GR SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ MVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLT+EEIAFISQSA NYSNLAQ HA ENAK  + IEFEKVLRKK A +DE
Sbjct  181   WGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNVIEFEKVLRKKHALRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLG+VRETP EL LP+NILPDK  K
Sbjct  241   EYDSMLGIVRETPPELNLPNNILPDKETK  269



>gb|AAM61583.1| unknown [Arabidopsis thaliana]
Length=275

 Score =   468 bits (1204),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 220/269 (82%), Positives = 243/269 (90%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDV +GR SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ MVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLT+EEIAFISQSA NYSNLAQ HA ENAK  + IEFEKVLRKK A KDE
Sbjct  181   WGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNVIEFEKVLRKKHALKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLG+VRETP EL LP+NILPDK  K
Sbjct  241   EYDSMLGIVRETPPELNLPNNILPDKETK  269



>ref|XP_011083204.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Sesamum 
indicum]
Length=265

 Score =   466 bits (1200),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 222/261 (85%), Positives = 243/261 (93%), Gaps = 0/261 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MGS GRAFYTVGFWIRETGQALDRLG RLQGNY+F EQLSRHR LMN+FDKVP V ++AF
Sbjct  1     MGSFGRAFYTVGFWIRETGQALDRLGSRLQGNYFFQEQLSRHRTLMNVFDKVPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASI+GDV VGR SSIWYGCVLRGDVNSISIG+GTNIQDNSLVHVAKSNL+GKVL  
Sbjct  61    VAPSASIVGDVHVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPI  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDE+FVGMGATLLDGVVVEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   LIGDNVTVGHSAVLHGCTVEDESFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPAGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTE+EIAFISQSA NY+NLAQVHA ENAK FD++EFEKVLRKKFA +DE
Sbjct  181   WGGNPARFLRKLTEDEIAFISQSAINYANLAQVHASENAKGFDKVEFEKVLRKKFASRDE  240

Query  384   DYDSMLGVVRETPQELILPDN  322
             +YDSMLGVVR+TP EL+  +N
Sbjct  241   EYDSMLGVVRQTPPELVHSNN  261



>ref|XP_004287879.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=269

 Score =   465 bits (1196),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 221/268 (82%), Positives = 238/268 (89%), Gaps = 0/268 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLG RLQGNY+F EQLSRHR LMN+FDK P V +EAF
Sbjct  1     MGTLGRAVYTVGFWIRETGQAIDRLGSRLQGNYFFKEQLSRHRTLMNVFDKAPEVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIG VQVGR SSIWYGCVLRGD NSISIG+GTNIQDNSLVHVAKSNL GKVL T
Sbjct  61    VAPSASIIGQVQVGRGSSIWYGCVLRGDANSISIGSGTNIQDNSLVHVAKSNLDGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLTE+E+AFISQSA NY+NLAQVHA ENAK  D +EFEKVLRKKF R+DE
Sbjct  181   WGGNPAKFLRKLTEDEMAFISQSAINYANLAQVHAAENAKELDSVEFEKVLRKKFGRRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAA  301
             DYD+M  VVR+T  E  LPDN+ P   A
Sbjct  241   DYDTMFEVVRQTSPEATLPDNVGPPPKA  268



>ref|XP_010523601.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Tarenaya 
hassleriana]
Length=276

 Score =   465 bits (1196),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 218/268 (81%), Positives = 245/268 (91%), Gaps = 0/268 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQALDRLG RLQG++Y  EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAIYTVGFWIRETGQALDRLGYRLQGSHYLQEQLSRHRTLMNVFDKAPLVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ  R SSIWYGCVLRGDVN IS+G+ TNIQDN+LVHVAKSN++GKVL T
Sbjct  61    VAPSASVIGDVQXXRASSIWYGCVLRGDVNGISVGSRTNIQDNALVHVAKSNISGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCT+EDEAFVGMGATLLDGVVVEK+AMVAAGALVRQNTRIP  EV
Sbjct  121   IIGDNVTVGHSAVIHGCTIEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPSREV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+EEIAFISQSA NY+NLAQVHA ENAKSF+EIEFEK LRKK+A KDE
Sbjct  181   WGGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENAKSFEEIEFEKALRKKYANKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAA  301
             +YD+M+GVVRE P +LILPDN+LP KA+
Sbjct  241   EYDAMIGVVREVPPQLILPDNVLPVKAS  268



>dbj|BAD44607.1| unknown protein [Arabidopsis thaliana]
Length=275

 Score =   464 bits (1194),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/269 (81%), Positives = 241/269 (90%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY+VGFWI ETGQALDRLGCRLQG  YF EQLSRHR  MN+FDK P V +EAF
Sbjct  1     MGTLGRAFYSVGFWILETGQALDRLGCRLQGKNYFREQLSRHRTQMNVFDKAPIVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDV +GR SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ MVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLT+EEIAFISQSA NYSNLAQ HA ENAK  + IEFEKVLRKK A KDE
Sbjct  181   WGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNVIEFEKVLRKKHALKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLG+VRETP EL LP+NILPDK  K
Sbjct  241   EYDSMLGIVRETPPELNLPNNILPDKETK  269



>ref|XP_006305516.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
 gb|EOA38414.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
Length=275

 Score =   457 bits (1177),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 214/270 (79%), Positives = 240/270 (89%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V + AF
Sbjct  1     MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKTAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+GR SSIWYGCVLRGD N++S+G+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASVIGDVQIGRGSSIWYGCVLRGDANTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLHGCTVE++ F+GMGATLLDGVVVE++ MVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTIGHSAVLHGCTVENQTFIGMGATLLDGVVVEEHGMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLT+EEIAFIS+SA NYSNLAQ HA ENAK  + IEFEKVLRKK A KDE
Sbjct  181   WGGNPARFLRKLTDEEIAFISESATNYSNLAQAHAAENAKPLNAIEFEKVLRKKHAGKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLG+VRETP EL LP+NI  DK  K 
Sbjct  241   EYDSMLGIVRETPSELNLPNNIQSDKETKG  270



>ref|XP_002890347.1| F18O14.34 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66606.1| F18O14.34 [Arabidopsis lyrata subsp. lyrata]
Length=299

 Score =   456 bits (1173),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 219/293 (75%), Positives = 244/293 (83%), Gaps = 24/293 (8%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQ----------------------  991
             MG++GRAFY+VGFWIRETGQALDRLGCRLQG  YF EQ                      
Sbjct  1     MGTVGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQRKLLRNSSFHSDFEFVVSTAFT  60

Query  990   --LSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGA  817
               +SRHR LMN+FDK P V +EAFVAPSAS+IGDVQ+GR SSIWYGCVLRGDVN++S+G+
Sbjct  61    QLISRHRTLMNVFDKAPIVDKEAFVAPSASVIGDVQIGRGSSIWYGCVLRGDVNTVSVGS  120

Query  816   GTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVV  637
             GTNIQDNSLVHVAKSNL+GKV  T+IG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVV
Sbjct  121   GTNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVV  180

Query  636   VEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAV  457
             VEK+ MVAAGALVRQNTRIP GEVWGGNPA+FLRKLT+EEIAFISQSA NYSNLAQ HA 
Sbjct  181   VEKHGMVAAGALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAA  240

Query  456   ENAKSFDEIEFEKVLRKKFARKDEDYDSMLGVVRETPQELILPDNILPDKAAK  298
             ENAK  + IEFEKVLRKK A+KDE+YDSMLG+VRETP EL LP+NI PDK  K
Sbjct  241   ENAKPLNAIEFEKVLRKKHAQKDEEYDSMLGIVRETPPELNLPNNIQPDKETK  293



>ref|XP_009612501.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=273

 Score =   455 bits (1170),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 211/270 (78%), Positives = 245/270 (91%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A Y++G  +R TGQALDR+G RLQG+ Y  E LSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGKAIYSLGAIVRATGQALDRIGNRLQGSSYLEEHLSRHRTLMNIFDKAPVVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAP AS+IGDV VGR+SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSN++ KVL T
Sbjct  61    VAPGASVIGDVHVGRNSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNISQKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAV+HGCT+EDEAF+GMGATLLDGV VEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFI+QSA NY NLA+VHA EN+KSFDEIEFEK+LRKK+A++DE
Sbjct  181   WAGNPAKFLRKLTDEEIAFIAQSATNYCNLARVHAAENSKSFDEIEFEKMLRKKYAKRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSM+GVVRETP EL+LPDNILP+KAAK+
Sbjct  241   EYDSMIGVVRETPPELVLPDNILPEKAAKS  270



>gb|KFK44104.1| hypothetical protein AALP_AA1G216400 [Arabis alpina]
Length=275

 Score =   454 bits (1169),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 210/269 (78%), Positives = 239/269 (89%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P VH+EAF
Sbjct  1     MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKSPIVHKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+GR SSIWYGCVLRGDVN++++G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVQIGRGSSIWYGCVLRGDVNTVTVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLHGCTVEDE  +GMGATLLDGVVVEK+++VAAGALVRQNTRIP GE+
Sbjct  121   IIGDNVTIGHSAVLHGCTVEDETLIGMGATLLDGVVVEKHSIVAAGALVRQNTRIPAGEI  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKL E+E  F S SA  YSN+AQ HA ENAK  + IEFEKVLRKK+ RKDE
Sbjct  181   WGGNPARFLRKLKEKEFDFFSTSAITYSNIAQAHAAENAKPLNAIEFEKVLRKKYGRKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLG+VRETP EL LP+NI P+K  K
Sbjct  241   EYDSMLGIVRETPPELKLPNNIQPEKETK  269



>ref|XP_006393603.1| hypothetical protein EUTSA_v10011707mg [Eutrema salsugineum]
 gb|ESQ30889.1| hypothetical protein EUTSA_v10011707mg [Eutrema salsugineum]
Length=276

 Score =   454 bits (1168),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 210/268 (78%), Positives = 241/268 (90%), Gaps = 0/268 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVG WIR TGQALDR+G RLQG+ YF E LSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGRAIYTVGNWIRGTGQALDRVGSRLQGSPYFQEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN+IS+G+GTNIQDNSLVHVAK+NL+GKV  T
Sbjct  61    VAPSASVIGDVQIGKRSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLSGKVQPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AMVAA ALV++NTRIP GEV
Sbjct  121   IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAAALVKENTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKF+RKLT+EEI +IS+SA NY NLA +HA EN+KSFDEIE E+ LRKK+ARKDE
Sbjct  181   WGGNPAKFMRKLTDEEIEYISKSAENYINLAHIHAAENSKSFDEIEVERALRKKYARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAA  301
             DYDSMLG+VRETP ELILPDN+LP+K  
Sbjct  241   DYDSMLGIVRETPAELILPDNVLPEKTT  268



>gb|AAF79435.1|AC025808_17 F18O14.34 [Arabidopsis thaliana]
Length=298

 Score =   454 bits (1169),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 220/292 (75%), Positives = 243/292 (83%), Gaps = 23/292 (8%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQ----------------------  991
             MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQ                      
Sbjct  1     MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQRKILRNSIFHSDFEFVKSEEFR  60

Query  990   -LSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAG  814
              +SRHR LMN+FDK P V +EAFVAPSAS+IGDV +GR SSIWYGCVLRGDVN++S+G+G
Sbjct  61    LVSRHRTLMNVFDKAPIVDKEAFVAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSG  120

Query  813   TNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVV  634
             TNIQDNSLVHVAKSNL+GKV  T+IG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVV
Sbjct  121   TNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVV  180

Query  633   EKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVE  454
             EK+ MVAAGALVRQNTRIP GEVWGGNPA+FLRKLT+EEIAFISQSA NYSNLAQ HA E
Sbjct  181   EKHGMVAAGALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAE  240

Query  453   NAKSFDEIEFEKVLRKKFARKDEDYDSMLGVVRETPQELILPDNILPDKAAK  298
             NAK  + IEFEKVLRKK A KDE+YDSMLG+VRETP EL LP+NILPDK  K
Sbjct  241   NAKPLNVIEFEKVLRKKHALKDEEYDSMLGIVRETPPELNLPNNILPDKETK  292



>ref|XP_003517218.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Glycine 
max]
Length=270

 Score =   453 bits (1165),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 217/270 (80%), Positives = 238/270 (88%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGR FY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1     MGTLGRVFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS++GDV VG  SSIWYGCVLRGDVNSI+IG+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASLLGDVHVGPASSIWYGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAAGALVRQNTRIPYGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTE+E+ F SQSA NYSNLAQ HA ENAK  DE EF KVL KKFAR+ E
Sbjct  181   WGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHAAENAKGLDETEFVKVLYKKFARRGE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +Y S+LG V+ETP EL +PDN+L DK  KA
Sbjct  241   EYHSVLGGVQETPAELNVPDNVLLDKVPKA  270



>gb|KEH36170.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=272

 Score =   452 bits (1162),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 214/270 (79%), Positives = 242/270 (90%), Gaps = 1/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y+VG  IR+TGQA+DRLG  LQG Y   EQLSRHR ++N+FDK P + ++ F
Sbjct  1     MGTLGRAIYSVGQLIRKTGQAVDRLGSHLQGGY-IEEQLSRHRTVLNIFDKAPVIDKDVF  59

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSA++IGDVQ+G+ SSIWYG VLRGDVN I IG+GTN+QDNSLVHVAKSNL+GKVL T
Sbjct  60    VAPSAAVIGDVQIGKGSSIWYGSVLRGDVNIIRIGSGTNLQDNSLVHVAKSNLSGKVLPT  119

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAMVAAGALVRQNT+IP GEV
Sbjct  120   IIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTKIPSGEV  179

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFISQSA NY+NLAQVHA EN+KS++EIEFEKVLRKK+A KDE
Sbjct  180   WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSYEEIEFEKVLRKKYATKDE  239

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRE P ELILPDN+LPDKA KA
Sbjct  240   EYDSMLGVVREIPPELILPDNVLPDKAKKA  269



>ref|XP_009771198.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Nicotiana 
sylvestris]
Length=273

 Score =   451 bits (1161),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 209/270 (77%), Positives = 244/270 (90%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A Y++G  +R TGQALDR+G RLQG+ Y  E LSRHR LMN+ DK P V ++ F
Sbjct  1     MGTLGKAIYSLGSIVRATGQALDRVGNRLQGSSYLEEHLSRHRTLMNILDKAPVVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAP AS+IGDV VGR+SSIWYGCVLRGDVNSIS+G+G+NIQDNSLVHVAKSN++ KVL T
Sbjct  61    VAPGASVIGDVHVGRNSSIWYGCVLRGDVNSISVGSGSNIQDNSLVHVAKSNISQKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAV+HGCT+EDEAF+GMGATLLDGV VEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFI+QSA NY NLA+VHA EN+KSFDEIEFEK+LRKK+A++DE
Sbjct  181   WAGNPAKFLRKLTDEEIAFIAQSATNYCNLARVHAAENSKSFDEIEFEKMLRKKYAKRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSM+GVVRETP EL+LPDNILP+KAAK+
Sbjct  241   EYDSMIGVVRETPPELVLPDNILPEKAAKS  270



>ref|XP_003567426.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Brachypodium 
distachyon]
Length=260

 Score =   450 bits (1158),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 210/256 (82%), Positives = 234/256 (91%), Gaps = 0/256 (0%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             + +AFY VGFWIRETGQALDRLG RLQGNY+FHEQ+SRHR LMN+FDK P VHREAFVAP
Sbjct  1     MAKAFYAVGFWIRETGQALDRLGSRLQGNYFFHEQISRHRTLMNIFDKAPYVHREAFVAP  60

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             SAS+IGDVQVG+ SSIWYGCVLRGD N++ IG+GTNIQDNS+VHVAKSNL+GKV  T+IG
Sbjct  61    SASLIGDVQVGQGSSIWYGCVLRGDANNVQIGSGTNIQDNSVVHVAKSNLSGKVFPTIIG  120

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             +NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ MVAAGALVRQNTRIPCGEVWGG
Sbjct  121   DNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEVWGG  180

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYD  376
             NPAKFLRKLT+EEIAFI++SAANYSNLA+ HAVENAK  ++IEFEKVLRK+FAR+DE+YD
Sbjct  181   NPAKFLRKLTDEEIAFIAESAANYSNLAKAHAVENAKPLEKIEFEKVLRKRFARQDEEYD  240

Query  375   SMLGVVRETPQELILP  328
             SMLGV RE   EL  P
Sbjct  241   SMLGVTREAHPELTPP  256



>gb|KHN36089.1| Hypothetical protein glysoja_003212 [Glycine soja]
Length=270

 Score =   450 bits (1157),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 216/270 (80%), Positives = 237/270 (88%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGR FY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1     MGTLGRVFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS++GDV VG  SSIWYGCVLRGDVNSI+IG+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASLLGDVHVGPASSIWYGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVL GCTVEDEAF+GMGATLL GV VEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLGGVYVEKHAMVAAGALVRQNTRIPYGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTE+E+ F SQSA NYSNLAQ HA ENAK  DE EF KVL KKFAR+ E
Sbjct  181   WGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHAAENAKGLDETEFVKVLYKKFARRGE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +Y S+LG V+ETP EL +PDN+L DK  KA
Sbjct  241   EYHSVLGGVQETPAELNVPDNVLLDKVPKA  270



>ref|XP_004238283.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Solanum 
lycopersicum]
Length=273

 Score =   449 bits (1156),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 208/270 (77%), Positives = 245/270 (91%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A Y++G  +R TG+ALDR+G RLQG+ +  E LSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGKAIYSLGSIVRATGKALDRVGNRLQGSSHIEEHLSRHRTLMNVFDKAPVVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAP AS+IGDV VGR+SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSN++ KVL T
Sbjct  61    VAPGASVIGDVHVGRNSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNISQKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAV+HGCT+EDEAF+GMGATLLDGV VEK+AMVAAGALV+QNTRIP GEV
Sbjct  121   IIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAAGALVKQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFI+QSA NY NLA+VHA EN+KSFDEIEFEK+LRKK+A++DE
Sbjct  181   WAGNPAKFLRKLTDEEIAFIAQSATNYCNLARVHAAENSKSFDEIEFEKMLRKKYAKRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSM+GVVRETP EL+LPDNILP+KAAK+
Sbjct  241   EYDSMIGVVRETPPELVLPDNILPEKAAKS  270



>gb|ACU23675.1| unknown [Glycine max]
Length=270

 Score =   449 bits (1155),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 215/270 (80%), Positives = 236/270 (87%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGR FY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1     MGTLGRVFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS++GDV VG  SSIWYGCVLRGDVNSI+IG+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASLLGDVHVGPASSIWYGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVL GCTVEDEAF+GMG TLLDGV VEK+A VAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVLQGCTVEDEAFIGMGVTLLDGVYVEKHATVAAGALVRQNTRIPYGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTE+E+ F SQSA NYSNLAQ HA ENAK  DE EF KVL KKFAR+ E
Sbjct  181   WGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHAAENAKGLDETEFLKVLYKKFARRGE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +Y S+LG V+ETP EL +PDN+L DK  KA
Sbjct  241   EYHSVLGGVQETPAELDVPDNVLLDKVPKA  270



>ref|XP_002455477.1| hypothetical protein SORBIDRAFT_03g011540 [Sorghum bicolor]
 gb|EES00597.1| hypothetical protein SORBIDRAFT_03g011540 [Sorghum bicolor]
Length=263

 Score =   448 bits (1153),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 207/260 (80%), Positives = 235/260 (90%), Gaps = 0/260 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1     MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG  +SIWYGCVLRGD N+I IG+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASLIGDVQVGPGASIWYGCVLRGDANNIQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ MVAAGALVRQNTRIPCGEV
Sbjct  121   IIGNNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT++EIAFI++SAANYS+L++VHA+ENAK  ++IEFEKVLRKKFA +DE
Sbjct  181   WGGNPAKFLRKLTDDEIAFIAESAANYSSLSKVHAIENAKPLEKIEFEKVLRKKFAHQDE  240

Query  384   DYDSMLGVVRETPQELILPD  325
             +YDS +GV RE P EL  P+
Sbjct  241   EYDSSIGVTREAPPELTSPN  260



>gb|AFK41197.1| unknown [Medicago truncatula]
Length=272

 Score =   448 bits (1153),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 212/270 (79%), Positives = 240/270 (89%), Gaps = 1/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y+ G  IR+TGQA+DRLG  LQG Y   EQLSRHR ++N+FDK P + ++ F
Sbjct  1     MGTLGRAIYSAGQLIRKTGQAVDRLGSHLQGGY-IEEQLSRHRTVLNIFDKAPVIDKDVF  59

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSA++IGDVQ+G+ SSIWYG VLRGDVN I IG+GTN+QDNSLVHVAKSNL+G VL T
Sbjct  60    VAPSAAVIGDVQIGKGSSIWYGSVLRGDVNIIRIGSGTNLQDNSLVHVAKSNLSGMVLPT  119

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAMVAAGALVRQNT+IP GEV
Sbjct  120   IIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTKIPSGEV  179

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFISQSA NY+NLAQVHA EN+KS++EIEFEKVLRKK+A KDE
Sbjct  180   WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSYEEIEFEKVLRKKYATKDE  239

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRE P ELILPDN+LPDKA KA
Sbjct  240   EYDSMLGVVREIPPELILPDNVLPDKAKKA  269



>ref|XP_003537599.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Glycine 
max]
 gb|KHN41952.1| Hypothetical protein glysoja_003692 [Glycine soja]
Length=270

 Score =   448 bits (1152),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 215/270 (80%), Positives = 236/270 (87%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1     MGTLGRAFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS++GDV VG  SSIWYGCVLRGDVNSI+IG+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASLLGDVHVGPASSIWYGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAAGALVRQNTRIPYGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTE+E+ F SQSA NYSNLAQ H+ ENAK  DE EF KVL KKFAR  +
Sbjct  181   WGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHSAENAKGLDETEFVKVLHKKFARHGD  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +Y S+LG V+ETP EL   DN+L DK  KA
Sbjct  241   EYHSVLGGVQETPTELKSSDNVLLDKVPKA  270



>ref|XP_006341958.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Solanum 
tuberosum]
Length=273

 Score =   447 bits (1151),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 206/270 (76%), Positives = 245/270 (91%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A Y++G  +R TG+ALDR+G RLQG+ +  E LSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGKAIYSLGSIVRATGKALDRVGNRLQGSSHIEEHLSRHRTLMNIFDKAPVVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAP A++IGDV VGR+SSIWYGCVLRGDVNSIS+G+GTNIQDNSLVHVAKSN++ KVL T
Sbjct  61    VAPGATVIGDVHVGRNSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNISQKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAV+HGCT+EDEAF+GMGATLLDGV VEK+AMVAAG+LV+QNTRIP GEV
Sbjct  121   IIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAAGSLVKQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFI+QSA NY NLA+VHA EN+KSFDEIEFEK+LRKK+A++DE
Sbjct  181   WAGNPAKFLRKLTDEEIAFIAQSATNYCNLARVHAAENSKSFDEIEFEKMLRKKYAKRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSM+GVVRETP EL+LPDNILP+KAAK+
Sbjct  241   EYDSMIGVVRETPPELVLPDNILPEKAAKS  270



>ref|XP_010459631.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X1 [Camelina sativa]
 ref|XP_010459632.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X2 [Camelina sativa]
Length=269

 Score =   447 bits (1150),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 212/269 (79%), Positives = 237/269 (88%), Gaps = 6/269 (2%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V + AF
Sbjct  1     MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKGAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+GR SSIWYGCVLRGD N++S+G+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASVIGDVQIGRGSSIWYGCVLRGDANTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLHGCTVE+E F+GMGATLLDGVVVEK+ MVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTIGHSAVLHGCTVENETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLT+EEIAFI++SA NYSNLAQ HA ENAK  + IEFEKVLRKK A+KDE
Sbjct  181   WGGNPARFLRKLTDEEIAFIAESATNYSNLAQAHAAENAKPLNAIEFEKVLRKKHAQKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLG VRET      P+NI PDK  K
Sbjct  241   EYDSMLGSVRET------PNNIQPDKETK  263



>gb|ACU19296.1| unknown [Glycine max]
Length=270

 Score =   447 bits (1150),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 214/270 (79%), Positives = 235/270 (87%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1     MGTLGRAFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS++GDV VG  SSIWYGCVLRGDVNSI+IG+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASLLGDVHVGPASSIWYGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAAGALVRQNTRIPYGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTE+E+ F SQSA NYSNLAQ H+ ENAK  DE EF KVL KKF R  +
Sbjct  181   WGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHSAENAKGLDETEFVKVLHKKFVRHGD  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +Y S+LG V+ETP EL   DN+L DK  KA
Sbjct  241   EYHSVLGGVQETPTELKFSDNVLLDKVPKA  270



>gb|EYU45182.1| hypothetical protein MIMGU_mgv1a011728mg [Erythranthe guttata]
Length=272

 Score =   447 bits (1150),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 209/270 (77%), Positives = 240/270 (89%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A YT+G WIR TG+A+D++G  LQG+ Y  E LSRHR LM +FDK P V ++AF
Sbjct  1     MGTLGKAVYTLGNWIRGTGKAMDKVGSLLQGSSYIEEHLSRHRTLMEIFDKSPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             +AP AS+IGDVQVG+ +SIWYG VLRGDVNSISIG GTNIQDNSLVHVAKSNL+G VL T
Sbjct  61    IAPGASVIGDVQVGQGASIWYGSVLRGDVNSISIGYGTNIQDNSLVHVAKSNLSGNVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAV+HGCT+EDEAFVGMGATLLDGVVVEK+AMVAAG+LVRQNTRIP GEV
Sbjct  121   IIGNNVTVGHSAVIHGCTIEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEIAFISQSA NY NLA+VHA EN KSFDEI+ EK+LRKKFAR+DE
Sbjct  181   WAGNPAKFLRKLTDEEIAFISQSATNYINLAKVHAAENTKSFDEIQLEKMLRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             DY+SM+G+VRE P ELILPDNILP+K+ KA
Sbjct  241   DYESMIGIVREIPPELILPDNILPEKSQKA  270



>ref|NP_001066265.1| Os12g0169700 [Oryza sativa Japonica Group]
 gb|ABA95932.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29284.1| Os12g0169700 [Oryza sativa Japonica Group]
 gb|EAY82406.1| hypothetical protein OsI_37621 [Oryza sativa Indica Group]
 gb|EAZ19787.1| hypothetical protein OsJ_35366 [Oryza sativa Japonica Group]
 dbj|BAG96313.1| unnamed protein product [Oryza sativa Japonica Group]
Length=273

 Score =   446 bits (1147),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 208/270 (77%), Positives = 239/270 (89%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVG WIR TGQA+DRLG  +QG     EQLSRHR +MN+F+K P VH++ F
Sbjct  1     MGTLGRAIYTVGKWIRGTGQAMDRLGSTIQGGLRVEEQLSRHRTIMNIFEKEPRVHKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSA++IGDV++G  SSIWYG +LRGDVNSI IG+G+NIQDNSLVHVAK+N++GKVL T
Sbjct  61    VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGSNIQDNSLVHVAKANISGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVT+GHSAVLH CTVEDEAFVGMGATLLDGVVVEK++MV AG+LV+QNTRIP GEV
Sbjct  121   IIGNNVTIGHSAVLHACTVEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLTEEEIAFI+QSA NY NLAQVHA EN+K+FDEIE EK+LRKK+A KDE
Sbjct  181   WVGNPAKFLRKLTEEEIAFIAQSATNYINLAQVHAAENSKTFDEIELEKMLRKKYAHKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRE P ELILPDNILP+KA KA
Sbjct  241   EYDSMLGVVREIPPELILPDNILPNKAQKA  270



>emb|CDX83758.1| BnaC08g18870D [Brassica napus]
Length=269

 Score =   446 bits (1147),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 208/261 (80%), Positives = 236/261 (90%), Gaps = 0/261 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P V +EAF
Sbjct  1     MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IG+VQ+GR SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAKSNL+GKV +T
Sbjct  61    VAPSASVIGNVQIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVPAT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLHGCTVEDEAF+GMGATLLDGVVVEK+A+VAAGALVRQNTRIP GE+
Sbjct  121   IIGDNVTIGHSAVLHGCTVEDEAFIGMGATLLDGVVVEKHALVAAGALVRQNTRIPSGEI  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKL  +EI FI  SA NYSNLA+ HA ENAK  + IEFEKVLRK++A KDE
Sbjct  181   WGGNPAKFLRKLKSKEIDFIPVSAENYSNLAKAHAAENAKPLNAIEFEKVLRKRYAAKDE  240

Query  384   DYDSMLGVVRETPQELILPDN  322
             +YDSMLG+VRETP EL LP+N
Sbjct  241   EYDSMLGIVRETPPELKLPNN  261



>emb|CDY67628.1| BnaCnng55730D [Brassica napus]
Length=276

 Score =   446 bits (1147),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 206/268 (77%), Positives = 240/268 (90%), Gaps = 0/268 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVG WIR +GQALDR+G  LQG++ F E LSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGRAIYTVGKWIRGSGQALDRVGSLLQGSHRFEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN+IS+G+GTNIQDNSLVHVAK+NL GKVL T
Sbjct  61    VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLGGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
              IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVE +AMVAAG++V++NTRIP GEV
Sbjct  121   TIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVETHAMVAAGSIVKENTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKF+RKLT+EEIA+IS+SA NY NLA +HA EN+KSFDEIE E+ LRKK+ARKDE
Sbjct  181   WGGNPAKFMRKLTDEEIAYISKSAENYINLAHIHAAENSKSFDEIEVERALRKKYARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAA  301
             DYDSMLG+VRETP ELILPDN+LP+K  
Sbjct  241   DYDSMLGIVRETPAELILPDNVLPEKTT  268



>ref|XP_010477178.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Camelina 
sativa]
 ref|XP_010477179.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Camelina 
sativa]
Length=269

 Score =   446 bits (1146),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 236/269 (88%), Gaps = 6/269 (2%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V + AF
Sbjct  1     MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKGAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+GR SSIWYGCVLRGD NS+S+G+GTNIQDNSL+HVAKSNL+GKV  T
Sbjct  61    VAPSASVIGDVQIGRGSSIWYGCVLRGDANSVSVGSGTNIQDNSLLHVAKSNLSGKVHPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLHGCTVE+E F+GMGATLLDGVVVEK+ MVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTIGHSAVLHGCTVENETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLT+EEIAFI++SA NYSNLAQ HA ENAK  + IEFEKVLRKK A+KDE
Sbjct  181   WGGNPARFLRKLTDEEIAFIAESATNYSNLAQAHAAENAKPLNAIEFEKVLRKKHAQKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLG  RET      P+NI PDK  K
Sbjct  241   EYDSMLGSARET------PNNIQPDKETK  263



>emb|CDM82924.1| unnamed protein product [Triticum aestivum]
Length=262

 Score =   445 bits (1145),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 204/256 (80%), Positives = 233/256 (91%), Gaps = 0/256 (0%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             + +AFY VGFWIRETGQALDRLGCRLQGNY+FHEQ+SRHR LMN+FDK P VH+EAFVAP
Sbjct  1     MAKAFYAVGFWIRETGQALDRLGCRLQGNYFFHEQISRHRTLMNIFDKAPHVHKEAFVAP  60

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             SAS+IGDV+VG+ SSIWYGC+LRGD N++ +G+GTNIQDNS+VHVAKSNL+GKV  T+IG
Sbjct  61    SASLIGDVEVGQGSSIWYGCILRGDANNVQVGSGTNIQDNSVVHVAKSNLSGKVFPTIIG  120

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             +NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ MVAAGALVRQNTRIPCGEVWGG
Sbjct  121   DNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEVWGG  180

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYD  376
             NPAKFLRKLT+EEIAFI++SAANYSNLA+ HAVENAK  ++I+FEKVLRKKFA +D ++D
Sbjct  181   NPAKFLRKLTDEEIAFIAESAANYSNLAKAHAVENAKPLEKIDFEKVLRKKFAHQDNEHD  240

Query  375   SMLGVVRETPQELILP  328
             SML V RE P EL  P
Sbjct  241   SMLSVTREVPPELAPP  256



>ref|XP_010498381.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Camelina 
sativa]
Length=269

 Score =   445 bits (1145),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 236/269 (88%), Gaps = 6/269 (2%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V + AF
Sbjct  1     MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKTPIVDKGAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+GR SSIWYGCVLRGD N++S+G+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASVIGDVQIGRGSSIWYGCVLRGDANTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLHGCTVE+E F+GMGATLLDGVVVEK+ MVAAGALVRQNT IP GEV
Sbjct  121   IIGDNVTIGHSAVLHGCTVENETFIGMGATLLDGVVVEKHGMVAAGALVRQNTTIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLT+EEIAFI++SA NYSNLAQ HA ENAK  + IEFEKVLRKK A+KDE
Sbjct  181   WGGNPARFLRKLTDEEIAFIAESATNYSNLAQAHAAENAKPLNAIEFEKVLRKKHAQKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             +YDSMLG VRET      P+NI PDK  K
Sbjct  241   EYDSMLGSVRET------PNNIQPDKETK  263



>emb|CDY47592.1| BnaC08g04620D [Brassica napus]
Length=276

 Score =   444 bits (1143),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 206/268 (77%), Positives = 240/268 (90%), Gaps = 0/268 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGR  YTVG WIR +GQALDR+G  LQG++   E LSRHR LM++FDK P V ++ F
Sbjct  1     MGTLGRVIYTVGNWIRGSGQALDRVGSILQGSHRLEEHLSRHRTLMSVFDKSPLVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN+IS+G+GTNIQDNSLVHVAK+NL+GKVL T
Sbjct  61    VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
              IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AMVAAG+LVR+NTRIP GEV
Sbjct  121   TIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRENTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKF+RKLT+EEIA+IS+SA NY NLA +HA EN+KSF+EIE E+ LRKK+ARKDE
Sbjct  181   WGGNPAKFMRKLTDEEIAYISKSAENYINLAHIHAAENSKSFEEIEVERALRKKYARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAA  301
             DYDSMLG+VRETP ELILPDN+LP+K  
Sbjct  241   DYDSMLGIVRETPAELILPDNVLPEKTT  268



>ref|XP_009110271.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Brassica 
rapa]
Length=269

 Score =   444 bits (1141),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/260 (80%), Positives = 234/260 (90%), Gaps = 0/260 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P V +EAF
Sbjct  1     MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IG+VQ+GR SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASVIGNVQIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVPPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLHGCTVEDEAF+GMGATLLDGVVVEK+A+VAAGALVRQNTRIP GE+
Sbjct  121   IIGDNVTIGHSAVLHGCTVEDEAFIGMGATLLDGVVVEKHALVAAGALVRQNTRIPSGEI  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKL  +EI FI  SA NYSNLA+ HA ENAK  + IEFEKVLRK++A KDE
Sbjct  181   WGGNPAKFLRKLKSKEIDFIPVSAENYSNLAKAHAAENAKPLNAIEFEKVLRKRYAAKDE  240

Query  384   DYDSMLGVVRETPQELILPD  325
             +YDSMLG+VRETP EL LP+
Sbjct  241   EYDSMLGIVRETPPELKLPN  260



>emb|CDX96658.1| BnaA08g22010D [Brassica napus]
Length=269

 Score =   444 bits (1141),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/260 (80%), Positives = 234/260 (90%), Gaps = 0/260 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P V +EAF
Sbjct  1     MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IG+VQ+GR SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASVIGNVQIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVPPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLHGCTVEDEAF+GMGATLLDGVVVEK+A+VAAGALVRQNTRIP GE+
Sbjct  121   IIGDNVTIGHSAVLHGCTVEDEAFIGMGATLLDGVVVEKHALVAAGALVRQNTRIPSGEI  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKL  +EI FI  SA NYSNLA+ HA ENAK  + IEFEKVLRK++A KDE
Sbjct  181   WGGNPAKFLRKLKSKEIDFIPVSAENYSNLAKAHAAENAKPLNAIEFEKVLRKRYAAKDE  240

Query  384   DYDSMLGVVRETPQELILPD  325
             +YDSMLG+VRETP EL LP+
Sbjct  241   EYDSMLGIVRETPPELKLPN  260



>ref|XP_007156970.1| hypothetical protein PHAVU_002G032600g [Phaseolus vulgaris]
 gb|ESW28964.1| hypothetical protein PHAVU_002G032600g [Phaseolus vulgaris]
Length=270

 Score =   444 bits (1141),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 215/270 (80%), Positives = 236/270 (87%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVH++AF
Sbjct  1     MGTLGRAFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKGPSVHKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS++GDV VG  SSIWYGCVLRGDVN I IG+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASLLGDVHVGPASSIWYGCVLRGDVNGIVIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAAGALVRQNTRIPYGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTE+E+ F SQSA NYSNLAQ HA ENAK  +E EF KVL KKFA + E
Sbjct  181   WGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHADENAKELEETEFVKVLHKKFAPRGE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDS+LG  +ETP EL L DN+L DKA KA
Sbjct  241   EYDSILGGGQETPAELNLQDNVLLDKAPKA  270



>ref|XP_008655471.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Zea 
mays]
 gb|AFW79496.1| hypothetical protein ZEAMMB73_562884 [Zea mays]
Length=263

 Score =   443 bits (1140),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 203/260 (78%), Positives = 234/260 (90%), Gaps = 0/260 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VHR+AF
Sbjct  1     MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHRDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG+ +SIWYGCVLRGD N+I IG+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASLIGDVQVGQGASIWYGCVLRGDANNIQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVT+GHSAVL GCTVEDEAFVGMGATLLDGVVV K+ MVAAG+LVRQNTRIPCGEV
Sbjct  121   IIGNNVTIGHSAVLQGCTVEDEAFVGMGATLLDGVVVGKHGMVAAGSLVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT++EIAFI++SA+NYSNL++VHA ENAK  ++IEFEKVLRKKFA +DE
Sbjct  181   WGGNPAKFLRKLTDDEIAFITESASNYSNLSKVHAAENAKPLEKIEFEKVLRKKFAHQDE  240

Query  384   DYDSMLGVVRETPQELILPD  325
             +YDS +G+ R +P EL  P+
Sbjct  241   EYDSSIGITRGSPPELTSPN  260



>ref|XP_003612060.1| Transcription factor APFI-like protein [Medicago truncatula]
 gb|AES95018.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=270

 Score =   443 bits (1139),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 211/271 (78%), Positives = 236/271 (87%), Gaps = 1/271 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFYTVGFWIRETGQA+DRLG RLQGNY+F EQLSRHR LMN++DKVP VH++AF
Sbjct  1     MGTLGRAFYTVGFWIRETGQAIDRLGSRLQGNYFFQEQLSRHRPLMNVYDKVPYVHKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             +APSASI GDVQ+G  SSIWYGCVLRGDVN+I+IG+ TNIQDNSLVHVAKSNL+G+VL T
Sbjct  61    IAPSASITGDVQIGHASSIWYGCVLRGDVNNITIGSSTNIQDNSLVHVAKSNLSGRVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVHVEKHAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTE+E+ F SQSA NYSNLAQ HA ENAK  DE EF KVL KKF R DE
Sbjct  181   WGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHAAENAKKLDETEFVKVLGKKFVRPDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
               DS+L  V +TP E+  PDN   DKA KA+
Sbjct  241   -VDSVLNAVGDTPPEITPPDNAALDKAPKAS  270



>ref|NP_175159.1| gamma carbonic anhydrase 2 [Arabidopsis thaliana]
 sp|Q9C6B3.1|GCA2_ARATH RecName: Full=Gamma carbonic anhydrase 2, mitochondrial; Short=AtCA2; 
Short=GAMMA CA2; AltName: Full=Transcription factor 
APFI; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG52641.1|AC079677_5 unknown protein; 6976-8939 [Arabidopsis thaliana]
 gb|AAK76653.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44984.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32144.1| gamma carbonic anhydrase 2 [Arabidopsis thaliana]
Length=278

 Score =   443 bits (1139),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 204/264 (77%), Positives = 239/264 (91%), Gaps = 0/264 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN+IS+G+GTNIQDN+LVHVAK+N++GKVL T
Sbjct  61    VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AMVAAG+LV+QNTRIP GEV
Sbjct  121   LIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKF+RKLT+EEI +ISQSA NY NLAQ+HA EN+KSF++IE E+ LRKK+ARKDE
Sbjct  181   WGGNPAKFMRKLTDEEIVYISQSAKNYINLAQIHASENSKSFEQIEVERALRKKYARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILP  313
             DYDSMLG+ RETP ELILPDN+LP
Sbjct  241   DYDSMLGITRETPPELILPDNVLP  264



>emb|CDY17034.1| BnaA08g03980D [Brassica napus]
Length=276

 Score =   442 bits (1138),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 205/268 (76%), Positives = 239/268 (89%), Gaps = 0/268 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGR  YTVG WIR +GQALDR+G  LQG++   E LSRHR LM++FDK P V ++ F
Sbjct  1     MGTLGRVIYTVGNWIRGSGQALDRVGSLLQGSHRLEEHLSRHRTLMSVFDKSPLVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN+IS+G+GTNIQDNSLVHVAK+NLAGKVL T
Sbjct  61    VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLAGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
              IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AMVAAG+LVR+NTRIP GEV
Sbjct  121   TIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRENTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKF+RKLT+EE+A+IS+SA NY NLA +HA EN+KSF+EIE E+ LRKK+ARKDE
Sbjct  181   WGGNPAKFMRKLTDEEVAYISKSAENYINLAHIHAAENSKSFEEIEVERALRKKYARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAA  301
             DYDSMLG+VRE P ELILPDN+LP+K  
Sbjct  241   DYDSMLGIVREIPAELILPDNVLPEKTT  268



>ref|XP_006644073.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Oryza 
brachyantha]
Length=263

 Score =   442 bits (1136),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 204/259 (79%), Positives = 232/259 (90%), Gaps = 0/259 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             M  LG+AFY VGFWIRETGQALDRLGCRLQGNY+FHEQLSRHR LMN+FDK P VHR+AF
Sbjct  1     MAGLGKAFYAVGFWIRETGQALDRLGCRLQGNYFFHEQLSRHRTLMNIFDKTPHVHRDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG+ +SIWYGCVLRGD N++ IG+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASLIGDVQVGQGASIWYGCVLRGDANNVQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ MVAAG+LVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGSLVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT+ EIAFI +SA+NYS+LA+ HA ENAK  ++IEFEK+LRKK A +DE
Sbjct  181   WGGNPAKFLRKLTDSEIAFIKESASNYSSLAKAHAAENAKPVEKIEFEKLLRKKSAHQDE  240

Query  384   DYDSMLGVVRETPQELILP  328
             ++DS++G  RE P EL  P
Sbjct  241   EHDSVIGATREVPPELAPP  259



>ref|XP_006663861.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Oryza 
brachyantha]
Length=273

 Score =   442 bits (1136),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 205/270 (76%), Positives = 238/270 (88%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVG WIR TGQA+DRLG  +QG     EQLSRHR +MN+F+K P +H++ F
Sbjct  1     MGTLGRAIYTVGKWIRGTGQAMDRLGSTIQGGLRVEEQLSRHRTIMNIFEKEPRIHKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSA++IGDV++G  SSIWYG +LRGDVNSI IG+GTNIQDNSLVHV+K+N++GKVL T
Sbjct  61    VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGTNIQDNSLVHVSKANISGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GHSAVLH CT+EDEAFVGMGATLLDGVVVEK++MV AG+LV+QNTRIP GEV
Sbjct  121   IIGSNVTIGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLTEEE+AFI+QSA NY NLAQVHA ENAK+FDEIE EK+LRKKFA KDE
Sbjct  181   WVGNPAKFLRKLTEEEMAFIAQSAMNYINLAQVHAAENAKTFDEIELEKMLRKKFAHKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRE P ELILPDNILP+KA  A
Sbjct  241   EYDSMLGVVREIPPELILPDNILPNKAPNA  270



>ref|XP_002463275.1| hypothetical protein SORBIDRAFT_02g041030 [Sorghum bicolor]
 gb|EER99796.1| hypothetical protein SORBIDRAFT_02g041030 [Sorghum bicolor]
Length=273

 Score =   441 bits (1135),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 207/270 (77%), Positives = 236/270 (87%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA +TVG WIR TGQA+DRLG  LQG     EQ+SRHR +MN+F+K P +HR+ F
Sbjct  1     MGTLGRAIFTVGKWIRGTGQAMDRLGSTLQGGLRVEEQVSRHRTIMNIFEKEPKIHRDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSA++IGDV++G  SSIWYG +LRGDVNSI IG+GTNIQDNSLVHVAK+N +GKVL T
Sbjct  61    VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGTNIQDNSLVHVAKANFSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGV+VEK++MV AG+LV+QNTRIP GEV
Sbjct  121   IIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVLVEKHSMVGAGSLVKQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLTEEEIAFI+QSA NY NLAQVHA ENAKSFDEIE EK+LRKK+A KDE
Sbjct  181   WVGNPAKFLRKLTEEEIAFIAQSATNYINLAQVHAAENAKSFDEIELEKMLRKKYAHKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRE P ELILPDNILP  A KA
Sbjct  241   EYDSMLGVVREIPPELILPDNILPHNAQKA  270



>gb|EAZ04886.1| hypothetical protein OsI_27068 [Oryza sativa Indica Group]
Length=273

 Score =   441 bits (1134),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 205/270 (76%), Positives = 236/270 (87%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVG WIR TGQA+DRLG  +QG     EQLSRHR +MN+F+K P +H++ F
Sbjct  1     MGTLGRAIYTVGKWIRGTGQAMDRLGSTIQGGLRVEEQLSRHRTIMNIFEKEPRIHKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSA++IGDV++G  SSIWYG +LRGDVNSI IGAGTNIQDNSLVHV+K+N++GKVL T
Sbjct  61    VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGAGTNIQDNSLVHVSKANISGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGN VT+GHSAVLH C VEDEAFVGMGATLLDGVVVEK++MV AG+LV+QNTRIP GEV
Sbjct  121   IIGNRVTIGHSAVLHACIVEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLTEEE+ FI+QSA NY NLAQVHA ENAK+FDEIE EK+LRKKFA KDE
Sbjct  181   WVGNPAKFLRKLTEEEMTFIAQSATNYINLAQVHAAENAKTFDEIELEKMLRKKFAHKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGV+RE P ELILPDNILP+KA KA
Sbjct  241   EYDSMLGVIREIPPELILPDNILPNKAQKA  270



>ref|NP_001169012.1| uncharacterized protein LOC100382844 [Zea mays]
 gb|ACN31405.1| unknown [Zea mays]
Length=273

 Score =   440 bits (1131),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 205/270 (76%), Positives = 237/270 (88%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA +TVG WIR TGQA+DRLG  +QG     EQ+SRHR +MN+F+K P +HR+ F
Sbjct  1     MGTLGRAIFTVGKWIRGTGQAMDRLGSTIQGGLRVEEQVSRHRTIMNIFEKEPRIHRDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSA++IGDV++G  SSIWYG +LRGDVNSI IG+GTNIQDNSLVHV+K+N++GKVL T
Sbjct  61    VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGTNIQDNSLVHVSKANISGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++MV AG+LV+QNTRIP GEV
Sbjct  121   IIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLTEEEIAFI+QSA NY NLAQVHA ENAKSFDEIE EK+LRKK+A KDE
Sbjct  181   WVGNPAKFLRKLTEEEIAFIAQSATNYINLAQVHAAENAKSFDEIELEKMLRKKYAHKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRE P +LILPDNILP  A KA
Sbjct  241   EYDSMLGVVREIPPQLILPDNILPHNAQKA  270



>ref|XP_010500247.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Camelina 
sativa]
 ref|XP_010479124.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Camelina 
sativa]
Length=278

 Score =   440 bits (1131),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 203/264 (77%), Positives = 237/264 (90%), Gaps = 0/264 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+F K P V ++ F
Sbjct  1     MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFGKSPLVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN+IS+G+GTNIQDN+LVHVAK+N++GKVL T
Sbjct  61    VAPSASVIGDVQIGKSSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AMVAAG+LV+QNTRIP GEV
Sbjct  121   LIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKF+RKLT+EEI +ISQSA NY NLAQ+HA EN+KSFD+IE EK LR+K+ARKDE
Sbjct  181   WGGNPAKFMRKLTDEEIEYISQSAKNYINLAQIHASENSKSFDQIEVEKALRRKYARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILP  313
             DYDSMLG+ RE P ELILPDN+LP
Sbjct  241   DYDSMLGITREIPPELILPDNVLP  264



>ref|XP_009145039.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Brassica 
rapa]
Length=276

 Score =   439 bits (1130),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 203/268 (76%), Positives = 238/268 (89%), Gaps = 0/268 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVG WIR +GQALDR+G  LQG++ F E LSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGRAIYTVGKWIRGSGQALDRVGSLLQGSHRFEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS++GDVQ+G+ SSIWYGCVLRGDVN+IS+G+GTNIQDNSLVHVAK+NL GKV  T
Sbjct  61    VAPSASVLGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLGGKVSPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
              IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVE +AMVAAG++V++NTRIP  EV
Sbjct  121   TIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVETHAMVAAGSIVKENTRIPSREV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKF+RKLT+EEIA+IS+SA NY NLA +HA EN+KSFDEIE E+ LRKK+ARKDE
Sbjct  181   WGGNPAKFMRKLTDEEIAYISKSAENYINLAHIHAAENSKSFDEIEVERALRKKYARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAA  301
             DYDSMLG+VRETP ELILPDN+LP+K  
Sbjct  241   DYDSMLGIVRETPAELILPDNVLPEKTT  268



>ref|XP_009107430.1| PREDICTED: LOW QUALITY PROTEIN: gamma carbonic anhydrase 2, mitochondrial-like 
[Brassica rapa]
Length=276

 Score =   439 bits (1130),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 205/268 (76%), Positives = 238/268 (89%), Gaps = 0/268 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGR  YTVG WI  +GQALDR+G  L G++   E LSRHR LM++FDK P V ++ F
Sbjct  1     MGTLGRVIYTVGNWICGSGQALDRIGSLLXGSHRLEEHLSRHRTLMSVFDKSPLVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN+IS+G+GTNIQDNSLVHVAK+NLAGKVL T
Sbjct  61    VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLAGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
              IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AMVAAG+LVR+NTRIP GEV
Sbjct  121   TIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRENTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKF+RKLT+EEIA+IS+SA NY NLA +HA EN+KSF+EIE E+ LRKK+ARKDE
Sbjct  181   WGGNPAKFMRKLTDEEIAYISKSAENYINLAHIHAAENSKSFEEIEIERALRKKYARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAA  301
             DYDSMLG+VRETP ELILPDN+LP+K  
Sbjct  241   DYDSMLGIVRETPAELILPDNVLPEKTT  268



>ref|XP_004512067.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cicer 
arietinum]
Length=269

 Score =   439 bits (1129),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 209/270 (77%), Positives = 236/270 (87%), Gaps = 1/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+AFYTVGFWIRETGQA+DRLG RLQGNY+F EQLSRHR LMN+F+K P VH++AF
Sbjct  1     MGTLGKAFYTVGFWIRETGQAIDRLGSRLQGNYFFQEQLSRHRPLMNVFNKTPYVHKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             +APSASI GDVQ+G+ SSIWYGCVLRGDVNSI+IG+ TNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    IAPSASITGDVQIGQSSSIWYGCVLRGDVNSITIGSSTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKL+E+E+ F SQSA NYSNLAQ HA ENAK  DE EF KVL KK  R DE
Sbjct  181   WGGNPARFLRKLSEDEMTFFSQSALNYSNLAQAHAAENAKKLDETEFVKVLGKKSVRLDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
              +  + G V ETPQE+ LPDN++ DK  KA
Sbjct  241   -HGLIQGDVHETPQEINLPDNVVLDKVPKA  269



>gb|AAK28403.1|AF249876_1 transcription factor APFI [Arabidopsis thaliana]
Length=278

 Score =   439 bits (1128),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 202/264 (77%), Positives = 238/264 (90%), Gaps = 0/264 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN+IS+G+GTNIQDN+LVHVAK+ ++GKVL T
Sbjct  61    VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTTISGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AMVAAG+LV+QNTRIP GEV
Sbjct  121   LIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKF+R+LT+EEI +ISQSA NY NLAQ+HA EN+KSF++IE E+ LRKK+ARKDE
Sbjct  181   WGGNPAKFMRELTDEEIVYISQSAKNYINLAQIHASENSKSFEQIEVERALRKKYARKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILP  313
             DYDSMLG+ RETP ELILPDN+LP
Sbjct  241   DYDSMLGITRETPPELILPDNVLP  264



>ref|XP_004958498.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Setaria 
italica]
Length=273

 Score =   438 bits (1126),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 205/270 (76%), Positives = 236/270 (87%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA +TVG WIR TGQA+DRLG  LQG     EQ+SRHR +MN+F+K P +HR+ F
Sbjct  1     MGTLGRAIFTVGKWIRGTGQAMDRLGSTLQGGLRVEEQVSRHRTIMNIFEKEPRIHRDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSA++IGDV++G  SSIWYG +LRGDVNSI IG+GTNIQDNSLVHV++SN++ KVL T
Sbjct  61    VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGTNIQDNSLVHVSRSNISRKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++MV AG+LV+QNTRIP GEV
Sbjct  121   IIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLTEEEIAFI+QSA NY NLAQVHA EN+KSFDEIE EK+LRKK+A KDE
Sbjct  181   WVGNPAKFLRKLTEEEIAFIAQSATNYINLAQVHAAENSKSFDEIELEKMLRKKYAHKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRE P ELILPDNILP  A KA
Sbjct  241   EYDSMLGVVREIPPELILPDNILPHNAQKA  270



>ref|XP_003562574.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Brachypodium 
distachyon]
Length=275

 Score =   437 bits (1125),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 205/270 (76%), Positives = 236/270 (87%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVG WIR TGQA+DRLG  +QG     E +SRHR +M +F+K P ++++ F
Sbjct  1     MGTLGRAIYTVGKWIRGTGQAMDRLGSAVQGGLRAEEHVSRHRTIMGIFEKEPRINKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSA++IGDV++G  SSIWYG +LRGDVN+I IG+G+NIQDNSLVHV+KSN++GKVL T
Sbjct  61    VAPSAAVIGDVEIGHGSSIWYGSILRGDVNTIQIGSGSNIQDNSLVHVSKSNISGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGN VTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++MV AG+LV+QNTRIP GEV
Sbjct  121   IIGNKVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLTEEEIAFI+QSA NY NLAQVHA ENAKSFDEIE EK+LRKKFA KDE
Sbjct  181   WVGNPAKFLRKLTEEEIAFIAQSATNYFNLAQVHAAENAKSFDEIELEKMLRKKFAHKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRE P ELILPDNILPDKA KA
Sbjct  241   EYDSMLGVVREIPPELILPDNILPDKAPKA  270



>gb|EEC70424.1| hypothetical protein OsI_01428 [Oryza sativa Indica Group]
Length=263

 Score =   437 bits (1124),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 201/256 (79%), Positives = 227/256 (89%), Gaps = 0/256 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             M  LG+AFY VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMN+FDK P VHR+AF
Sbjct  1     MAGLGKAFYAVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNIFDKTPHVHRDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGD+QVG+ +SIWYGCVLRGD N++ IG+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASLIGDIQVGQGASIWYGCVLRGDANNVQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ MVAAGALVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT++EI FI +SA+NYS LA+ HA ENAK  ++ EFEK+ RKK A +DE
Sbjct  181   WGGNPAKFLRKLTDDEITFIKESASNYSTLAKAHATENAKPVEKTEFEKLFRKKSAHQDE  240

Query  384   DYDSMLGVVRETPQEL  337
             ++DSM+G  RE   EL
Sbjct  241   EHDSMIGATREVTPEL  256



>ref|XP_004967660.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Setaria 
italica]
Length=263

 Score =   437 bits (1124),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 202/259 (78%), Positives = 229/259 (88%), Gaps = 0/259 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             M  LG+A Y VGFWIRETGQALDRLGCRLQGNY+FHEQ+SRHR LMN+FDK P VHR+AF
Sbjct  1     MAGLGKAMYAVGFWIRETGQALDRLGCRLQGNYFFHEQISRHRTLMNIFDKTPHVHRDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG  +SIWYGCVLRGD N+I IG+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASLIGDVQVGPGASIWYGCVLRGDANNIQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG NVTVGHSAVL GCT+EDEAFVGMGATLLDGV+VEK+ MVAAGALVRQNTRIP GEV
Sbjct  121   IIGENVTVGHSAVLQGCTIEDEAFVGMGATLLDGVIVEKHGMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT++EIAFI++SAANY +L++ HA ENAK  +++EFEKVL KKFA +DE
Sbjct  181   WGGNPAKFLRKLTDDEIAFIAESAANYFSLSKEHAAENAKPLEKVEFEKVLPKKFAHQDE  240

Query  384   DYDSMLGVVRETPQELILP  328
             +YDS +GV RE P EL  P
Sbjct  241   EYDSTIGVTREAPPELTPP  259



>ref|XP_006304043.1| hypothetical protein CARUB_v10009842mg, partial [Capsella rubella]
 gb|EOA36941.1| hypothetical protein CARUB_v10009842mg, partial [Capsella rubella]
Length=306

 Score =   438 bits (1127),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 202/264 (77%), Positives = 237/264 (90%), Gaps = 0/264 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  29    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  88

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAP AS+IGDVQ+G+ SSIWYGCVLRGDVN+IS+G+GTNIQDN+LVHVAK+N++GKVL T
Sbjct  89    VAPGASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPT  148

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AMVAAG+LV+QNTRIP GEV
Sbjct  149   LIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIPSGEV  208

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKF+RKLT+EE+ +ISQSA NY NLAQ+HA EN+KSFD+IE E+ LRKK+ARKDE
Sbjct  209   WGGNPAKFMRKLTDEEVEYISQSAKNYINLAQIHASENSKSFDQIEVERALRKKYARKDE  268

Query  384   DYDSMLGVVRETPQELILPDNILP  313
             DYDSMLG+ RE P ELILPDN+LP
Sbjct  269   DYDSMLGITREIPAELILPDNVLP  292



>ref|NP_001042763.1| Os01g0283100 [Oryza sativa Japonica Group]
 dbj|BAD82610.1| putative gamma-carbonic anhydrase [Oryza sativa Japonica Group]
 dbj|BAF04677.1| Os01g0283100 [Oryza sativa Japonica Group]
 dbj|BAG96503.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87611.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92644.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00769.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54348.1| hypothetical protein OsJ_01333 [Oryza sativa Japonica Group]
Length=263

 Score =   437 bits (1123),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 201/256 (79%), Positives = 227/256 (89%), Gaps = 0/256 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             M  LG+AFY VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMN+FDK P VHR+AF
Sbjct  1     MAGLGKAFYAVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNIFDKTPHVHRDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGD+QVG+ +SIWYGCVLRGD N++ IG+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASLIGDIQVGQGASIWYGCVLRGDANNVQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ MVAAGALVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT++EI FI +SA+NYS LA+ HA ENAK  ++ EFEK+ RKK A +DE
Sbjct  181   WGGNPAKFLRKLTDDEITFIKESASNYSTLAKAHAAENAKPVEKTEFEKLFRKKSAHQDE  240

Query  384   DYDSMLGVVRETPQEL  337
             ++DSM+G  RE   EL
Sbjct  241   EHDSMIGATREVTPEL  256



>gb|KFK36155.1| hypothetical protein AALP_AA4G085200 [Arabis alpina]
Length=276

 Score =   437 bits (1124),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 207/269 (77%), Positives = 234/269 (87%), Gaps = 0/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGR  YTVG  IR TGQALDR+G  LQG + F E LSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGRVIYTVGKAIRVTGQALDRVGSTLQGGHRFEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN+ISIG+GTNIQDNSLVHVAK+NL+ K L T
Sbjct  61    VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISIGSGTNIQDNSLVHVAKTNLSNKSLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
              IG+NVT+GHSAV+H CTVEDEAFVGMGATLLDGVVVEK+AMVAAG+LV+ NTRIP GEV
Sbjct  121   TIGDNVTIGHSAVIHACTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVKGNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKF+RKLT+EEI +IS+SA NY NLAQ+HA EN KSF+EIE E+ LRKKFA KDE
Sbjct  181   WGGNPAKFMRKLTDEEIDYISKSAENYINLAQIHAAENTKSFEEIEVERALRKKFANKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAK  298
             DYDSMLGVVRETP ELILPDN+LP KA K
Sbjct  241   DYDSMLGVVRETPPELILPDNVLPGKANK  269



>ref|NP_001060439.1| Os07g0642900 [Oryza sativa Japonica Group]
 dbj|BAC16488.1| putative transcription factor APFI [Oryza sativa Japonica Group]
 dbj|BAD30257.1| putative transcription factor APFI [Oryza sativa Japonica Group]
 dbj|BAF22353.1| Os07g0642900 [Oryza sativa Japonica Group]
 gb|EAZ40840.1| hypothetical protein OsJ_25319 [Oryza sativa Japonica Group]
 dbj|BAG87352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=273

 Score =   435 bits (1119),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 202/270 (75%), Positives = 235/270 (87%), Gaps = 0/270 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YT G WIR TGQA+DRLG  +QG     EQL RHR +MN+F+K P +H++ F
Sbjct  1     MGTLGRAIYTAGKWIRGTGQAMDRLGSTIQGGLRVDEQLPRHRTIMNIFEKEPRIHKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSA++IGD+++G  SSIWYG +LRGDVNSI IG GTNIQDNSLVHV+K+N++GKVL T
Sbjct  61    VAPSAAVIGDIEIGHGSSIWYGSILRGDVNSIHIGVGTNIQDNSLVHVSKANISGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGN+VT+GHSAVLH C VEDEAFVGMGATLLDGVVVEK++MV AG+LV+QNTRIP GEV
Sbjct  121   IIGNSVTIGHSAVLHACIVEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLTEEE+AFI+QSA NY NLAQVHA ENAK+FDEIE EK+LRKKFA KDE
Sbjct  181   WVGNPAKFLRKLTEEEMAFIAQSATNYINLAQVHAAENAKTFDEIELEKMLRKKFAHKDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDSMLGVVRE P ELILPD+ILP+KA KA
Sbjct  241   EYDSMLGVVREIPPELILPDSILPNKAQKA  270



>ref|XP_010679759.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Beta 
vulgaris subsp. vulgaris]
Length=255

 Score =   434 bits (1116),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 205/261 (79%), Positives = 231/261 (89%), Gaps = 9/261 (3%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFW+RE+GQALDRLGCRLQGNY+F EQLSRHR LMN+FDK P V +EAF
Sbjct  1     MGTLGRAVYTVGFWVRESGQALDRLGCRLQGNYFFQEQLSRHRTLMNVFDKKPMVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDV++G  SSIWYGC+LRGDVN ISIG+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIIGDVRIGHRSSIWYGCILRGDVNFISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAF+G GATLLDGV+VEK+ MVAAG+LVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHSAVLHGCTVEDEAFIGTGATLLDGVLVEKHGMVAAGSLVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLR LTEEE+AFIS SA+NYSNLAQVHA ENAKSFDE EF+KVLRK++  KDE
Sbjct  181   WAGNPAKFLRNLTEEEMAFISLSASNYSNLAQVHAAENAKSFDETEFQKVLRKRYTPKDE  240

Query  384   DYDSMLGVVRETPQELILPDN  322
             +Y+S          EL++ DN
Sbjct  241   EYNSA---------ELVISDN  252



>emb|CDY23649.1| BnaA05g17800D [Brassica napus]
Length=277

 Score =   435 bits (1118),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 203/269 (75%), Positives = 238/269 (88%), Gaps = 1/269 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVG WIR +GQALDR+G  LQG++ F E LSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGRAIYTVGKWIRGSGQALDRVGSLLQGSHRFEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS++GDVQ+G+ SSIWYGCVLRGDVN+IS+G+GTNIQDNSLVHVAK+NL GKV  T
Sbjct  61    VAPSASVLGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLGGKVSPT  120

Query  744   VIGNNVTV-GHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGE  568
              IG+NVTV GHSAV+HGCTVED+AFVGMGATLLDGVVVE +AMVAAG++V++NTRIP  E
Sbjct  121   TIGDNVTVAGHSAVIHGCTVEDDAFVGMGATLLDGVVVETHAMVAAGSIVKENTRIPSRE  180

Query  567   VWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKD  388
             VWGGNPAKF+RKLT+EEIA+IS+SA NY NLA +HA EN+KSFDEIE E+ LRKK+ARKD
Sbjct  181   VWGGNPAKFMRKLTDEEIAYISKSAENYINLAHIHAAENSKSFDEIEVERALRKKYARKD  240

Query  387   EDYDSMLGVVRETPQELILPDNILPDKAA  301
             EDYDSMLG+VRETP ELILPDN+LP+K  
Sbjct  241   EDYDSMLGIVRETPAELILPDNVLPEKTT  269



>ref|XP_008672300.1| PREDICTED: uncharacterized protein LOC100217184 isoform X1 [Zea 
mays]
 gb|ACN28454.1| unknown [Zea mays]
 tpg|DAA54232.1| TPA: transcription factor APFI [Zea mays]
Length=262

 Score =   431 bits (1108),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 202/260 (78%), Positives = 228/260 (88%), Gaps = 1/260 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1     MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG  +SIWYGCVLRGD N I IG+GTNIQDNSL+HVAKSNL+GKV  T
Sbjct  61    VAPSASLIGDVQVGSGASIWYGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
              IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ MVAAGALVRQNTRIPCGEV
Sbjct  121   TIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT++EI+FI++SAANYSNL++VHA ENAK  ++IEFEKVL KKFA +DE
Sbjct  181   WGGNPAKFLRKLTDDEISFIAESAANYSNLSKVHAAENAKPLEKIEFEKVLGKKFAHQDE  240

Query  384   DYDSMLGVVRETPQELILPD  325
              YDS +GV    P EL  P+
Sbjct  241   -YDSSIGVAEGAPPELTSPN  259



>gb|ACG35255.1| transcription factor APFI [Zea mays]
Length=262

 Score =   427 bits (1098),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 201/260 (77%), Positives = 227/260 (87%), Gaps = 1/260 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1     MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG  +SIWYGCVLRGD N I IG+GTNIQDNSL+HVAKSNL+GKV  T
Sbjct  61    VAPSASLIGDVQVGSGASIWYGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
              IGNNVTV HSAVL GCTVEDEAFVG+GATLLDGVVVEK+ MVAAGALVRQNTRIPCGEV
Sbjct  121   TIGNNVTVCHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT++EI+FI++SAANYSNL++VHA ENAK  ++IEFEKVL KKFA +DE
Sbjct  181   WGGNPAKFLRKLTDDEISFIAESAANYSNLSKVHAAENAKPLEKIEFEKVLGKKFAHQDE  240

Query  384   DYDSMLGVVRETPQELILPD  325
              YDS +GV    P EL  P+
Sbjct  241   -YDSSIGVTEGAPPELTSPN  259



>gb|ABK26184.1| unknown [Picea sitchensis]
Length=273

 Score =   425 bits (1093),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 198/266 (74%), Positives = 231/266 (87%), Gaps = 0/266 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+  Y  GF IRETGQA+DR GCRLQGN+ F EQLSRHR LMN+F+K PS+HR+ F
Sbjct  1     MGTLGKVIYMAGFLIRETGQAIDRFGCRLQGNHGFQEQLSRHRTLMNIFEKAPSLHRDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSA+++GDV+VG+ SSIWYG VLRGDVNSI +G+GTNIQDN+LVHVAK+N++GKVL T
Sbjct  61    VAPSAAVMGDVKVGQGSSIWYGSVLRGDVNSIMVGSGTNIQDNTLVHVAKTNISGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGN VT+GH AVLHGCTVEDEAFVGMGATLLDGVV+EKNAMVAAG+LVRQN RIP GEV
Sbjct  121   IIGNKVTIGHGAVLHGCTVEDEAFVGMGATLLDGVVLEKNAMVAAGSLVRQNARIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEI FI QSA NY NLA++HA ENAKS+DEIE  KVLRKK AR+ +
Sbjct  181   WAGNPAKFLRKLTDEEIEFILQSALNYQNLAEMHARENAKSYDEIEAYKVLRKKLARQSD  240

Query  384   DYDSMLGVVRETPQELILPDNILPDK  307
             DYDS LGVVRE P EL++PD ++  K
Sbjct  241   DYDSHLGVVREFPPELVVPDRVIEGK  266



>gb|EPS62312.1| hypothetical protein M569_12479, partial [Genlisea aurea]
Length=267

 Score =   424 bits (1091),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 194/267 (73%), Positives = 233/267 (87%), Gaps = 0/267 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+A Y +G WIR  GQA+DRLG  +QG Y+  E +S+HR L+ L +K P V ++AF
Sbjct  1     MGTLGKAVYRLGSWIRVAGQAVDRLGSTVQGGYFVPETISKHRTLLALSEKTPIVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             +APS+S+IGDVQVG  SSIWYG VLRGDVNSIS+G GTNIQDNSLVHVAKSN+ GK L T
Sbjct  61    IAPSSSVIGDVQVGSGSSIWYGAVLRGDVNSISVGTGTNIQDNSLVHVAKSNIGGKELPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAV+HGCT++DEAF+GMGATLLDGV VEK++MV AG+LVRQNTRIP GE+
Sbjct  121   IIGNNVTVGHSAVIHGCTIDDEAFIGMGATLLDGVTVEKHSMVGAGSLVRQNTRIPYGEI  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W GNPAKFLRKLT+EEI+FISQSA NY NLA+VHA EN+KS +EI+ EK LRKKFAR+DE
Sbjct  181   WAGNPAKFLRKLTDEEISFISQSAVNYINLAKVHAAENSKSNEEIDLEKALRKKFARRDE  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKA  304
             +YDSM+G++RETPQELILPDNILP+K+
Sbjct  241   EYDSMIGIIRETPQELILPDNILPEKS  267



>gb|KCW68230.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=241

 Score =   422 bits (1086),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 202/235 (86%), Positives = 217/235 (92%), Gaps = 0/235 (0%)
 Frame = -2

Query  1002  FHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISI  823
              H  +SRHR LMN+FDK P V ++AFVAPSASIIGDVQVGR SSIWYGCVLRGDVNSIS+
Sbjct  3     IHLSVSRHRTLMNIFDKAPVVDKDAFVAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISV  62

Query  822   GAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG  643
             G+GTNIQDNSLVHVAKSNL+GKVL T+IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDG
Sbjct  63    GSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDG  122

Query  642   VVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVH  463
             VVVEK+ MVA GALVRQNTRIP GEVWGGNPAKFLRKLTEEE+AFI+QSA NYSNLAQVH
Sbjct  123   VVVEKHGMVAGGALVRQNTRIPAGEVWGGNPAKFLRKLTEEEVAFITQSATNYSNLAQVH  182

Query  462   AVENAKSFDEIEFEKVLRKKFARKDEDYDSMLGVVRETPQELILPDNILPDKAAK  298
             A ENAK FDEIEFEKVLRKKFAR+DE+YDSMLGVVRETP ELILPDN+LP KA K
Sbjct  183   AAENAKPFDEIEFEKVLRKKFARRDEEYDSMLGVVRETPPELILPDNVLPGKAPK  237



>gb|EYU31197.1| hypothetical protein MIMGU_mgv1a012119mg [Erythranthe guttata]
Length=261

 Score =   422 bits (1086),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 203/254 (80%), Positives = 223/254 (88%), Gaps = 1/254 (0%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             LGR+  TVGFWIRETGQALDRLGCRLQGNY+F EQLSRHR LMNLFDK P V ++ FVAP
Sbjct  3     LGRSICTVGFWIRETGQALDRLGCRLQGNYFFQEQLSRHRTLMNLFDKAPFVQKDVFVAP  62

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             SASIIGDV VG +SSIWYGCV+RGDVN +SIG+GTNIQDNSLVHVAKSNL GKVL T+IG
Sbjct  63    SASIIGDVHVGSNSSIWYGCVVRGDVNKVSIGSGTNIQDNSLVHVAKSNLYGKVLPTLIG  122

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             +NVTVGHSA+LHGCTVEDEAFVGMGATLLDGVVVEK+AMVAAGALVRQNTRIP GE+WGG
Sbjct  123   DNVTVGHSAILHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPSGEIWGG  182

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYD  376
             NPAKFLRKLT++EIAFI+QSA NYS LAQ HA ENAK  ++IEFEKVL KK   +D +YD
Sbjct  183   NPAKFLRKLTDDEIAFIAQSAINYSKLAQAHAAENAKELEKIEFEKVLHKKL-HQDAEYD  241

Query  375   SMLGVVRETPQELI  334
               L VVRE   ELI
Sbjct  242   LTLAVVREATPELI  255



>ref|XP_010550419.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial [Tarenaya 
hassleriana]
Length=265

 Score =   423 bits (1087),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 200/270 (74%), Positives = 229/270 (85%), Gaps = 7/270 (3%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LG+AFY VGFWIRETGQALDRLGCRLQGNYYF E+LSRHR LMN+FDK PSV ++AF
Sbjct  1     MGTLGKAFYNVGFWIRETGQALDRLGCRLQGNYYFREELSRHRTLMNVFDKAPSVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDV+VG  SSIWYGCVLRGD NSIS+GAGTNIQDNSLVHVAKSNL GKVL T
Sbjct  61    VAPSASVIGDVRVGHGSSIWYGCVLRGDANSISVGAGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+GH AVLHGCT+EDEAF+G  ATLLDG  VEK+AMVA+GALVRQNTRIP GEV
Sbjct  121   IIGDNVTIGHGAVLHGCTIEDEAFIGTSATLLDGAYVEKHAMVASGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRKLTEEE A IS+SA +YSNLAQVHA E AK ++E+EF KV+ KKFA  D 
Sbjct  181   WGGNPARFLRKLTEEETALISRSALDYSNLAQVHAAEFAKKYEEVEFMKVVNKKFAHPDG  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKAAKA  295
             +YDS       TP EL  P+N++ +  + A
Sbjct  241   EYDS-------TPTELAPPENVVKNDKSPA  263



>gb|EPS71345.1| hypothetical protein M569_03414 [Genlisea aurea]
Length=249

 Score =   421 bits (1081),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 199/243 (82%), Positives = 216/243 (89%), Gaps = 0/243 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             M SLG+AFYTVGFWIRETGQALDRLG RLQGNY+F EQLSRHR LMNLFDKVP VH++AF
Sbjct  1     MASLGKAFYTVGFWIRETGQALDRLGSRLQGNYHFQEQLSRHRTLMNLFDKVPVVHKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASI GDV +G  SSIWYGCVLRGD   + IG GTNIQDNSLVHVAKSNL GKVL T
Sbjct  61    VAPSASITGDVHIGGGSSIWYGCVLRGDAKHVGIGTGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             VIGNNVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+AMVAAGALVRQNTRIP GE+
Sbjct  121   VIGNNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPSGEI  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT +EIAFI +SA NY+NLA++HA ENAK FD+ E EKVL+KKF+R+D 
Sbjct  181   WGGNPAKFLRKLTADEIAFIPKSADNYANLARIHAAENAKDFDKAELEKVLQKKFSRQDN  240

Query  384   DYD  376
              YD
Sbjct  241   TYD  243



>dbj|BAK01732.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   409 bits (1052),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 189/235 (80%), Positives = 215/235 (91%), Gaps = 0/235 (0%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             + +AFY VG WIRETGQALDRLGCRLQGNY+FHEQ+SRHR LMN+FDK P VH+EAFVAP
Sbjct  1     MTKAFYAVGLWIRETGQALDRLGCRLQGNYFFHEQISRHRTLMNIFDKAPHVHKEAFVAP  60

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             SAS+IGDV+VG  SSIWYGCVLRGD N++ +G+GTNIQDNS+VHVAKSNL+GKV  T+IG
Sbjct  61    SASLIGDVEVGPGSSIWYGCVLRGDANNVQVGSGTNIQDNSVVHVAKSNLSGKVFPTIIG  120

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             +NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ MVAAGALVRQNTRIPCGEVWGG
Sbjct  121   DNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEVWGG  180

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARK  391
             NPAKFLRKLT+EEI FI +S+ANYSNLA+ HAVE+AK  ++I+FEKVLRKKFA +
Sbjct  181   NPAKFLRKLTDEEIGFIGESSANYSNLARAHAVESAKPMEKIDFEKVLRKKFAHQ  235



>ref|XP_010484635.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial-like [Camelina 
sativa]
Length=258

 Score =   407 bits (1046),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 194/262 (74%), Positives = 223/262 (85%), Gaps = 8/262 (3%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG++GRAFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P+V ++AF
Sbjct  1     MGTMGRAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPNVDKKAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAP+ASI GDV VGR SSIWYGCVLRGD NSIS+GAGTNIQDN+LVHVAKSNL+GKVL T
Sbjct  61    VAPNASITGDVHVGRGSSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAVLHGCTVEDEA++G  AT+LDG  VEK+AMVA+GALVRQNTRIP GEV
Sbjct  121   IIGNNVTVGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRK+TEEE  F S SAA YSNL QVHA ENAK+ DE EF+K+L KK  R D 
Sbjct  181   WGGNPARFLRKVTEEERVFFSSSAAEYSNLGQVHATENAKNLDETEFKKLLNKKNTR-DS  239

Query  384   DYDSMLGVVRETPQELILPDNI  319
             +YDS+L        ++ LP+N+
Sbjct  240   EYDSLL-------DDVTLPENV  254



>ref|XP_010444788.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial [Camelina 
sativa]
Length=258

 Score =   407 bits (1046),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 195/262 (74%), Positives = 223/262 (85%), Gaps = 8/262 (3%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG++GRAFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P+V + AF
Sbjct  1     MGTMGRAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPNVDKGAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAP+ASI GDV VGR SSIWYGCVLRGD NSIS+GAGTNIQDN+LVHVAKSNL+GKVL T
Sbjct  61    VAPNASITGDVHVGRGSSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGNNVTVGHSAVLHGCTVEDEA++G  AT+LDG  VEK+AMVA+GALVRQNTRIP GEV
Sbjct  121   IIGNNVTVGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRK+TEEE  F S SAA YSNL QVHA ENAK+ DE EF+K+L KK AR D 
Sbjct  181   WGGNPARFLRKVTEEERVFFSSSAAEYSNLGQVHATENAKNLDETEFKKLLNKKNAR-DS  239

Query  384   DYDSMLGVVRETPQELILPDNI  319
             +YDS+L        ++ LP+N+
Sbjct  240   EYDSVL-------DDITLPENV  254



>ref|XP_006393845.1| hypothetical protein EUTSA_v10004794mg [Eutrema salsugineum]
 gb|ABB45859.1| hypothetical protein [Eutrema halophilum]
 gb|ESQ31131.1| hypothetical protein EUTSA_v10004794mg [Eutrema salsugineum]
Length=258

 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 193/262 (74%), Positives = 221/262 (84%), Gaps = 8/262 (3%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG++GRA Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV ++AF
Sbjct  1     MGTMGRALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKQAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASI GDV VGR SSIWYGCVLRGD NSI++GAGTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASITGDVHVGRGSSIWYGCVLRGDANSITVGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             VIG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK AMVA+GALVRQNTRIP GEV
Sbjct  121   VIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKQAMVASGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRK+TEEE AF S SA +YSNLAQVHA EN K+ DE +F+K+L KK +R D 
Sbjct  181   WGGNPARFLRKVTEEERAFFSSSAVDYSNLAQVHAAENTKNLDETDFKKLLHKKNSR-DA  239

Query  384   DYDSMLGVVRETPQELILPDNI  319
             +YDS L        +L L +N+
Sbjct  240   EYDSQL-------NDLALSENV  254



>dbj|BAB39954.1| OSJNBa0004B13.8 [Oryza sativa Japonica Group]
Length=257

 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/256 (74%), Positives = 218/256 (85%), Gaps = 6/256 (2%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             M  LG+AFY VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMN+FDK P VHR+AF
Sbjct  1     MAGLGKAFYAVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNIFDKTPHVHRDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGD+QVG+ +SIWYGCVLRGD N++ IG+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASLIGDIQVGQGASIWYGCVLRGDANNVQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ MVAAGAL+         +V
Sbjct  121   IIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALLYWI------QV  174

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT++EI FI +SA+NYS LA+ HA ENAK  ++ EFEK+ RKK A +DE
Sbjct  175   WGGNPAKFLRKLTDDEITFIKESASNYSTLAKAHAAENAKPVEKTEFEKLFRKKSAHQDE  234

Query  384   DYDSMLGVVRETPQEL  337
             ++DSM+G  RE   EL
Sbjct  235   EHDSMIGATREVTPEL  250



>ref|XP_010465384.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial-like [Camelina 
sativa]
Length=258

 Score =   402 bits (1032),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 193/262 (74%), Positives = 221/262 (84%), Gaps = 8/262 (3%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG++GRAFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AF
Sbjct  1     MGTMGRAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKSPSVDKGAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAP+ASI GDV VGR SSIWYGCVLRGD NSIS+GAGTNIQDN+LVHVAKSNL+GKVL T
Sbjct  61    VAPNASITGDVHVGRGSSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             VIG+NVTVGHSAVLH CTVEDEA++G  AT+LDG  +EK+AMVA+GALVRQNTRIP GEV
Sbjct  121   VIGDNVTVGHSAVLHRCTVEDEAYIGTSATVLDGAHIEKHAMVASGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRK+TEEE  F S SAA YSNL QVHA ENAK+ DE EF+K+L KK  R D 
Sbjct  181   WGGNPARFLRKVTEEERVFFSSSAAEYSNLGQVHATENAKNLDETEFKKLLNKKNTR-DS  239

Query  384   DYDSMLGVVRETPQELILPDNI  319
             +YDS+L        ++ LP+N+
Sbjct  240   EYDSVL-------DDITLPENV  254



>ref|NP_569036.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
 sp|Q94AU7.1|GCA3_ARATH RecName: Full=Gamma carbonic anhydrase 3, mitochondrial; Short=AtCA3; 
Short=GAMMA CA3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK76458.1| putative ferripyochelin-binding protein [Arabidopsis thaliana]
 gb|AAL85116.1| putative ferripyochelin-binding protein [Arabidopsis thaliana]
 gb|AAM64929.1| ferripyochelin-binding protein-like [Arabidopsis thaliana]
 gb|AED98222.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
Length=258

 Score =   401 bits (1031),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 192/262 (73%), Positives = 222/262 (85%), Gaps = 8/262 (3%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG++G+AFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P+V + AF
Sbjct  1     MGTMGKAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKTPNVDKGAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAP+AS+ GDV VGR SSIWYGCVLRGD NSIS+GAGTNIQDN+LVHVAK+NL+GKVL T
Sbjct  61    VAPNASLSGDVHVGRGSSIWYGCVLRGDANSISVGAGTNIQDNALVHVAKTNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             VIG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AMVA+GALVRQNTRIP GEV
Sbjct  121   VIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRK+TEEE  F S SA  YSNLAQ HA ENAK+ DE EF+K+L KK AR D 
Sbjct  181   WGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQAHATENAKNLDEAEFKKLLNKKNAR-DT  239

Query  384   DYDSMLGVVRETPQELILPDNI  319
             +YDS+L        +L LP+N+
Sbjct  240   EYDSVL-------DDLTLPENV  254



>ref|XP_002865062.1| gamma CA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41321.1| gamma CA3 [Arabidopsis lyrata subsp. lyrata]
Length=269

 Score =   396 bits (1017),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 195/273 (71%), Positives = 222/273 (81%), Gaps = 19/273 (7%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG++G+AFY VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AF
Sbjct  1     MGTMGKAFYNVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKGAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLR-----------GDVNSISIGAGTNIQDNSLVHVA  778
             VAP+ASI GDV VGR SSIWYGCVLR           GD NSIS+GAGTNIQDN+LVHVA
Sbjct  61    VAPNASITGDVHVGRGSSIWYGCVLRDIPIDLTIYSAGDANSISVGAGTNIQDNALVHVA  120

Query  777   KSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALV  598
             K+NL+GKVL TVIG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AMVA+GALV
Sbjct  121   KTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALV  180

Query  597   RQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEK  418
             RQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA  YSNLAQVHA ENAK+ DE EF+K
Sbjct  181   RQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQVHATENAKNLDEAEFKK  240

Query  417   VLRKKFARKDEDYDSMLGVVRETPQELILPDNI  319
             +L KK AR D +YDS+L        +L LP+N+
Sbjct  241   LLNKKNAR-DTEYDSVL-------DDLTLPENV  265



>gb|AFK09615.1| gamma carbonic anhydrase 3 [Arabidopsis kamchatica]
 gb|AFK09617.1| gamma carbonic anhydrase 3 [Arabidopsis halleri subsp. halleri]
Length=269

 Score =   395 bits (1016),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 194/273 (71%), Positives = 222/273 (81%), Gaps = 19/273 (7%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG++G+AFY VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AF
Sbjct  1     MGTMGKAFYNVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKGAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLR-----------GDVNSISIGAGTNIQDNSLVHVA  778
             VAP+ASI GDV VGR SSIWYGCVLR           GD NSI++GAGTNIQDN+LVHVA
Sbjct  61    VAPNASITGDVHVGRGSSIWYGCVLRDIPVDLTTYSAGDANSITVGAGTNIQDNALVHVA  120

Query  777   KSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALV  598
             K+NL+GKVL TVIG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AMVA+GALV
Sbjct  121   KTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALV  180

Query  597   RQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEK  418
             RQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA  YSNLAQVHA ENAK+ DE EF+K
Sbjct  181   RQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQVHATENAKNLDEAEFKK  240

Query  417   VLRKKFARKDEDYDSMLGVVRETPQELILPDNI  319
             +L KK AR D +YDS+L        +L LP+N+
Sbjct  241   LLNKKNAR-DTEYDSVL-------DDLTLPENV  265



>ref|NP_001078808.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
 gb|AED98223.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
Length=269

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/273 (70%), Positives = 222/273 (81%), Gaps = 19/273 (7%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG++G+AFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P+V + AF
Sbjct  1     MGTMGKAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKTPNVDKGAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLR-----------GDVNSISIGAGTNIQDNSLVHVA  778
             VAP+AS+ GDV VGR SSIWYGCVLR           GD NSIS+GAGTNIQDN+LVHVA
Sbjct  61    VAPNASLSGDVHVGRGSSIWYGCVLRDIPFDLMTDSAGDANSISVGAGTNIQDNALVHVA  120

Query  777   KSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALV  598
             K+NL+GKVL TVIG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AMVA+GALV
Sbjct  121   KTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALV  180

Query  597   RQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEK  418
             RQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA  YSNLAQ HA ENAK+ DE EF+K
Sbjct  181   RQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQAHATENAKNLDEAEFKK  240

Query  417   VLRKKFARKDEDYDSMLGVVRETPQELILPDNI  319
             +L KK AR D +YDS+L        +L LP+N+
Sbjct  241   LLNKKNAR-DTEYDSVL-------DDLTLPENV  265



>gb|AFK09616.1| gamma carbonic anhydrase 3 [Arabidopsis halleri subsp. gemmifera]
Length=269

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/273 (70%), Positives = 220/273 (81%), Gaps = 19/273 (7%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG++G+AFY VGFWIRETGQALDRLGCRLQG  +F EQLS HR LMN+FDK PSV + AF
Sbjct  1     MGTMGKAFYNVGFWIRETGQALDRLGCRLQGKNHFREQLSTHRTLMNVFDKAPSVDKGAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLR-----------GDVNSISIGAGTNIQDNSLVHVA  778
             VAP+ASI GDV VGR SSIWYGCVLR           GD NSI++GA TNIQDN+LVHVA
Sbjct  61    VAPNASITGDVHVGRGSSIWYGCVLRDIPVDLTTYSAGDANSITVGARTNIQDNALVHVA  120

Query  777   KSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALV  598
             K+NL+GKVL TVIG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AMVA+GALV
Sbjct  121   KTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALV  180

Query  597   RQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEK  418
             RQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA  YSNLAQVHA ENAK+ DE EF+K
Sbjct  181   RQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQVHATENAKNLDEAEFKK  240

Query  417   VLRKKFARKDEDYDSMLGVVRETPQELILPDNI  319
             +L KK AR D +YDS+L        +L LP+N+
Sbjct  241   LLNKKNAR-DTEYDSVL-------DDLTLPENV  265



>ref|XP_002894036.1| hypothetical protein ARALYDRAFT_891497 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70295.1| hypothetical protein ARALYDRAFT_891497 [Arabidopsis lyrata subsp. 
lyrata]
Length=255

 Score =   389 bits (1000),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 187/264 (71%), Positives = 217/264 (82%), Gaps = 23/264 (9%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN+IS+G+GTNIQDN+LVHVAK+N++GKVL T
Sbjct  61    VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AMVAAG+LV+QNTRIP GE 
Sbjct  121   LIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIPSGE-  179

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
                                   SA NY NLAQ+HA EN+KSFD+IE E+ LRKK+ARKDE
Sbjct  180   ----------------------SAKNYINLAQIHASENSKSFDQIEVERALRKKYARKDE  217

Query  384   DYDSMLGVVRETPQELILPDNILP  313
             DYDSMLG+ RETP ELILPDN+LP
Sbjct  218   DYDSMLGITRETPPELILPDNVLP  241



>tpg|DAA63887.1| TPA: hypothetical protein ZEAMMB73_753225 [Zea mays]
Length=239

 Score =   389 bits (998),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/232 (78%), Positives = 209/232 (90%), Gaps = 0/232 (0%)
 Frame = -2

Query  990  LSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGT  811
            +SRHR +MN+F+K P +HR+ FVAPSA++IGDV++G  SSIWYG +LRGDVNSI IG+GT
Sbjct  5    VSRHRTIMNIFEKEPRIHRDVFVAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGT  64

Query  810  NIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVE  631
            NIQDNSLVHV+K+N++GKVL T+IG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGVVVE
Sbjct  65   NIQDNSLVHVSKANISGKVLPTIIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVE  124

Query  630  KNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVEN  451
            K++MV AG+LV+QNTRIP GEVW GNPAKFLRKLTEEEIAFI+QSA NY NLAQVHA EN
Sbjct  125  KHSMVGAGSLVKQNTRIPSGEVWVGNPAKFLRKLTEEEIAFIAQSATNYINLAQVHAAEN  184

Query  450  AKSFDEIEFEKVLRKKFARKDEDYDSMLGVVRETPQELILPDNILPDKAAKA  295
            AKSFDEIE EK+LRKK+A KDE+YDSMLGVVRE P +LILPDNILP  A KA
Sbjct  185  AKSFDEIELEKMLRKKYAHKDEEYDSMLGVVREIPPQLILPDNILPHNAQKA  236



>gb|AFK09618.1| gamma carbonic anhydrase 3 [Arabidopsis lyrata subsp. lyrata]
Length=268

 Score =   389 bits (999),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 193/273 (71%), Positives = 221/273 (81%), Gaps = 20/273 (7%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG++G+AFY VGFWIRETG+ALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AF
Sbjct  1     MGTMGKAFYNVGFWIRETGRALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKGAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLR-----------GDVNSISIGAGTNIQDNSLVHVA  778
             VAP+ASI GDV VGR  SIWYGCVLR           GD NSIS+GAGTNIQDN+LVHVA
Sbjct  61    VAPNASITGDVHVGR-GSIWYGCVLRDIPIDLTIYSAGDANSISVGAGTNIQDNALVHVA  119

Query  777   KSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALV  598
             K+NL+GKVL TVIG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AMVA+GALV
Sbjct  120   KTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALV  179

Query  597   RQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEK  418
             RQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA  YSNLAQVHA ENAK+ DE EF+K
Sbjct  180   RQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQVHATENAKNLDEAEFKK  239

Query  417   VLRKKFARKDEDYDSMLGVVRETPQELILPDNI  319
             +L KK AR D +YDS+L        +L LP+N+
Sbjct  240   LLNKKNAR-DTEYDSVL-------DDLTLPENV  264



>ref|XP_009103523.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial [Brassica 
rapa]
Length=253

 Score =   386 bits (992),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 180/242 (74%), Positives = 209/242 (86%), Gaps = 1/242 (0%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             +G+A Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV ++AFVAP
Sbjct  3     MGKALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKQAFVAP  62

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             SAS+IG+V VG  SSIWYGCVLRGD NSIS+GAGTNIQDN+LVHVAKSNL+GKVL T+IG
Sbjct  63    SASLIGNVHVGPASSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPTLIG  122

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             +NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK AMV +GALVRQNTRIP GEVWGG
Sbjct  123   DNVTIGHSAVLHGCTVEDEAYIGASATVLDGAHVEKQAMVESGALVRQNTRIPSGEVWGG  182

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYD  376
             NPA+F+RK+TEEE AF S SA +YSNLAQVH  EN K+ DE +F+K+L KK AR D +YD
Sbjct  183   NPARFMRKVTEEEKAFFSSSAVDYSNLAQVHTAENTKNLDETDFKKLLYKKNAR-DAEYD  241

Query  375   SM  370
              +
Sbjct  242   DL  243



>emb|CDY45234.1| BnaA07g12560D [Brassica napus]
Length=253

 Score =   385 bits (990),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 180/242 (74%), Positives = 209/242 (86%), Gaps = 1/242 (0%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             +G+A Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV ++AFVAP
Sbjct  3     MGKALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKQAFVAP  62

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             SAS+IG+V VG  SSIWYGCVLRGD NSIS+GAGTNIQDN+LVHVAKSNL+GKVL T+IG
Sbjct  63    SASLIGNVHVGPASSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPTLIG  122

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             +NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK AMV +GALVRQNT+IP GEVWGG
Sbjct  123   DNVTIGHSAVLHGCTVEDEAYIGASATVLDGAHVEKQAMVESGALVRQNTKIPSGEVWGG  182

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYD  376
             NPA+FLRK+TEEE AF S SA +YSNLAQVH  EN K+ DE +F+K+L KK AR D +YD
Sbjct  183   NPARFLRKVTEEEKAFFSSSAVDYSNLAQVHTAENTKNLDETDFKKLLYKKNAR-DAEYD  241

Query  375   SM  370
              +
Sbjct  242   DL  243



>gb|ADQ43216.1| GAMMA CA3/carbonate dehydratase [Eutrema parvulum]
Length=255

 Score =   383 bits (983),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 187/246 (76%), Positives = 214/246 (87%), Gaps = 4/246 (2%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG++GRAFY+VGFWIRETGQALDRLGCRLQG  +F EQ SRHR LMN+FDK PSV +EAF
Sbjct  1     MGTMGRAFYSVGFWIRETGQALDRLGCRLQGKNHFREQ-SRHRTLMNVFDKAPSVDKEAF  59

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIGDV VGR SSIWYGCVLR D NSIS+GAGTNIQDNSLVHVAKSNL+GKVL T
Sbjct  60    VAPSASIIGDVHVGRGSSIWYGCVLR-DANSISVGAGTNIQDNSLVHVAKSNLSGKVLPT  118

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             VIG+NVT+ HSAVLHGCTVED+A++G  AT+LDG  VEK AMVA+GALVRQNTRIP GEV
Sbjct  119   VIGDNVTI-HSAVLHGCTVEDKAYIGASATVLDGAHVEKQAMVASGALVRQNTRIPSGEV  177

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+F+RK+TE+E  F S SA +YSNLA+VH  ENAK+ DE +F+K+L KK AR D 
Sbjct  178   WGGNPARFMRKVTEDERTFFSSSAVDYSNLAKVHVAENAKNLDETDFKKLLYKKNAR-DA  236

Query  384   DYDSML  367
             +YDS+L
Sbjct  237   EYDSVL  242



>emb|CDY50984.1| BnaC02g48920D [Brassica napus]
Length=260

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/264 (70%), Positives = 219/264 (83%), Gaps = 7/264 (3%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             M S+GRA Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P V +EA 
Sbjct  1     MASMGRALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPIVDKEAL  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASIIG+V +G  SSIWYGCVLRGD N+I++GAGTNIQDNSLVHVAKSNL GKVL T
Sbjct  61    VAPSASIIGNVHLGPGSSIWYGCVLRGDANTITVGAGTNIQDNSLVHVAKSNLNGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVT+G+SAVLHGCT+EDE+++G  AT+LDG  VEK+A+V +G+LVRQNTRIP GEV
Sbjct  121   LIGDNVTIGNSAVLHGCTLEDESYIGASATVLDGAHVEKHAIVESGSLVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPA+FLRK+TEEE AF S SA +YSNLAQVHA +N K+ DE +F+K+L KK AR D 
Sbjct  181   WGGNPARFLRKVTEEERAFFSTSAMDYSNLAQVHAAQNTKNLDETDFKKLLYKKNAR-DA  239

Query  384   DYDSMLGVVRETPQELILPDNILP  313
             +YDS+L        +L L +N LP
Sbjct  240   EYDSLLN------DDLTLSENHLP  257



>gb|KFK28325.1| hypothetical protein AALP_AA8G501300 [Arabis alpina]
Length=257

 Score =   379 bits (973),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/241 (75%), Positives = 206/241 (85%), Gaps = 1/241 (0%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             + +AFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AFVAP
Sbjct  1     MAKAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKGAFVAP  60

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             SASI GDV VGR SSIWYGCVLRGD NSIS+GAGT+IQDN+L+HVAKSNL+GKVL TVIG
Sbjct  61    SASITGDVNVGRGSSIWYGCVLRGDANSISVGAGTSIQDNALIHVAKSNLSGKVLPTVIG  120

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             +NVT+GHSAVLHGCTVEDEA++   AT+LDG  VEK+AMVA GALVRQNTRIP GEVWGG
Sbjct  121   DNVTIGHSAVLHGCTVEDEAYISASATVLDGAHVEKHAMVAPGALVRQNTRIPSGEVWGG  180

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYD  376
             NPA FLRK+TEEE AF S SA + S LAQ HA ENAK+ DE +F+K+L KK AR D +Y+
Sbjct  181   NPAGFLRKVTEEEKAFFSSSAVDNSKLAQAHAAENAKNLDETDFKKLLYKKNAR-DTEYE  239

Query  375   S  373
             S
Sbjct  240   S  240



>gb|EMT05784.1| hypothetical protein F775_31542 [Aegilops tauschii]
Length=229

 Score =   377 bits (969),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  969  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSL  790
            M++FDK P ++++ FVAPSAS+IGDV++G  SSIWYG VLRGDVNSI IG+G+NIQDNSL
Sbjct  1    MSIFDKEPRINKDVFVAPSASVIGDVEIGHGSSIWYGSVLRGDVNSIRIGSGSNIQDNSL  60

Query  789  VHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAA  610
            VHVAK+N++GKVL T+IG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++MV A
Sbjct  61   VHVAKTNISGKVLPTIIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGA  120

Query  609  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEI  430
            G+LV+QNTRIP GEVW GNPAKFLRKLTEEEI FI+QSAANY NLA VHA EN+KSFDEI
Sbjct  121  GSLVKQNTRIPSGEVWVGNPAKFLRKLTEEEITFIAQSAANYINLAHVHATENSKSFDEI  180

Query  429  EFEKVLRKKFARKDEDYDSMLGVVRETPQELILPDNILPDKAAKA  295
            E EK LRKKFA KDE+YDSMLGVVRE P +LILPDNILPDKA KA
Sbjct  181  ELEKKLRKKFAHKDEEYDSMLGVVREIPPQLILPDNILPDKAPKA  225



>emb|CDY30772.1| BnaC07g16720D [Brassica napus]
Length=257

 Score =   378 bits (970),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 179/243 (74%), Positives = 209/243 (86%), Gaps = 1/243 (0%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             +GRA Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV ++AFVAP
Sbjct  3     MGRALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKSPSVDKQAFVAP  62

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             SAS+IG+V VG  SSIWYGCVLRGD NSIS+GAGTNIQDN+LVHVAKSNL+GKVL T+IG
Sbjct  63    SASLIGNVHVGPASSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPTLIG  122

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             +NVT+GHSAVLHGCTV+D +++G  AT+LDG  VEK AMV +GALVRQNTRIP GEVWGG
Sbjct  123   DNVTIGHSAVLHGCTVDDGSYIGASATVLDGAHVEKQAMVESGALVRQNTRIPSGEVWGG  182

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYD  376
             NPA+FLRK+TEEE AF S SA + SNLAQ HA EN K+ DE +F+K+L KK +R D +YD
Sbjct  183   NPARFLRKVTEEEKAFFSSSAVDCSNLAQAHAGENTKNLDETDFKKLLYKKNSR-DAEYD  241

Query  375   SML  367
             S+L
Sbjct  242   SVL  244



>gb|ACG33606.1| transcription factor APFI [Zea mays]
Length=250

 Score =   377 bits (969),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/235 (76%), Positives = 204/235 (87%), Gaps = 1/235 (0%)
 Frame = -2

Query  1029  GCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVL  850
             G R  G Y+FHEQ+SRHR +MN+FDK P VH++AFVAPSAS+IGDVQVG  +SIWYGCVL
Sbjct  14    GRRGGGKYFFHEQISRHRTIMNIFDKTPHVHKDAFVAPSASLIGDVQVGSGASIWYGCVL  73

Query  849   RGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFV  670
             RGD N I IG+GTNIQDNSL+HVAKSNL+GKV  T IGNNVTVGHSAVL GCTVEDEAFV
Sbjct  74    RGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPTTIGNNVTVGHSAVLQGCTVEDEAFV  133

Query  669   GMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAA  490
             G+GATLLDGVVVEK+ MVAAGALVRQNTRIPCGEVWGGNPAKFLRKLT++EI+FI++SAA
Sbjct  134   GIGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTDDEISFIAESAA  193

Query  489   NYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYDSMLGVVRETPQELILPD  325
             NYSNL++VHA ENAK  ++IEFEKVL KKFA +DE YDS +GV    P EL  P+
Sbjct  194   NYSNLSKVHAAENAKPLEKIEFEKVLGKKFAHQDE-YDSSIGVTEGAPPELTSPN  247



>gb|ACJ85087.1| unknown [Medicago truncatula]
Length=226

 Score =   375 bits (963),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 203/227 (89%), Gaps = 1/227 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y+VG  IR+TGQA+DRLG  LQG Y   EQLSRHR ++N+FDK P + ++ F
Sbjct  1     MGTLGRAIYSVGQLIRKTGQAVDRLGSHLQGGY-IEEQLSRHRTVLNIFDKAPVIDKDVF  59

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSA++IGDVQ+G+ SSIWYG VLRGDVN I IG+GTN+QDNSLVHVAKSNL+GKVL T
Sbjct  60    VAPSAAVIGDVQIGKGSSIWYGSVLRGDVNIIRIGSGTNLQDNSLVHVAKSNLSGKVLPT  119

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAMVAAGALVRQNT+IP GEV
Sbjct  120   IIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTKIPSGEV  179

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEF  424
             W GNPAKFLRKLT+EEIAFISQSA NY+NLAQVHA EN+KS++EIEF
Sbjct  180   WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSYEEIEF  226



>ref|XP_006305517.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
 gb|EOA38415.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
Length=230

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 199/224 (89%), Gaps = 0/224 (0%)
 Frame = -2

Query  969  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSL  790
            MN+FDK P V + AFVAPSAS+IGDVQ+GR SSIWYGCVLRGD N++S+G+GTNIQDNSL
Sbjct  1    MNVFDKAPIVDKTAFVAPSASVIGDVQIGRGSSIWYGCVLRGDANTVSVGSGTNIQDNSL  60

Query  789  VHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAA  610
            VHVAKSNL+GKV  T+IG+NVT+GHSAVLHGCTVE++ F+GMGATLLDGVVVE++ MVAA
Sbjct  61   VHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVENQTFIGMGATLLDGVVVEEHGMVAA  120

Query  609  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEI  430
            GALVRQNTRIP GEVWGGNPA+FLRKLT+EEIAFIS+SA NYSNLAQ HA ENAK  + I
Sbjct  121  GALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISESATNYSNLAQAHAAENAKPLNAI  180

Query  429  EFEKVLRKKFARKDEDYDSMLGVVRETPQELILPDNILPDKAAK  298
            EFEKVLRKK A KDE+YDSMLG+VRETP EL LP+NI  DK  K
Sbjct  181  EFEKVLRKKHAGKDEEYDSMLGIVRETPSELNLPNNIQSDKETK  224



>gb|ACU22925.1| unknown [Glycine max]
Length=211

 Score =   370 bits (950),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y+VG WIRETGQA+DRLG RL G YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1     MGTLGRAIYSVGNWIRETGQAIDRLGSRLHGGYYFQEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+GR SSIWYG VLRGDVNSI +G GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVQLGRGSSIWYGVVLRGDVNSIRVGNGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVEDEAFVGMGA LLDGVVVEKNAMVAAGALVRQNTRIP GEV
Sbjct  121   IIGDNVTVGHSAVIHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTRIPSGEV  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLA  472
             W GNPAKFLRKLT+EEIAFISQSA NY+NLA
Sbjct  181   WAGNPAKFLRKLTDEEIAFISQSATNYTNLA  211



>ref|XP_002968991.1| hypothetical protein SELMODRAFT_145865 [Selaginella moellendorffii]
 ref|XP_002990654.1| hypothetical protein SELMODRAFT_448100 [Selaginella moellendorffii]
 gb|EFJ08286.1| hypothetical protein SELMODRAFT_448100 [Selaginella moellendorffii]
 gb|EFJ30107.1| hypothetical protein SELMODRAFT_145865 [Selaginella moellendorffii]
Length=266

 Score =   368 bits (944),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/252 (69%), Positives = 207/252 (82%), Gaps = 1/252 (0%)
 Frame = -2

Query  1092  GRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPS  913
             GRA Y +GFWIRETGQALDRLGCR+QGNY F EQL+RHR LMNL+DK P V    F+APS
Sbjct  3     GRALYQIGFWIRETGQALDRLGCRIQGNYIFREQLNRHRTLMNLYDKKPEVMENVFIAPS  62

Query  912   ASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGN  733
             A++IGDV V   SSIWYGCVLRGDVN I +G GTNIQDN+LVHVA++ ++GKV  T+IG+
Sbjct  63    ATLIGDVSVAGGSSIWYGCVLRGDVNEIRVGYGTNIQDNTLVHVARTGMSGKVAPTIIGD  122

Query  732   NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGN  553
              VT+GH+AVLH CTV+DE+FVGMGATLLDGV VEK AMV AG+LV QNTRIP GE+W GN
Sbjct  123   AVTIGHNAVLHACTVDDESFVGMGATLLDGVYVEKGAMVGAGSLVTQNTRIPSGEIWAGN  182

Query  552   PAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYDS  373
             PA+FLR LTEEE +FI++SA NYSNLA VHA EN K  DEIE +KVLRKK+  + E+ D+
Sbjct  183   PARFLRNLTEEETSFITKSAENYSNLAIVHAQENEKYSDEIEEDKVLRKKWCYQLEE-DN  241

Query  372   MLGVVRETPQEL  337
              LGV+R+ P ++
Sbjct  242   YLGVMRQAPFQM  253



>emb|CDY55089.1| BnaA02g34770D [Brassica napus]
Length=258

 Score =   366 bits (940),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/261 (69%), Positives = 213/261 (82%), Gaps = 6/261 (2%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             +GRA Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P V ++AFVAP
Sbjct  1     MGRALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPLVDKDAFVAP  60

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             SASIIG+V +G  SSIWYGCVLRGD N+I++GAGTNIQDNSLVHVAKSNL GKVL T+IG
Sbjct  61    SASIIGNVHLGPGSSIWYGCVLRGDANTITVGAGTNIQDNSLVHVAKSNLNGKVLPTLIG  120

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             +NVT+ +SA+L GCT+EDE+++G  AT+LDG  VEK+A+V +GALVR NTRIP GEVWGG
Sbjct  121   DNVTIRNSALLLGCTLEDESYIGASATVLDGAHVEKHAIVESGALVRHNTRIPSGEVWGG  180

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYD  376
             NPA+FLRK+TEEE AF S SA +YSNLAQVHA EN ++ DE +F K+L KK AR D +YD
Sbjct  181   NPARFLRKVTEEERAFFSTSAVDYSNLAQVHAAENTENLDETDFNKLLYKKKAR-DAEYD  239

Query  375   SMLGVVRETPQELILPDNILP  313
             S L        +L L +N LP
Sbjct  240   SPL-----LNDDLTLSENHLP  255



>gb|AFW79497.1| hypothetical protein ZEAMMB73_562884 [Zea mays]
Length=218

 Score =   361 bits (927),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -2

Query  969  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSL  790
            MN+FDK P VHR+AFVAPSAS+IGDVQVG+ +SIWYGCVLRGD N+I IG+GTNIQDNSL
Sbjct  1    MNIFDKTPHVHRDAFVAPSASLIGDVQVGQGASIWYGCVLRGDANNIQIGSGTNIQDNSL  60

Query  789  VHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAA  610
            VHVAKSNL+GKV  T+IGNNVT+GHSAVL GCTVEDEAFVGMGATLLDGVVV K+ MVAA
Sbjct  61   VHVAKSNLSGKVFPTIIGNNVTIGHSAVLQGCTVEDEAFVGMGATLLDGVVVGKHGMVAA  120

Query  609  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEI  430
            G+LVRQNTRIPCGEVWGGNPAKFLRKLT++EIAFI++SA+NYSNL++VHA ENAK  ++I
Sbjct  121  GSLVRQNTRIPCGEVWGGNPAKFLRKLTDDEIAFITESASNYSNLSKVHAAENAKPLEKI  180

Query  429  EFEKVLRKKFARKDEDYDSMLGVVRETPQELILPD  325
            EFEKVLRKKFA +DE+YDS +G+ R +P EL  P+
Sbjct  181  EFEKVLRKKFAHQDEEYDSSIGITRGSPPELTSPN  215



>emb|CBI17490.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   359 bits (921),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 199/228 (87%), Gaps = 2/228 (1%)
 Frame = -2

Query  969  MNLFDKVPSVHREAFV--APSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDN  796
            MNLFDK P V ++A V  AP+AS+IGDV+VG+ SSIWYGCVLRGDVNSISIG+GTNI+DN
Sbjct  1    MNLFDKAPVVAKDASVSVAPTASVIGDVKVGQRSSIWYGCVLRGDVNSISIGSGTNIEDN  60

Query  795  SLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMV  616
            +LVHVA+S+L+GKVL T IG+ VT+GH AVLHGCTVE+EAF+GMGATLLDG  VEK+AMV
Sbjct  61   ALVHVARSSLSGKVLPTTIGDTVTIGHGAVLHGCTVENEAFIGMGATLLDGAFVEKHAMV  120

Query  615  AAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFD  436
            AAG LV Q+TRIPCGEVW GNPA+FLRKLTEEEIAFISQSA NYSNLAQVHA ENA SFD
Sbjct  121  AAGVLVLQDTRIPCGEVWAGNPARFLRKLTEEEIAFISQSAINYSNLAQVHAKENANSFD  180

Query  435  EIEFEKVLRKKFARKDEDYDSMLGVVRETPQELILPDNILPDKAAKAT  292
            EI +EKVLRKKFA  + DY +++ V RETP ELILPDNILP++  KAT
Sbjct  181  EIAYEKVLRKKFAYPETDYAALVSVDRETPPELILPDNILPERLRKAT  228



>gb|KHG18626.1| Protein YrdA [Gossypium arboreum]
 gb|KHG19737.1| Protein YrdA [Gossypium arboreum]
Length=191

 Score =   343 bits (879),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -2

Query  846  GDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVG  667
            GDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T IGNNVTVGHSAVLHGCTVEDEAFVG
Sbjct  5    GDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTNIGNNVTVGHSAVLHGCTVEDEAFVG  64

Query  666  MGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAAN  487
            MGATLLDGVVVEK+AMVAAGALVRQNTRIP GEVWGGNPAKFLRKLTEEEIAFISQSA N
Sbjct  65   MGATLLDGVVVEKHAMVAAGALVRQNTRIPAGEVWGGNPAKFLRKLTEEEIAFISQSATN  124

Query  486  YSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYDSMLGVVRETPQELILPDNILPDK  307
            Y+NLAQVHA ENAK FDEIEFEK+LRKKFA++DE+YDSMLGVVRETP ELILPDN+LPDK
Sbjct  125  YTNLAQVHAAENAKPFDEIEFEKILRKKFAKRDEEYDSMLGVVRETPPELILPDNVLPDK  184

Query  306  AAKAT  292
              K++
Sbjct  185  EQKSS  189



>gb|KCW68231.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=209

 Score =   338 bits (866),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -2

Query  852  LRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAF  673
            L GDVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T+IG+NVTVGHSAVLHGCTVEDEAF
Sbjct  21   LSGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAF  80

Query  672  VGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSA  493
            VGMGATLLDGVVVEK+ MVA GALVRQNTRIP GEVWGGNPAKFLRKLTEEE+AFI+QSA
Sbjct  81   VGMGATLLDGVVVEKHGMVAGGALVRQNTRIPAGEVWGGNPAKFLRKLTEEEVAFITQSA  140

Query  492  ANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYDSMLGVVRETPQELILPDNILP  313
             NYSNLAQVHA ENAK FDEIEFEKVLRKKFAR+DE+YDSMLGVVRETP ELILPDN+LP
Sbjct  141  TNYSNLAQVHAAENAKPFDEIEFEKVLRKKFARRDEEYDSMLGVVRETPPELILPDNVLP  200

Query  312  DKAAK  298
             KA K
Sbjct  201  GKAPK  205



>ref|XP_007204710.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
 gb|EMJ05909.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
Length=190

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSASI+G VQVGR SSIWYGCVLRGDVNSISIG+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASIVGQVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             VIG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AMVAAGALVRQNTRIPCGEV
Sbjct  121   VIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNP  550
                +P
Sbjct  181   CQSSP  185



>gb|KDO84603.1| hypothetical protein CISIN_1g0242241mg, partial [Citrus sinensis]
Length=183

 Score =   327 bits (837),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  843  DVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGM  664
            DVNSIS+G+GTNIQDNSLVHVAKSNL+GKVL T IG+NVTVGHSAVLHGCTVEDEAFVGM
Sbjct  1    DVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTTIGDNVTVGHSAVLHGCTVEDEAFVGM  60

Query  663  GATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANY  484
            GATLLDGVVVE++ MVAAG+LVRQNTRIP GEVWGGNPAKFLRKLT+EEIAFISQSA NY
Sbjct  61   GATLLDGVVVERHGMVAAGSLVRQNTRIPSGEVWGGNPAKFLRKLTDEEIAFISQSATNY  120

Query  483  SNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYDSMLGVVRETPQELILPDNILPDKA  304
            SNLAQVHA ENAKSFDEIEFEKVLRKKFAR+DE+YDSMLGVVRETPQE+I+PD+I   K+
Sbjct  121  SNLAQVHAAENAKSFDEIEFEKVLRKKFARRDEEYDSMLGVVRETPQEIIVPDSIKDPKS  180



>ref|XP_001776500.1| predicted protein [Physcomitrella patens]
 gb|EDQ58633.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   328 bits (842),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/263 (56%), Positives = 208/263 (79%), Gaps = 0/263 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGR  +++G   R TGQALDRLG RLQG   F +++S+H+ ++++FDK P +   AF
Sbjct  1     MGTLGRVVFSLGKAARTTGQALDRLGSRLQGGNTFKDEVSKHQTVLSIFDKKPVIEESAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAP AS++G+V++G+ SS+WYGCVLRGDV+ I +G+ TNIQDN++VHVAK+N++G V  T
Sbjct  61    VAPGASVVGEVEIGKQSSVWYGCVLRGDVHHIKVGSETNIQDNTVVHVAKTNVSGNVEPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             VIGN VT+GH++VLH CTVEDE+FVGMG+T+LDG VVEK AMVAAG++V Q TR+P G++
Sbjct  121   VIGNRVTIGHNSVLHACTVEDESFVGMGSTILDGAVVEKGAMVAAGSVVTQRTRVPSGQI  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W G+PAKFLR+LT+EE + +S++A  Y +LA+VHA EN K+  EIE +K LR+K+  + +
Sbjct  181   WAGSPAKFLRELTDEERSSLSENAILYMDLAEVHASENRKTAGEIEADKALRRKWEIQSD  240

Query  384   DYDSMLGVVRETPQELILPDNIL  316
             DYDS LG+VR    E+  P+ ++
Sbjct  241   DYDSHLGIVRSKRPEIHFPNKMI  263



>ref|XP_007136608.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
 ref|XP_007136613.1| hypothetical protein PHAVU_009G0594000g, partial [Phaseolus vulgaris]
 gb|ESW08602.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
 gb|ESW08607.1| hypothetical protein PHAVU_009G0594000g, partial [Phaseolus vulgaris]
Length=179

 Score =   324 bits (830),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y+VGFWIRETGQA+DRLG RLQG Y+F EQLSRHR LMN+FDK P V ++AF
Sbjct  1     MGTLGRAIYSVGFWIRETGQAIDRLGSRLQGGYFFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVGR SSIWYGCVLRGDVNSI +G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVQVGRGSSIWYGCVLRGDVNSIRVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGE  568
             VIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAMVAAGALVRQNTRIP GE
Sbjct  121   VIGDNVTVGHSAVLHGCTVEDEAFVGMGAVLLDGVVVEKNAMVAAGALVRQNTRIPSGE  179



>ref|XP_003612061.1| Transcription factor APFI-like protein [Medicago truncatula]
 gb|AES95019.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=201

 Score =   322 bits (826),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFYTVGFWIRETGQA+DRLG RLQGNY+F EQLSRHR LMN++DKVP VH++AF
Sbjct  1     MGTLGRAFYTVGFWIRETGQAIDRLGSRLQGNYFFQEQLSRHRPLMNVYDKVPYVHKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             +APSASI GDVQ+G  SSIWYGCVLRGDVN+I+IG+ TNIQDNSLVHVAKSNL+G+VL T
Sbjct  61    IAPSASITGDVQIGHASSIWYGCVLRGDVNNITIGSSTNIQDNSLVHVAKSNLSGRVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AMVAAGALVRQNTRIPCGEV
Sbjct  121   IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVHVEKHAMVAAGALVRQNTRIPCGEV  180



>ref|XP_008672301.1| PREDICTED: uncharacterized protein LOC100217184 isoform X2 [Zea 
mays]
 tpg|DAA54234.1| TPA: hypothetical protein ZEAMMB73_935334 [Zea mays]
Length=214

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/260 (64%), Positives = 186/260 (72%), Gaps = 49/260 (19%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ                  R+A 
Sbjct  1     MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQ------------------RDA-  41

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
                                          N I IG+GTNIQDNSL+HVAKSNL+GKV  T
Sbjct  42    -----------------------------NIIQIGSGTNIQDNSLIHVAKSNLSGKVFPT  72

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
              IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ MVAAGALVRQNTRIPCGEV
Sbjct  73    TIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  132

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             WGGNPAKFLRKLT++EI+FI++SAANYSNL++VHA ENAK  ++IEFEKVL KKFA +DE
Sbjct  133   WGGNPAKFLRKLTDDEISFIAESAANYSNLSKVHAAENAKPLEKIEFEKVLGKKFAHQDE  192

Query  384   DYDSMLGVVRETPQELILPD  325
              YDS +GV    P EL  P+
Sbjct  193   -YDSSIGVAEGAPPELTSPN  211



>ref|XP_001758123.1| predicted protein [Physcomitrella patens]
 gb|EDQ76945.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 143/267 (54%), Positives = 207/267 (78%), Gaps = 0/267 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGR  +++G   R TGQALDRLG RLQG Y F +++S+H+ ++ +F+K P +   AF
Sbjct  1     MGTLGRVVFSLGKAARSTGQALDRLGSRLQGGYVFKDEVSKHQTILGIFNKKPVIEESAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAP AS++G+VQ+G +SSIWYGCVLRGDV+ I +GA +NIQDN++V+V K+N++  +  T
Sbjct  61    VAPGASVVGEVQIGENSSIWYGCVLRGDVHQIKVGAESNIQDNTVVNVPKTNVSSSIEPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IGN VT+GH++VLH CTVEDE+FVGMG+T+LDG VVEK AMVAAG++V + TR+P G++
Sbjct  121   IIGNRVTIGHNSVLHACTVEDESFVGMGSTILDGAVVEKGAMVAAGSVVAEKTRVPSGQI  180

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W G+PAKFLR LT EE + ++ +A+ Y++LA+VHA EN K+  +IE +K LR+K+  + +
Sbjct  181   WAGSPAKFLRDLTAEERSSLTVNASIYTDLAEVHAFENRKTAGDIEADKALRRKWEIQSD  240

Query  384   DYDSMLGVVRETPQELILPDNILPDKA  304
             DYDS LG+VR    ++  P+N++   A
Sbjct  241   DYDSHLGIVRSKKPDIAFPNNMISKGA  267



>dbj|BAB10927.1| ferripyochelin-binding protein-like [Arabidopsis thaliana]
Length=213

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/217 (72%), Positives = 181/217 (83%), Gaps = 8/217 (4%)
 Frame = -2

Query  969  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSL  790
            MN+FDK P+V + AFVAP+AS+ GDV VGR SSIWYGCVLRGD NSIS+GAGTNIQDN+L
Sbjct  1    MNVFDKTPNVDKGAFVAPNASLSGDVHVGRGSSIWYGCVLRGDANSISVGAGTNIQDNAL  60

Query  789  VHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAA  610
            VHVAK+NL+GKVL TVIG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AMVA+
Sbjct  61   VHVAKTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVAS  120

Query  609  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEI  430
            GALVRQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA  YSNLAQ HA ENAK+ DE 
Sbjct  121  GALVRQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQAHATENAKNLDEA  180

Query  429  EFEKVLRKKFARKDEDYDSMLGVVRETPQELILPDNI  319
            EF+K+L KK AR D +YDS+L        +L LP+N+
Sbjct  181  EFKKLLNKKNAR-DTEYDSVL-------DDLTLPENV  209



>ref|NP_001137016.1| uncharacterized protein LOC100217184 [Zea mays]
 gb|ACF83081.1| unknown [Zea mays]
Length=222

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 172/204 (84%), Gaps = 4/204 (2%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1     MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG  +SIWYGCVLRGD N I IG+GTNIQDNSL+HVAKSNL+GKV  T
Sbjct  61    VAPSASLIGDVQVGSGASIWYGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
              IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ MVAAGALVRQNTRIPCGEV
Sbjct  121   TIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  564   WGGNPA----KFLRKLTEEEIAFI  505
                +      +FL K ++  + F+
Sbjct  181   EHTSSTVLCFEFLIKPSQAPLPFL  204



>ref|XP_001754319.1| predicted protein [Physcomitrella patens]
 gb|EDQ80769.1| predicted protein [Physcomitrella patens]
Length=248

 Score =   320 bits (819),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 172/220 (78%), Gaps = 0/220 (0%)
 Frame = -2

Query  1089  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  910
             RA YTVGFWIRETGQALDR GCRLQGNY F E+LSRH+ L NLFDK P V  +AFVAPSA
Sbjct  4     RALYTVGFWIRETGQALDRAGCRLQGNYVFREELSRHKTLFNLFDKKPVVAEDAFVAPSA  63

Query  909   SIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNN  730
             S++GDVQVG  SSIWYGCVLRGD + I +G+ TNIQD+SLV V  S   G     VIGN 
Sbjct  64    SLVGDVQVGPKSSIWYGCVLRGDASGIRVGSETNIQDHSLVSVGGSRFGGGHAPAVIGNR  123

Query  729   VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNP  550
             VT+GHSAV+H CTVEDEAFVGMGATL+DGVVVEK A VAAG+LV +NTRIP G++W GNP
Sbjct  124   VTIGHSAVIHACTVEDEAFVGMGATLMDGVVVEKGAFVAAGSLVTENTRIPAGQIWAGNP  183

Query  549   AKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEI  430
             AKFLR+L  +E +FI +S  NYS LA  HA  N KSF  +
Sbjct  184   AKFLRELKGDETSFIPKSTDNYSELAAAHAEANVKSFQAL  223



>ref|NP_001185039.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
 gb|AEE29871.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
Length=220

 Score =   318 bits (816),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V +EAF
Sbjct  1     MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDV +GR SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61    VAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGE  568
             +IG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ MVAAGALVRQNTRIP GE
Sbjct  121   IIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGE  179



>tpg|DAA54233.1| TPA: hypothetical protein ZEAMMB73_935334 [Zea mays]
Length=222

 Score =   318 bits (815),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1     MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG  +SIWYGCVLRGD N I IG+GTNIQDNSL+HVAKSNL+GKV  T
Sbjct  61    VAPSASLIGDVQVGSGASIWYGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
              IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ MVAAGALVRQNTRIPCGEV
Sbjct  121   TIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180



>ref|XP_002504597.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65855.1| predicted protein [Micromonas sp. RCC299]
Length=254

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 187/247 (76%), Gaps = 0/247 (0%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             + R  +++G  +RETGQALDR+GC +QG+  F E +S+HR +M +++K P++ R  F+AP
Sbjct  1     MSRFMFSIGTVLRETGQALDRIGCSMQGSNAFREAISKHRTIMGIYEKTPALPRAGFIAP  60

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             SAS+IGDV +G  SS+WYG VLRGDVNSI IG+ TNIQDN+++HVAK+N+ G    T+IG
Sbjct  61    SASVIGDVTIGEKSSVWYGAVLRGDVNSIRIGSQTNIQDNTVIHVAKTNVGGVAAPTIIG  120

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             + VTVGH+A+LH CTV+D+AFVGMGAT++DG VVE  AMVAAGALV   T +P G++W G
Sbjct  121   DRVTVGHNAILHACTVKDDAFVGMGATVMDGAVVESGAMVAAGALVTPGTVVPTGQLWAG  180

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYD  376
              PAKF+R++T EE AF   SA  Y+ +  VHA EN KSF+E+E++K  R+    +D DYD
Sbjct  181   APAKFMREMTAEEKAFTVTSAETYAEVGAVHAAENDKSFEELEYDKAARRMARERDPDYD  240

Query  375   SMLGVVR  355
             S LG+ R
Sbjct  241   SHLGIER  247



>ref|XP_003059787.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55739.1| predicted protein [Micromonas pusilla CCMP1545]
Length=255

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 181/247 (73%), Gaps = 0/247 (0%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             + R  + +G  +RETGQALDR+GC  QG+  F E +S+HR +  +++KVP +    FVAP
Sbjct  1     MARVMHALGTALRETGQALDRIGCSFQGSNVFREAISKHRTIQQIYEKVPKLPAAGFVAP  60

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             SAS+IGDV +G +SS+WYG VLRGDVN +SIG+ TNIQDN++VHVAK+N+ G  L TVIG
Sbjct  61    SASVIGDVTIGENSSVWYGAVLRGDVNPVSIGSFTNIQDNAVVHVAKTNVGGVSLPTVIG  120

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             + VTVGH+A++H CT++D+AF+GMGAT++DG  VE  AMVAAGALV   T +P G++W G
Sbjct  121   DRVTVGHNAIIHACTIKDDAFIGMGATVMDGATVEAGAMVAAGALVTPGTTVPSGQLWAG  180

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYD  376
              PA+ +R++T EE AF   SA  Y+ + +VHA E  K F+EIE +K  R+    +D DYD
Sbjct  181   APARMMREMTAEEKAFTKTSAETYAAVGEVHAEECGKGFEEIEHDKAARRMALERDPDYD  240

Query  375   SMLGVVR  355
             S LGV R
Sbjct  241   SHLGVRR  247



>ref|XP_010463232.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Camelina 
sativa]
Length=195

 Score =   294 bits (752),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+F K P V ++ F
Sbjct  1     MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFGKSPLVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN+IS+G+GTNIQDN+LVHVAK+N++GKVL T
Sbjct  61    VAPSASVIGDVQIGKSSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
             +IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AMVAAG+LV+QNTRIP GEV
Sbjct  121   LIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIPSGEV  180



>gb|KHN45864.1| Hypothetical protein glysoja_023087, partial [Glycine soja]
Length=203

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 171/234 (73%), Gaps = 36/234 (15%)
 Frame = -2

Query  990  LSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGT  811
            +SRH  LMN+FDK P V ++AFVAPSAS++           WYGCVLRG +     GA  
Sbjct  1    VSRHLTLMNIFDKAPVVDKDAFVAPSASVV-----------WYGCVLRGQLP----GACC  45

Query  810  NIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLL-DGVVV  634
             +         K    G V     G NVTVGHSAVLHGCTVEDEAFVGMGA LL DGV+V
Sbjct  46   KV---------KFKWEG-VAYNDWGYNVTVGHSAVLHGCTVEDEAFVGMGAILLLDGVIV  95

Query  633  EKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVE  454
            EKNAMVA GALVRQNTRIP GEVW GNPAKFLRKLT+EEIAFISQSAANY+NLAQVHA E
Sbjct  96   EKNAMVAVGALVRQNTRIPSGEVWAGNPAKFLRKLTDEEIAFISQSAANYTNLAQVHAAE  155

Query  453  NAKSFDEIEFEKV-LRKKFARKDEDYDSMLGVVRETPQELILPDNILPDKAAKA  295
            N+KSFDEIEFEKV LRKKFARKDE+YDSML VV         PDN+LPDKA KA
Sbjct  156  NSKSFDEIEFEKVLLRKKFARKDEEYDSMLDVV---------PDNVLPDKAEKA  200



>gb|AFK40628.1| unknown [Lotus japonicus]
Length=193

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRA Y+VGFWIRETGQA+DRLG RLQG Y+  EQLSRHR LMN+FDK P+V ++ F
Sbjct  1     MGTLGRAIYSVGFWIRETGQAIDRLGSRLQGGYFIQEQLSRHRTLMNIFDKAPTVDKDVF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQVG+ SSIWYG VLRGDVNSI +G+GTNIQDNSLVHVAKSNL GKVL T
Sbjct  61    VAPSASVIGDVQVGKGSSIWYGTVLRGDVNSIRVGSGTNIQDNSLVHVAKSNLGGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNA  622
             +IGNNVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEK  
Sbjct  121   IIGNNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKKC  161


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  631  EKCHGCCWCPCETEYTHSMWRGLGWKSSKVPKEAH  527
            +KCHGCCW PCETEY  S+WRG+G +SSKVP++AH
Sbjct  159  KKCHGCCWSPCETEYKGSIWRGMGRQSSKVPEKAH  193



>gb|ACV52585.1| transcription factor APFI-like protein, partial [Nicotiana benthamiana]
Length=152

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -2

Query  981  HRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQ  802
            HR LMNLFDKVP V ++AFVAPSASI+GDV +G  +SIWYGCVLRGDVNS+SIGAGTN+Q
Sbjct  1    HRTLMNLFDKVPVVDKDAFVAPSASIVGDVHIGHSASIWYGCVLRGDVNSVSIGAGTNVQ  60

Query  801  DNSLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNA  622
            DNSL+HVAKSN++G+V  T IG NVT+GHSAVLHGCTVEDEAF+GMGAT+LDG VVEKN+
Sbjct  61   DNSLIHVAKSNISGRVSPTTIGKNVTIGHSAVLHGCTVEDEAFIGMGATVLDGAVVEKNS  120

Query  621  MVAAGALVRQNTRIPCGEVWGGNPAKFLRKLT  526
            MVAAGALVRQNTRIPCGEVWGGNPA+FLRKLT
Sbjct  121  MVAAGALVRQNTRIPCGEVWGGNPARFLRKLT  152



>ref|XP_005644680.1| gamma-carbonic anhydrase [Coccomyxa subellipsoidea C-169]
 gb|EIE20136.1| gamma-carbonic anhydrase [Coccomyxa subellipsoidea C-169]
Length=263

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 168/246 (68%), Gaps = 0/246 (0%)
 Frame = -2

Query  1089  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  910
             + F   G   R+TGQ LD +G ++QG Y + E +  H+ L     K P++   AFVAP+A
Sbjct  5     KIFKLFGSVARQTGQTLDSIGLKIQGQYGYKEGVPTHQTLQGYLGKRPTLGTGAFVAPNA  64

Query  909   SIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNN  730
             S+IGDV++G +SS+WYG VLRGDVN I +G  TNIQD   VHVA+ N  GKV  T IGNN
Sbjct  65    SVIGDVKLGNNSSVWYGAVLRGDVNHIVVGNNTNIQDGVTVHVARHNPQGKVAPTTIGNN  124

Query  729   VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNP  550
             VTVGH A++H  TVED   VGMGAT+LDGV V+K ++VAAGA+V     +P GEVW GNP
Sbjct  125   VTVGHGAIIHAATVEDNVLVGMGATILDGVTVQKGSVVAAGAVVTPGKTVPSGEVWAGNP  184

Query  549   AKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYDSM  370
             AK LRKL EEE  FI+Q+A +Y+ LA VHA EN K  +EI  +   R+  AR+  DYDS 
Sbjct  185   AKMLRKLEEEEAGFIAQAANDYAALAAVHAAENGKGMEEILLDNARREDRARRSLDYDSH  244

Query  369   LGVVRE  352
             +GV R+
Sbjct  245   MGVERD  250



>gb|KFM25989.1| Uncharacterized protein F751_3627 [Auxenochlorella protothecoides]
Length=237

 Score =   254 bits (649),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 158/223 (71%), Gaps = 0/223 (0%)
 Frame = -2

Query  1098  SLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVA  919
             SLG   Y +GF +RETGQALDR+G RLQG+Y F E+L+R R L NLF+  PS+  +AFVA
Sbjct  8     SLGYVVYRLGFALRETGQALDRVGSRLQGSYAFREELNRARPLQNLFNLKPSLGTDAFVA  67

Query  918   PSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVI  739
             P+AS+IGDV +G  SS++YG VLR D  SI +GAGTNIQD SL+  A  ++      T I
Sbjct  68    PNASVIGDVTLGPRSSVFYGSVLRADSGSIKVGAGTNIQDGSLIRTAPQSIDEHAADTTI  127

Query  738   GNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWG  559
             G NVT+GH   +HG T+EDE  VGMGA L  G VV K AMVAAGA+V   T IP G++WG
Sbjct  128   GANVTIGHQVSMHGVTLEDEVLVGMGAVLSHGTVVRKGAMVAAGAVVPPGTEIPAGQIWG  187

Query  558   GNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEI  430
             GNPA+FLR L + E +F+++SA +Y N+A+ H  EN+ S + +
Sbjct  188   GNPARFLRDLKDNESSFLAESAEHYVNVAKNHIKENSGSLENV  230



>ref|XP_005847553.1| hypothetical protein CHLNCDRAFT_35390 [Chlorella variabilis]
 gb|EFN55451.1| hypothetical protein CHLNCDRAFT_35390 [Chlorella variabilis]
Length=261

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 170/251 (68%), Gaps = 3/251 (1%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             M  L RA  T G  +R  G+ALD LG  +QG+  + E L++ + +     K P +    F
Sbjct  1     MSVLTRA--TAGL-LRGLGRALDGLGSAVQGSGAYKETLNKAQSVQAFAGKRPQLADSVF  57

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAP+AS++GDV++G  +SIWYG V+RGDVNS+ IG  TN+QDN LVHVAK N+AGK L T
Sbjct  58    VAPNASVVGDVKIGSGASIWYGAVVRGDVNSVVIGDRTNVQDNVLVHVAKHNMAGKALPT  117

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
              IG+NVT+G  A +H  T+ED   VGMGA ++DG  VE  ++VAAGALV   T IP G+V
Sbjct  118   QIGSNVTIGPGATIHAATIEDCVVVGMGAVIMDGAKVESKSVVAAGALVPPGTVIPSGQV  177

Query  564   WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
             W G+PAKFLR L E+E+ F+S +A +YS LA +HA ENAKSF+E+E +K  R     +D 
Sbjct  178   WAGSPAKFLRNLIEDEVQFVSAAADSYSQLALLHAEENAKSFEEVEADKARRADRISRDP  237

Query  384   DYDSMLGVVRE  352
             DYD   GV R+
Sbjct  238   DYDEQQGVARD  248



>ref|XP_006416491.1| hypothetical protein EUTSA_v10008724mg [Eutrema salsugineum]
 gb|ESQ34844.1| hypothetical protein EUTSA_v10008724mg [Eutrema salsugineum]
Length=221

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  925
             MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P V +EAF
Sbjct  1     MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  924   VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLST  745
             VAPSAS+IGDVQ+GR SSIWYGCVLRGD N++++G+GTNIQDNSLVHVAKSNL+GKVL T
Sbjct  61    VAPSASVIGDVQIGRGSSIWYGCVLRGDANTVTVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  744   VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMV  616
             +IG+NVT+GHSAVLHGCTV      G     L G   ++ A +
Sbjct  121   IIGDNVTIGHSAVLHGCTVRIRPLSGWVRHFLTGSWSKRMAWL  163



>ref|XP_005649920.1| trimeric LpxA-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25376.1| trimeric LpxA-like protein [Coccomyxa subellipsoidea C-169]
Length=219

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 151/209 (72%), Gaps = 0/209 (0%)
 Frame = -2

Query  1074  VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGD  895
             +GF IRETGQALDRLGCRLQGN  F E + +HR +M+L  K  S+   AFVAPSA++IGD
Sbjct  8     LGFIIRETGQALDRLGCRLQGNNAFLEDVFQHRTVMSLGGKKASIGDGAFVAPSAAVIGD  67

Query  894   VQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGH  715
             V +G+ SSIWYG VLRGD  +I+IG  TN+QDN  V  +K+ L G   +T IGN+VTVGH
Sbjct  68    VTLGKRSSIWYGTVLRGDEGAITIGDNTNLQDNVSVRTSKAFLGGHAGATSIGNSVTVGH  127

Query  714   SAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLR  535
             S +L   T+EDEA +GMGATLL+GV VEK A VAAGA+V   T IP GE+WGGNPAK LR
Sbjct  128   SVLLDTVTIEDEALIGMGATLLEGVKVEKGAQVAAGAVVSPGTVIPSGELWGGNPAKLLR  187

Query  534   KLTEEEIAFISQSAANYSNLAQVHAVENA  448
              L  EE AFIS+SA  Y+ L   H  E +
Sbjct  188   PLKPEEAAFISKSAQTYAELGAKHLKETS  216



>ref|XP_007136607.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
 gb|ESW08601.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
Length=134

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = -2

Query  969  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSL  790
            MN+FDK P V ++AFVAPSAS+IGDVQVGR SSIWYGCVLRGDVNSI +G+GTNIQDNSL
Sbjct  1    MNIFDKAPVVDKDAFVAPSASVIGDVQVGRGSSIWYGCVLRGDVNSIRVGSGTNIQDNSL  60

Query  789  VHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAA  610
            VHVAKSNL+GKVL TVIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAMVAA
Sbjct  61   VHVAKSNLSGKVLPTVIGDNVTVGHSAVLHGCTVEDEAFVGMGAVLLDGVVVEKNAMVAA  120

Query  609  GALVRQNTRIPCGE  568
            GALVRQNTRIP GE
Sbjct  121  GALVRQNTRIPSGE  134



>ref|XP_006279533.1| hypothetical protein CARUB_v10028265mg, partial [Capsella rubella]
 gb|EOA12431.1| hypothetical protein CARUB_v10028265mg, partial [Capsella rubella]
Length=177

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 146/223 (65%), Gaps = 50/223 (22%)
 Frame = -2

Query  987  SRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTN  808
            SRHR LMN+FDK PSV + AFVAP+ASI GDV VGR SSIWYGCVLR             
Sbjct  1    SRHRTLMNVFDKSPSVDKGAFVAPNASITGDVHVGRGSSIWYGCVLR-------------  47

Query  807  IQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK  628
                                         GHSAVLHGCTVEDEA++G  AT+LDG  VEK
Sbjct  48   -----------------------------GHSAVLHGCTVEDEAYIGTSATVLDGAHVEK  78

Query  627  NAMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENA  448
            +AMVA+GALVRQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA  YSNLAQVHA ENA
Sbjct  79   HAMVASGALVRQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQVHATENA  138

Query  447  KSFDEIEFEKVLRKKFARKDEDYDSMLGVVRETPQELILPDNI  319
            K+ DE EF+ +L KK AR D +YDS+L        +L LP+N+
Sbjct  139  KNLDETEFKTLLNKKNAR-DTEYDSVL-------DDLTLPENV  173



>ref|XP_010649292.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Vitis 
vinifera]
Length=173

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -2

Query  744  VIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  565
            +I N    GH AVLHGCTVE+EAF+GMGATLLDG  VEK+AMVAAG LV Q+TRIPCGEV
Sbjct  23   MISNLNWTGHGAVLHGCTVENEAFIGMGATLLDGAFVEKHAMVAAGVLVLQDTRIPCGEV  82

Query  564  WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDE  385
            W GNPA+FLRKLTEEEIAFISQSA NYSNLAQVHA ENA SFDEI +EKVLRKKFA  + 
Sbjct  83   WAGNPARFLRKLTEEEIAFISQSAINYSNLAQVHAKENANSFDEIAYEKVLRKKFAYPET  142

Query  384  DYDSMLGVVRETPQELILPDNILPDKAAKAT  292
            DY +++ V RETP ELILPDNILP++  KAT
Sbjct  143  DYAALVSVDRETPPELILPDNILPERLRKAT  173



>gb|AFK37757.1| unknown [Medicago truncatula]
Length=149

 Score =   233 bits (593),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  969  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSL  790
            MN+FDK P V ++AF+APSAS+IGDV +GR SSIWYGCV+RGDVN+IS+G+GTNIQDNSL
Sbjct  1    MNVFDKAPVVGKDAFIAPSASVIGDVHIGRGSSIWYGCVMRGDVNNISVGSGTNIQDNSL  60

Query  789  VHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAA  610
            VHVAKSNL+GKVL T+IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AMVAA
Sbjct  61   VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  120

Query  609  GALVRQNTRIPCGEVWGGNPAKFL  538
            GALVRQN+RIP     G   +K L
Sbjct  121  GALVRQNSRIPSRRGLGRQSSKVL  144



>ref|XP_008871299.1| hypothetical protein H310_07655 [Aphanomyces invadans]
 gb|ETW00274.1| hypothetical protein H310_07655 [Aphanomyces invadans]
Length=235

 Score =   233 bits (594),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 154/212 (73%), Gaps = 0/212 (0%)
 Frame = -2

Query  1089  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  910
             +A Y +G  +RETGQA+DRLG R+ G+    E+ SRHR +M L+DKVP +  +++VAP+A
Sbjct  3     KAIYQLGRAVRETGQAVDRLGLRVLGSNLHREKFSRHRQVMALYDKVPMIAHDSWVAPNA  62

Query  909   SIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNN  730
             S+IGDV++   SSIWYG V+RGD+N +SIG  TNIQD +++H + +   G    T IGNN
Sbjct  63    SVIGDVEICNDSSIWYGVVIRGDLNKVSIGNRTNIQDRAVIHTSSTTTPGLAPGTSIGNN  122

Query  729   VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNP  550
             VTVGH A+L+ CT+E+   VGMG+ +LDG +VE N+++AAG +V    RIP G++W G+P
Sbjct  123   VTVGHGAILYSCTIENNVLVGMGSIVLDGALVESNSILAAGTVVPPGRRIPSGQLWAGSP  182

Query  549   AKFLRKLTEEEIAFISQSAANYSNLAQVHAVE  454
             A+F+R ++E+E+A + + A  Y+ LA+ H+ E
Sbjct  183   AQFVRDVSEDEVADLVKQATEYTKLAETHSEE  214



>ref|XP_005703463.1| hypothetical protein Gasu_55130 [Galdieria sulphuraria]
 gb|EME26943.1| hypothetical protein Gasu_55130 [Galdieria sulphuraria]
Length=280

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 161/230 (70%), Gaps = 6/230 (3%)
 Frame = -2

Query  1077  TVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIG  898
             T G  +R++GQALD++G + QG Y + E LSRH  +  + DK P +  + FVAP+AS+IG
Sbjct  10    TTGNLLRKSGQALDKVGEQFQGVYAYKELLSRHHRMRAILDKKPLLSSQVFVAPNASVIG  69

Query  897   DVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSN------LAGKVLSTVIG  736
              V++G +SS+WYG ++RGDV S+SIG  TN+QD + +H++K +      L      TVIG
Sbjct  70    TVELGPNSSVWYGAIVRGDVASVSIGENTNVQDRACIHLSKGDSMFQGGLLNNCTETVIG  129

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             + V++GH A++HG  ++DE  VGMGA LL+G  + K+A+V +GA+V +   IP GE+W G
Sbjct  130   SRVSIGHGAIIHGAHIQDECMVGMGAILLEGCKISKHAIVGSGAVVPRKAIIPTGELWAG  189

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRK  406
             +PA+F+RKL  EEI  I QSA +Y+NLA  HAVE +KS +EIE +K+ RK
Sbjct  190   SPARFVRKLLTEEIDAILQSAEDYTNLAAAHAVECSKSLEEIESDKIARK  239



>ref|XP_005536976.1| transcription factor APFI [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80940.1| transcription factor APFI [Cyanidioschyzon merolae strain 10D]
Length=303

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 167/255 (65%), Gaps = 8/255 (3%)
 Frame = -2

Query  1104  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQL--SRHRVLMNLFDKVPSVHRE  931
             M    R  Y +G+  RETGQALDR GC LQGN+ + E L  SRHR +MNL D+ P +  +
Sbjct  1     MSVFRRFLYHLGYLARETGQALDRAGCFLQGNFAYREALYLSRHRQIMNLVDRKPIISPQ  60

Query  930   A-FVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKV  754
               F+AP+A+IIGDV +G  SS+WYG V+RGDVN + IG  TN+QD +++HVA     GK+
Sbjct  61    VQFIAPNAAIIGDVAIGAASSVWYGAVIRGDVNKVVIGERTNVQDRAVIHVASGG--GKL  118

Query  753   ---LSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTR  583
                L T IGN VT+GH A+LH C VED+A VGMGA +LDG  VE  A++ AG+++   T 
Sbjct  119   ERALPTFIGNEVTIGHGAILHACAVEDQAVVGMGAIVLDGSRVESGAVIGAGSVLPPGTV  178

Query  582   IPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKK  403
             +  G++W G PA+F+R ++ EE    +   + Y  LA++HA E  K+ D+++ E++    
Sbjct  179   VGAGQLWLGTPARFVRLVSAEEKQQFAVQCSQYVELAKMHATECGKTPDQLDAEQMAALL  238

Query  402   FARKDEDYDSMLGVV  358
             +  + EDY S LG++
Sbjct  239   WEERSEDYLSSLGLL  253



>ref|XP_009831264.1| hypothetical protein H257_07436 [Aphanomyces astaci]
 gb|ETV79423.1| hypothetical protein H257_07436 [Aphanomyces astaci]
Length=235

 Score =   228 bits (580),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 153/212 (72%), Gaps = 0/212 (0%)
 Frame = -2

Query  1089  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  910
             +A + +G  +RETGQA+DRLG R+ G+    E+ SRHR +M L+DK P +  +++VAP+A
Sbjct  3     KAIFELGRAVRETGQAVDRLGLRVLGSSLHREKFSRHRQIMALYDKAPVIAHDSWVAPNA  62

Query  909   SIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNN  730
             S+IGDV++   SS+WYG V+RGD+N +SIG  TNIQD +++H + +   G    T IGNN
Sbjct  63    SVIGDVEICNDSSVWYGVVIRGDLNKVSIGNRTNIQDRAVIHTSSTTTPGLAPGTSIGNN  122

Query  729   VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNP  550
             VTVGH A+L+ CT+E+   VGMG+ +LDG +VE N+++AAG +V    RIP  ++W G+P
Sbjct  123   VTVGHGAILYSCTIENNVLVGMGSIVLDGALVESNSILAAGTVVPPGRRIPSNQLWAGSP  182

Query  549   AKFLRKLTEEEIAFISQSAANYSNLAQVHAVE  454
             AK++R ++E+E+A + + A+ Y+ LA+ H+ E
Sbjct  183   AKYVRDVSEDEVADLVKQASEYTKLAETHSDE  214



>ref|XP_008608997.1| hypothetical protein SDRG_05080 [Saprolegnia diclina VS20]
 gb|EQC37477.1| hypothetical protein SDRG_05080 [Saprolegnia diclina VS20]
Length=236

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 152/214 (71%), Gaps = 0/214 (0%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             L +  + +G  +RETGQA+DRLG R+ G+    E+ SRHR +MNL+DKVPSV  +++VAP
Sbjct  2     LRKVTFELGRCVRETGQAMDRLGLRVLGSNEAREKFSRHRQIMNLYDKVPSVAYDSWVAP  61

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             +AS+IGDV++   +S+WYG V+RGD+N +SIG  TNIQD +++H + +   G      IG
Sbjct  62    NASVIGDVEICNDASVWYGVVIRGDLNKVSIGNRTNIQDRTVIHTSSTTTPGLAPGASIG  121

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             N+VTVGH  +L+ CT+E+   +GMG+ +LDG +VE N+++AAG +V    RIP G++W G
Sbjct  122   NDVTVGHGCILYSCTIENNCLIGMGSIVLDGALVESNSILAAGTVVPPGRRIPSGQLWAG  181

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVE  454
             +PA+++R +TE+EIA ++  A  Y  LA  H+ E
Sbjct  182   SPAQYVRDVTEDEIADLTNQAKEYKKLADTHSDE  215



>gb|KDO22056.1| hypothetical protein SPRG_12043 [Saprolegnia parasitica CBS 223.65]
Length=236

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 152/214 (71%), Gaps = 0/214 (0%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             L +  + +G  +RETGQA+DRLG R+ G+    E+ SRHR +MNL+DKVPSV  +++VAP
Sbjct  2     LRKVTFELGRCVRETGQAMDRLGLRVLGSNEAREKFSRHRQIMNLYDKVPSVAYDSWVAP  61

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             +AS+IGDV++   +S+WYG V+RGD+N +SIG  TNIQD +++H + +   G      IG
Sbjct  62    NASVIGDVEICNDASVWYGVVIRGDLNKVSIGNRTNIQDRTVIHTSSTTTPGLAPGASIG  121

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             N+VTVGH  +L+ CT+E+   +GMG+ +LDG +VE N+++AAG +V    RIP G++W G
Sbjct  122   NDVTVGHGCILYSCTIENNCLIGMGSIVLDGALVESNSILAAGTVVPPGRRIPSGQLWAG  181

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVE  454
             +PA+++R +TE+EIA ++  A  Y  LA  H+ E
Sbjct  182   SPAQYVRDVTEDEIADLTNQAKEYKKLADTHSDE  215



>gb|AAU93943.1| gamma-carbonic anhydrase, partial [Helicosporidium sp. ex Simulium 
jonesi]
Length=246

 Score =   226 bits (575),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 111/237 (47%), Positives = 159/237 (67%), Gaps = 0/237 (0%)
 Frame = -2

Query  1062  IRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVG  883
             +R  G+A++ +G  +QG   + E L++ + L+    K PS+  E FVAPSAS+IGDV++G
Sbjct  1     LRGLGKAVESIGVMMQGTLAYRETLNKSQTLLTYNAKRPSLAAEVFVAPSASVIGDVKIG  60

Query  882   RHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHSAVL  703
               SS+WYG V+RGDV S+SIG+ T++QDN++VHVAK N    +  T IG++VTVGH AV+
Sbjct  61    ASSSVWYGAVVRGDVGSVSIGSHTSVQDNAMVHVAKHNAQNTLRGTSIGSHVTVGHGAVV  120

Query  702   HGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTE  523
             H  T+ED  FVG GAT++DG  V++ A++AAG+L+     +P GEVW G PAK LR L  
Sbjct  121   HAATLEDGCFVGAGATVMDGATVQRGAVLAAGSLLAPGASVPAGEVWAGVPAKKLRGLAP  180

Query  522   EEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYDSMLGVVRE  352
              E A+++ +A  YS LA+VHA E AK F+ +E +   R     +D  YD+  GV R+
Sbjct  181   GEQAYLASAAEEYSALAKVHAGECAKGFNAVELDSARRADRRGRDPAYDAQNGVARD  237



>ref|XP_002673591.1| gamma carbonic dehydratase [Naegleria gruberi]
 gb|EFC40847.1| gamma carbonic dehydratase [Naegleria gruberi]
Length=257

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 147/217 (68%), Gaps = 2/217 (1%)
 Frame = -2

Query  1080  YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASII  901
             + +G   RE G+A+DR+GC LQG+  + E L+R R +M   +  PSV   +F+AP+AS+I
Sbjct  10    HLIGSLFREAGEAMDRVGCFLQGSLAYKEDLNRTRRVMKFKNFKPSVQPSSFIAPNASVI  69

Query  900   GDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTV  721
             G V +G +SS+WY  V+RGDVNSI IG  TNIQD  ++H   +   G    T+IGNNVTV
Sbjct  70    GSVSLGPNSSVWYNVVIRGDVNSIQIGENTNIQDRVIIHC--TGKVGHEKPTIIGNNVTV  127

Query  720   GHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKF  541
                A+LH CT+EDE+++G GAT+LDG VV + AM+A GA+V   T +P GE+W G PAK 
Sbjct  128   ESGAILHACTLEDESYIGFGATVLDGAVVGRGAMIAPGAVVTPGTIVPGGEIWAGVPAKK  187

Query  540   LRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEI  430
             LR+LT EE   I +SAA  S LAQVH  E  K F+E+
Sbjct  188   LRELTPEEQESIKKSAAELSELAQVHKQEQDKEFEEL  224



>emb|CCI47075.1| unnamed protein product [Albugo candida]
Length=236

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 149/209 (71%), Gaps = 0/209 (0%)
 Frame = -2

Query  1080  YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASII  901
             + VG   RETGQALDR+G ++ GN  + EQ SRHR ++NL+DK P++  + +VAP+A++I
Sbjct  7     FKVGRAFRETGQALDRVGLKVLGNNSYKEQFSRHRQIINLYDKQPAIAHDVWVAPNATVI  66

Query  900   GDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTV  721
             GDV++   +S+WY  V+RGD+N+++IG  TN+QD +++H +K N  G    T IGNNVT+
Sbjct  67    GDVEICNDASVWYNVVIRGDLNAVTIGNRTNVQDRTVIHTSKENSPGVPAGTSIGNNVTI  126

Query  720   GHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKF  541
             GH  VL+ CT+E+ + +GMG+ +LDG ++E N ++ AG++V    RIP G++W GNPAK+
Sbjct  127   GHGCVLYSCTIENTSLIGMGSIILDGALIESNTIIGAGSVVPPGARIPSGQLWVGNPAKY  186

Query  540   LRKLTEEEIAFISQSAANYSNLAQVHAVE  454
             +R +T++E+  I + A  Y  +A  H+ E
Sbjct  187   VRDITDDEVQDIIRQAKEYQAIALTHSAE  215



>ref|XP_009149442.1| PREDICTED: LOW QUALITY PROTEIN: gamma carbonic anhydrase 1, mitochondrial 
[Brassica rapa]
Length=191

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 142/196 (72%), Gaps = 22/196 (11%)
 Frame = -2

Query  876  SSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHG  697
            +S+W       DVN++S+G+GTNIQDNSLVHVAKS L GKV  T+IG+NV +GHSA+LHG
Sbjct  9    TSVW-------DVNTVSVGSGTNIQDNSLVHVAKSYLIGKVPPTIIGDNVIIGHSALLHG  61

Query  696  CTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTR--IPCGE-VWGGNPAKFLRKLT  526
            CTVEDEAF+ MGATLLDGVVVEK+ MVAAGA +   T   +P GE +WGGNP KFLRKL 
Sbjct  62   CTVEDEAFIRMGATLLDGVVVEKHDMVAAGACLFDKTLEFLPSGEKIWGGNPVKFLRKL-  120

Query  525  EEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYDSMLGVVRETP  346
            EE   F+ +SA NY NLA+ HA ENAK  + IEFEK       +KDE+YD+ML      P
Sbjct  121  EETDXFLPKSAENYPNLAKAHAAENAKPLNAIEFEK------GQKDEEYDAML-----XP  169

Query  345  QELILPDNILPDKAAK  298
             EL L DNI PDK AK
Sbjct  170  PELKLSDNIEPDKEAK  185



>ref|XP_005850191.1| hypothetical protein CHLNCDRAFT_20587 [Chlorella variabilis]
 gb|EFN58089.1| hypothetical protein CHLNCDRAFT_20587 [Chlorella variabilis]
Length=230

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 154/228 (68%), Gaps = 0/228 (0%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             + R  + VG  +RETG ALDR G  LQG++ F E+LSRHR L  L  K PS+  + FVAP
Sbjct  1     MSRVLHAVGKALRETGLALDRAGATLQGSFAFREELSRHRSLAPLGGKSPSLGLDVFVAP  60

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             SA++IGDV++G ++S++YG V+R D  SISIG  +N+QD  ++  A + L+G    T IG
Sbjct  61    SAAVIGDVKLGDNASVFYGSVIRADSGSISIGDKSNVQDGCVIRTASAFLSGHSADTTIG  120

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
               VT+GH A LHGCTV D A +GM +TLL+G  VE  AMVAAGA+V   T +  GE+WGG
Sbjct  121   RMVTIGHQASLHGCTVGDRALIGMNSTLLEGCSVEDGAMVAAGAVVAPGTVVKAGEIWGG  180

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVL  412
             NPA FLRKL  EE  F+ +SA +Y+ LA  HA E  KS ++I  +K L
Sbjct  181   NPAVFLRKLKPEEGKFLPESANHYARLAAEHAAETTKSLEQIAADKGL  228



>gb|KDD73982.1| hypothetical protein H632_c1679p0 [Helicosporidium sp. ATCC 50920]
Length=251

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 152/241 (63%), Gaps = 13/241 (5%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             LG  FY +GF +RETGQALDR+G R++G++ F E+L+R R LMN+F K P + RE FVAP
Sbjct  9     LGYVFYRLGFALRETGQALDRVGSRMEGSWAFREELNRSRTLMNIFHKKPELGRETFVAP  68

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNS-------------ISIGAGTNIQDNSLVHVAK  775
             SAS+IG V +G  +S++YG VLR +V+S             I++G  TNIQD  ++    
Sbjct  69    SASLIGRVTLGDQASVFYGSVLRDNVSSPPLPTPSTADKGRITVGPRTNIQDGVVIRTGP  128

Query  774   SNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVR  595
               L      TV+G++VTVGH A LHG  V D   VGMGA L  GVV+E  +MVAA A+V 
Sbjct  129   GCLGEHKCDTVLGSDVTVGHLAALHGARVGDGCLVGMGAVLGHGVVMEPGSMVAANAVVA  188

Query  594   QNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKV  415
               T +  G+VWGGNPA+F+R L   E AF+ +SA +Y  +A  H  EN  S +EI   K 
Sbjct  189   PGTTVSAGQVWGGNPARFVRDLKPSEAAFLPESARHYVFVAAEHRNENGASLEEIAQAKG  248

Query  414   L  412
             L
Sbjct  249   L  249



>ref|XP_009523979.1| hypothetical protein PHYSODRAFT_285582 [Phytophthora sojae]
 gb|EGZ21262.1| hypothetical protein PHYSODRAFT_285582 [Phytophthora sojae]
Length=236

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 148/212 (70%), Gaps = 0/212 (0%)
 Frame = -2

Query  1089  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  910
             +  + +G  +RETGQALDRLG R+  +  F E+ SRHR +M L+DK P +  + +VAP+A
Sbjct  4     KVTFELGRCVRETGQALDRLGLRVLNDNSFKEKFSRHRQVMALYDKRPKIAHDVWVAPNA  63

Query  909   SIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNN  730
             +++GDV++   +S++Y  V+RGD+N + IG  TN+QD +++H A S   G      IGN+
Sbjct  64    TVVGDVEICNDASVFYNVVIRGDLNQVRIGNRTNVQDRTVIHTASSTSPGLAPGANIGND  123

Query  729   VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNP  550
             VT+GH   L+ CTVE+ A +GMG+ +LDG +VE N ++AAG++V    RIP G++W GNP
Sbjct  124   VTIGHGCTLYSCTVENNALIGMGSIILDGALVESNTVIAAGSVVPPGRRIPSGQLWAGNP  183

Query  549   AKFLRKLTEEEIAFISQSAANYSNLAQVHAVE  454
             AK++R L+++E+A I++ A+ Y ++A  H+ E
Sbjct  184   AKYVRDLSDDEVADITKQASEYKSIASTHSDE  215



>emb|CCA20868.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=236

 Score =   215 bits (547),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 146/209 (70%), Gaps = 0/209 (0%)
 Frame = -2

Query  1080  YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASII  901
             + VG   RETGQALDR+G R+     + EQ SRHR ++NL DK P++  + +VAP+A++I
Sbjct  7     FKVGRAFRETGQALDRVGLRVLEKNSYKEQFSRHRQIINLSDKRPTIAHDVWVAPNATVI  66

Query  900   GDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTV  721
             GDV++   +S+WY  V+RGD+N+++IG  TN+QD +++H +K    G    T IGNNVT+
Sbjct  67    GDVEICNDASVWYNVVIRGDLNAVTIGNRTNVQDRTVIHTSKDTSPGIPAGTSIGNNVTI  126

Query  720   GHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKF  541
             GH  VL+ CT+E+ + +GMG+ +LDG +VE N ++ AG++V   TRIP G++W GNPAK+
Sbjct  127   GHGCVLYSCTIENTSLIGMGSIILDGALVESNTIIGAGSVVPPGTRIPSGQLWVGNPAKY  186

Query  540   LRKLTEEEIAFISQSAANYSNLAQVHAVE  454
             +R +T++E+  I + +  Y  +A  H+ E
Sbjct  187   VRDITDDEVQDIIRQSNEYQAIALTHSAE  215



>ref|XP_001696746.1| gamma carbonic anhydrase [Chlamydomonas reinhardtii]
 gb|AAR82949.1| putative gamma carbonic anhydrase [Chlamydomonas reinhardtii]
 gb|AAR82950.1| putative gamma carbonic anhydrase [Chlamydomonas reinhardtii]
 gb|AAS48197.1| mitochondrial NADH:ubiquinone oxidoreductase 32 kDa subunit [Chlamydomonas 
reinhardtii]
 gb|EDP00854.1| gamma carbonic anhydrase [Chlamydomonas reinhardtii]
Length=312

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 164/279 (59%), Gaps = 37/279 (13%)
 Frame = -2

Query  1083  FYTVGFWIRETGQALDRLGCRLQG-----------NYYFHEQLSRHRVLMNLFDKVPSV-  940
              Y +G   R  G ALD LG  +QG           N  F     +  V +N    VP+  
Sbjct  29    LYGLGSLFRGVGAALDELGSMVQGPQGSVKDHVQPNLAFAPVHRKPDVPVNAGQVVPAPP  88

Query  939   ----------------HREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTN  808
                             H  AFVA +A+++G+V++G  SS+WYG VLRGDVN I +GA +N
Sbjct  89    AAARTLKIKEVVVPNKHSTAFVAANANVLGNVKLGAGSSVWYGAVLRGDVNGIEVGANSN  148

Query  807   IQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK  628
             IQDN++VHV+K ++ G    TVIGNNVT+GH+A +H CT+ED   VGMGAT+LDG  V+ 
Sbjct  149   IQDNAIVHVSKYSMDGTARPTVIGNNVTIGHAATVHACTIEDNCLVGMGATVLDGATVKS  208

Query  627   NAMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENA  448
              ++VAAGA+V  NT IP G+VW G+PAKFLR L  EE +FI +SA+ Y+ L+ +H  E +
Sbjct  209   GSIVAAGAVVPPNTTIPSGQVWAGSPAKFLRHLEPEEASFIGKSASCYAELSAIHKFEQS  268

Query  447   KSFDEIEFEK-VLRKKFARKDE--------DYDSMLGVV  358
             K+F+E   E  +++ + A  D         +YDS   +V
Sbjct  269   KTFEEQYTESCIIKDRAALADPSNSVHQMWEYDSQTALV  307



>ref|XP_002908534.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY61617.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=236

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 148/212 (70%), Gaps = 0/212 (0%)
 Frame = -2

Query  1089  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  910
             +  + +G  +RETGQALDRLG R+  +  F E+ SRHR +M L+DK P +  + +VAP+A
Sbjct  4     KVTFELGRCVRETGQALDRLGLRVLNDNSFKEKFSRHRQVMALYDKRPRIAHDVWVAPNA  63

Query  909   SIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNN  730
             +++GDV++   +S++Y  V+RGD+N + IG  TN+QD +++H A S   G      IGN+
Sbjct  64    TVVGDVEICNDASVFYNVVIRGDLNQVRIGNRTNVQDRTVIHTASSTSPGLAPGANIGND  123

Query  729   VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNP  550
             VT+GH   L+ CTVE+ + +GMG+ +LDG +VE N ++AAG++V    RIP G++W GNP
Sbjct  124   VTIGHGCTLYSCTVENNSLIGMGSIILDGALVESNTIIAAGSVVPPGRRIPSGQLWAGNP  183

Query  549   AKFLRKLTEEEIAFISQSAANYSNLAQVHAVE  454
             AK++R L+++E+A I++ A+ Y ++A  H+ E
Sbjct  184   AKYVRDLSDDEVADIAKQASEYKSIASTHSDE  215



>ref|XP_008890951.1| hypothetical protein PPTG_01107 [Phytophthora parasitica INRA-310]
 gb|ETI56121.1| hypothetical protein F443_01293 [Phytophthora parasitica P1569]
 gb|ETK95912.1| hypothetical protein L915_01223 [Phytophthora parasitica]
 gb|ETL49292.1| hypothetical protein L916_01206 [Phytophthora parasitica]
 gb|ETM02344.1| hypothetical protein L917_01180 [Phytophthora parasitica]
 gb|ETM55585.1| hypothetical protein L914_01223 [Phytophthora parasitica]
 gb|ETN24946.1| hypothetical protein PPTG_01107 [Phytophthora parasitica INRA-310]
 gb|ETO84854.1| hypothetical protein F444_01295 [Phytophthora parasitica P1976]
 gb|ETP25915.1| hypothetical protein F441_01271 [Phytophthora parasitica CJ01A1]
 gb|ETP53918.1| hypothetical protein F442_01235 [Phytophthora parasitica P10297]
Length=236

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 148/212 (70%), Gaps = 0/212 (0%)
 Frame = -2

Query  1089  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  910
             +  + +G  +RETGQALDRLG R+  +  F E+ SRHR +M L+DK P +  + +VAP+A
Sbjct  4     KVTFELGRCVRETGQALDRLGLRVLNDNSFKEKFSRHRQVMALYDKRPKIAHDVWVAPNA  63

Query  909   SIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNN  730
             +++GDV++   +S++Y  V+RGD+N + IG  TN+QD +++H A S   G      IGN+
Sbjct  64    TVVGDVEICNDASVFYNVVIRGDLNQVRIGNRTNVQDRTVIHTASSTSPGLAPGANIGND  123

Query  729   VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNP  550
             VT+GH   L+ CT+E+ + +GMG+ +LDG +VE N ++AAG++V    RIP G++W GNP
Sbjct  124   VTIGHGCTLYSCTIENNSLIGMGSIILDGALVESNTIIAAGSVVPPGRRIPPGQLWAGNP  183

Query  549   AKFLRKLTEEEIAFISQSAANYSNLAQVHAVE  454
             AK++R L+++E+A I++ A+ Y ++A  H+ E
Sbjct  184   AKYVRDLSDDEVADITKQASEYKSIASTHSDE  215



>ref|XP_010461522.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Camelina 
sativa]
Length=132

 Score =   209 bits (531),  Expect = 7e-62, Method: Composition-based stats.
 Identities = 95/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  666  MGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAAN  487
            MGATLLDGVVVEK+AMVAAG+LV+QNTRIP GEVWGGNPAKF+RKLT+EEI +ISQSA N
Sbjct  1    MGATLLDGVVVEKHAMVAAGSLVKQNTRIPSGEVWGGNPAKFMRKLTDEEIEYISQSAKN  60

Query  486  YSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYDSMLGVVRETPQELILPDNILP  313
            Y NLAQ+HA EN+KSFD+IE EK LR+K+ARKDEDYDSMLG+ RE P ELILPDN+LP
Sbjct  61   YINLAQIHASENSKSFDQIEVEKALRRKYARKDEDYDSMLGITREIPPELILPDNVLP  118



>ref|XP_002956125.1| hypothetical protein VOLCADRAFT_83469 [Volvox carteri f. nagariensis]
 gb|EFJ42865.1| hypothetical protein VOLCADRAFT_83469 [Volvox carteri f. nagariensis]
Length=313

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 163/280 (58%), Gaps = 38/280 (14%)
 Frame = -2

Query  1083  FYTVGFWIRETGQALDRLGCRLQGNY-YFHEQLSRHRVLMNLFDK---------------  952
              Y +G  +R  G ALD LG  +QG      E +  +     +  K               
Sbjct  29    LYGLGSVLRGVGIALDELGSMIQGPQGAIKEHVQPNLAFAPVHRKPDVPVGAGQVVPAPA  88

Query  951   ------------VPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTN  808
                         +P+ H  AFVA +A+++G+V++G +SSIWYG VLRGDVN I +G  TN
Sbjct  89    AAARTLKVKEMVIPNKHSTAFVAANANVLGNVKIGANSSIWYGAVLRGDVNGIFVGNNTN  148

Query  807   IQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK  628
             IQDN + HV+K +L G   +T IGNNVT+GH A +H CT+ED   VGMGAT+LDG  V+K
Sbjct  149   IQDNVVAHVSKYSLDGDARTTTIGNNVTIGHGATVHACTIEDNCLVGMGATILDGATVKK  208

Query  627   NAMVAAGALVRQNTRIPCG-EVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVEN  451
              A+VAAGA+V   T IP G +VW G+PAKFLR L  EE AFI++SAANYS L+ +H  E 
Sbjct  209   GAIVAAGAVVPPKTVIPSGQQVWAGSPAKFLRNLEPEEEAFIARSAANYSELSAIHKFEQ  268

Query  450   AKSFDEIEFE-KVLRKKFARKDE--------DYDSMLGVV  358
             +K+F+E   E  ++R + A  D         +YDS   +V
Sbjct  269   SKTFEEQFVEMAIMRDRAALADPSNSVHQMWEYDSQTALV  308



>dbj|GAM24838.1| hypothetical protein SAMD00019534_080130 [Acytostelium subglobosum 
LB1]
Length=244

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/242 (43%), Positives = 153/242 (63%), Gaps = 2/242 (1%)
 Frame = -2

Query  1098  SLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVA  919
             S+    Y +G  IR TG++LD+LGC LQGNY + E LSRH  +  L  KV S+ +E+F+A
Sbjct  4     SMKNIIYLIGDSIRSTGKSLDKLGCNLQGNYSYMENLSRHSRVTPLRGKVASLGKESFIA  63

Query  918   PSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVI  739
             PS+ +IG+V++G  SS+WY  VLR DVNSI +G  T I D ++VH +  N       TV+
Sbjct  64    PSSCVIGNVEIGTKSSVWYNTVLRADVNSIVVGNETVISDRTVVHCSSENGPKGAQPTVV  123

Query  738   GNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWG  559
             GN V VG  A+LH C +ED+ ++G G+ + DG VVEK A + AG+LV    R+P  ++WG
Sbjct  124   GNRVFVGPGAILHACVIEDDVYIGPGSAVFDGAVVEKGAHLEAGSLVTAGKRVPANQIWG  183

Query  558   GNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDY  379
             G+PA+F+R+++ +E    SQ   + S LAQ H  + +K   ++  E+  R+ FA+     
Sbjct  184   GSPARFVREISSKEKEQHSQLINDNSKLAQEHDAQTSKPATQLYTEQ--REAFAKSQAQS  241

Query  378   DS  373
             +S
Sbjct  242   ES  243



>gb|ETI49161.1| hypothetical protein F443_06919 [Phytophthora parasitica P1569]
 gb|ETK89052.1| hypothetical protein L915_06794 [Phytophthora parasitica]
 gb|ETL42459.1| hypothetical protein L916_06736 [Phytophthora parasitica]
 gb|ETL95631.1| hypothetical protein L917_06603 [Phytophthora parasitica]
 gb|ETM48826.1| hypothetical protein L914_06698 [Phytophthora parasitica]
 gb|ETO77896.1| hypothetical protein F444_06984 [Phytophthora parasitica P1976]
 gb|ETP18931.1| hypothetical protein F441_06922 [Phytophthora parasitica CJ01A1]
Length=251

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 148/225 (66%), Gaps = 7/225 (3%)
 Frame = -2

Query  1071  GFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDV  892
             G  IR  GQ +DR+G  L+G + + E L+     +    + P      FVAP+AS+IGDV
Sbjct  7     GKAIRSLGQTIDRVGVSLEGKFTYTEHLNPSTRAVKNLGRSPKFEESVFVAPNASVIGDV  66

Query  891   QVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHS  712
             +VG+ SSIWY   +RGDVN I+IG  TNIQD ++VHVAK +   K + T IG+NVTVG +
Sbjct  67    KVGKGSSIWYNATVRGDVNHITIGENTNIQDQAVVHVAKIH---KDIPTKIGSNVTVGPA  123

Query  711   AVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRK  532
             A++H CT++D   +G GA +LDG VV   +++ AG++V +  ++P G++W G PA++LR 
Sbjct  124   AIVHACTIQDHCIIGTGAQVLDGAVVGAKSIITAGSIVTKGKQVPSGQLWSGVPARYLRD  183

Query  531   LTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFE----KVLR  409
             LT EE  F+ Q +A Y+ LA+ HA E AK+F+E E +    K+LR
Sbjct  184   LTAEETQFMQQCSAEYTQLAEQHAEECAKTFEEYEADTERYKILR  228



>ref|XP_009516211.1| hypothetical protein PHYSODRAFT_537494 [Phytophthora sojae]
 gb|EGZ28936.1| hypothetical protein PHYSODRAFT_537494 [Phytophthora sojae]
Length=251

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 151/237 (64%), Gaps = 11/237 (5%)
 Frame = -2

Query  1071  GFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDV  892
             G  IR  GQ +DR+G  L+G   + E L+     +    + P      FVAP+AS+IGDV
Sbjct  7     GKAIRSLGQTIDRVGVSLEGKLTYTEHLNPSTRAVKNLGRAPKFEEGVFVAPNASVIGDV  66

Query  891   QVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHS  712
             +VG+ SSIWY   +RGDVN I+IG  TNIQD ++VHVAK +   + + T IGNNVTVG +
Sbjct  67    KVGKGSSIWYNATVRGDVNHITIGENTNIQDQAVVHVAKIH---QDIPTKIGNNVTVGPN  123

Query  711   AVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRK  532
             A++H CT++D   +G GA +LDG VV   ++V AG++V    ++P G++W G PA++LR 
Sbjct  124   AIVHACTIQDHCIIGTGAQVLDGAVVGAKSIVTAGSIVTMGKQVPSGQLWSGVPARYLRD  183

Query  531   LTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFE----KVLR----KKFARKDE  385
             LT EE+ F+ Q +A Y+ LA+ HA E AKSF+E E +    K+LR        +KDE
Sbjct  184   LTAEEMQFMQQCSAEYTQLAEQHAEECAKSFEEYEADTERFKILRDVGETGLPQKDE  240



>ref|XP_008903478.1| hypothetical protein PPTG_09984 [Phytophthora parasitica INRA-310]
 gb|ETN10960.1| hypothetical protein PPTG_09984 [Phytophthora parasitica INRA-310]
 gb|ETP46878.1| hypothetical protein F442_06954 [Phytophthora parasitica P10297]
Length=251

 Score =   208 bits (530),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 148/225 (66%), Gaps = 7/225 (3%)
 Frame = -2

Query  1071  GFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDV  892
             G  IR  GQ +DR+G  L+G + + E L+     +    + P      FVAP+AS+IGDV
Sbjct  7     GKAIRSLGQTIDRVGVSLEGKFTYTEHLNPSTRAVKNLGRSPKFEEGVFVAPNASVIGDV  66

Query  891   QVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHS  712
             +VG+ SSIWY   +RGDVN I+IG  TNIQD ++VHVAK +   K + T IG+NVTVG +
Sbjct  67    KVGKGSSIWYNATVRGDVNHITIGENTNIQDQAVVHVAKIH---KDIPTKIGSNVTVGPA  123

Query  711   AVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRK  532
             A++H CT++D   +G GA +LDG VV   +++ AG++V +  ++P G++W G PA++LR 
Sbjct  124   AIVHACTIQDHCIIGTGAQVLDGAVVGAKSIITAGSIVTKGKQVPSGQLWSGVPARYLRD  183

Query  531   LTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFE----KVLR  409
             LT EE  F+ Q +A Y+ LA+ HA E AK+F+E E +    K+LR
Sbjct  184   LTAEETQFMQQCSAEYTQLAEQHAEECAKTFEEYEADTERYKILR  228



>ref|XP_009821152.1| hypothetical protein H257_00264 [Aphanomyces astaci]
 gb|ETV88752.1| hypothetical protein H257_00264 [Aphanomyces astaci]
Length=249

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 147/223 (66%), Gaps = 3/223 (1%)
 Frame = -2

Query  1074  VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGD  895
             +G  +R  GQ LD++G  ++G   + E+L     L+      P++    FVAP+AS+IG+
Sbjct  4     LGNTLRAFGQKLDKVGVSIEGALTYTERLVPSTRLVKFAGHKPTLAATTFVAPNASVIGE  63

Query  894   VQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGH  715
             V +G+ SS+WYG  +RGDVN+I+IG  TNIQD ++VH AK         T+IGNNVT+G 
Sbjct  64    VSIGQGSSVWYGATVRGDVNTITIGDNTNIQDQAVVHAAK---IANDFPTIIGNNVTIGP  120

Query  714   SAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLR  535
             +A++H   + ++  +G GA +LDG VV +N++V AG++V Q   +P G++W G PA+ +R
Sbjct  121   NAIIHAAKISNQCIIGTGAQVLDGAVVGENSIVTAGSIVTQGKNVPAGQLWSGIPARAVR  180

Query  534   KLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRK  406
              LT EEI FI Q + +Y  L++ HAVE AKSF+EIE +K  RK
Sbjct  181   DLTSEEIEFIKQCSLDYVELSEAHAVEAAKSFEEIEADKEKRK  223



>gb|KFM26034.1| Uncharacterized protein F751_3672 [Auxenochlorella protothecoides]
Length=232

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 141/204 (69%), Gaps = 0/204 (0%)
 Frame = -2

Query  1083  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  904
               ++G  +R TG+A+D LG  LQG+  + E LS+ + ++      P++    F+APSAS+
Sbjct  5     LKSLGSVVRSTGKAIDSLGLALQGSLGYRETLSKAQTVLPYAGAKPAIADSVFIAPSASV  64

Query  903   IGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVT  724
             IG+V +G  SS+WYG VLRGDVNSIS+G  TNIQDN LVHVAK N A + L T IG++VT
Sbjct  65    IGNVTLGSGSSVWYGTVLRGDVNSISVGEKTNIQDNVLVHVAKHNAAHQELPTRIGSSVT  124

Query  723   VGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAK  544
             VGH AV+H  T+ D   +GMGA ++DG VVE  ++VAAGALV   T +P G+VW G+PA+
Sbjct  125   VGHGAVIHAATLGDRVVIGMGAVVMDGAVVEPESIVAAGALVTPGTVVPSGQVWAGSPAR  184

Query  543   FLRKLTEEEIAFISQSAANYSNLA  472
             FLR L   E  FI+ +A +Y+ LA
Sbjct  185   FLRDLAPGEAEFIAAAAEDYARLA  208



>ref|XP_008610617.1| hypothetical protein SDRG_06605 [Saprolegnia diclina VS20]
 gb|EQC35855.1| hypothetical protein SDRG_06605 [Saprolegnia diclina VS20]
Length=249

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 150/224 (67%), Gaps = 5/224 (2%)
 Frame = -2

Query  1074  VGFWIRETGQALDRLGCRLQGNYYFHEQL-SRHRVLMNLFDKVPSVHREAFVAPSASIIG  898
             +G  +R  GQ+LD++G  L+G   + E+L    R++ N  +K P +   AFVAP+AS++G
Sbjct  4     LGKTLRSLGQSLDKVGVALEGRLTYTERLVPSTRLVANAGNK-PVLAEGAFVAPNASVVG  62

Query  897   DVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVG  718
             +V +G+ SS+WYG  +RGDVN I+IG  TN+QD +++H AK         TVIGNNVT+G
Sbjct  63    EVSIGKGSSVWYGATVRGDVNHITIGDNTNVQDQAVIHAAK---IANDFPTVIGNNVTIG  119

Query  717   HSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFL  538
              SAV+H C + ++  +G GA +LDG  V +N+++ AG++V    ++P G++W G PA+ +
Sbjct  120   PSAVIHACKISNQCIIGTGAQVLDGAEVGENSIITAGSIVTMGKKVPAGQLWSGIPARPV  179

Query  537   RKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRK  406
             R LT +EI FI Q + +Y  L++VHA E AK+F +IE EK  RK
Sbjct  180   RDLTSDEIEFIKQCSLDYVQLSEVHAGETAKTFAQIELEKENRK  223



>ref|XP_008862851.1| hypothetical protein H310_01513 [Aphanomyces invadans]
 gb|ETW09046.1| hypothetical protein H310_01513 [Aphanomyces invadans]
Length=249

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 147/223 (66%), Gaps = 3/223 (1%)
 Frame = -2

Query  1074  VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGD  895
             +G  +R  GQ LD++G  ++G   + E+L     L+N     P++    FVAP+AS+IG+
Sbjct  4     IGNTLRAFGQKLDKVGVSIEGALSYTERLVPSTRLVNHGGHKPALASTTFVAPNASVIGE  63

Query  894   VQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGH  715
             V +G+ SS+WYG  +RGDVN+I+IG  TNIQD ++VH AK         T+IGNNVT+G 
Sbjct  64    VSIGQGSSVWYGATVRGDVNAITIGDNTNIQDQAVVHAAK---IANDFPTIIGNNVTIGP  120

Query  714   SAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLR  535
              A++H   + ++  +G GA +LDG VV +N+++ AG++V Q   +P G++W G PA+ +R
Sbjct  121   KAIIHAAKISNQCIIGTGAQVLDGAVVGENSIITAGSIVTQGKSVPAGQLWSGIPARAVR  180

Query  534   KLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRK  406
              LT EEI FI Q + +Y  L++ H+VE +KSF+EIE +K  RK
Sbjct  181   DLTTEEIEFIKQCSLDYVELSEAHSVEASKSFEEIEADKEKRK  223



>ref|XP_002997211.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY69573.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=251

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 147/225 (65%), Gaps = 7/225 (3%)
 Frame = -2

Query  1071  GFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDV  892
             G  IR  GQ +DR+G  L+G   + E L+     +    + P      FVAP+A++IGDV
Sbjct  7     GKAIRSLGQTIDRVGVSLEGKLAYTEHLNPSTRAVKNLGRSPKFEEGVFVAPNAAVIGDV  66

Query  891   QVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHS  712
             +VG+ SSIWY   +RGDVN I+IG  TNIQD ++VHVAK +   K + T IGNNVTVG +
Sbjct  67    KVGKGSSIWYNATVRGDVNHITIGENTNIQDQAVVHVAKIH---KDIPTKIGNNVTVGPA  123

Query  711   AVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRK  532
             A++H CT++D   +G GA +LDG VV   +++ AG++V +  ++P G++W G PA++LR 
Sbjct  124   AIVHACTIQDHCIIGTGAQVLDGAVVGAKSIITAGSIVTKGKQVPSGQLWSGVPARYLRD  183

Query  531   LTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFE----KVLR  409
             LT EE  F+ Q ++ Y+ LA+ +A E AK+F+E E +    K+LR
Sbjct  184   LTAEETQFMQQCSSEYAQLAEQYADECAKTFEEYEADTERYKILR  228



>ref|WP_025898515.1| carbonic anhydrase [Sneathiella glossodoripedis]
Length=173

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 124/162 (77%), Gaps = 5/162 (3%)
 Frame = -2

Query  948  PSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSN  769
            PS     FVAPSA +IGDV++G  SSIW+ CV+RGDVNSI IG  +NIQD +++HV+   
Sbjct  13   PSFDDTVFVAPSADVIGDVEIGEGSSIWFNCVVRGDVNSIRIGKRSNIQDGTVIHVSNGT  72

Query  768  LAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQN  589
                    VIG++V VGH+ ++HGCT+EDE+FVGMGAT+LDG VVE  AMVAAGAL+  N
Sbjct  73   HP-----AVIGDDVLVGHNCIIHGCTLEDESFVGMGATVLDGAVVESGAMVAAGALLTPN  127

Query  588  TRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVH  463
             R+P GE+WGG+PAKFLRKL++EE+A ++  A +Y+ LAQ++
Sbjct  128  KRVPTGELWGGSPAKFLRKLSDEEVANLTSGAKHYAELAQIY  169



>ref|WP_002727628.1| carbonic anhydrase [Phaeospirillum molischianum]
 emb|CCG40950.1| Protein yrdA [Phaeospirillum molischianum DSM 120]
Length=174

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 123/162 (76%), Gaps = 5/162 (3%)
 Frame = -2

Query  954  KVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAK  775
            ++P +   AF+AP+A++IGDV +G  SSIW+GC+LRGDVN I IGA TNIQD +++HV +
Sbjct  11   RLPEIDATAFIAPNATVIGDVTIGAESSIWFGCILRGDVNEIRIGARTNIQDGTVIHVTR  70

Query  774  SNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVR  595
                 +   T IG+++T+GH+AVLHGCT+ED  F+GMGA LLDGVVVE+ AM+AAGA+V 
Sbjct  71   -----RTFGTNIGSDITIGHAAVLHGCTLEDCCFIGMGAVLLDGVVVEREAMIAAGAVVT  125

Query  594  QNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQ  469
               RI  GE+WGGNPA+ LR LTE++ A    SAANY+ L++
Sbjct  126  PGKRIRTGELWGGNPARLLRPLTEQDRAHFPISAANYTELSR  167



>ref|WP_021132357.1| carbonic anhydrase/acetyltransferase [Phaeospirillum fulvum]
 gb|EPY01605.1| carbonic anhydrase/acetyltransferase [Phaeospirillum fulvum MGU-K5]
Length=174

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 122/162 (75%), Gaps = 5/162 (3%)
 Frame = -2

Query  954  KVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAK  775
            ++P +   AF+AP+A++IG+V +G  SSIW+GC+LRGDVN I IG  TNIQD +++HV +
Sbjct  11   RLPEIDATAFIAPNATVIGEVTIGAESSIWFGCILRGDVNQIRIGERTNIQDGTVIHVTR  70

Query  774  SNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVR  595
                 K   T IG+++T+GH+AVLHGCT+ED  F+GMGA LLDGVVVE+ AMVAAGA+V 
Sbjct  71   -----KTFGTFIGSDITIGHAAVLHGCTLEDCCFIGMGAVLLDGVVVEREAMVAAGAVVT  125

Query  594  QNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQ  469
               R+  GE+WGGNPA+ LR LTE++ A    SAANY+ LA+
Sbjct  126  PGKRVKSGELWGGNPARLLRPLTEQDRAHFPVSAANYTELAR  167



>gb|KDD72217.1| hypothetical protein H632_c3683p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=231

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 145/213 (68%), Gaps = 0/213 (0%)
 Frame = -2

Query  990  LSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGT  811
            +++ + L+    K PS+  E FVAPSAS+IGDV++G  SS+WYG V+RGDV S+SIG+ T
Sbjct  10   VNKSQTLLAYGAKRPSLASEVFVAPSASVIGDVKIGSSSSVWYGAVVRGDVGSVSIGSHT  69

Query  810  NIQDNSLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVE  631
            +IQDN++VHVA+ N       T IG++VTVGH AV+H  T+ED  FVG GAT++DG  VE
Sbjct  70   SIQDNAMVHVARHNAQNLSRGTAIGSHVTVGHGAVVHAATLEDGCFVGAGATVMDGATVE  129

Query  630  KNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVEN  451
            + A++AAGAL+     +P GEVW G PAK LR L   E A+++ +A  YS LA+VHA E 
Sbjct  130  RGAVLAAGALLAPGATVPAGEVWAGVPAKKLRGLAPGEQAYLASAAEEYSALARVHAGEC  189

Query  450  AKSFDEIEFEKVLRKKFARKDEDYDSMLGVVRE  352
            AK F+ +E +   R+    +D  YD+  GV R+
Sbjct  190  AKGFNAVELDSARREDRRGRDPAYDAQNGVARD  222



>ref|XP_005713311.1| carbonic anhydrase, gamma type [Chondrus crispus]
 emb|CDF33509.1| carbonic anhydrase, gamma type [Chondrus crispus]
Length=263

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 144/244 (59%), Gaps = 10/244 (4%)
 Frame = -2

Query  1089  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  910
             RA Y  G  IRETGQALDR+G RLQG Y F EQLSRHR +MNL D  P +  + F+APSA
Sbjct  3     RAAYAAGMMIRETGQALDRVGSRLQGKYAFIEQLSRHRQVMNLRDSKPIISSDVFLAPSA  62

Query  909   SIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNN  730
             S+IG+V++   SS+WYG V+RGD   ++IG    +QD +++H            + +G  
Sbjct  63    SVIGNVELHASSSVWYGAVIRGDTGPVTIGERAAVQDRAVIHA----------PSRVGAA  112

Query  729   VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNP  550
              T+   AV+    V   + VG  A +  G VV   +MVA G+ V   T I  GE+W G P
Sbjct  113   ATISCGAVVEAAAVGPNSVVGPAAVIAKGAVVGAGSMVAPGSYVAPGTEIADGELWSGVP  172

Query  549   AKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYDSM  370
             A   R L+ +E   I Q++ + +NLA  HA E  K+ ++IE EK+ ++    + EDY+S 
Sbjct  173   AVRERTLSAQEQEAIKQASIDMANLASAHATEAGKTHEQIEAEKLRQELLDERSEDYNSH  232

Query  369   LGVV  358
             +G++
Sbjct  233   MGLI  236



>emb|CCA17668.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=254

 Score =   197 bits (501),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 146/222 (66%), Gaps = 3/222 (1%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             L   F  +G  IR  GQ+LDR G  L+GN  + E L+     ++   + P +   AF+AP
Sbjct  2     LKNGFEAIGKSIRSFGQSLDRTGVLLEGNASYIEHLNPSTRCVSNAGRRPKMEAAAFIAP  61

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             +AS+IG+V +G+ SS+WYG  LRGD+N I+IG  TN+ +++++HVAK +   + + T++G
Sbjct  62    NASVIGEVTIGKGSSVWYGATLRGDINHITIGENTNVLESAIIHVAKIH---RDIPTIVG  118

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             N+VT+G S+++H CT+     +G G+ +LDG VVE +++VAAG++V     +  G++W G
Sbjct  119   NHVTIGPSSIIHACTIGSNCIIGTGSQILDGSVVESDSIVAAGSIVTYGKVVSSGQLWSG  178

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEI  430
              PA+++R LT EE AFI QSA  Y+ L+ +HA E  KS  EI
Sbjct  179   TPARYVRDLTSEEKAFIKQSAVEYAGLSLIHAKECDKSLQEI  220



>emb|CCI50078.1| unnamed protein product [Albugo candida]
Length=254

 Score =   194 bits (494),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/244 (42%), Positives = 152/244 (62%), Gaps = 9/244 (4%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             L      +G  IR  GQ+LDR G  L+G+  + E L+     +N   + P +   AF+AP
Sbjct  2     LKNGLEAIGKSIRSFGQSLDRTGVLLEGSASYTEHLNPSTRCVNNAGRRPKLEAAAFIAP  61

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             +AS+IG+V VG  SS+WYG  LRGD+N I+IG  TN+ D +++HVAK +   + + T+IG
Sbjct  62    NASVIGEVNVGSGSSVWYGATLRGDINHITIGNHTNVLDAAIIHVAKIH---RDIPTIIG  118

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             N+VT+G S+++H CT+     +G G  +LDG VVE  ++VAAG++V     I  G++W G
Sbjct  119   NHVTIGPSSIIHACTIGSNCIIGTGTQILDGSVVESESVVAAGSIVTYGKVISSGQLWSG  178

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEI----EFEKVLRK--KFAR  394
              PA+++R LT EE AFI QSA  Y+ L+ +HA E  KS +EI    E  K+L +  KF  
Sbjct  179   VPARYVRDLTTEEKAFIKQSAIEYAELSLIHAKECEKSLEEIVAANERSKILEEFGKFGL  238

Query  393   KDED  382
              +++
Sbjct  239   PEKE  242



>ref|WP_007091625.1| MULTISPECIES: carbonic anhydrase [Thalassospira]
 gb|KEO58829.1| carbonic anhydrase [Thalassospira permensis NBRC 106175]
 gb|AJD51718.1| carbonic anhydrase/acetyltransferase [Thalassospira xiamenensis 
M-5 = DSM 17429]
Length=177

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = -2

Query  948  PSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSN  769
            P++   AF+AP+A+IIGDV++G  + IW+GCV+RGDV+ I IG+ TNIQD ++VHVAK  
Sbjct  10   PTIDETAFIAPNATIIGDVEIGAETGIWFGCVIRGDVHEIRIGSRTNIQDLTMVHVAKGK  69

Query  768  LAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQN  589
                   T IG++VT+GHSAV+H CT+ED +FVGM AT++DG V+E+ AM+ AGAL+   
Sbjct  70   FG-----TYIGDDVTIGHSAVIHACTLEDRSFVGMSATVMDGCVIEQGAMLGAGALLAPG  124

Query  588  TRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAV  457
             RIP GE+W G PA+ +R LT+EEI F   SA  Y++LAQ + V
Sbjct  125  KRIPAGELWAGVPARKVRDLTQEEIEFFKVSADRYADLAQEYRV  168



>dbj|GAM26691.1| hypothetical protein SAMD00019534_098660 [Acytostelium subglobosum 
LB1]
Length=242

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 143/223 (64%), Gaps = 6/223 (3%)
 Frame = -2

Query  1083  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  904
             F  +G  IR TG+ALDRLGC +QGNY + E+L+RH  +M     +  + REAF+AP++S+
Sbjct  6     FAVLGDSIRSTGKALDRLGCSIQGNYAYIEKLNRHSRVMPFRGNIAHLGREAFIAPNSSV  65

Query  903   IGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVT  724
             IG V++G  SS+WY  VLRGD N+I IG  + I D ++++  +         T IG NV 
Sbjct  66    IGSVRIGHQSSVWYNTVLRGDTNAIIIGTNSIISDRTVINATRDK------QTTIGTNVY  119

Query  723   VGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAK  544
             VG  A+L+GC+++    +G G+ +L+GV +E  A + AG++V  NT +P  +VWGG+PA+
Sbjct  120   VGPGAILNGCSIDSNVVIGTGSIVLEGVRIESGASLEAGSIVPANTVVPQNQVWGGSPAR  179

Query  543   FLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKV  415
             F+R  T+E++A       ++S LAQ H V+N KS  E+  + +
Sbjct  180   FIRPATQEDVANRELLLDDHSTLAQEHEVQNLKSAKELHTDTL  222



>dbj|BAF32946.1| putative gamma-type carbonic anhydrase [Pleurochrysis haptonemofera]
Length=234

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/235 (41%), Positives = 145/235 (62%), Gaps = 4/235 (2%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             L R    VG  +R+TGQA++R+GCR Q N+ F+E   RHR +MNL+D+ P V + AF+AP
Sbjct  2     LKRVAVGVGKALRDTGQAIERMGCRAQDNFIFNEPYCRHRAVMNLYDQRPRVAQGAFIAP  61

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             +A++IG+V +   +SIWYG V+RGD ++I IG  ++I D S+V  +  N  G    T IG
Sbjct  62    NAAVIGNVDIEPRTSIWYGAVIRGDQSNIFIGGESSIGDRSVVQSSTVNPTGFSARTCIG  121

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             + V +G   VL  CT+ED   +G G  + +G ++E  AM+  G++V Q  R+P GEV+ G
Sbjct  122   DWVKIGQGCVLRACTIEDYCQIGDGCIVQEGALIENGAMLEPGSVVPQGARVPAGEVYAG  181

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARK  391
             NPA F+RKL++EEI    + A    +LA  H  E    F +      LR++ A++
Sbjct  182   NPATFVRKLSKEEIEEFGEYAEEVCDLAAKHLDE----FLDYPTTYQLREQMAKE  232



>ref|WP_028096230.1| carbonic anhydrase [Dongia sp. URHE0060]
Length=178

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 122/168 (73%), Gaps = 1/168 (1%)
 Frame = -2

Query  972  LMNLFDKV-PSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDN  796
            L+  +D + PS+  +AF+A +A +IGDV++G  SSIWYGCVLRGD NSI IGA TNIQD 
Sbjct  4    LIKPYDGITPSIAPDAFIAETAVVIGDVEIGAGSSIWYGCVLRGDSNSIKIGARTNIQDG  63

Query  795  SLVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMV  616
            +++HV           T IG++VTVGH A+LH CT+ED +FVGM A ++DGVVVE  AMV
Sbjct  64   TIIHVNHEREGAAGTRTTIGSDVTVGHMALLHACTLEDGSFVGMKACVMDGVVVESGAMV  123

Query  615  AAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLA  472
            AAGALV    R+  GE+W G+PAK +R L E+EIA+ + SA +Y++LA
Sbjct  124  AAGALVTPGKRVKKGELWAGSPAKLMRPLMEKEIAYFTYSAQHYADLA  171



>ref|XP_005766975.1| gamma carbonic anhydrase [Emiliania huxleyi CCMP1516]
 gb|ABG37688.1| gamma carbonic anhydrase [Emiliania huxleyi]
 gb|EOD14546.1| gamma carbonic anhydrase [Emiliania huxleyi CCMP1516]
Length=235

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 138/214 (64%), Gaps = 0/214 (0%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             + R    VG  +R+TGQA++R+G R Q N+ F E++ RHR LMNLFD+ P +    FVAP
Sbjct  1     MKRVLVGVGKALRDTGQAVERMGMRAQDNWIFQEKICRHRALMNLFDQRPKLRPSVFVAP  60

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             +AS+IG+V V   SSIWYG V+RGD + + IG  ++I D S+V  A  N  G    T IG
Sbjct  61    NASLIGNVSVMDESSIWYGAVVRGDQSPVDIGGKSSIGDRSVVLSASVNPTGFAAKTSIG  120

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             + VTVG   VL GCTV++ A VG G  + +G +VE + ++ AG+++     +P GEV GG
Sbjct  121   DWVTVGQGCVLRGCTVDNFAVVGDGCVIGEGALVETHGVLEAGSVLPAGGLVPRGEVHGG  180

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVE  454
             NPA F+RKL ++EIA I + A + S  A+ HA E
Sbjct  181   NPAAFVRKLEKDEIAAIEKKAEDVSMSAKKHADE  214



>ref|WP_008890933.1| carbonic anhydrase [Thalassospira profundimaris]
 gb|EKF07893.1| carbonic anhydrase/acetyltransferase [Thalassospira profundimaris 
WP0211]
Length=175

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 122/172 (71%), Gaps = 9/172 (5%)
 Frame = -2

Query  948  PSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSN  769
            P++   AF+AP+A+IIGDV++G  + IW+GCV+RGDV+ I IG+ TNIQD ++VHVAK  
Sbjct  10   PTIDETAFIAPNATIIGDVEIGAETGIWFGCVIRGDVHEIRIGSRTNIQDLTMVHVAKGK  69

Query  768  LAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQN  589
                   T IG++VT+GHSA++H CT+ED +FVGMGAT++DG V+E+  M+ A AL+   
Sbjct  70   FG-----TYIGDDVTIGHSAIIHACTLEDRSFVGMGATVMDGCVIEQGGMLGANALLAPG  124

Query  588  TRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDE  433
             RIP GE+W G PA+ +R LT+EEI F   SA  Y++LAQ    E  KS  E
Sbjct  125  KRIPAGELWAGVPARKVRNLTQEEIEFFKVSADRYADLAQ----EYVKSVPE  172



>ref|WP_033067257.1| carbonic anhydrase [Thalassospira australica]
Length=187

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 118/160 (74%), Gaps = 5/160 (3%)
 Frame = -2

Query  948  PSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSN  769
            P++   AF+AP+A+IIGDV++G  + IW+GCV+RGDV+ I IG+ TNIQD ++VHVAK  
Sbjct  22   PTIDETAFIAPNATIIGDVEIGAETGIWFGCVIRGDVHEIRIGSRTNIQDLTMVHVAKGK  81

Query  768  LAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQN  589
                   T IG++VT+GHSA++H CT+ED +FVGMGAT++DG V+E+  M+ A AL+   
Sbjct  82   FG-----TYIGDDVTIGHSAIIHACTLEDRSFVGMGATVMDGCVIEQGGMLGANALLAPG  136

Query  588  TRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQ  469
             RIP GE+W G PA+ +R LT+EEI F   SA  Y++LAQ
Sbjct  137  KRIPAGELWAGVPARKVRDLTQEEIEFFKVSADRYADLAQ  176



>emb|CBN79571.1| gamma carbonic anhydrase [Ectocarpus siliculosus]
Length=304

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/239 (43%), Positives = 149/239 (62%), Gaps = 4/239 (2%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             L +A   VG   R  G++LD +G  L+ + Y  + L+  R + +   KVPS  + +FVAP
Sbjct  2     LNQAKTAVGMAARRVGRSLDGMGAALETHPYTEKLLASTRSVGHK-GKVPSTAQASFVAP  60

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             +AS+IGDV+VG  +S+WYG V+RGDVN + IGAG+++ D+++VHVA   LAG    T++G
Sbjct  61    NASVIGDVKVGEGASLWYGSVVRGDVNHVVIGAGSSVGDSAVVHVA--GLAGN-KPTIVG  117

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             NNV +G  A +H CT++D+  VG GAT++DG  V   AMVA GA V  N  +P G++W G
Sbjct  118   NNVVIGPRATIHACTLKDDCMVGAGATVMDGATVSSGAMVAPGATVSPNITVPTGQLWAG  177

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDY  379
              PA ++R ++E E A I  +AA    L+  HA E  K   EIE ++    + A +D  Y
Sbjct  178   TPAVYVRDISELEAASIVTTAAETQALSLAHASECEKGPLEIELDERKWDEKASRDPTY  236



>ref|WP_028791231.1| carbonic anhydrase [Thalassospira lucentensis]
Length=175

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = -2

Query  948  PSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSN  769
            P++   AF+AP+A+IIGDV++G  + IW+GCV+RGDV+ I IG+ TNIQD ++VHVAK  
Sbjct  10   PTIDENAFIAPNATIIGDVEIGAETGIWFGCVIRGDVHEIRIGSRTNIQDLTMVHVAKGK  69

Query  768  LAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQN  589
                   T IG++VT+GH+A++H CT+ED +FVGMGAT++DG V+E+  M+ A AL+   
Sbjct  70   FG-----TYIGDDVTIGHAAIIHACTLEDRSFVGMGATVMDGCVIEQGGMLGANALLAPG  124

Query  588  TRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAV  457
             RIP GE+W G PA+ +R+LT+EEI F   SA  Y++LAQ + V
Sbjct  125  KRIPAGELWAGVPARKVRELTQEEIEFFKVSADRYADLAQEYRV  168



>ref|WP_024080899.1| putative hexapeptide repeat acetyltransferase [Magnetospirillum 
gryphiswaldense]
 ref|YP_008938603.1| putative hexapeptide repeat acetyltransferase [Magnetospirillum 
gryphiswaldense MSR-1]
 emb|CDK99943.1| putative hexapeptide repeat acetyltransferase [Magnetospirillum 
gryphiswaldense MSR-1 v2]
Length=175

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 115/162 (71%), Gaps = 5/162 (3%)
 Frame = -2

Query  948  PSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSN  769
            P++  + F+AP+A+IIGDV +G  +S+W+GCV+RGDV+ I IG  TNIQD ++VHV    
Sbjct  13   PTIADDCFIAPNATIIGDVVIGAGTSVWFGCVIRGDVHEIRIGERTNIQDGTIVHVT---  69

Query  768  LAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQN  589
              G  L T IG+++T+GH AVLH CT+ED  F+GMGA +LDG V+E  AMVAAGA+V   
Sbjct  70   --GGKLGTYIGSDITIGHGAVLHACTLEDGCFIGMGAVVLDGAVIESGAMVAAGAVVTPG  127

Query  588  TRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVH  463
             R+  GE+W GNPAK +R L E EIAF  +SAANY  L   +
Sbjct  128  KRVAAGELWSGNPAKLMRPLKEAEIAFFPKSAANYRTLGDTY  169



>emb|CBK21456.2| unnamed protein product [Blastocystis hominis]
Length=202

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 134/198 (68%), Gaps = 3/198 (2%)
 Frame = -2

Query  1023  RLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRG  844
             R++G   F +  SRHR +M L+DK P+V+ +AFVAP+AS+IGDV++   SS+WY  V+RG
Sbjct  2     RMEGVQDFLKLFSRHRPIMGLYDKRPAVNTDAFVAPNASVIGDVKMAAGSSVWYNAVVRG  61

Query  843   DVNSISIGAGTNIQDNS-LVHVAKSNLAGKVLSTVIGNNVTVGHSAVLHGCTVEDEAFVG  667
             D+N+++IG  TN+QD + L    KS+ +   L   IGNNVT+GH+A+L+ C V+D + +G
Sbjct  62    DINTVTIGENTNVQDRAVLASAKKSHCSDGTLK--IGNNVTIGHAAILNACQVDDYSLIG  119

Query  666   MGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAAN  487
             MGA L +G  V   +MV AG++V +   IP GE+W GNPA+F+RKLTEE+   +  SAA 
Sbjct  120   MGAILEEGCHVGSYSMVGAGSVVEKQQEIPSGELWTGNPARFVRKLTEEKKKSLEHSAAE  179

Query  486   YSNLAQVHAVENAKSFDE  433
             Y  L +  A E  + + E
Sbjct  180   YVELGRKSAAEIQQKYGE  197



>ref|XP_002948065.1| hypothetical protein VOLCADRAFT_73531 [Volvox carteri f. nagariensis]
 gb|EFJ51053.1| hypothetical protein VOLCADRAFT_73531 [Volvox carteri f. nagariensis]
Length=229

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/207 (45%), Positives = 133/207 (64%), Gaps = 4/207 (2%)
 Frame = -2

Query  1083  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  904
              + VGF +RE+G AL+R+GCRLQG Y F E+LSRH  ++ +  + PS+ + A+VAPS  +
Sbjct  11    LHRVGFAMRESGLALERVGCRLQGIYSFEEKLSRHASVLPMRYETPSIAKSAWVAPSGML  70

Query  903   IGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVT  724
              G+V +G  SS+WYG ++RGD   +++G  +NIQD + V  A S  +  V    IGNNV+
Sbjct  71    SGNVSIGEGSSVWYGAIVRGDFQPVTVGNNSNIQDAAYVGAA-SEFSPPV---NIGNNVS  126

Query  723   VGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAK  544
             VGH AVL GCT+ D   VG+ A + + V V+  A++AAGA V +   +P GEVW GNPAK
Sbjct  127   VGHGAVLKGCTIGDNVLVGINAVISENVEVQSGAVIAAGAYVEEGAVVPSGEVWAGNPAK  186

Query  543   FLRKLTEEEIAFISQSAANYSNLAQVH  463
              LR + E E+ ++      Y+ LA  H
Sbjct  187   KLRDVREGEVEYLKSLPGRYTELAGEH  213



>ref|XP_636871.1| trimeric LpxA-like domain-containing protein [Dictyostelium discoideum 
AX4]
 sp|Q54JC2.1|Y2881_DICDI RecName: Full=Uncharacterized protein DDB_G0288155 [Dictyostelium 
discoideum]
 gb|EAL63365.1| trimeric LpxA-like domain-containing protein [Dictyostelium discoideum 
AX4]
Length=246

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 149/239 (62%), Gaps = 3/239 (1%)
 Frame = -2

Query  1083  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  904
             F  +G  ++ TG  L R GC++QG+Y + E+L+RH  L    D  P V +++F+AP+ASI
Sbjct  7     FGILGEVVKNTGLILHRTGCKMQGDYAYVEKLNRHTRLTAFGDNAPIVGQKSFIAPNASI  66

Query  903   IGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIGNNVT  724
             IGDV +G+ SSIWY  VLRGDVNSI IG  T + D ++VH + +   G    T IG+ V 
Sbjct  67    IGDVVIGKESSIWYNAVLRGDVNSIHIGDKTVVSDRTVVHCSSNGPLGPK-PTQIGDKVY  125

Query  723   VGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGGNPAK  544
             +G  +++H  T+  E+F+G G+TL DG VVEKN  + AG+L+     I  GE WGG+PAK
Sbjct  126   IGPGSIVHAATILGESFIGTGSTLCDGSVVEKNGFLEAGSLLTAGKTIKSGEYWGGSPAK  185

Query  543   FLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFEKVLRKKFARKDEDYDSML  367
             F+R++T+++ + + +      NL++ H  + +KS  E+  +  L +K+ +     D +L
Sbjct  186   FIRQVTKDDESQLEKIIEQNINLSEQHEKQTSKSAKELNND--LLQKYVKNRTRSDHIL  242



>ref|XP_004351419.1| trimeric LpxA-like domain-containing protein [Dictyostelium fasciculatum]
 gb|EGG14903.1| trimeric LpxA-like domain-containing protein [Dictyostelium fasciculatum]
Length=249

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/225 (41%), Positives = 142/225 (63%), Gaps = 0/225 (0%)
 Frame = -2

Query  1095  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  916
             L   FY VG  +R TG+ALD +G  +QGNY + EQL+R   +  L  K+  + +++FVAP
Sbjct  2     LKNVFYLVGDAVRSTGKALDVVGRNMQGNYAYVEQLNRQSRVTPLRGKLAHLGKDSFVAP  61

Query  915   SASIIGDVQVGRHSSIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLAGKVLSTVIG  736
             ++S+IG V +G +S++WY  V+RGDVN I++G  T+I D +++H +  N      +T IG
Sbjct  62    NSSVIGQVTIGNNSALWYNTVVRGDVNQITVGNETSIGDRTVIHASSKNGPKGEQATQIG  121

Query  735   NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEVWGG  556
             + V VG  A+LHGC +ED A +G G+ + DG VVEK A + AG+LV    R+P G++WGG
Sbjct  122   SRVLVGSGAILHGCVIEDGANIGSGSIVYDGAVVEKGAHLEAGSLVASGKRVPAGQLWGG  181

Query  555   NPAKFLRKLTEEEIAFISQSAANYSNLAQVHAVENAKSFDEIEFE  421
             +PA+F+R +T +E +       +   L+  H  ++AKS  +   E
Sbjct  182   SPARFIRDVTAQEKSHHDTILQDTITLSAEHEAQHAKSAKQQHME  226



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3649860628038