BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14549_g2_i1 len=1029 path=[1315:0-1028]

Length=1029
                                                                      Score     E

emb|CDP09916.1|  unnamed protein product                                470   1e-157   
ref|XP_011070162.1|  PREDICTED: beta-fructofuranosidase, soluble ...    464   5e-156   
ref|XP_010676175.1|  PREDICTED: acid beta-fructofuranosidase-like...    465   6e-156   
ref|XP_011081205.1|  PREDICTED: beta-fructofuranosidase, soluble ...    464   7e-156   
ref|XP_010676174.1|  PREDICTED: acid beta-fructofuranosidase-like...    465   9e-156   
ref|XP_006440371.1|  hypothetical protein CICLE_v10019134mg             456   2e-154   
emb|CBI31885.3|  unnamed protein product                                454   3e-154   
ref|XP_009775767.1|  PREDICTED: acid beta-fructofuranosidase-like       459   1e-153   
ref|NP_001284386.1|  acid beta-fructofuranosidase-like                  459   1e-153   
emb|CAD19321.1|  acid vacuolar invertase                                459   1e-153   Beta vulgaris [beet]
ref|XP_004147588.1|  PREDICTED: acid beta-fructofuranosidase-like       459   2e-153   
ref|XP_004171067.1|  PREDICTED: LOW QUALITY PROTEIN: acid beta-fr...    459   2e-153   
ref|XP_002303519.1|  vacuolar invertase family protein                  458   2e-153   Populus trichocarpa [western balsam poplar]
gb|ACJ04701.1|  invertase 1                                             457   4e-153   Cucumis melo [Oriental melon]
ref|XP_011033927.1|  PREDICTED: acid beta-fructofuranosidase            457   6e-153   
ref|XP_008373808.1|  PREDICTED: acid beta-fructofuranosidase            457   9e-153   
emb|CAA47636.1|  soluble beta-fructosidase                              456   1e-152   Daucus carota [carrots]
gb|ADF27780.1|  soluble acid invertase 2                                452   2e-152   
gb|AAB47172.1|  vacuolar invertase 2, GIN2                              456   2e-152   
ref|XP_006355490.1|  PREDICTED: acid beta-fructofuranosidase-like       455   2e-152   
ref|XP_009630517.1|  PREDICTED: acid beta-fructofuranosidase-like       455   3e-152   
ref|XP_009350311.1|  PREDICTED: acid beta-fructofuranosidase-like       455   5e-152   
ref|NP_001234069.1|  invertase                                          454   6e-152   
ref|XP_002532576.1|  Acid beta-fructofuranosidase precursor, puta...    454   6e-152   Ricinus communis
ref|NP_001275813.1|  acid beta-fructofuranosidase-like                  455   9e-152   
ref|XP_009343902.1|  PREDICTED: acid beta-fructofuranosidase-like       455   1e-151   
dbj|BAF35859.1|  soluble acid invertase                                 454   3e-151   Pyrus pyrifolia var. culta [Asian pear]
ref|XP_002272809.3|  PREDICTED: acid beta-fructofuranosidase-like       452   5e-151   Vitis vinifera
ref|XP_007039920.1|  Glycosyl hydrolases family 32 protein              455   7e-151   
dbj|BAB82419.1|  acid invertase                                         451   3e-150   Citrus unshiu [satsuma mandarin]
ref|XP_004298661.1|  PREDICTED: acid beta-fructofuranosidase-like       450   1e-149   
gb|AEY79730.1|  vacuolar invertase isoform 2                            447   2e-149   
sp|P80065.2|INVB_DAUCA  RecName: Full=Beta-fructofuranosidase, so...    447   5e-149   Daucus carota [carrots]
gb|AFS17280.1|  acid vacuolar invertase                                 447   6e-149   
ref|XP_009401797.1|  PREDICTED: beta-fructofuranosidase 1-like          447   8e-149   
emb|CAA53098.1|  beta-fructofuranosidase                                446   1e-148   Daucus carota [carrots]
pdb|3UGF|A  Chain A, Crystal Structure Of A 6-Sst6-Sft From Pachy...    441   2e-148   
ref|XP_010259020.1|  PREDICTED: beta-fructofuranosidase, soluble ...    445   3e-148   
gb|KHG18769.1|  Acid beta-fructofuranosidase                            438   4e-148   
gb|AFR69121.1|  vacuolar invertase                                      444   4e-148   
ref|XP_008238615.1|  PREDICTED: acid beta-fructofuranosidase-like       445   5e-148   
emb|CAA53099.1|  beta-fructofuranosidase                                444   6e-148   Daucus carota [carrots]
ref|XP_007210314.1|  hypothetical protein PRUPE_ppa002334mg             444   1e-147   
ref|XP_010093687.1|  Acid beta-fructofuranosidase                       444   1e-147   
emb|CBM41476.2|  sucrose:(sucrose/fructan) 6-fructosyltransferase...    442   2e-147   
emb|CAD12104.1|  beta-fructofuranosidase                                442   3e-147   Cichorium intybus [radicchio]
gb|AEM00023.1|  vacuolar acid invertase                                 437   4e-147   
gb|AFH77957.1|  vacuolar invertase                                      442   5e-147   
ref|XP_004515737.1|  PREDICTED: acid beta-fructofuranosidase-like       440   3e-146   
ref|XP_002303584.2|  hypothetical protein POPTR_0003s12640g             438   3e-146   Populus trichocarpa [western balsam poplar]
ref|XP_006573732.1|  PREDICTED: acid beta-fructofuranosidase-like       440   5e-146   
gb|AFO84092.1|  vacuolar invertase                                      438   6e-146   
gb|KHN42709.1|  Acid beta-fructofuranosidase                            439   6e-146   
gb|KHN34956.1|  Acid beta-fructofuranosidase                            439   8e-146   
gb|KDP25630.1|  hypothetical protein JCGZ_20786                         438   1e-145   
ref|XP_010053435.1|  PREDICTED: acid beta-fructofuranosidase-like       437   3e-145   
gb|ACT21538.1|  acid invertase                                          432   3e-144   Vigna radiata [mung bean]
gb|ABI17894.1|  vacuolar invertase                                      432   4e-144   Coffea canephora [robusta coffee]
emb|CDP05324.1|  unnamed protein product                                430   6e-144   
ref|XP_009384549.1|  PREDICTED: beta-fructofuranosidase 1-like          433   8e-144   
gb|KEH31660.1|  soluble acid invertase FRUCT2                           429   1e-143   
sp|P29001.1|INVA_VIGRR  RecName: Full=Acid beta-fructofuranosidas...    432   2e-143   Vigna radiata var. radiata [golden gram]
ref|XP_004511663.1|  PREDICTED: acid beta-fructofuranosidase-like       431   4e-143   
dbj|BAP47496.1|  invertase                                              432   5e-143   
ref|XP_011022761.1|  PREDICTED: acid beta-fructofuranosidase-like       430   1e-142   
ref|XP_011101120.1|  PREDICTED: beta-fructofuranosidase, soluble ...    431   1e-142   
ref|XP_003608758.1|  Acid beta-fructofuranosidase                       429   2e-142   
gb|AFV59228.1|  vacuolar invertase CvINV                                429   2e-142   
gb|AES90955.2|  soluble acid invertase FRUCT2                           429   2e-142   
ref|XP_006878590.1|  hypothetical protein AMTR_s00011p00252750          429   3e-142   
gb|AFV59227.2|  vacuolar invertase NvINV                                429   4e-142   
gb|AEX15265.1|  vacuolar invertase                                      429   4e-142   
gb|KHN04338.1|  Acid beta-fructofuranosidase                            426   5e-142   
ref|XP_011076337.1|  PREDICTED: beta-fructofuranosidase, soluble ...    429   5e-142   
ref|XP_007157332.1|  hypothetical protein PHAVU_002G061200g             429   6e-142   
gb|AFD62255.1|  acid invertase                                          427   1e-141   
sp|Q43857.1|INVA_VICFA  RecName: Full=Acid beta-fructofuranosidas...    427   1e-141   Vicia faba [broad bean]
ref|XP_006307369.1|  hypothetical protein CARUB_v10008995mg             421   3e-141   
ref|XP_003525803.1|  PREDICTED: acid beta-fructofuranosidase-like       426   6e-141   
emb|CDY30056.1|  BnaC05g09640D                                          426   8e-141   
gb|KFK40573.1|  hypothetical protein AALP_AA2G014000                    415   1e-140   
ref|XP_009794076.1|  PREDICTED: acid beta-fructofuranosidase AIV-18     424   2e-140   
gb|EYU24965.1|  hypothetical protein MIMGU_mgv1a004782mg                420   2e-140   
gb|AFD62256.1|  acid invertase                                          424   3e-140   
ref|XP_003580229.1|  PREDICTED: beta-fructofuranosidase 1-like          425   4e-140   
gb|AGW23637.1|  soluble acid invertase                                  423   7e-140   
ref|XP_008778382.1|  PREDICTED: beta-fructofuranosidase 1-like          420   7e-140   
gb|AEV46289.1|  vacuolar invertase                                      422   1e-139   
ref|NP_001274993.1|  beta-fructosidase                                  422   1e-139   
sp|P29000.1|INVA_SOLLC  RecName: Full=Acid beta-fructofuranosidas...    421   2e-139   Solanum lycopersicum
gb|KHN09790.1|  Acid beta-fructofuranosidase                            421   3e-139   
gb|ADE44160.1|  acid invertase                                          421   3e-139   
gb|AAG36943.1|AF274299_1  acid invertase                                422   3e-139   Brassica oleracea
ref|XP_002446857.1|  hypothetical protein SORBIDRAFT_06g023760          422   5e-139   Sorghum bicolor [broomcorn]
gb|AEV46287.1|  vacuolar invertase                                      421   5e-139   
gb|ADM47340.1|  vacuolar invertase                                      421   5e-139   
ref|XP_003549902.1|  PREDICTED: acid beta-fructofuranosidase-like...    421   6e-139   
gb|ABF18956.1|  acid invertase                                          421   6e-139   Solanum tuberosum [potatoes]
gb|AAL75450.1|AF465613_1  minor allergen beta-fructofuranosidase ...    420   7e-139   Solanum lycopersicum
gb|AAQ17074.1|  acid invertase                                          420   7e-139   Solanum tuberosum [potatoes]
gb|AEV46294.1|  vacuolar invertase                                      420   1e-138   
gb|ACC93585.1|  beta-fructofuranosidase                                 419   2e-138   Solanum tuberosum [potatoes]
gb|AEV46296.1|  vacuolar invertase                                      419   2e-138   
ref|NP_001234843.1|  acid invertase                                     419   2e-138   
ref|NP_563901.1|  acid beta-fructofuranosidase 4                        419   3e-138   Arabidopsis thaliana [mouse-ear cress]
emb|CAA66330.1|  beta-fructosidase                                      419   3e-138   Arabidopsis thaliana [mouse-ear cress]
gb|AFU25742.1|  soluble acid invertase 2                                419   3e-138   
gb|KDO65461.1|  hypothetical protein CISIN_1g006523mg                   412   4e-138   
sp|O24509.1|INVA_PHAVU  RecName: Full=Acid beta-fructofuranosidas...    418   6e-138   Phaseolus vulgaris [French bean]
ref|XP_010933713.1|  PREDICTED: beta-fructofuranosidase 1               418   6e-138   
emb|CAA49831.1|  beta-fructofuranosidase                                417   7e-138   Solanum tuberosum [potatoes]
ref|XP_009619840.1|  PREDICTED: acid beta-fructofuranosidase AIV-...    417   1e-137   
gb|ABX55832.1|  soluble acid invertase                                  417   1e-137   Cucumis melo [Oriental melon]
ref|XP_007155629.1|  hypothetical protein PHAVU_003G217900g             417   1e-137   
emb|CBI24585.3|  unnamed protein product                                414   2e-137   
ref|NP_001169591.1|  uncharacterized protein LOC100383472               411   2e-137   Zea mays [maize]
ref|XP_009148607.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    417   2e-137   
prf||1905419A  invertase                                                416   2e-137
sp|P93761.1|INV1_CAPAN  RecName: Full=Acid beta-fructofuranosidas...    416   3e-137   Capsicum annuum
ref|XP_006417255.1|  hypothetical protein EUTSA_v10007016mg             417   3e-137   
ref|XP_009406946.1|  PREDICTED: beta-fructofuranosidase 1-like          413   3e-137   
gb|AAK71504.1|  soluble acid invertase FRUCT2                           417   3e-137   Ipomoea batatas [batate]
emb|CDX98080.1|  BnaA06g08310D                                          417   4e-137   
ref|XP_010418267.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    416   4e-137   
gb|ACC93584.1|  beta-fructofuranosidase                                 415   7e-137   Solanum tuberosum [potatoes]
gb|AFP23357.1|  soluble acid invertase                                  415   8e-137   
gb|KDO65460.1|  hypothetical protein CISIN_1g006523mg                   411   1e-136   
ref|XP_002265534.1|  PREDICTED: beta-fructofuranosidase, soluble ...    414   2e-136   Vitis vinifera
ref|XP_010546426.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    415   2e-136   
gb|AAM52062.1|  vacuolar acid invertase PsI-1                           414   2e-136   Pisum sativum [garden pea]
ref|XP_006653622.1|  PREDICTED: beta-fructofuranosidase 1-like          412   5e-136   
ref|XP_010906620.1|  PREDICTED: beta-fructofuranosidase 1-like          413   6e-136   
pir||S49256  beta-fructofuranosidase (EC 3.2.1.26) - red goosefoo...    409   6e-136
ref|XP_002889923.1|  beta-fructosidase                                  414   6e-136   
gb|KDO65459.1|  hypothetical protein CISIN_1g006523mg                   412   9e-136   
gb|AAA50305.1|  beta-fructosidase                                       412   1e-135   Solanum tuberosum [potatoes]
gb|AAK71505.2|  soluble acid invertase Ib2FRUCT3                        412   1e-135   Ipomoea batatas [batate]
emb|CDY15984.1|  BnaC08g41390D                                          413   2e-135   
ref|XP_010473488.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    412   2e-135   
ref|NP_001275874.1|  beta-fructofuranosidase, soluble isoenzyme I...    411   3e-135   
ref|XP_008796841.1|  PREDICTED: LOW QUALITY PROTEIN: beta-fructof...    411   3e-135   
ref|XP_004976364.1|  PREDICTED: beta-fructofuranosidase 1-like          412   3e-135   
gb|AAG36942.1|AF274298_1  acid invertase                                411   4e-135   Brassica oleracea
ref|XP_010430328.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    411   4e-135   
ref|XP_006421676.1|  hypothetical protein CICLE_v10004465mg             412   5e-135   
ref|XP_010264216.1|  PREDICTED: beta-fructofuranosidase, soluble ...    410   7e-135   
emb|CDY26548.1|  BnaA09g47290D                                          410   1e-134   
ref|XP_008668436.1|  PREDICTED: uncharacterized protein LOC100383...    410   1e-134   
gb|AAB47171.1|  vacuolar invertase 1, GIN1                              410   1e-134   
ref|XP_009118103.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    410   1e-134   
sp|P49175.1|INV1_MAIZE  RecName: Full=Beta-fructofuranosidase 1; ...    410   1e-134   Zea mays [maize]
gb|ADF27779.1|  soluble acid invertase 1                                410   1e-134   
ref|XP_011101190.1|  PREDICTED: beta-fructofuranosidase, soluble ...    409   1e-134   
dbj|BAJ95733.1|  predicted protein                                      406   2e-134   
gb|AFH77956.1|  vacuolar invertase                                      409   2e-134   
gb|EPS61897.1|  soluble acid invertase 1                                406   3e-134   
ref|XP_010919479.1|  PREDICTED: beta-fructofuranosidase 1 isoform X2    409   3e-134   
ref|XP_010919478.1|  PREDICTED: beta-fructofuranosidase 1 isoform X1    409   3e-134   
ref|XP_002510944.1|  Beta-fructofuranosidase, soluble isoenzyme I...    408   4e-134   Ricinus communis
emb|CDY46906.1|  BnaA09g12880D                                          408   6e-134   
ref|XP_006300839.1|  hypothetical protein CARUB_v10019930mg             408   6e-134   
ref|XP_010672026.1|  PREDICTED: beta-fructofuranosidase, soluble ...    407   1e-133   
ref|XP_010493951.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    408   1e-133   
ref|XP_010458650.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    408   1e-133   
emb|CAH67112.1|  H0502G05.3                                             407   1e-133   Oryza sativa [red rice]
ref|NP_001053422.1|  Os04g0535600                                       407   1e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008787011.1|  PREDICTED: beta-fructofuranosidase 1               406   4e-133   
ref|XP_010476187.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    406   6e-133   
ref|XP_010106222.1|  hypothetical protein L484_003380                   405   7e-133   
ref|XP_009113064.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    405   1e-132   
ref|NP_001284469.1|  acid beta-fructofuranosidase-like                  404   1e-132   
ref|XP_011010942.1|  PREDICTED: beta-fructofuranosidase, soluble ...    400   2e-132   
ref|XP_006391837.1|  hypothetical protein EUTSA_v10023331mg             404   2e-132   
ref|XP_006300852.1|  hypothetical protein CARUB_v10019944mg             403   4e-132   
emb|CAA66237.1|  invertase 5                                            402   6e-132   Tulipa gesneriana
gb|AAM77272.1|AF519809_1  acid invertase                                403   7e-132   Lagenaria siceraria [bottle gourd]
ref|XP_002888009.1|  predicted protein                                  403   8e-132   
emb|CAA61624.1|  beta-fructofuranosidase                                399   9e-132   Arabidopsis thaliana [mouse-ear cress]
emb|CDY31826.1|  BnaC09g13230D                                          402   1e-131   
ref|XP_008794813.1|  PREDICTED: beta-fructofuranosidase 1-like          402   2e-131   
ref|XP_011000150.1|  PREDICTED: beta-fructofuranosidase, soluble ...    401   2e-131   
ref|XP_007131343.1|  hypothetical protein PHAVU_011G005900g             400   2e-131   
gb|AAF87245.1|AF276703_1  vacuolar acid invertase                       401   2e-131   Oryza sativa [red rice]
ref|XP_004307805.1|  PREDICTED: beta-fructofuranosidase, soluble ...    401   3e-131   
emb|CAA64781.1|  beta-fructosidase                                      401   3e-131   Arabidopsis thaliana [mouse-ear cress]
gb|KDP22418.1|  hypothetical protein JCGZ_26249                         400   3e-131   
gb|AAD43622.1|AC005698_21  T3P18.21                                     401   3e-131   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564798.1|  acid beta-fructofuranosidase 3                        401   3e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003533514.1|  PREDICTED: beta-fructofuranosidase, soluble ...    400   3e-131   
gb|KHN11662.1|  Beta-fructofuranosidase, soluble isoenzyme I            397   4e-131   
gb|KHN42772.1|  Beta-fructofuranosidase, soluble isoenzyme I            397   4e-131   
ref|XP_004143623.1|  PREDICTED: beta-fructofuranosidase, soluble ...    400   5e-131   
ref|XP_009112697.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    400   6e-131   
emb|CAA70855.1|  sucrose sucrose 1-fructosyltransferase                 399   8e-131   Cynara cardunculus var. scolymus [artichoke]
gb|AAF19535.1|AC007190_3  F23N19.3                                      402   8e-131   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM66574.1|  fructan:fructan 1-fructosyltransferase                 399   9e-131   
ref|XP_010533769.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    401   9e-131   
gb|AAB58909.1|  sucrose:sucrose 1-fructosyl transferase                 399   1e-130   Cichorium intybus [radicchio]
gb|AAK62665.1|  At1g62660/F23N19_3                                      399   1e-130   Arabidopsis thaliana [mouse-ear cress]
emb|CAA04120.2|  fructan fructan 1-fructosyltransferase                 398   2e-130   Cynara cardunculus var. scolymus [artichoke]
ref|XP_007218855.1|  hypothetical protein PRUPE_ppa002732mg             394   2e-130   
ref|XP_003526374.1|  PREDICTED: beta-fructofuranosidase, soluble ...    399   2e-130   
ref|XP_010473489.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    398   3e-130   
ref|XP_007038395.1|  Glycosyl hydrolases family 32 protein isoform 1    398   4e-130   
gb|AFB83198.1|  sucrose:sucrose 1-fructosyl transferase                 397   5e-130   
gb|ACZ05614.1|  vacuolar invertase 2                                    397   7e-130   
ref|XP_010430330.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    397   1e-129   
ref|XP_010259193.1|  PREDICTED: beta-fructofuranosidase, soluble ...    397   1e-129   
ref|XP_002321831.2|  hypothetical protein POPTR_0015s14790g             396   2e-129   Populus trichocarpa [western balsam poplar]
gb|EEC77707.1|  hypothetical protein OsI_16783                          397   2e-129   Oryza sativa Indica Group [Indian rice]
emb|CAD41525.3|  OSJNBb0020O11.6                                        397   2e-129   Oryza sativa Japonica Group [Japonica rice]
gb|AGU12782.1|  vacuolar invertase 2a                                   394   5e-129   
emb|CAA66238.1|  invertase 6                                            395   5e-129   Tulipa gesneriana
ref|XP_007218853.1|  hypothetical protein PRUPE_ppa002732mg             395   6e-129   
emb|CAB60153.1|  sucrose:sucrose 1-fructosyl transferase                394   6e-129   Taraxacum officinale [dandelion]
ref|XP_010941127.1|  PREDICTED: beta-fructofuranosidase 1-like          395   8e-129   
ref|XP_008234397.1|  PREDICTED: beta-fructofuranosidase, soluble ...    394   8e-129   
emb|CAA64953.1|  invertase                                              394   1e-128   Tulipa gesneriana
dbj|BAJ24841.1|  fructan:fructan 1-fructosyltransferase                 393   2e-128   
gb|ABX90019.1|  sucrose:sucrose 1-fructosyltransferase                  394   2e-128   Lactuca sativa [cultivated lettuce]
ref|XP_010062212.1|  PREDICTED: beta-fructofuranosidase, soluble ...    394   3e-128   
emb|CDY39804.1|  BnaA09g10560D                                          392   5e-128   
gb|AAL05427.2|  vacuolar acid invertase                                 392   8e-128   Prunus cerasus [pie cherry]
gb|AFJ21575.1|  vacuolar invertase                                      391   2e-127   
emb|CAH18892.1|  2,1-fructan:2,1-fructan 1-fructosyltransferase p...    389   3e-127   Viguiera discolor
emb|CAH25486.1|  1,2-beta-fructan 1F-fructosyltransferase               390   3e-127   Taraxacum officinale [dandelion]
ref|XP_009374489.1|  PREDICTED: beta-fructofuranosidase, soluble ...    390   3e-127   
gb|AAB71136.1|  acid invertase                                          390   5e-127   Asparagus officinalis
gb|ABS72186.1|  fructan:fructan 1-fructosyltransferase                  390   5e-127   Agave tequilana
ref|XP_009340588.1|  PREDICTED: beta-fructofuranosidase, soluble ...    390   6e-127   
gb|KHG09862.1|  Beta-fructofuranosidase, soluble isoenzyme I            386   6e-127   
emb|CAH18891.1|  2,1-fructan:2,1-fructan 1-fructosyltransferase p...    388   1e-126   Echinops ritro
emb|CAA08811.1|  1,2-beta-fructan 1F-fructosyltransferase               388   1e-126   Helianthus tuberosus [Jerusalem artichoke]
sp|Q5FC15.1|GFT_ASPOF  RecName: Full=6(G)-fructosyltransferase; A...    387   2e-126   Asparagus officinalis
ref|XP_003538727.1|  PREDICTED: acid beta-fructofuranosidase-like       388   2e-126   
emb|CAH18938.1|  2,1-fructan:2,1-fructan 1-fructosyltransferase p...    385   2e-126   Bellis perennis [English daisy]
emb|CAA06838.1|  sucrose sucrose 1-fructosyltransferase                 388   2e-126   Allium cepa
emb|CDY03265.1|  BnaC09g10830D                                          388   3e-126   
gb|AFU56882.1|  vacuolar invertase                                      388   3e-126   
ref|XP_003598216.1|  Acid beta-fructofuranosidase                       384   3e-126   
gb|AHK05786.1|  vacuolar invertase                                      387   6e-126   
gb|AFB83199.1|  fructan-fructan 1-fructosyltransferase                  387   6e-126   
emb|CAA06839.1|  invertase                                              389   6e-126   Allium cepa
gb|ADP08983.1|  vacuolar invertase 1                                    387   7e-126   
gb|AAD00558.1|  fructan-fructan 1-fructosyltransferase                  386   9e-126   Cichorium intybus [radicchio]
gb|AES68467.2|  soluble acid invertase FRUCT2                           386   1e-125   
ref|XP_007148711.1|  hypothetical protein PHAVU_005G008200g             385   2e-125   
gb|ACQ82802.1|  vacuolar invertase                                      385   3e-125   Gossypium hirsutum [American cotton]
gb|KFK40589.1|  hypothetical protein AALP_AA2G015400                    385   4e-125   
ref|XP_008376436.1|  PREDICTED: beta-fructofuranosidase, soluble ...    384   8e-125   
gb|AAL99550.1|AF490530_1  beta-fructofuranosidase TAI 20-19             374   9e-125   Solanum lycopersicum
ref|XP_004499664.1|  PREDICTED: beta-fructofuranosidase, soluble ...    384   1e-124   
emb|CAA08812.1|  sucrose 1F-fructosyltransferase                        383   1e-124   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_010536536.1|  PREDICTED: acid beta-fructofuranosidase-like       383   2e-124   
gb|AFJ21571.1|  sucrose:sucrose 1-fructosyltransferase                  382   3e-124   
emb|CAH18937.1|  2,1-fructan:2,1-fructan 1-fructosyltransferase p...    381   5e-124   Doronicum pardalianches
ref|XP_009370474.1|  PREDICTED: beta-fructofuranosidase, soluble ...    382   8e-124   
gb|KHN32440.1|  Beta-fructofuranosidase, soluble isoenzyme I            380   8e-124   
gb|ABG00265.1|  sucrose:sucrose 1-fructosyltransferase                  380   2e-123   Agave tequilana
dbj|BAM66575.1|  sucrose:sucrose 1-fructosyltransferase                 380   2e-123   
gb|AAX38361.1|  sucrose accumulator                                     371   2e-123   Solanum pimpinellifolium [currant tomato]
gb|AAX38344.1|  sucrose accumulator                                     371   3e-123   Solanum chilense
gb|AFJ21570.1|  sucrose:sucrose 1-fructosyltransferase                  379   3e-123   
gb|AAL99549.1|  beta-fructofuranosidase MFAI1                           370   4e-123   Cucumis melo [Oriental melon]
gb|AFJ21576.1|  sucrose:sucrose 1-fructosyltransferase                  379   4e-123   
gb|AAX38332.1|  sucrose accumulator                                     371   4e-123   Solanum peruvianum [Peruvian tomato]
dbj|BAG30919.1|  soluble acid invertase                                 380   4e-123   Pyrus pyrifolia [sha li]
gb|AAX38331.1|  sucrose accumulator                                     370   4e-123   Solanum peruvianum [Peruvian tomato]
gb|AAX38330.1|  sucrose accumulator                                     370   5e-123   Solanum peruvianum [Peruvian tomato]
gb|AAX38333.1|  sucrose accumulator                                     370   5e-123   Solanum peruvianum [Peruvian tomato]
gb|AAM21931.1|  sucrose:sucrose 1-fructosyltransferase                  379   5e-123   Allium sativum
gb|AAX38336.1|  sucrose accumulator                                     370   6e-123   Solanum chilense
emb|CAH25487.1|  1,2-beta-fructan 1F-fructosyltransferase               379   6e-123   Taraxacum officinale [dandelion]
gb|AAX38329.1|  sucrose accumulator                                     370   7e-123   Solanum peruvianum [Peruvian tomato]
gb|AAZ85379.1|  vacuolar invertase                                      370   8e-123   Solanum ochranthum
ref|XP_003540575.1|  PREDICTED: beta-fructofuranosidase, soluble ...    378   8e-123   
gb|AAX38351.1|  sucrose accumulator                                     370   1e-122   Solanum chmielewskii
gb|AAX38345.1|  sucrose accumulator                                     370   1e-122   Solanum habrochaites
dbj|BAF35858.1|  Soluble acid invertase                                 379   1e-122   Pyrus pyrifolia var. culta [Asian pear]
gb|AFJ21578.1|  fructan:fructan 6G-fructosyltransferase                 378   1e-122   
gb|AFJ21572.1|  fructan:fructan 6G-fructosyltransferase                 378   1e-122   
gb|AAG49563.1|  acid invertase                                          366   1e-122   
gb|AAD10239.1|  invertase                                               379   2e-122   
gb|AAX38328.1|  sucrose accumulator                                     369   3e-122   
gb|AAX38335.1|  sucrose accumulator                                     369   3e-122   
gb|AAX38326.1|  sucrose accumulator                                     368   6e-122   
gb|ABX90020.1|  fructan:fructan 1-fructosyltransferase                  376   7e-122   
gb|AAX38327.1|  sucrose accumulator                                     367   8e-122   
ref|XP_004951208.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose:sucr...    368   2e-118   
sp|P92916.1|GFT_ALLCE  RecName: Full=Bifunctional 6(G)-fructosylt...    366   4e-118   
gb|AAD01606.1|  beta-fructofuranosidase                                 367   5e-118   
gb|ABB77251.1|  vacuolar invertase BObetaFRUCT3                         365   3e-117   
ref|XP_010228144.1|  PREDICTED: sucrose:sucrose 1-fructosyltransf...    358   3e-116   
gb|AFJ21579.1|  fructan:fructan 6G-fructosyltransferase                 361   5e-116   
ref|XP_002451357.1|  hypothetical protein SORBIDRAFT_04g000620          356   1e-115   
gb|AFJ21573.1|  fructan:fructan 6G-fructosyltransferase                 360   2e-115   
gb|ACY78464.1|  soluble acid invertase                                  356   8e-115   
gb|ACS92722.1|  vacuolar invertase                                      358   1e-114   
pir||JC7905  fructan 6-fructosyltransferase - wheat                     357   2e-114
dbj|BAB82469.1|  sucrose:fructan 6-fructosyltransferase                 357   2e-114   
gb|ACH73192.1|  sucrose:fructan 6-fructosyltransferase                  357   2e-114   
gb|ACY78467.1|  soluble acid invertase                                  354   3e-114   
gb|ACY78465.1|  soluble acid invertase                                  354   4e-114   
gb|ACH73195.1|  sucrose:fructan 6-fructosyltransferase                  356   4e-114   
gb|ACH73193.1|  sucrose:fructan 6-fructosyltransferase                  355   8e-114   
gb|ACH73194.1|  sucrose:fructan 6-fructosyltransferase                  355   1e-113   
gb|AGO03820.1|  soluble acid invertase                                  356   2e-113   
gb|AFP72240.1|  sucrose:fructan 6-fructosyltransferase                  354   2e-113   
gb|AAK72492.2|  soluble acid invertase bfruct2                          355   3e-113   
gb|AFN66440.1|  soluble acid invertase                                  351   4e-113   
gb|AFN66439.1|  soluble acid invertase                                  351   4e-113   
gb|EAZ21424.1|  hypothetical protein OsJ_05029                          351   5e-113   
gb|AFH57543.1|  soluble acid invertase                                  355   6e-113   
gb|EMT09010.1|  6(G)-fructosyltransferase                               351   6e-113   
gb|AGO03823.1|  soluble acid invertase                                  354   8e-113   
gb|AFV94474.1|  soluble acid invertase 11                               355   1e-112   
emb|CAD91358.1|  vacuolar invertase                                     348   1e-112   
gb|AGG41117.1|  putative vacuole invertase                              347   2e-112   
ref|NP_001045626.1|  Os02g0106100                                       353   3e-112   
ref|XP_003571181.2|  PREDICTED: sucrose:sucrose 1-fructosyltransf...    353   3e-112   
ref|XP_004307806.1|  PREDICTED: beta-fructofuranosidase, soluble ...    347   3e-112   
gb|AFV94468.1|  soluble acid invertase 4                                353   5e-112   
gb|AGR51646.1|  soluble acid invertase                                  350   6e-112   
ref|XP_006646767.1|  PREDICTED: sucrose:sucrose 1-fructosyltransf...    351   8e-112   
gb|AFV94470.1|  soluble acid invertase 7                                352   1e-111   
gb|AAA74584.1|  invertase                                               346   1e-111   
emb|CAA58235.1|  sucrose:fructan 6-fructosyltransferase                 349   2e-111   
gb|ACI43225.3|  sucrose:fructan 6-fructosyltransferase                  349   2e-111   
gb|AAC16655.1|  soluble acid invertase                                  347   2e-111   
dbj|BAK03249.1|  predicted protein                                      351   2e-111   
dbj|BAH30252.1|  sucrose: fructan 6-fructosyltransferase                349   2e-111   
gb|AFV94412.1|  soluble acid invertase 1                                351   2e-111   
gb|AFV94472.1|  soluble acid invertase 9                                351   2e-111   
gb|EMT14935.1|  Beta-fructofuranosidase 1                               346   2e-111   
gb|AFV94413.1|  soluble acid invertase 2                                351   2e-111   
gb|AFV94414.1|  soluble acid invertase 3                                350   4e-111   
gb|EYU24750.1|  hypothetical protein MIMGU_mgv1a0026273mg               342   5e-111   
emb|CAF22241.1|  soluble acid invertase                                 349   6e-111   
gb|ACN93835.1|  putative sucrose:fructan 6-fructosyltransferase         347   7e-111   
gb|AAP59436.1|  soluble acid invertase                                  348   1e-110   
gb|AAL92880.1|  fructosyltransferase                                    348   1e-110   
gb|AAC16654.1|  soluble acid invertase                                  345   2e-110   
gb|AAG24787.1|AF252607_1  sucrose:fructan 6-fructosyltransferase        337   2e-110   
gb|KDO65462.1|  hypothetical protein CISIN_1g006523mg                   345   4e-110   
gb|EYU30506.1|  hypothetical protein MIMGU_mgv1a0199921mg               343   5e-110   
ref|XP_008645147.1|  PREDICTED: sucrose:sucrose 1-fructosyltransf...    347   8e-110   
dbj|BAJ87063.1|  predicted protein                                      346   1e-109   
gb|AFV94469.1|  soluble acid invertase 6                                347   1e-109   
gb|EMT19913.1|  Beta-fructofuranosidase 1                               345   3e-109   
gb|AAC36118.1|  soluble acid invertase                                  334   4e-109   
gb|AAG24788.1|AF252608_1  sucrose:fructan 6-fructosyltransferase        333   4e-109   
gb|EMT19915.1|  Beta-fructofuranosidase 1                               345   4e-109   
gb|AFK29573.1|  sucrose: fructan 6-fructosyltransferase                 342   7e-109   
gb|AFV94467.1|  soluble acid invertase 5                                343   2e-108   
gb|AAS88729.1|  vacuolar invertase1                                     342   2e-108   
emb|CAG25609.1|  acid beta-fructofuranosidase precursor                 343   2e-108   
dbj|BAJ88213.1|  predicted protein                                      334   2e-108   
gb|KDO48371.1|  hypothetical protein CISIN_1g0052792mg                  339   3e-108   
emb|CDY03264.1|  BnaC09g10840D                                          339   7e-108   
dbj|BAJ93214.1|  predicted protein                                      340   1e-107   
emb|CAD58681.1|  putative soluble acid invertase                        341   1e-107   
gb|AFV94471.1|  soluble acid invertase 8                                342   1e-107   
emb|CAD58683.1|  putative soluble acid invertase                        335   3e-107   
gb|AFV94475.1|  soluble acid invertase 12                               339   8e-107   
gb|AAK27319.1|AF211253_1  sucrose:fructan 6-fructosyltransferase        337   9e-107   
gb|ADP38056.1|  putative sucrose:fructan fructosyl transferase          337   1e-106   
dbj|BAJ94230.1|  predicted protein                                      338   1e-106   
gb|AAF87246.1|AF276704_1  vacuolar acid invertase                       337   2e-106   
gb|ADP38058.1|  putative sucrose:fructan fructosyl transferase 2        335   4e-106   
gb|EMT19914.1|  Beta-fructofuranosidase 1                               333   4e-106   
gb|AAG36767.1|AF192394_1  sucrose:fructan 6-fructosyltransferase        334   9e-106   
gb|AFP72241.1|  vacuolar invertase                                      334   2e-105   
emb|CDY39805.1|  BnaA09g10570D                                          333   2e-105   
gb|ADP38057.1|  putative sucrose:fructan fructosyl transferase 1        333   3e-105   
gb|EMT19916.1|  Beta-fructofuranosidase 1                               334   4e-105   
dbj|BAK04106.1|  predicted protein                                      333   4e-105   
gb|EMT09009.1|  Beta-fructofuranosidase, soluble isoenzyme I            331   1e-104   
gb|AEB66649.1|  vacuole invertase                                       330   2e-104   
gb|AAL87233.1|AF481763_1  fructosyltransferase                          332   2e-104   
gb|EMT23832.1|  6(G)-fructosyltransferase                               330   3e-104   
gb|AFP72238.1|  sucrose:sucrose 1-fructosyltransferase                  331   6e-104   
gb|AAK72493.2|  soluble acid invertase bfruct3                          332   7e-104   
ref|XP_001764172.1|  predicted protein                                  328   7e-104   
gb|AFV94473.1|  soluble acid invertase 10                               332   8e-104   
gb|AEB66648.1|  vacuole invertase                                       328   9e-104   
dbj|BAJ88350.1|  predicted protein                                      330   1e-103   
dbj|BAJ97223.1|  predicted protein                                      330   1e-103   
gb|ACL13557.1|  sucrose:sucrose 1-fructosyltransferase                  330   1e-103   
ref|XP_010259021.1|  PREDICTED: beta-fructofuranosidase, soluble ...    328   2e-103   
dbj|BAB82470.1|  sucrose:sucrose 1-fructosytransferase                  329   4e-103   
gb|EMS56293.1|  Beta-fructofuranosidase 1                               327   6e-103   
gb|AAM13671.1|AF492836_1  fructan:fructan 6G-fructosyltransferase       327   9e-103   
emb|CAL51272.1|  putative fructan:fructan 6G-fructosyltransferase       327   1e-102   
gb|AFP72242.1|  vacuolar invertase                                      326   1e-102   
dbj|BAK05319.1|  predicted protein                                      326   2e-102   
gb|ACL13558.1|  sucrose:sucrose 1-fructosyltransferase                  327   2e-102   
gb|EMT23831.1|  hypothetical protein F775_52102                         323   2e-102   
emb|CAL51273.1|  putative sucrose:sucrose 1-fructosyltransferase        327   2e-102   
dbj|BAD26613.1|  putative fructosyltransferase2                         326   3e-102   
dbj|BAJ91277.1|  predicted protein                                      326   4e-102   
gb|ABD72592.1|  fructosyltransferase FTa                                326   4e-102   
dbj|BAF99807.1|  sucrose:sucrose fructosyltransferase                   325   5e-102   
gb|AAO86693.1|  sucrose:sucrose 1-fructosyltransferase                  325   6e-102   
gb|AAZ29516.1|  fructosyltransferase-like protein                       325   7e-102   
gb|ACL13556.1|  sucrose:sucrose 1-fructosyltransferase                  325   8e-102   
gb|EMT24081.1|  Beta-fructofuranosidase 1                               325   9e-102   
ref|XP_002976640.1|  hypothetical protein SELMODRAFT_10966              321   1e-101   
gb|AEY79729.1|  vacuolar invertase isoform 1                            323   1e-101   
gb|EMS55535.1|  Beta-fructofuranosidase 1                               320   2e-101   
sp|Q9FSV7.1|SST_FESAR  RecName: Full=Sucrose:sucrose 1-fructosylt...    324   2e-101   
ref|XP_002973210.1|  hypothetical protein SELMODRAFT_98949              323   4e-101   
gb|EMT11750.1|  Beta-fructofuranosidase 1                               322   4e-101   
emb|CAD98793.2|  sucrose-sucrose-1-fructosyltransferase                 323   4e-101   
dbj|BAE19751.1|  fructan:fructan 1-fructosyltransferase                 323   4e-101   
dbj|BAJ85557.1|  predicted protein                                      323   4e-101   
ref|XP_001784437.1|  predicted protein                                  318   9e-101   
gb|EMT16812.1|  6(G)-fructosyltransferase                               320   2e-100   
dbj|BAF99808.1|  fructan:fructan 6G-fructosyltransferase 2              320   5e-100   
gb|AFP72239.1|  fructan-fructan 1-fructosyltransferase                  319   1e-99    
dbj|BAE19752.1|  fructan:fructan 1-fructosyltransferase                 319   2e-99    
gb|EMT29525.1|  6(G)-fructosyltransferase                               315   2e-99    
dbj|BAO09621.1|  fructosyltransferase                                   318   3e-99    
ref|XP_008680035.1|  PREDICTED: beta-fructofuranosidase 1-like          315   3e-99    
gb|EMS52383.1|  Beta-fructofuranosidase 1                               316   1e-98    
gb|EMT14599.1|  Beta-fructofuranosidase, soluble isoenzyme I            317   1e-98    
gb|AAM14603.1|AF494041_1  fructan 6-fructosyltransferase                316   1e-98    
dbj|BAD35132.1|  putative fructosyltransferase1                         316   2e-98    
gb|AFK29572.1|  sucrose: sucrose-1-fructosyltransferase                 316   3e-98    
gb|ACH73188.1|  fructan:fructan 1-fructosyltransferase                  315   7e-98    
dbj|BAF99806.1|  putative fructosyltransferase 2                        313   1e-97    
gb|ACH73189.1|  fructan:fructan 1-fructosyltransferase                  313   5e-97    
emb|CAD58682.1|  putative fructan 6-fructosyltransferase                312   5e-97    
gb|AAC23502.1|  vacuolar invertase                                      308   6e-97    
gb|ACH73196.1|  sucrose:sucrose 1-fructosyltransferase                  312   8e-97    
emb|CAL51274.1|  putative (sucrose/fructan) 6-fructosyltransferase      311   9e-97    
gb|ACL14897.1|  fructan:fructan 1-fructosyltransferase                  311   1e-96    
ref|NP_001234618.1|  acid beta-fructofuranosidase precursor             308   2e-96    
gb|ACH73190.1|  fructan:fructan 1-fructosyltransferase                  310   3e-96    
gb|ACH73191.1|  fructan:fructan 1-fructosyltransferase                  308   3e-95    
ref|XP_001778420.1|  predicted protein                                  295   3e-94    
ref|XP_001774490.1|  predicted protein                                  302   1e-93    
gb|KDO65463.1|  hypothetical protein CISIN_1g006523mg                   300   4e-93    
ref|XP_001755639.1|  predicted protein                                  299   2e-92    
gb|EMS52931.1|  6(G)-fructosyltransferase                               298   4e-92    
ref|XP_001783601.1|  predicted protein                                  296   6e-92    
ref|XP_010262081.1|  PREDICTED: beta-fructofuranosidase, insolubl...    297   8e-92    
ref|XP_010062641.1|  PREDICTED: beta-fructofuranosidase, insolubl...    295   8e-91    
ref|XP_010106248.1|  hypothetical protein L484_005113                   292   7e-90    
ref|XP_006426549.1|  hypothetical protein CICLE_v10025259mg             292   7e-90    
ref|XP_006466029.1|  PREDICTED: beta-fructofuranosidase, insolubl...    292   7e-90    
ref|XP_006858327.1|  hypothetical protein AMTR_s00064p00137280          291   1e-89    
ref|XP_004141685.1|  PREDICTED: beta-fructofuranosidase, insolubl...    289   1e-89    
ref|XP_001761961.1|  predicted protein                                  290   2e-89    
dbj|BAF99809.1|  putative fructosyltransferase 3                        292   3e-89    
ref|XP_006466030.1|  PREDICTED: beta-fructofuranosidase, insolubl...    290   3e-89    
gb|KGN45520.1|  hypothetical protein Csa_7G450770                       289   1e-88    
ref|XP_006426548.1|  hypothetical protein CICLE_v10025243mg             289   1e-88    
gb|ADN34115.1|  cell wall apoplastic invertase                          283   3e-88    
ref|XP_008462456.1|  PREDICTED: beta-fructofuranosidase, insolubl...    283   3e-88    
ref|XP_010262080.1|  PREDICTED: beta-fructofuranosidase, insolubl...    285   3e-88    
ref|XP_002988348.1|  hypothetical protein SELMODRAFT_127793             286   6e-88    
ref|XP_010262079.1|  PREDICTED: beta-fructofuranosidase, insolubl...    285   3e-87    
gb|AEV46324.1|  apoplastic invertase                                    285   6e-87    
ref|XP_002991452.1|  hypothetical protein SELMODRAFT_429742             282   8e-87    
gb|AEV46325.1|  apoplastic invertase                                    284   1e-86    
gb|AEV46323.1|  apoplastic invertase                                    284   1e-86    
ref|XP_009779642.1|  PREDICTED: beta-fructofuranosidase, insolubl...    283   2e-86    
ref|XP_007215309.1|  hypothetical protein PRUPE_ppa003470mg             283   2e-86    
ref|XP_010042359.1|  PREDICTED: beta-fructofuranosidase, insolubl...    282   3e-86    
ref|XP_006845606.1|  hypothetical protein AMTR_s00019p00208020          275   3e-86    
gb|AEV46322.1|  apoplastic invertase                                    283   4e-86    
ref|XP_004249824.1|  PREDICTED: beta-fructofuranosidase, insolubl...    280   4e-86    
ref|XP_008228278.1|  PREDICTED: beta-fructofuranosidase, insolubl...    281   7e-86    
ref|XP_007024490.1|  Glycosyl hydrolases family 32 protein isoform 1    281   9e-86    
emb|CDP08275.1|  unnamed protein product                                280   3e-85    
gb|AFH77955.1|  cell wall invertase                                     280   4e-85    
gb|AEV46321.1|  apoplastic invertase                                    280   4e-85    
gb|ADN06440.1|  invertase                                               280   6e-85    
gb|AAD10959.1|  cell wall invertase                                     273   1e-84    
gb|ACF80261.1|  unknown                                                 271   1e-84    
gb|ABY81288.1|  cell-wall invertase                                     278   1e-84    
emb|CDP15449.1|  unnamed protein product                                272   2e-84    
ref|XP_009601011.1|  PREDICTED: beta-fructofuranosidase, insolubl...    278   2e-84    
gb|EPS71507.1|  hypothetical protein M569_03251                         276   3e-84    
gb|ADM47341.1|  apoplastic invertase                                    277   3e-84    
ref|XP_010271619.1|  PREDICTED: beta-fructofuranosidase, insolubl...    277   3e-84    
emb|CAA79676.1|  beta-fructofuranosidase                                278   3e-84    
ref|NP_001274815.1|  beta-fructofuranosidase, insoluble isoenzyme...    278   3e-84    
emb|CBI35961.3|  unnamed protein product                                277   3e-84    
ref|NP_001268208.1|  cell wall apoplastic invertase                     277   4e-84    
gb|AEV46305.1|  apoplastic invertase                                    277   5e-84    
gb|AEV46327.1|  apoplastic invertase                                    277   6e-84    
gb|AEV46326.1|  apoplastic invertase                                    277   6e-84    
ref|XP_010312228.1|  PREDICTED: beta-fructofuranosidase, insolubl...    275   6e-84    
ref|XP_009758032.1|  PREDICTED: beta-fructofuranosidase, insolubl...    276   7e-84    
gb|AEV46306.1|  apoplastic invertase                                    276   9e-84    
gb|KDP37326.1|  hypothetical protein JCGZ_06780                         276   9e-84    
ref|XP_004297549.1|  PREDICTED: beta-fructofuranosidase, insolubl...    276   1e-83    
ref|XP_008462457.1|  PREDICTED: beta-fructofuranosidase, insolubl...    271   1e-83    
gb|AAM22411.1|AF506007_1  cell-wall invertase                           275   1e-83    



>emb|CDP09916.1| unnamed protein product [Coffea canephora]
Length=682

 Score =   470 bits (1209),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 221/332 (67%), Positives = 266/332 (80%), Gaps = 2/332 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T+  GLDTS +G  +KHV+K SLDDDRNDYYA+GTY     KW PDDP
Sbjct  318  MWECVDFYPVSRTDENGLDTSDDGSGVKHVVKASLDDDRNDYYALGTYDGVRGKWIPDDP  377

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
            T+D GIGLRYDYG +YASK+FYD  K+RRV WGW+TE DSE +D+ KGWAS+Q IPRT+L
Sbjct  378  TLDVGIGLRYDYGNFYASKTFYDQEKRRRVLWGWITETDSEAADIAKGWASLQAIPRTVL  437

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGTNL+QWPVEEVEKLR     F+ VEVKPGSV+ LDVG + +LD++AEFE+DK+A
Sbjct  438  YDKKTGTNLLQWPVEEVEKLRLNGKSFDGVEVKPGSVIPLDVGSAAQLDVVAEFEIDKEA  497

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                 G+D  Y C  + GA++RG LGPFGLLV+A +D SE TP+YFYIAK T GNFKT F
Sbjct  498  KEMVNGTDAEYVCSTSGGAAERGALGPFGLLVLADNDQSEQTPVYFYIAKGTDGNFKTSF  557

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSS A DVRK  YG TVPVL+GE LSMR+LVDHSIVESF QGGRTCITSR+YPT+
Sbjct  558  CSDLSRSSKATDVRKGVYGSTVPVLEGEKLSMRVLVDHSIVESFGQGGRTCITSRVYPTN  617

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            ++ E+A+LFLFNNATDA + AS+  WQM+  +
Sbjct  618  SVHENARLFLFNNATDAKVKASIRAWQMNSAN  649



>ref|XP_011070162.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=652

 Score =   464 bits (1195),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 228/331 (69%), Positives = 261/331 (79%), Gaps = 4/331 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVD +P+S     GLDT  NGP +KHV+KTSLDDDRNDYYA+GTY   + KW PDDP
Sbjct  316  MWECVDIFPVSKIVENGLDTGENGPGVKHVVKTSLDDDRNDYYALGTYDGETGKWIPDDP  375

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLRYDYG +YASK+FYD  KKRRV WGW+ E DSE +D+QKGWASVQ IPRTIL
Sbjct  376  INDVGIGLRYDYGIFYASKTFYDQEKKRRVLWGWIKETDSENADIQKGWASVQAIPRTIL  435

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVG-KSDELDILAEFEVDKD  538
            FD KTGTN++QWPVEEVE+LR  K  F+KVE KPGS+V L VG  + +LDI+AEFEVDK 
Sbjct  436  FDKKTGTNILQWPVEEVERLRMSKKVFDKVEAKPGSIVPLHVGFATSQLDIVAEFEVDKV  495

Query  539  AFGKAAGSD-IPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKT  709
            A      +D   YSC  + GA+QRG LGPFGLLV   +  +E TP+YFYI+KDT GNFKT
Sbjct  496  ALESINDTDHTTYSCPTSHGAAQRGALGPFGLLVHTDNHQTEQTPVYFYISKDTEGNFKT  555

Query  710  FFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYP  889
            FFCADH RSS A DV K  YG TVPVL+GE LSMRILVDHSI+ESFAQGGRTCITSRIYP
Sbjct  556  FFCADHSRSSEAIDVDKAIYGSTVPVLEGEKLSMRILVDHSIIESFAQGGRTCITSRIYP  615

Query  890  TSAIGEDAKLFLFNNATDATITASVEVWQMS  982
              A+ E+A +FLFNNATDATITAS+ +WQMS
Sbjct  616  MRAVYENAGIFLFNNATDATITASLHIWQMS  646



>ref|XP_010676175.1| PREDICTED: acid beta-fructofuranosidase-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=677

 Score =   465 bits (1197),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 219/329 (67%), Positives = 261/329 (79%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S  E  GLDTS NGP++KHVLK S+DDDRNDYY +GTY E +  W PD+P
Sbjct  335  MWECVDFYPVSVAEPNGLDTSTNGPSVKHVLKASMDDDRNDYYTLGTYIEDNVTWVPDNP  394

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIGLRYDYG +YASK+FYD  KKRR+ WGW+TE DSE +D++KGWAS+QGIPRT+L
Sbjct  395  AIDVGIGLRYDYGRFYASKTFYDHEKKRRILWGWITEGDSEAADVKKGWASLQGIPRTVL  454

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KT TNL+QWPVEEVE LR     F+KVEV  GSVV LDV  + E+DI+AEF++DK+A
Sbjct  455  FDQKTRTNLVQWPVEEVETLRQNNKDFDKVEVPAGSVVPLDVSAATEIDIIAEFDIDKEA  514

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                  S+  YSC A  GA+QRG LGPFGLLV+A +D +E TP+YFY+ K  +G+FKTFF
Sbjct  515  LENLPVSEEHYSCPASKGAAQRGALGPFGLLVLANNDLAEQTPVYFYVIKTLSGSFKTFF  574

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS A DV K  YG TVPVL GE LSMRILVDHSIVE+FAQGGRTCITSR+YPT 
Sbjct  575  CTDLSRSSAATDVFKNIYGSTVPVLKGEKLSMRILVDHSIVEAFAQGGRTCITSRVYPTK  634

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI ++ KL++FNNAT AT+TAS++ WQMS
Sbjct  635  AIYKETKLYVFNNATTATVTASIKTWQMS  663



>ref|XP_011081205.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I [Sesamum 
indicum]
Length=655

 Score =   464 bits (1195),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 220/331 (66%), Positives = 263/331 (79%), Gaps = 4/331 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S  E  G+DTS NGP +KHV+KTSLDDDRNDYYA+GTY   +  W PDDP
Sbjct  320  MWECVDFYPVSEVENEGMDTSVNGPKVKHVVKTSLDDDRNDYYALGTYDSEAGIWTPDDP  379

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
            +ID GIGLRYDYG +YASK+FYD   +RR+ W W+ E DSE SD+QKGWAS+Q +PRTI+
Sbjct  380  SIDVGIGLRYDYGIFYASKTFYDKKLRRRILWSWIKETDSEKSDIQKGWASLQAVPRTIV  439

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG+N++QWPV+EVE+LR  +  F+KVEV  GSVV LDV  + +LDI+AEF+VD++A
Sbjct  440  FDMKTGSNILQWPVKEVERLRRNRIVFDKVEVTAGSVVPLDVVSTSQLDIVAEFKVDEEA  499

Query  542  FGK--AAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKT  709
              +    GSD  YSC  + GA++RG LGPFGLLV+A     E TPIYFYI+KDT GNFKT
Sbjct  500  LKRMNVNGSDSSYSCQKSGGAAERGALGPFGLLVLASKHLIEQTPIYFYISKDTKGNFKT  559

Query  710  FFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYP  889
            FFCADH RSS ANDV K+ YG TVPVL  E+LSMRILVD SIVESF QGGR+CITSR+YP
Sbjct  560  FFCADHSRSSQANDVDKEIYGSTVPVLKDETLSMRILVDRSIVESFGQGGRSCITSRVYP  619

Query  890  TSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            T    ED K+FLFNNATDA ITAS+++WQMS
Sbjct  620  TRVACEDVKIFLFNNATDARITASLQIWQMS  650



>ref|XP_010676174.1| PREDICTED: acid beta-fructofuranosidase-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
 emb|CAC81825.1| beta-fructofuranosidase [Beta vulgaris]
Length=691

 Score =   465 bits (1197),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 219/329 (67%), Positives = 261/329 (79%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S  E  GLDTS NGP++KHVLK S+DDDRNDYY +GTY E +  W PD+P
Sbjct  335  MWECVDFYPVSVAEPNGLDTSTNGPSVKHVLKASMDDDRNDYYTLGTYIEDNVTWVPDNP  394

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIGLRYDYG +YASK+FYD  KKRR+ WGW+TE DSE +D++KGWAS+QGIPRT+L
Sbjct  395  AIDVGIGLRYDYGRFYASKTFYDHEKKRRILWGWITEGDSEAADVKKGWASLQGIPRTVL  454

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KT TNL+QWPVEEVE LR     F+KVEV  GSVV LDV  + E+DI+AEF++DK+A
Sbjct  455  FDQKTRTNLVQWPVEEVETLRQNNKDFDKVEVPAGSVVPLDVSAATEIDIIAEFDIDKEA  514

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                  S+  YSC A  GA+QRG LGPFGLLV+A +D +E TP+YFY+ K  +G+FKTFF
Sbjct  515  LENLPVSEEHYSCPASKGAAQRGALGPFGLLVLANNDLAEQTPVYFYVIKTLSGSFKTFF  574

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS A DV K  YG TVPVL GE LSMRILVDHSIVE+FAQGGRTCITSR+YPT 
Sbjct  575  CTDLSRSSAATDVFKNIYGSTVPVLKGEKLSMRILVDHSIVEAFAQGGRTCITSRVYPTK  634

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI ++ KL++FNNAT AT+TAS++ WQMS
Sbjct  635  AIYKETKLYVFNNATTATVTASIKTWQMS  663



>ref|XP_006440371.1| hypothetical protein CICLE_v10019134mg [Citrus clementina]
 gb|ESR53611.1| hypothetical protein CICLE_v10019134mg [Citrus clementina]
Length=508

 Score =   456 bits (1172),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 211/329 (64%), Positives = 264/329 (80%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+STT   GLDTS+NGP +KHV+K S+DDDR+DYYAIGTY E +  W PD+P
Sbjct  130  MWECVDFYPVSTTGEHGLDTSHNGPGVKHVVKASMDDDRHDYYAIGTYHEKNVTWVPDNP  189

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+RYDYG +YASK+FYD +KKRRV WGW+ E DSE +D++KGWAS+QGIPRT+ 
Sbjct  190  EIDVGIGIRYDYGLFYASKTFYDQNKKRRVLWGWIGESDSEIADVKKGWASLQGIPRTVA  249

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPVEEV+ LR    +F+K+E+KPGSV+ LDVG + +LDI+AEFE+DK A
Sbjct  250  LDTKTGSNLLQWPVEEVDSLRLTSKEFKKIELKPGSVMPLDVGSATQLDIVAEFELDKAA  309

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K A S++ +SC++  G+++RG LGPFGLLV+A D  SE TP+YFYIAK   G+ KT+F
Sbjct  310  LEKTAESNVEFSCSSSEGSAERGALGPFGLLVLADDSLSEQTPVYFYIAKGKDGSLKTYF  369

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS ANDV K  YG  VPVL+GE  SMR+LVDHSIVE FAQGGRT ITSR+YPT 
Sbjct  370  CTDQSRSSEANDVNKSKYGSFVPVLEGEKFSMRVLVDHSIVEGFAQGGRTTITSRVYPTK  429

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A++FLFNNAT A++T+S++ WQM+
Sbjct  430  AIYGAARVFLFNNATGASVTSSLKAWQMN  458



>emb|CBI31885.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   454 bits (1167),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 208/328 (63%), Positives = 259/328 (79%), Gaps = 2/328 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVD YP+S  E  GLDTS+NGP +KHVLK SLDDD+NDYYAIGTY   S  W PD+ 
Sbjct  130  MWECVDLYPVSLKEDNGLDTSFNGPGVKHVLKASLDDDKNDYYAIGTYSLESGNWTPDNS  189

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLRYDYG +YASK+FYD +K+RR+ WGW+ E D E++D++KGWASVQ IPRT++
Sbjct  190  NLDVGIGLRYDYGKFYASKTFYDQNKQRRILWGWIGETDGESADIKKGWASVQSIPRTVV  249

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTGTN++QWPV E++ LR    KF+K+EV PGSVV L+V K+ ++DI AEFE+DK+A
Sbjct  250  FDKKTGTNILQWPVAEIKSLRKSSKKFDKLEVGPGSVVTLEVEKATQMDITAEFEIDKEA  309

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              +   SD+ YSC  + G++QRG LGPFGLL++A +   E TP+YFY+AK T G  KTFF
Sbjct  310  LKRIGESDVEYSCGTSGGSAQRGELGPFGLLLLADEGRCEQTPVYFYVAKGTDGQLKTFF  369

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSSLANDV K+ +G TVPV+ GE LSMRILVDHSI+ESFAQGGRTCITSR+YPT 
Sbjct  370  CTDESRSSLANDVDKRIFGSTVPVIKGEKLSMRILVDHSIIESFAQGGRTCITSRVYPTK  429

Query  896  AIGEDAKLFLFNNATDATITASVEVWQM  979
            AI   A+L++FNNAT A+ITAS++ W M
Sbjct  430  AIYGAAQLYVFNNATSASITASIQTWAM  457



>ref|XP_009775767.1| PREDICTED: acid beta-fructofuranosidase-like [Nicotiana sylvestris]
Length=652

 Score =   459 bits (1180),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 221/328 (67%), Positives = 255/328 (78%), Gaps = 2/328 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS NGP +KHVLK+SLDDDRNDYYA+GTY   + KW PD+P
Sbjct  317  MWECVDFYPVSKVVENGLDTSDNGPAVKHVLKSSLDDDRNDYYALGTYDAVAGKWVPDNP  376

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
            TID GIGLRYDYG +YASK+FYD  KKRRV W W+TE DSE +D+ KGWAS+Q IPRTI 
Sbjct  377  TIDVGIGLRYDYGNFYASKTFYDQEKKRRVLWAWITESDSEAADICKGWASLQPIPRTIK  436

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTG+N+I WPV EVE LR    +F+KVEVKPG+VV L+VG + +LDI+AEFEVD   
Sbjct  437  YDKKTGSNIITWPVAEVENLRFNSKEFDKVEVKPGNVVPLEVGTATQLDIMAEFEVDPKV  496

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K  GS+  Y C  + G+++RG LGPFGLLV+     SE TPIYFYIAKD  GNF TFF
Sbjct  497  LEKLEGSNATYECRSSGGSAERGALGPFGLLVLTDKGLSEQTPIYFYIAKDAAGNFTTFF  556

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS A DVRK  YG TVPVL GE LS+R LVDHSIVESFAQ GRT ITSR+YPT 
Sbjct  557  CNDLTRSSEATDVRKLIYGSTVPVLQGEKLSLRTLVDHSIVESFAQNGRTAITSRVYPTK  616

Query  896  AIGEDAKLFLFNNATDATITASVEVWQM  979
            AI EDAKL+LFNNATD TITASV++WQ+
Sbjct  617  AIYEDAKLYLFNNATDVTITASVKIWQI  644



>ref|NP_001284386.1| acid beta-fructofuranosidase-like [Cucumis melo]
 gb|ACS94417.1| acid invertase 1 [Cucumis melo]
Length=680

 Score =   459 bits (1182),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 213/329 (65%), Positives = 258/329 (78%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWEC+DF+P+S    +GLDTS NGP++KHV+KTSLDDDR+DYY++GTY E +  W PDDP
Sbjct  314  MWECLDFFPVSKAGNVGLDTSVNGPDVKHVVKTSLDDDRHDYYSLGTYDEKTATWVPDDP  373

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIGLRYDYG +YASKSF+D  K RRV WGW+ E DSE +D+QKGWASVQGIPRTIL
Sbjct  374  KIDVGIGLRYDYGIFYASKSFFDHKKGRRVLWGWIGESDSEFADVQKGWASVQGIPRTIL  433

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FDNKTGT+L+QWPVEE+E LR +   F  + ++PGSVV L++G S +LDI AEFE+DK+A
Sbjct  434  FDNKTGTHLLQWPVEEIESLRQRSHAFNNLVIQPGSVVPLEIGSSSQLDIFAEFELDKEA  493

Query  542  FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              KA  +D+ +SC    GA+ RG LGPFGLLV+A +  SEHTP+YFY+AK   G  KTFF
Sbjct  494  AAKAIETDVEFSCQTRGGAANRGALGPFGLLVLADESLSEHTPVYFYVAKGQNGTLKTFF  553

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS ANDV K  YG  VPVL+ E  S+RILVDHS+VESFAQGGRTCITSR+YPT 
Sbjct  554  CTDESRSSEANDVFKPIYGSYVPVLEDEKFSLRILVDHSVVESFAQGGRTCITSRVYPTK  613

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LF+FNNA D  ITAS+ +WQM+
Sbjct  614  AIYGAARLFVFNNAKDTNITASLTIWQMN  642



>emb|CAD19321.1| acid vacuolar invertase [Beta vulgaris]
Length=675

 Score =   459 bits (1181),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 217/329 (66%), Positives = 259/329 (79%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S  E  GLDTS N  ++KHVLK S+DDDRNDYY +GTY E +  W PD+P
Sbjct  333  MWECVDFYPVSVAEPNGLDTSTNDQSVKHVLKASMDDDRNDYYTLGTYIEDNVTWVPDNP  392

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIGLRYDYG +YASK+FYD  KKRR+ WGW+TE DSE +D++KGWAS+QGIPRT+L
Sbjct  393  AIDVGIGLRYDYGRFYASKTFYDHEKKRRILWGWITEGDSEAADVKKGWASLQGIPRTVL  452

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KT TNL+QWPVEEVE LR     F+KVEV  GSVV LDV  + E+DI+AEF++DK+A
Sbjct  453  FDQKTRTNLVQWPVEEVETLRQNNKDFDKVEVPAGSVVPLDVSAATEIDIIAEFDIDKEA  512

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                  S+  YSC A  GA+QRG LGPFGLLV+A +D +E TP+YFY+ K  +G+FKTFF
Sbjct  513  LENLPVSEEHYSCPASKGAAQRGALGPFGLLVLANNDLAEQTPVYFYVIKTLSGSFKTFF  572

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS A DV K  YG TVPVL GE LSMRILVDHSIVE+FAQGGRTCITSR+YPT 
Sbjct  573  CTDLSRSSAATDVFKNIYGSTVPVLKGEKLSMRILVDHSIVEAFAQGGRTCITSRVYPTK  632

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI ++ KL++FNNAT AT+TAS++ WQMS
Sbjct  633  AIYKETKLYVFNNATTATVTASIKTWQMS  661



>ref|XP_004147588.1| PREDICTED: acid beta-fructofuranosidase-like [Cucumis sativus]
 gb|KGN50220.1| hypothetical protein Csa_5G160230 [Cucumis sativus]
Length=685

 Score =   459 bits (1182),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 213/329 (65%), Positives = 259/329 (79%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWEC+DF+P+S    IGLDTS NGP++KHV+KTSLDDDR+DYY++GTY E +  W PD+P
Sbjct  314  MWECLDFFPVSKDGKIGLDTSVNGPDVKHVVKTSLDDDRHDYYSLGTYDEKTATWVPDNP  373

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIGLRYDYG +YASKSF+D  K RRV WGW+ E DSE +D+QKGWAS+QGIPRT+L
Sbjct  374  KIDVGIGLRYDYGLFYASKSFFDHKKGRRVLWGWIGEADSEYADVQKGWASLQGIPRTVL  433

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FDNKTGTNL+QWPVEE+E LR +   F  + + PGSVV L+VG S +LDI AEFE+DK+A
Sbjct  434  FDNKTGTNLLQWPVEEIENLRQRSHAFHNLVIHPGSVVPLEVGSSTQLDIFAEFELDKEA  493

Query  542  FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              KA  +++ +SC    GA+ RG LGPFGLLV+A +  SEHTP+YFY+AK   G  KTFF
Sbjct  494  VAKAIETNVEFSCQRRGGAAIRGALGPFGLLVLADETLSEHTPVYFYVAKGQNGTLKTFF  553

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS ANDV K  YG +VPVL+GE  S+RILVDHS+VESFAQGGRTCITSR+YPT 
Sbjct  554  CTDESRSSEANDVYKPIYGSSVPVLEGEKFSLRILVDHSVVESFAQGGRTCITSRVYPTK  613

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LF+FNNA D  ITAS+ +WQM+
Sbjct  614  AIYGAARLFVFNNAKDTNITASLTIWQMN  642



>ref|XP_004171067.1| PREDICTED: LOW QUALITY PROTEIN: acid beta-fructofuranosidase-like 
[Cucumis sativus]
Length=685

 Score =   459 bits (1181),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 213/329 (65%), Positives = 259/329 (79%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWEC+DF+P+S    IGLDTS NGP++KHV+KTSLDDDR+DYY++GTY E +  W PD+P
Sbjct  314  MWECLDFFPVSKDGKIGLDTSVNGPDVKHVVKTSLDDDRHDYYSLGTYDEKTATWVPDNP  373

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIGLRYDYG +YASKSF+D  K RRV WGW+ E DSE +D+QKGWAS+QGIPRT+L
Sbjct  374  KIDVGIGLRYDYGLFYASKSFFDHKKGRRVLWGWIGEADSEYADVQKGWASLQGIPRTVL  433

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FDNKTGTNL+QWPVEE+E LR +   F  + + PGSVV L+VG S +LDI AEFE+DK+A
Sbjct  434  FDNKTGTNLLQWPVEEIENLRQRSHAFHNLVIHPGSVVPLEVGSSTQLDIFAEFELDKEA  493

Query  542  FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              KA  +++ +SC    GA+ RG LGPFGLLV+A +  SEHTP+YFY+AK   G  KTFF
Sbjct  494  VAKAIETNVEFSCQRRGGAAIRGALGPFGLLVLADETLSEHTPVYFYVAKGQNGTLKTFF  553

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS ANDV K  YG +VPVL+GE  S+RILVDHS+VESFAQGGRTCITSR+YPT 
Sbjct  554  CTDESRSSEANDVYKPIYGSSVPVLEGEKFSLRILVDHSVVESFAQGGRTCITSRVYPTK  613

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LF+FNNA D  ITAS+ +WQM+
Sbjct  614  AIYGAARLFVFNNAKDTNITASLTIWQMN  642



>ref|XP_002303519.1| vacuolar invertase family protein [Populus trichocarpa]
 gb|EEE78498.1| vacuolar invertase family protein [Populus trichocarpa]
Length=662

 Score =   458 bits (1179),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 210/329 (64%), Positives = 264/329 (80%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP +KHV+KTSLDDDR+DYYA+GTY +   KW PD+P
Sbjct  322  MWECVDFYPVSKTGQNGLDTSVNGPQVKHVIKTSLDDDRHDYYALGTYADKVGKWYPDNP  381

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+RYDYG +YASK+FYD SK RRV WGW+ E DSE +D++KGWAS+QGIPRT++
Sbjct  382  EIDVGIGIRYDYGIFYASKTFYDQSKGRRVLWGWIGESDSEVADVKKGWASLQGIPRTVV  441

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPVEEVE LR +   F  +EVK GS V L++  + +LDI+AEFE+D+ A
Sbjct  442  LDTKTGSNLLQWPVEEVESLRLKSKNFNNIEVKAGSAVPLELDGATQLDIVAEFELDRKA  501

Query  542  FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              + A S++ +SC+   GAS RG LGPFGLLV+A DD +E+TP+YF++AK   G+ KTFF
Sbjct  502  IERTAESNVEFSCSTNGGASHRGALGPFGLLVLADDDLTEYTPVYFFVAKGNNGSLKTFF  561

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS+ANDVRK+ YG  VPVL+GE LS+RILVDHSI+ESFAQGGRTCITSR+YPT 
Sbjct  562  CTDQSRSSVANDVRKEIYGSYVPVLEGEKLSVRILVDHSIIESFAQGGRTCITSRVYPTR  621

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNAT+A +T+S+++W M+
Sbjct  622  AIYGSARLFLFNNATEAGVTSSLKIWNMN  650



>gb|ACJ04701.1| invertase 1 [Cucumis melo]
Length=665

 Score =   457 bits (1177),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 212/329 (64%), Positives = 257/329 (78%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWEC+DF+P+S    +GLDTS NGP++KHV+KTSLDDDR+DYY++GTY E +  W PDDP
Sbjct  299  MWECLDFFPVSKAGNVGLDTSVNGPDVKHVVKTSLDDDRHDYYSLGTYDEKTATWVPDDP  358

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIGLRYDYG +YASKSF+D  K RRV WGW+ E DSE +D+QKGWASVQGIPRTIL
Sbjct  359  KIDVGIGLRYDYGIFYASKSFFDHKKGRRVLWGWIGESDSEFADVQKGWASVQGIPRTIL  418

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FDNKTGT+L+QWPVEE+E LR +   F  + ++PGSVV L++G S +LDI AEFE+DK+A
Sbjct  419  FDNKTGTHLLQWPVEEIESLRQRSHAFNNLVIQPGSVVPLEIGSSSQLDIFAEFELDKEA  478

Query  542  FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              KA  +D+ +SC    GA+ RG LGPFGLLV+A +  SEHTP+YFY+AK   G  KTFF
Sbjct  479  VAKAIETDVEFSCQTRGGAANRGALGPFGLLVLADESLSEHTPVYFYVAKGQNGTLKTFF  538

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS ANDV K  YG  VPVL+    S+RILVDHS+VESFAQGGRTCITSR+YPT 
Sbjct  539  CTDESRSSEANDVFKPIYGSYVPVLEDAKFSLRILVDHSVVESFAQGGRTCITSRVYPTK  598

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LF+FNNA D  ITAS+ +WQM+
Sbjct  599  AIYGAARLFVFNNAKDTNITASLTIWQMN  627



>ref|XP_011033927.1| PREDICTED: acid beta-fructofuranosidase [Populus euphratica]
Length=661

 Score =   457 bits (1176),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 210/329 (64%), Positives = 263/329 (80%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP +KHV+KTSLDDDR+DYYA+GTY +   KW PD+P
Sbjct  321  MWECVDFYPVSKTGQNGLDTSVNGPQVKHVIKTSLDDDRHDYYALGTYADKVGKWYPDNP  380

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+RYDYG +YASK+FYD SK RRV WGW+ E DSE +D++KGWAS+QGIPRT++
Sbjct  381  EIDVGIGIRYDYGIFYASKTFYDQSKGRRVLWGWIGESDSEVADVKKGWASLQGIPRTVV  440

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPVEEVE LR +   F  +EVK GSVV L++  + +LDI+AEFE+D+ A
Sbjct  441  LDTKTGSNLLQWPVEEVESLRLKSKNFNNIEVKAGSVVPLELDGATQLDIVAEFELDRKA  500

Query  542  FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              + A S++ +SC+   GAS RG LGPFGLLV+A DD +E+TP+YF++AK   G+ KTFF
Sbjct  501  IERTAESNVEFSCSTNGGASHRGALGPFGLLVLADDDLTEYTPVYFFVAKGNNGSLKTFF  560

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS+ANDVRK  YG  VPVL+GE LS+RILVDHSI+ESFAQGGRTCITSR+YPT 
Sbjct  561  CTDQSRSSVANDVRKGIYGSNVPVLEGEKLSVRILVDHSIIESFAQGGRTCITSRVYPTR  620

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNAT+  +T+S+++W M+
Sbjct  621  AIYGAARLFLFNNATETGVTSSLKIWNMN  649



>ref|XP_008373808.1| PREDICTED: acid beta-fructofuranosidase [Malus domestica]
Length=681

 Score =   457 bits (1177),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 218/329 (66%), Positives = 263/329 (80%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP++KHV+K SLDDDRNDYY++GTY+E + KW PD+ 
Sbjct  314  MWECVDFYPVSKTSDKGLDTSVNGPDVKHVVKASLDDDRNDYYSLGTYEEKTGKWVPDNQ  373

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+RYDYG +YASK+FYD +K+RRV WGW+ E DSE +D+QKGWASVQGIPRT++
Sbjct  374  KIDVGIGIRYDYGIFYASKTFYDQNKERRVLWGWIGESDSENADMQKGWASVQGIPRTVV  433

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG+NL+QWPVEEVEKLR   + F+KVEVK GSV+ L VG + +LDI+AEFE+DK  
Sbjct  434  FDKKTGSNLLQWPVEEVEKLRLSITDFDKVEVKAGSVLPLQVGTATQLDIVAEFELDKKV  493

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                A S+  +SC  +AGAS RG LGPFGLLV+A +  SE TP+YFY+AK   GNF TFF
Sbjct  494  LESVAESNEVFSCNTSAGASHRGALGPFGLLVLADETLSEQTPVYFYVAKGPGGNFDTFF  553

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS+ANDV+KK  G  VPVL  E LS RILVDHSIVESFAQGGRT ITSR+YPT 
Sbjct  554  CADQTRSSVANDVKKKVTGSYVPVLKDEKLSARILVDHSIVESFAQGGRTTITSRVYPTK  613

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+L LFNNAT+ ++TAS++VWQM+
Sbjct  614  AIYGAARLILFNNATETSVTASLKVWQMN  642



>emb|CAA47636.1| soluble beta-fructosidase [Daucus carota]
 emb|CAA77266.1| beta-fructofuranosidase, isoform II [Daucus carota]
Length=650

 Score =   456 bits (1173),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 216/329 (66%), Positives = 258/329 (78%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS++G  +KHV+K SLDDDRNDYYAIGTY   S KW PD+P
Sbjct  309  MWECVDFYPVSKFGENGLDTSFDGVGVKHVMKASLDDDRNDYYAIGTYDPVSGKWVPDNP  368

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLRYDYG YYASK+FYD +KKRRV W W+ E DSE SD++KGWASVQGIPRTIL
Sbjct  369  ELDVGIGLRYDYGIYYASKTFYDSNKKRRVLWSWIKETDSEISDVRKGWASVQGIPRTIL  428

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG+NL+QWPVEEV KLR  K+ FE VE+  G+V+ L++G   +LDI AEFEVDK++
Sbjct  429  FDPKTGSNLLQWPVEEVNKLRLNKTVFENVEINTGAVLPLEIGSGSQLDITAEFEVDKES  488

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              +   ++  Y C    G+S RG LGPFGLL++A  D SE TP+YFYIAK + GN +TFF
Sbjct  489  LERVQETNEVYDCKNNGGSSGRGALGPFGLLILADKDLSEQTPVYFYIAKGSGGNLRTFF  548

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CADH RSS A DV K+ YG  VPVL GE L+MRILVDHSIVESF+QGGRTCITSR+YPT 
Sbjct  549  CADHSRSSKAVDVDKEIYGSVVPVLRGEKLTMRILVDHSIVESFSQGGRTCITSRVYPTK  608

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI  +AK+FLFNNAT+A I AS+ +WQM+
Sbjct  609  AIYNNAKVFLFNNATEARIIASLNIWQMN  637



>gb|ADF27780.1| soluble acid invertase 2 [Orobanche ramosa]
Length=544

 Score =   452 bits (1163),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 217/329 (66%), Positives = 253/329 (77%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYPIS     GLDTS NGP +KH +KTSLDDDRNDYY++GTY + + KW PD+P
Sbjct  194  MWECVDFYPISKIMENGLDTSDNGPGVKHAVKTSLDDDRNDYYSLGTYDDVTGKWTPDNP  253

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIGLRYDYG +YASK+FYD   KRRV WGW+ E DSE +D+QKGWAS+Q IPRTI+
Sbjct  254  EIDVGIGLRYDYGIFYASKTFYDQENKRRVLWGWIKETDSEAADIQKGWASLQAIPRTII  313

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG+NL+ WPVEEVE LR+ +    +    PGS+V L VG + +LDI+AEF VD++A
Sbjct  314  FDKKTGSNLLLWPVEEVESLRTTRKLSLRWRSPPGSIVPLAVGSASQLDIIAEFAVDQEA  373

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              +  G++  YSCT   GA+QRG LGPFGLLV    D +E T IYFYI+KDT GN KTFF
Sbjct  374  LDRLNGTNTTYSCTTSDGAAQRGALGPFGLLVHTDTDLTEQTSIYFYISKDTRGNLKTFF  433

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CADH RSS A DV K  YG  VPVL GE LSMRILVDHSIVESFAQGGRTCITSRIYPT 
Sbjct  434  CADHSRSSEATDVDKAIYGSVVPVLKGEKLSMRILVDHSIVESFAQGGRTCITSRIYPTK  493

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            A  E  ++F+FNNATDA IT S+E+WQMS
Sbjct  494  AAYEKTQIFVFNNATDAGITTSLEIWQMS  522



>gb|AAB47172.1| vacuolar invertase 2, GIN2 [Vitis vinifera=grape berries, Sultana, 
berries, Peptide, 664 aa]
Length=664

 Score =   456 bits (1173),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 209/328 (64%), Positives = 260/328 (79%), Gaps = 2/328 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVD YP+S  E  GLDTS+NGP +KHVLK SLDDD+NDYYAIGTY   S  W PD+P
Sbjct  323  MWECVDLYPVSLKEDNGLDTSFNGPGVKHVLKASLDDDKNDYYAIGTYSLESGNWTPDNP  382

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLRYDYG +YASK+FYD +K+RR+ WGW+ E D E++D++KGWASVQ IPRT++
Sbjct  383  NLDVGIGLRYDYGKFYASKTFYDQNKQRRILWGWIGETDGESADIKKGWASVQSIPRTVV  442

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTGTN++QWPV E++ LR    KF+K+EV PGSVV L+V K+ ++DI AEFE+DK+A
Sbjct  443  FDKKTGTNILQWPVAEIKSLRKSSKKFDKLEVGPGSVVTLEVEKATQMDITAEFEIDKEA  502

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              +   SD+ YSC  + G++QRG LGPFGLL++A +   E TP+YFY+AK T G  KTFF
Sbjct  503  LKRIGESDVEYSCRTSGGSAQRGELGPFGLLLLADEGRCEQTPVYFYVAKGTDGQLKTFF  562

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSSLANDV K+ +G TVPV+ GE LSMRILVDHSI+ESFAQGGRTCITSR+YPT 
Sbjct  563  CTDESRSSLANDVDKRIFGSTVPVIKGEKLSMRILVDHSIIESFAQGGRTCITSRVYPTK  622

Query  896  AIGEDAKLFLFNNATDATITASVEVWQM  979
            AI   A+L++FNNAT A+ITAS++ W M
Sbjct  623  AIYGAAQLYVFNNATSASITASIQTWAM  650



>ref|XP_006355490.1| PREDICTED: acid beta-fructofuranosidase-like [Solanum tuberosum]
Length=653

 Score =   455 bits (1171),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 213/332 (64%), Positives = 258/332 (78%), Gaps = 2/332 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS NGP +KHVLK+SLDDDRNDYYA+GTY   + KW PD+P
Sbjct  318  MWECVDFYPVSKIVENGLDTSENGPAVKHVLKSSLDDDRNDYYALGTYDAGAGKWVPDNP  377

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIGLRYDYG +YASK+FYD  KKRRV W W+ E DSE +D+ +GWAS+Q IPRTI 
Sbjct  378  IIDVGIGLRYDYGNFYASKTFYDQEKKRRVLWAWIKETDSEAADICRGWASLQSIPRTIK  437

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTG+N+I WPV EVE LRS  ++F KV VKPGS+V L+VG + +LDI+AEFE+D++ 
Sbjct  438  YDKKTGSNIITWPVAEVENLRSNNNEFNKVVVKPGSIVPLEVGSATQLDIMAEFEIDQNV  497

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K  GS+  Y C  + G+ +RG LGPFGLLV+  +  SE TPIYFYIAKD TGNF TFF
Sbjct  498  LKKVDGSNATYDCIKSGGSGERGALGPFGLLVLTDNSLSEQTPIYFYIAKDLTGNFNTFF  557

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS A DVRK  YG TVPVL GE LS+R LVDHSIVESFAQ GRT ITSR+YPT 
Sbjct  558  CNDLTRSSEATDVRKLIYGSTVPVLQGEKLSLRTLVDHSIVESFAQNGRTAITSRVYPTK  617

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            AI E+AK++LFNNATD ++TA++++WQM+  +
Sbjct  618  AIYENAKIYLFNNATDISVTATIKIWQMNSAN  649



>ref|XP_009630517.1| PREDICTED: acid beta-fructofuranosidase-like [Nicotiana tomentosiformis]
Length=652

 Score =   455 bits (1171),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 218/332 (66%), Positives = 256/332 (77%), Gaps = 2/332 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS NGP +KHVLK+SLDDDRNDYYA+GTY   + KW PD+P
Sbjct  317  MWECVDFYPVSKVVENGLDTSDNGPAVKHVLKSSLDDDRNDYYALGTYDAVAGKWIPDNP  376

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
            TID GIGLRYDYG +YASK+FYD  KKRRV W W+TE DSE +D+ KGWAS+Q IPRTI 
Sbjct  377  TIDVGIGLRYDYGNFYASKTFYDQEKKRRVLWAWITEGDSEAADICKGWASLQPIPRTIK  436

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTG+N+I WPV EVE LR    +F+KVEVKPGSV  L+VG + +LDI+AEFEVD   
Sbjct  437  YDKKTGSNIITWPVAEVENLRLNSKEFDKVEVKPGSVFPLEVGTATQLDIMAEFEVDPKV  496

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              +  G++  Y C  + G+++RG LGPFGLLV+     SE TPIYFYIAKD  GNF TFF
Sbjct  497  LERLEGNNATYECRSSGGSAERGALGPFGLLVLTDKGLSEQTPIYFYIAKDAAGNFTTFF  556

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS A DVRK  YG TVPVL GE LS+R LVDHSIVESFAQ GRT ITSR+YPT 
Sbjct  557  CNDLTRSSEATDVRKLIYGSTVPVLQGEKLSLRTLVDHSIVESFAQSGRTAITSRVYPTK  616

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            AI EDAKL+LFNNATD +ITAS+++WQM+  +
Sbjct  617  AIYEDAKLYLFNNATDVSITASLKIWQMNSAN  648



>ref|XP_009350311.1| PREDICTED: acid beta-fructofuranosidase-like [Pyrus x bretschneideri]
Length=680

 Score =   455 bits (1171),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 216/329 (66%), Positives = 263/329 (80%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP++KHV+K SLDDDRNDYY++G+Y+E + KW PD+ 
Sbjct  314  MWECVDFYPVSKTSDKGLDTSVNGPDVKHVVKASLDDDRNDYYSLGSYEEKTGKWVPDNQ  373

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+RYDYG +YASK+FYD +K+RRV WGW+ E DSE +D+QKGWASVQGIPRT++
Sbjct  374  KIDVGIGIRYDYGIFYASKTFYDQNKERRVLWGWIGESDSENADMQKGWASVQGIPRTVV  433

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG+NL+QWPVEEVEKLR   + F+KVEVK GSV+ L V  + +LDI+AEFE+DK  
Sbjct  434  FDKKTGSNLLQWPVEEVEKLRLSITDFDKVEVKAGSVLPLQVVTATQLDIVAEFELDKKV  493

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                A S+  +SC  +AG S RG LGPFGLLV+A +  SE TP+YFY+AK   GNF TFF
Sbjct  494  LESVAESNEVFSCNTSAGGSHRGALGPFGLLVLADETLSEQTPVYFYVAKGPGGNFDTFF  553

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS+ANDV+KK  G  VPVL  E LS+RILVDHSIVESFAQGGRT IT+R+YPT 
Sbjct  554  CADQTRSSVANDVKKKVTGSYVPVLKDEKLSVRILVDHSIVESFAQGGRTTITTRVYPTK  613

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNATD ++TAS++VWQM+
Sbjct  614  AIYGAARLFLFNNATDTSVTASLKVWQMN  642



>ref|NP_001234069.1| invertase [Solanum lycopersicum]
 emb|CAJ19056.1| invertase [Solanum lycopersicum]
Length=652

 Score =   454 bits (1168),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 214/332 (64%), Positives = 258/332 (78%), Gaps = 2/332 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS NGP +KHVLK+SLDDDRNDYYA+GTY   + KW PD+P
Sbjct  317  MWECVDFYPVSKIAENGLDTSENGPAVKHVLKSSLDDDRNDYYALGTYNAGAGKWVPDNP  376

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIGLRYDYG +YASKSFYD  KKRRV W W+ E DSE +D+ +GWAS+Q IPRTI 
Sbjct  377  IIDVGIGLRYDYGNFYASKSFYDQEKKRRVLWAWIKETDSEAADICRGWASLQPIPRTIQ  436

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTG+NLI WPV EV+ LRS  ++F KV VKPGS+V L+VG + +LDI+AEFEVD++ 
Sbjct  437  YDKKTGSNLITWPVAEVDNLRSNNNEFNKVVVKPGSIVPLEVGSATQLDIMAEFEVDQNM  496

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K  GS+  Y C  + G+ +RG LGPFGLLV+  +  SE TPIYFYIAKD TGNF TFF
Sbjct  497  LKKVDGSNATYDCIKSGGSGERGALGPFGLLVLTDNSLSEQTPIYFYIAKDLTGNFNTFF  556

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RS  A+DVRK  YG TVPVL GE LS+R LVDHSIVESFAQ GRT ITSR+YPT 
Sbjct  557  CNDLTRSFEASDVRKLIYGSTVPVLQGEKLSLRTLVDHSIVESFAQNGRTAITSRVYPTK  616

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            AI E+AK++LFNNATD ++TA++++WQM+  +
Sbjct  617  AIYENAKIYLFNNATDISVTATIKIWQMNSAN  648



>ref|XP_002532576.1| Acid beta-fructofuranosidase precursor, putative [Ricinus communis]
 gb|EEF29810.1| Acid beta-fructofuranosidase precursor, putative [Ricinus communis]
Length=649

 Score =   454 bits (1168),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 210/329 (64%), Positives = 259/329 (79%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S +   GLDTS NGP +KHVLKTSLDDDR+DYYA+G Y E +  W PD+P
Sbjct  310  MWECVDFYPVSKSSANGLDTSANGPQVKHVLKTSLDDDRHDYYALGNYNEKNGTWYPDNP  369

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             IDTGIG+RYDYG +YASK+FYD +K RR+ WGW+ E DSE +D++KGWAS+Q IPRT+L
Sbjct  370  EIDTGIGIRYDYGIFYASKTFYDQNKGRRLLWGWIGESDSEAADVKKGWASLQSIPRTVL  429

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPVEEVE LR + ++FEK+EVKPGSVV L +  + +LDI+AEFE+DK  
Sbjct  430  LDTKTGSNLLQWPVEEVESLRLRSNEFEKLEVKPGSVVPLHIDAATQLDIVAEFELDKKV  489

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
               AA S+  +SC  + GA+ R  LGPFGLLV+A +  +E TP+YFY+AK   G  KTFF
Sbjct  490  LANAAESNEEFSCKTSRGAAHRNALGPFGLLVLADESLAEQTPVYFYVAKGKNGTLKTFF  549

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS ANDV K+ YG  VPVL+GE  S+RILVDHSI+ESFAQGGRTCITSR+YPT 
Sbjct  550  CTDQKRSSAANDVNKQIYGNFVPVLEGEKFSVRILVDHSIIESFAQGGRTCITSRVYPTR  609

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   AKLFLFNNA +A +TAS+++WQM+
Sbjct  610  AIYGAAKLFLFNNALEANVTASLKIWQMN  638



>ref|NP_001275813.1| acid beta-fructofuranosidase-like [Citrus sinensis]
 ref|XP_006440372.1| hypothetical protein CICLE_v10019134mg [Citrus clementina]
 dbj|BAF34362.1| beta-fructofuranosidase [Citrus sinensis]
 gb|ESR53612.1| hypothetical protein CICLE_v10019134mg [Citrus clementina]
Length=687

 Score =   455 bits (1170),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 211/329 (64%), Positives = 264/329 (80%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+STT   GLDTS+NGP +KHV+K S+DDDR+DYYAIGTY E +  W PD+P
Sbjct  309  MWECVDFYPVSTTGEHGLDTSHNGPGVKHVVKASMDDDRHDYYAIGTYHEKNVTWVPDNP  368

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+RYDYG +YASK+FYD +KKRRV WGW+ E DSE +D++KGWAS+QGIPRT+ 
Sbjct  369  EIDVGIGIRYDYGLFYASKTFYDQNKKRRVLWGWIGESDSEIADVKKGWASLQGIPRTVA  428

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPVEEV+ LR    +F+K+E+KPGSV+ LDVG + +LDI+AEFE+DK A
Sbjct  429  LDTKTGSNLLQWPVEEVDSLRLTSKEFKKIELKPGSVMPLDVGSATQLDIVAEFELDKAA  488

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K A S++ +SC++  G+++RG LGPFGLLV+A D  SE TP+YFYIAK   G+ KT+F
Sbjct  489  LEKTAESNVEFSCSSSEGSAERGALGPFGLLVLADDSLSEQTPVYFYIAKGKDGSLKTYF  548

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS ANDV K  YG  VPVL+GE  SMR+LVDHSIVE FAQGGRT ITSR+YPT 
Sbjct  549  CTDQSRSSEANDVNKSKYGSFVPVLEGEKFSMRVLVDHSIVEGFAQGGRTTITSRVYPTK  608

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A++FLFNNAT A++T+S++ WQM+
Sbjct  609  AIYGAARVFLFNNATGASVTSSLKAWQMN  637



>ref|XP_009343902.1| PREDICTED: acid beta-fructofuranosidase-like [Pyrus x bretschneideri]
 ref|XP_009343903.1| PREDICTED: acid beta-fructofuranosidase-like [Pyrus x bretschneideri]
Length=681

 Score =   455 bits (1170),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 216/329 (66%), Positives = 263/329 (80%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP++KHV+K SLDDDRNDYY++G+Y+E + KW PD+ 
Sbjct  314  MWECVDFYPVSKTSDKGLDTSVNGPDVKHVVKASLDDDRNDYYSLGSYEEKTGKWVPDNQ  373

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+RYDYG +YASK+FYD +K+RRV WGW+ E DSE +D+QKGWASVQGIPRT++
Sbjct  374  KIDVGIGIRYDYGIFYASKTFYDQNKERRVLWGWIGESDSENADMQKGWASVQGIPRTVV  433

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG+NLIQWPVEEVEKLR   + F+KVEVK GSV+ L V  + +LDI+AEFE+DK  
Sbjct  434  FDKKTGSNLIQWPVEEVEKLRLSITDFDKVEVKAGSVLPLQVVTATQLDIVAEFELDKKV  493

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                A S+  +SC  +AG S RG LGPFGLLV+A +  SE TP+YFY+AK   GNF TFF
Sbjct  494  LESVAESNEVFSCNTSAGGSHRGALGPFGLLVLADETLSEQTPVYFYVAKGPGGNFDTFF  553

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS+ANDV+KK  G  VPVL  E LS+RILVDHSIVESFAQGGRT IT+R+YPT 
Sbjct  554  CADQTRSSVANDVKKKVTGSYVPVLKDEKLSVRILVDHSIVESFAQGGRTTITTRVYPTK  613

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNAT+ ++TAS++VWQM+
Sbjct  614  AIYGAARLFLFNNATEISVTASLKVWQMN  642



>dbj|BAF35859.1| soluble acid invertase [Pyrus pyrifolia var. culta]
 dbj|BAG30920.1| soluble acid invertase [Pyrus pyrifolia]
Length=681

 Score =   454 bits (1167),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 216/329 (66%), Positives = 262/329 (80%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP++KHV+K SLDDDRNDYY++G+Y+E + KW PD+ 
Sbjct  314  MWECVDFYPVSKTSDKGLDTSVNGPDVKHVVKASLDDDRNDYYSLGSYEEKTGKWVPDNQ  373

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+RYDYG +YASK+FYD +K+RRV WGW+ E DSE +D+QKGWASVQGIPRT+L
Sbjct  374  KIDVGIGIRYDYGIFYASKTFYDQNKERRVLWGWIGESDSENADMQKGWASVQGIPRTVL  433

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG+NLIQWPVEEVE LR   + F+KVEVK GSV+ L V  + +LDI+AEFE+DK  
Sbjct  434  FDKKTGSNLIQWPVEEVENLRLSITDFDKVEVKAGSVLPLQVVTATQLDIVAEFELDKKV  493

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                A S+  +SC  +AG S RG LGPFGLLV+A +  SE TP+YFY+AK   GNF TFF
Sbjct  494  LESVAESNEVFSCNTSAGGSHRGALGPFGLLVLADETLSEQTPVYFYVAKGPGGNFDTFF  553

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS+ANDV+KK  G  VPVL  E LS+RILVDHSIVESFAQGGRT IT+R+YPT 
Sbjct  554  CADQTRSSVANDVKKKVTGSYVPVLKDEKLSVRILVDHSIVESFAQGGRTTITTRVYPTK  613

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNAT+ ++TAS++VWQM+
Sbjct  614  AIYGAARLFLFNNATEISVTASLKVWQMN  642



>ref|XP_002272809.3| PREDICTED: acid beta-fructofuranosidase-like [Vitis vinifera]
Length=661

 Score =   452 bits (1163),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 208/328 (63%), Positives = 259/328 (79%), Gaps = 2/328 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVD YP+S  E  GLDTS+NGP +KHVLK SLDDD+NDYYAIGTY   S  W PD+ 
Sbjct  320  MWECVDLYPVSLKEDNGLDTSFNGPGVKHVLKASLDDDKNDYYAIGTYSLESGNWTPDNS  379

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLRYDYG +YASK+FYD +K+RR+ WGW+ E D E++D++KGWASVQ IPRT++
Sbjct  380  NLDVGIGLRYDYGKFYASKTFYDQNKQRRILWGWIGETDGESADIKKGWASVQSIPRTVV  439

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTGTN++QWPV E++ LR    KF+K+EV PGSVV L+V K+ ++DI AEFE+DK+A
Sbjct  440  FDKKTGTNILQWPVAEIKSLRKSSKKFDKLEVGPGSVVTLEVEKATQMDITAEFEIDKEA  499

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              +   SD+ YSC  + G++QRG LGPFGLL++A +   E TP+YFY+AK T G  KTFF
Sbjct  500  LKRIGESDVEYSCGTSGGSAQRGELGPFGLLLLADEGRCEQTPVYFYVAKGTDGQLKTFF  559

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSSLANDV K+ +G TVPV+ GE LSMRILVDHSI+ESFAQGGRTCITSR+YPT 
Sbjct  560  CTDESRSSLANDVDKRIFGSTVPVIKGEKLSMRILVDHSIIESFAQGGRTCITSRVYPTK  619

Query  896  AIGEDAKLFLFNNATDATITASVEVWQM  979
            AI   A+L++FNNAT A+ITAS++ W M
Sbjct  620  AIYGAAQLYVFNNATSASITASIQTWAM  647



>ref|XP_007039920.1| Glycosyl hydrolases family 32 protein [Theobroma cacao]
 gb|EOY24421.1| Glycosyl hydrolases family 32 protein [Theobroma cacao]
Length=766

 Score =   455 bits (1171),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 211/329 (64%), Positives = 265/329 (81%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S TE  GL+TS NGP +KHV+K SLDDDR+DYYAIGTY E +  W PD P
Sbjct  425  MWECVDFFPVSKTEENGLETSVNGPGVKHVVKASLDDDRHDYYAIGTYHEKNGTWIPDQP  484

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+RYDYG +YA+K+FYD +K RRV WGW+ E DSE +D+QKGWAS+Q IPRTIL
Sbjct  485  EIDVGIGIRYDYGIFYAAKTFYDQNKNRRVLWGWIGESDSEAADVQKGWASLQSIPRTIL  544

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FDNKTGT+L+QWPVEE E LR + ++F +V ++ G+VV LDVG + +LDI+AEF +DK+A
Sbjct  545  FDNKTGTHLLQWPVEETESLRLKSNEFNQVTLQAGTVVPLDVGSATQLDIMAEFVIDKEA  604

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              KA GS+  +SC  + GA++RG LGPFGLL +A +  SE TP+YFYIAK + GN KTFF
Sbjct  605  LEKATGSNETFSCGTSGGAAERGALGPFGLLALADESLSEKTPVYFYIAKGSDGNLKTFF  664

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS A+DV K  YG  VPVL+GE+LS+R+LVDHSI+ESFAQGGRT ITSR+YPT 
Sbjct  665  CNDQSRSSAASDVNKLIYGSFVPVLEGENLSLRMLVDHSIIESFAQGGRTVITSRVYPTK  724

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   AK+FLFNNAT+A++TAS+++WQM+
Sbjct  725  AIYGAAKVFLFNNATEASVTASLKIWQMN  753



>dbj|BAB82419.1| acid invertase [Citrus unshiu]
Length=687

 Score =   451 bits (1161),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 210/329 (64%), Positives = 263/329 (80%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+STT   GLDTS+NG  +KHV+K S+DDDR+DYYAIGTY E +  W PD+P
Sbjct  309  MWECVDFYPVSTTGEHGLDTSHNGLGVKHVVKASMDDDRHDYYAIGTYHEKNVTWVPDNP  368

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+RYDYG +YASK+FYD +KKRRV WGW+ E DSE +D++KGWAS+QGIPRT+ 
Sbjct  369  EIDVGIGIRYDYGLFYASKTFYDQNKKRRVLWGWIGESDSEIADVKKGWASLQGIPRTVA  428

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPVEEV+ LR    +F+K+E+KPGSV+ LDVG + +LDI+AEFE+DK A
Sbjct  429  LDTKTGSNLLQWPVEEVDSLRLTSKEFKKIELKPGSVMPLDVGSATQLDIVAEFELDKAA  488

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K A S++ +SC++  G+++RG LGPFGLLV+A D  SE TP+YFYIAK   G+ KT+F
Sbjct  489  LEKTAESNVEFSCSSSEGSAERGALGPFGLLVLADDSLSEQTPVYFYIAKGKDGSLKTYF  548

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS ANDV K  YG  VPVL+GE  SMR+LVDHSIVE FAQGGRT ITSR+YPT 
Sbjct  549  CTDQSRSSEANDVNKSKYGSFVPVLEGEKFSMRVLVDHSIVEGFAQGGRTTITSRVYPTK  608

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A++FLFNNAT A++T+S++ WQM+
Sbjct  609  AIYGAARVFLFNNATGASVTSSLKAWQMN  637



>ref|XP_004298661.1| PREDICTED: acid beta-fructofuranosidase-like [Fragaria vesca 
subsp. vesca]
Length=694

 Score =   450 bits (1157),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 207/329 (63%), Positives = 263/329 (80%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWEC+DFYP+S T   GLDTS NG ++KHV+KTSLDDDRNDYYA+G+Y E + KW PD+P
Sbjct  326  MWECIDFYPVSKTSDKGLDTSENGADVKHVIKTSLDDDRNDYYALGSYNEQTGKWVPDNP  385

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+RYDYG +YASK+FYD +K+RRV WGW+ E DSE +D+QKGWAS+QGIPRT+L
Sbjct  386  NIDVGIGIRYDYGKFYASKTFYDQNKQRRVLWGWIGESDSENADVQKGWASLQGIPRTVL  445

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG+NL+QWPVEE+EKLR   + F++V+VK GSVV LDVG + +LDI+AEFE+D+  
Sbjct  446  FDQKTGSNLLQWPVEEIEKLRLNMNNFDRVQVKAGSVVPLDVGTATQLDIVAEFELDQTV  505

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                A S+  +SC  + GA +RG LGPFGLLV+A D  +E TP+YFY+ K + G   T+F
Sbjct  506  LESTAESNEEFSCQTSGGAGKRGALGPFGLLVLADDGLTERTPVYFYVVKGSGGTVNTYF  565

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RS++ANDV K+  G  VPVL GE LS+RILVDHSI++SFAQGGRT IT+R+YPT 
Sbjct  566  CADQTRSTVANDVVKQVSGSYVPVLKGEKLSVRILVDHSIIDSFAQGGRTTITTRVYPTQ  625

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNAT+ ++TAS++VWQM+
Sbjct  626  AIYGAARLFLFNNATETSVTASLQVWQMN  654



>gb|AEY79730.1| vacuolar invertase isoform 2 [Rosa hybrid cultivar]
Length=640

 Score =   447 bits (1151),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 207/329 (63%), Positives = 262/329 (80%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWEC+DFYP+S T   GLDTS NG ++KHV+K SLDDDRNDYYA+G+Y E + KW PD+ 
Sbjct  272  MWECIDFYPVSKTSDKGLDTSQNGADVKHVMKASLDDDRNDYYALGSYNEKTGKWVPDNQ  331

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+RYDYG +YASK+FYD +K+RRV WGW+ E DSE +D++KGWAS+QGIPRT+L
Sbjct  332  KIDVGIGIRYDYGKFYASKTFYDQNKQRRVLWGWIGESDSENADVKKGWASLQGIPRTVL  391

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG+NL+QWPVEE+EKLR  K  F+KV+VK GSVV LDVG + +LDI+AEF++D+  
Sbjct  392  FDQKTGSNLLQWPVEEIEKLRLNKKNFDKVQVKAGSVVPLDVGTATQLDIVAEFQLDQKV  451

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
               AA ++  +SC  + GA++RG LGPFGLLV+A D  SE TP+YFY+ K + G   T+F
Sbjct  452  VESAAETNEEFSCQTSGGAAKRGALGPFGLLVLADDSLSERTPVYFYVVKGSGGTVNTYF  511

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS+A DV K+  G  VPVL GE+LS+RILVDHSI+ESFAQGGRT IT+R+YPT 
Sbjct  512  CADQTRSSVATDVVKQVSGSYVPVLKGETLSLRILVDHSIIESFAQGGRTTITTRVYPTQ  571

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNATD + TAS+++WQM+
Sbjct  572  AIYGAARLFLFNNATDTSFTASLQIWQMN  600



>sp|P80065.2|INVB_DAUCA RecName: Full=Beta-fructofuranosidase, soluble isoenzyme I; AltName: 
Full=Invertase; AltName: Full=Saccharase; AltName: Full=Sucrose 
hydrolase; Flags: Precursor [Daucus carota]
 emb|CAA53097.1| beta-fructofuranosidase [Daucus carota]
 emb|CAA77267.1| beta-fructofuranosidase, isoform I [Daucus carota]
Length=661

 Score =   447 bits (1150),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 213/329 (65%), Positives = 261/329 (79%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP +KHVLK+SLDDDR+DYYA+GTY   ++KW PD+P
Sbjct  321  MWECVDFYPVSVTGSNGLDTSVNGPGVKHVLKSSLDDDRHDYYALGTYDPINDKWTPDNP  380

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYD  K+RR+ WGW+ E DSE++DL KGWASVQ IPRT++
Sbjct  381  ELDVGIGLRLDYGKYYASKTFYDQDKERRLLWGWIGETDSESADLLKGWASVQSIPRTVV  440

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTGTN++QWPV+EVE LRS+  + + VE+KPGS+V L +  + +LDI+A FEVD++A
Sbjct  441  FDKKTGTNILQWPVKEVESLRSRSYEIDDVELKPGSLVPLKISSAAQLDIVASFEVDEEA  500

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
            F     +D  Y+CTA  GA+ RG LGPFG+LV+A D  SE TP+YFYIAK   GN KT+F
Sbjct  501  FKGTYEADASYNCTASEGAAGRGILGPFGILVLADDPLSELTPVYFYIAKGVDGNAKTYF  560

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS A+DV K+ YG  VPVL GESLSMR+LVDHSIVESFAQGGRT ITSR+YPT 
Sbjct  561  CADQSRSSTASDVDKEVYGSDVPVLHGESLSMRLLVDHSIVESFAQGGRTVITSRVYPTR  620

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A++FLFNNAT  ++TASV+ WQM+
Sbjct  621  AIYSAARVFLFNNATGVSVTASVKAWQMA  649



>gb|AFS17280.1| acid vacuolar invertase [Amaranthus cruentus/Amaranthus hypocondriacus 
mixed library]
Length=658

 Score =   447 bits (1149),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 209/329 (64%), Positives = 253/329 (77%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYPIS  E  G+DTS N P +KHVLK  +DDDRNDYYA+GTY E +  W PD+ 
Sbjct  323  MWECVDFYPISKAESNGVDTSINNPLVKHVLKAGMDDDRNDYYALGTYHEDTGTWVPDNA  382

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID G GLRYDYG +YASK+FYD  KKRR+ WGW+TE DSE +D++KGWAS+Q +PRT+L
Sbjct  383  AIDVGYGLRYDYGRFYASKTFYDQEKKRRILWGWITEADSEAADVKKGWASIQALPRTVL  442

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KT  NL+QWPVEEVE LR    +F+ +EV  GSVVHL V  + E+D++AEF+++K+A
Sbjct  443  YDQKTKANLVQWPVEEVETLRKNIKEFDNIEVPAGSVVHLYVSSATEIDVVAEFDIEKEA  502

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K   S+  +SC A  GASQRG LGPFGLLV+A D  SE TP+YFY+ K +  NFKTFF
Sbjct  503  LEKLPVSEENFSCPASKGASQRGALGPFGLLVLADDQLSEQTPVYFYVFKTSHTNFKTFF  562

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS+A DV K  YG  VPVL+ E LSMR+LVDHSI+E+FAQGGRTCITSR+YPT 
Sbjct  563  CTDLSRSSIAPDVAKDIYGSDVPVLNDEKLSMRVLVDHSIIEAFAQGGRTCITSRVYPTK  622

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI  DAKL LFNNAT A++TASV+ WQMS
Sbjct  623  AIYRDAKLHLFNNATAASVTASVKTWQMS  651



>ref|XP_009401797.1| PREDICTED: beta-fructofuranosidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=667

 Score =   447 bits (1149),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 209/331 (63%), Positives = 258/331 (78%), Gaps = 4/331 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDT-SYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDD  178
            MWECVDFYP+ST   +GLDT + +GP +KHVLK S+DD+R+DYYAIGTY   S  W PDD
Sbjct  316  MWECVDFYPVSTESAVGLDTTAASGPGVKHVLKASMDDNRHDYYAIGTYVAASNSWVPDD  375

Query  179  PTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTI  358
            P  D GIGLRYDYG YYASK+FYDP K+RRV WGW+ E DSE +DL+KGWAS+Q +PRT+
Sbjct  376  PEKDVGIGLRYDYGKYYASKTFYDPVKERRVLWGWIGETDSERTDLRKGWASLQTVPRTV  435

Query  359  LFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
            +FD KTG+NL+QWPVEEVE LR    +F  + +  GSVV LD+GK+ +LDI+AEF VD+ 
Sbjct  436  VFDQKTGSNLLQWPVEEVESLRLSSQEFSNISITAGSVVPLDIGKATQLDIVAEFSVDEA  495

Query  539  AFGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
            A   A G+D+ Y+C+   GA+QRG +GPFGLLV+A +D SE T +YFY+A+ T G+  T 
Sbjct  496  ALAGAIGADVGYNCSTSRGAAQRGVIGPFGLLVLADEDLSEQTAVYFYVARATDGSLSTH  555

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FC D LRSS AND+ K+ YG  VPVLDGE+ S+RILVDHSIVESFAQGGRTCITSR+YPT
Sbjct  556  FCHDELRSSEANDLVKRVYGSLVPVLDGETFSLRILVDHSIVESFAQGGRTCITSRVYPT  615

Query  893  SAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
             AI   A+LFL NNAT   +TA SV++WQM+
Sbjct  616  KAIFSRARLFLLNNATGVDVTATSVKIWQMN  646



>emb|CAA53098.1| beta-fructofuranosidase [Daucus carota]
Length=661

 Score =   446 bits (1147),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 212/329 (64%), Positives = 261/329 (79%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP +KHVLK+SLDDDR+DYYA+GTY   ++KW PD+P
Sbjct  321  MWECVDFYPVSVTVSNGLDTSVNGPGVKHVLKSSLDDDRHDYYALGTYDPINDKWTPDNP  380

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYD  K+RR+ WGW+ E D+E++DL KGWASVQ IPRT++
Sbjct  381  ELDVGIGLRLDYGKYYASKTFYDQDKERRLLWGWIGESDNESTDLLKGWASVQSIPRTVV  440

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTGTN++QWPV+EVE LRS+  +   VE+KPGS+V L +  + +LDI+A FEVD++A
Sbjct  441  FDKKTGTNILQWPVKEVESLRSRSYEINDVELKPGSLVPLKISSAAQLDIVASFEVDEEA  500

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
            F +   +D  Y+CTA  GA+ RG LGPFG+LV+A D  SE TP+YFYIAK   GN KT+F
Sbjct  501  FKRTYEADASYNCTASEGAAGRGILGPFGILVLADDPLSELTPVYFYIAKGVDGNAKTYF  560

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS A+DV K+ YG  VPVL GESLSMR+LVDHSIVESFAQGGRT ITSR+YPT 
Sbjct  561  CADQSRSSTASDVDKEVYGSDVPVLPGESLSMRLLVDHSIVESFAQGGRTVITSRVYPTR  620

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A++FLFNNAT  ++TASV+ WQM+
Sbjct  621  AIYSAARVFLFNNATGVSVTASVKAWQMA  649



>pdb|3UGF|A Chain A, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis
 pdb|3UGF|B Chain B, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis
 pdb|3UGG|A Chain A, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis 
In Complex With 1-Kestose
 pdb|3UGG|B Chain B, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis 
In Complex With 1-Kestose
 pdb|3UGH|A Chain A, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis 
In Complex With 6-Kestose
 pdb|3UGH|B Chain B, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis 
In Complex With 6-Kestose
Length=546

 Score =   441 bits (1135),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 214/341 (63%), Positives = 261/341 (77%), Gaps = 5/341 (1%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             +WECVD YP+STT   GL+TS NGP +KHVLK S+D+ + DYYAIGTY   + KW PD+P
Sbjct  209   LWECVDLYPVSTTGEKGLETSVNGPKVKHVLKASIDEQQRDYYAIGTYDLGTNKWTPDNP  268

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
               D GIGLRYD+G YYASK+FYDP K+RRV W W  E+DSE +D +KGWA+VQ IPRT+L
Sbjct  269   EEDVGIGLRYDWGKYYASKTFYDPKKQRRVVWAWTKELDSEVADREKGWANVQTIPRTVL  328

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
              D KTGTN++ WPVEEVE LR    +F KV+   GSVV LDVG + +LDI+AEFE+DK+A
Sbjct  329   LDQKTGTNVLLWPVEEVESLRLSSKEFSKVKAGAGSVVPLDVGTATQLDIIAEFEIDKEA  388

Query  542   FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                   +D+ Y+CT   GA++RG LGPFGLLV A ++ SE TP+YFYIAK T GNFKTFF
Sbjct  389   LEGTIEADMGYNCTTSGGAAERGVLGPFGLLVSATENLSEQTPVYFYIAKGTDGNFKTFF  448

Query  716   CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
             C D  RSS A+DV K+  G TVPVLDGE  +MR+LVDHSIVESFAQGGR+CITSR+YPT 
Sbjct  449   CLDESRSSKASDVSKQVKGFTVPVLDGEKFTMRLLVDHSIVESFAQGGRSCITSRVYPTE  508

Query  896   AIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNFNK  1018
             AI   AKLFLFNNAT A+ITAS+++W   EM+SA    F++
Sbjct  509   AIYGAAKLFLFNNATGASITASLKIW---EMNSAFIQPFHR  546



>ref|XP_010259020.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
isoform X1 [Nelumbo nucifera]
Length=664

 Score =   445 bits (1145),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 211/329 (64%), Positives = 258/329 (78%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+STTE IGL+TS  GP +KHVLK SLDD + DYYA+GTY   ++ W PD+P
Sbjct  323  MWECVDFYPVSTTEEIGLNTSAFGPGVKHVLKASLDDSKKDYYALGTYYVENDTWIPDNP  382

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIG+RYDYG YYASK+FYD  K+RRV +GW+ E D+E  D++KGWASVQ IPR +L
Sbjct  383  VADVGIGIRYDYGKYYASKTFYDQHKQRRVLFGWIGETDNEAEDIKKGWASVQSIPRVVL  442

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG+NL+QWPVEEVE LR   ++F+KV V  GSVV LDVG + +LDI AEFE+D + 
Sbjct  443  FDQKTGSNLVQWPVEEVESLRLTSTEFDKVVVGAGSVVPLDVGTATQLDITAEFEIDSET  502

Query  542  FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                  +DI Y+CT   GA+ RG LGPFGLLV+A+D  +E TP+YFYIAKDT G+++TFF
Sbjct  503  LEGTIEADIGYNCTTSGGAAGRGTLGPFGLLVLAEDSLAEQTPVYFYIAKDTDGDYRTFF  562

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSSLANDV K  YG  VPVL+GE L MR+LVDHSIVESFAQGGRT +TSR+YPT 
Sbjct  563  CADESRSSLANDVVKYVYGSYVPVLEGEKLIMRLLVDHSIVESFAQGGRTVVTSRVYPTQ  622

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A++FLFNNAT A +TAS+++WQM+
Sbjct  623  AIYGAARVFLFNNATAANVTASLKIWQMN  651



>gb|KHG18769.1| Acid beta-fructofuranosidase [Gossypium arboreum]
Length=469

 Score =   438 bits (1126),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 208/330 (63%), Positives = 257/330 (78%), Gaps = 3/330 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S TE  GL+TS NG  IKHV+K SLDDDR+DYYAIGTY + +  W PD P
Sbjct  130  MWECVDFFPVSETENNGLETSINGHGIKHVVKASLDDDRHDYYAIGTYNDRNGTWIPDRP  189

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIGLRYDYG YYA+K+FYD +KKRRV WGW+ E DSE +D++KGWASVQ IPRTIL
Sbjct  190  NIDVGIGLRYDYGIYYAAKTFYDQNKKRRVLWGWIGESDSEAADVKKGWASVQSIPRTIL  249

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTGT+L+QWPVEE++ LR +  +F +V ++ GSVV LD+  + +LDI+AEF++D DA
Sbjct  250  FDKKTGTHLLQWPVEEIDSLRLKGKEFNQVRIQAGSVVPLDIDSATQLDIIAEFKIDSDA  309

Query  542  FGKAAG-SDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              KA G SD  + C  + GA++RG LGPFGLLV+A +  SE TP+YFY+ K + GN KTF
Sbjct  310  LDKATGSSDASFDCVTSGGAAERGALGPFGLLVLADERLSEQTPVYFYMTKGSDGNLKTF  369

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FC D  RSS A+DV K  YG  VPVL GE+LS+RILVDHSI+ESF QGGRT ITSR+YPT
Sbjct  370  FCNDQSRSSKASDVDKHIYGSLVPVLRGENLSIRILVDHSIIESFGQGGRTVITSRVYPT  429

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMS  982
             AI   AK+FLFNNAT+  +TAS++ WQM+
Sbjct  430  KAIHGAAKVFLFNNATELNVTASLKTWQMN  459



>gb|AFR69121.1| vacuolar invertase [Manihot esculenta]
Length=653

 Score =   444 bits (1143),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 210/329 (64%), Positives = 256/329 (78%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS NGP++KHV+K SLDDDR+DYYAIGTY E + KW PD+P
Sbjct  314  MWECVDFYPVSKKYQHGLDTSDNGPDVKHVVKASLDDDRHDYYAIGTYDELNSKWTPDNP  373

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIGLRYDYG +YASK+FYD  K RRV WGW+ E DSE +D++KGWA +Q IPRT+ 
Sbjct  374  DIDVGIGLRYDYGIFYASKTFYDHHKGRRVLWGWIGESDSELADVKKGWACLQAIPRTVS  433

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPVEEVE LR +  +F+KVEV+PGSVV LD+  + +LDI+AEFE+DKDA
Sbjct  434  LDKKTGSNLLQWPVEEVENLRLRAREFKKVEVEPGSVVPLDLDAATQLDIVAEFELDKDA  493

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K A S   +SC  + GA+ R  LGPFGLLV+A D  +E TP+YFYI K + G FKTFF
Sbjct  494  LMKTAESTEEFSCKTSRGAAHRSALGPFGLLVLADDSLAEQTPVYFYINKGSNGTFKTFF  553

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS ANDV K+ YG  VPVL+GE  ++RILVDHSI+ESFAQGGRT ITSR+YPT 
Sbjct  554  CTDQSRSSAANDVNKQIYGNFVPVLEGEKFTLRILVDHSIIESFAQGGRTTITSRVYPTR  613

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   AK+FLFNNA +  +TAS+++WQM+
Sbjct  614  AIYGSAKVFLFNNAIETNVTASLKIWQMN  642



>ref|XP_008238615.1| PREDICTED: acid beta-fructofuranosidase-like [Prunus mume]
Length=686

 Score =   445 bits (1145),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 212/329 (64%), Positives = 258/329 (78%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+  T   GLDTS NGP++KHV+K SLDDDRNDYYA GTY E + KW PD+ 
Sbjct  319  MWECVDFYPVWKTSDKGLDTSVNGPDVKHVVKASLDDDRNDYYAFGTYDEKTGKWVPDNE  378

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+RYDYG +YASK+FYD +K RRV WGW+ E DSE++D+QKGWAS+QGIPRT+L
Sbjct  379  KIDVGIGIRYDYGKFYASKTFYDQNKGRRVLWGWIGESDSESADVQKGWASLQGIPRTVL  438

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG+NL+QWPVEE+EKLR     F KVEVK GSVV L VG + +LDI+AEFE+DK  
Sbjct  439  FDQKTGSNLLQWPVEEIEKLRLSSKDFNKVEVKAGSVVPLQVGTATQLDIIAEFELDKKV  498

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                A S+  +SC  + GA++RG LGPFGLLV+A +  SE TP+YFY+AK   G   TFF
Sbjct  499  LESVAESNEAFSCNTSGGAAKRGALGPFGLLVLADESLSEQTPVYFYVAKGPGGIVDTFF  558

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS+ANDVRK+  G  +PVL  E LS+RILVDHSIVESFAQGGRT IT+RIYPT 
Sbjct  559  CADQTRSSVANDVRKEITGSYIPVLKDEKLSVRILVDHSIVESFAQGGRTTITNRIYPTK  618

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LF+FNNAT+ ++TAS++VWQ++
Sbjct  619  AIYGAARLFVFNNATETSVTASIKVWQLN  647



>emb|CAA53099.1| beta-fructofuranosidase [Daucus carota]
Length=661

 Score =   444 bits (1142),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 212/329 (64%), Positives = 260/329 (79%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP +KHVLK+SLDDDR+DYYA+GTY   ++KW PD+P
Sbjct  321  MWECVDFYPVSVTGSNGLDTSVNGPGVKHVLKSSLDDDRHDYYALGTYDPINDKWTPDNP  380

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYD  K+RR+ WGW+ E D+E++DL KGWASVQ IPRT++
Sbjct  381  ELDVGIGLRLDYGKYYASKTFYDQDKERRLLWGWIGESDNESTDLLKGWASVQSIPRTVV  440

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTGTN++QWPV+EVE LRS+  +   VE+KPGS+V L +  + +LDI+A FEVD++A
Sbjct  441  FDKKTGTNILQWPVKEVESLRSRSYEINDVELKPGSLVPLKISSAAQLDIVASFEVDEEA  500

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
            F     +D  Y+CTA  GA+ RG LGPFG+LV+A D  SE TP+YFYIAK   GN KT+F
Sbjct  501  FKGTYEADASYNCTASEGAAGRGILGPFGILVLADDPLSELTPVYFYIAKGVDGNAKTYF  560

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS A+DV K+ YG  VPVL GESLSMR+LVDHSIVESFAQGGRT ITSR+YPT 
Sbjct  561  CADQSRSSTASDVDKEVYGSDVPVLPGESLSMRLLVDHSIVESFAQGGRTVITSRVYPTR  620

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A++FLFNNAT  ++TASV+ WQM+
Sbjct  621  AIYSAARVFLFNNATGVSVTASVKAWQMA  649



>ref|XP_007210314.1| hypothetical protein PRUPE_ppa002334mg [Prunus persica]
 gb|EMJ11513.1| hypothetical protein PRUPE_ppa002334mg [Prunus persica]
Length=686

 Score =   444 bits (1143),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 212/329 (64%), Positives = 258/329 (78%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP++KHV+K SLDDDRNDYYA GTY E + KW PD+ 
Sbjct  319  MWECVDFYPVSKTSDKGLDTSANGPDVKHVVKASLDDDRNDYYAFGTYDEKTGKWVPDNQ  378

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+RYDYG +YASK+FYD +K RRV WGW+ E DSE++D+QKGWAS+QGIPRT+L
Sbjct  379  KIDVGIGIRYDYGKFYASKTFYDQNKGRRVLWGWIGESDSESADVQKGWASLQGIPRTVL  438

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG+NL+QWPVEE+EKLR     F KVEVK GSV  L VG + +LDI+AEFE+DK  
Sbjct  439  FDQKTGSNLLQWPVEEIEKLRLSSKDFNKVEVKAGSVEPLQVGTATQLDIVAEFELDKKV  498

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                A S+  +SC  + GA++RG LGPFGLLV+A +  SE TP+YFY+AK   G   TFF
Sbjct  499  LESVAESNEAFSCNTSGGAAKRGALGPFGLLVLADESLSEQTPVYFYVAKGPGGIVDTFF  558

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS+ANDVRK+  G  +PVL  E LS+RILVDHSIVESFAQGGRT IT+RIYPT 
Sbjct  559  CADQTRSSVANDVRKEITGSYIPVLKDEKLSVRILVDHSIVESFAQGGRTTITNRIYPTK  618

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LF+FNNAT+ ++TAS++VWQ++
Sbjct  619  AIYGAARLFVFNNATEISVTASIKVWQLN  647



>ref|XP_010093687.1| Acid beta-fructofuranosidase [Morus notabilis]
 gb|EXB54467.1| Acid beta-fructofuranosidase [Morus notabilis]
Length=662

 Score =   444 bits (1141),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 209/330 (63%), Positives = 258/330 (78%), Gaps = 3/330 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWEC DFYP+S     G++TS NG  ++HV+K SLDDDR+DYYAIGTY E + KW PD+P
Sbjct  317  MWECADFYPVSEVSNEGMETSANGLGVRHVVKASLDDDRHDYYAIGTYDEKNSKWYPDNP  376

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+RYDYG +YASKSFYD +K+RR+ WGW++E DSE +D++KGWAS+QGIPRTI 
Sbjct  377  KIDVGIGIRYDYGIFYASKSFYDQNKRRRILWGWISESDSELADVRKGWASLQGIPRTIS  436

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTGTNL+QWPVEEVE LR   S+F  V+V PGSVV LD+G + +LDI+AEFE+DK A
Sbjct  437  LDKKTGTNLLQWPVEEVESLRLTSSEFNDVQVTPGSVVPLDIGTATQLDIVAEFEMDKKA  496

Query  542  F---GKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
                 KA  ++   S + GA QRG LGPFGLLV+A D  SE TP+YFYI K + GN KTF
Sbjct  497  LEETAKANYTEFSCSISGGAWQRGALGPFGLLVLADDIRSEQTPVYFYIVKGSDGNLKTF  556

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FC D  RSS+A+DV K+ YG  V VL+GE LS+RILVDHSIVESFAQGGR CITSR+YPT
Sbjct  557  FCTDQSRSSVASDVNKQIYGSFVSVLEGEKLSVRILVDHSIVESFAQGGRACITSRVYPT  616

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMS  982
             AI   A++F+FNNAT+AT+T S+++WQM+
Sbjct  617  RAIYGAARIFVFNNATEATVTTSLKIWQMN  646



>emb|CBM41476.2| sucrose:(sucrose/fructan) 6-fructosyltransferase precursor [Pachysandra 
terminalis]
Length=655

 Score =   442 bits (1138),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 214/341 (63%), Positives = 261/341 (77%), Gaps = 5/341 (1%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             +WECVD YP+STT   GL+TS NGP +KHVLK S+D+ + DYYAIGTY   + KW PD+P
Sbjct  318   LWECVDLYPVSTTGEKGLETSVNGPKVKHVLKASIDEQQRDYYAIGTYDLGTNKWTPDNP  377

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
               D GIGLRYD+G YYASK+FYDP K+RRV W W  E+DSE +D +KGWA+VQ IPRT+L
Sbjct  378   EEDVGIGLRYDWGKYYASKTFYDPKKQRRVVWAWTKELDSEVADREKGWANVQTIPRTVL  437

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
              D KTGTN++ WPVEEVE LR    +F KV+   GSVV LDVG + +LDI+AEFE+DK+A
Sbjct  438   LDQKTGTNVLLWPVEEVESLRLSSKEFSKVKAGAGSVVPLDVGTATQLDIIAEFEIDKEA  497

Query  542   FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                   +D+ Y+CT   GA++RG LGPFGLLV A ++ SE TP+YFYIAK T GNFKTFF
Sbjct  498   LEGTIEADMGYNCTTSGGAAERGVLGPFGLLVSATENLSEQTPVYFYIAKGTDGNFKTFF  557

Query  716   CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
             C D  RSS A+DV K+  G TVPVLDGE  +MR+LVDHSIVESFAQGGR+CITSR+YPT 
Sbjct  558   CLDESRSSKASDVSKQVKGFTVPVLDGEKFTMRLLVDHSIVESFAQGGRSCITSRVYPTE  617

Query  896   AIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNFNK  1018
             AI   AKLFLFNNAT A+ITAS+++W   EM+SA    F++
Sbjct  618   AIYGAAKLFLFNNATGASITASLKIW---EMNSAFIQPFHR  655



>emb|CAD12104.1| beta-fructofuranosidase [Cichorium intybus]
Length=646

 Score =   442 bits (1137),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 207/329 (63%), Positives = 251/329 (76%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYPIS     GLDTS +GP +KHV+K S+DDDRNDYYAIGTY     KW PD+P
Sbjct  314  MWECVDFYPISKQGENGLDTSVDGPGVKHVVKASMDDDRNDYYAIGTYDAYKGKWTPDNP  373

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
            T+D GIGLRYDYG YYASK+FYD +K+RRV W W+ E D+E SD++KGWAS+ G+PRTI+
Sbjct  374  TLDVGIGLRYDYGIYYASKTFYDQNKQRRVLWSWIKETDTEASDIKKGWASLMGVPRTIV  433

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KT +N+IQWPVEE+  LR+  + F+ V V+ GS+V L++  + +LDI+AEFEVDK  
Sbjct  434  LDKKTQSNIIQWPVEEINLLRTNLTVFKTVVVESGSLVPLNLPSASQLDIVAEFEVDKKT  493

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              +  G+DI Y C    GA+QRG LGPFG  V+A +  +EHTP+YFY+AK   GN +TFF
Sbjct  494  VERLNGADIAYDCAKNGGAAQRGALGPFGFSVLAHEGLAEHTPVYFYVAKGVDGNLQTFF  553

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS ANDV K  YG  VPVL GE L+MRILVDHSIVESFAQ GRTCITSR+YPT 
Sbjct  554  CADQSRSSNANDVDKSIYGSIVPVLKGEKLAMRILVDHSIVESFAQEGRTCITSRVYPTK  613

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI  +A+LFLFNNAT   +TASV VWQM+
Sbjct  614  AINNNAQLFLFNNATATKVTASVNVWQMN  642



>gb|AEM00023.1| vacuolar acid invertase [Manihot esculenta]
Length=502

 Score =   437 bits (1123),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 208/329 (63%), Positives = 254/329 (77%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS NGP++KHV+K SLDDDR+DYYAIGTY E + KW PD+P
Sbjct  163  MWECVDFYPVSKKYQHGLDTSDNGPDVKHVVKASLDDDRHDYYAIGTYDELNSKWTPDNP  222

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID  IGLRYDYG +YASK+FYD  K RRV  GW+ E DSE +D++KGWA +Q IPRT+ 
Sbjct  223  DIDVDIGLRYDYGIFYASKTFYDHHKGRRVCGGWIGESDSELADVKKGWACLQAIPRTVS  282

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPVEEVE LR +  +F+KVEV+PGSVV LD+  + +LDI+AEFE+DKDA
Sbjct  283  LDKKTGSNLLQWPVEEVENLRLRAREFKKVEVEPGSVVPLDLDAATQLDIVAEFELDKDA  342

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K A S   +SC  + GA+ R  LGPFGLLV+A D  +E TP+YFYI K + G FKTFF
Sbjct  343  LMKTAESTEEFSCKTSRGAAHRSALGPFGLLVLADDSLAEQTPVYFYINKGSNGTFKTFF  402

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS ANDV K+ YG  VPVL+GE  ++RILVDHSI+ESFAQGGRT ITSR+YPT 
Sbjct  403  CTDQSRSSAANDVNKQIYGNFVPVLEGEKFTLRILVDHSIIESFAQGGRTTITSRVYPTR  462

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   AK+FLFNNA +  +TAS+++WQM+
Sbjct  463  AIYGSAKVFLFNNAIETNVTASLKIWQMN  491



>gb|AFH77957.1| vacuolar invertase [Manihot esculenta]
Length=660

 Score =   442 bits (1136),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 208/329 (63%), Positives = 255/329 (78%), Gaps = 3/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   G+DTS  GP +KHV+K SLDDDR+DYYA+GTY E +  W PD+P
Sbjct  322  MWECVDFYPVSRTSQNGVDTSATGPEVKHVVKASLDDDRHDYYALGTYNEVTSTWTPDNP  381

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIGLRYDYG +YASK+FYD +K RRV WGW+ E DSE +D++KGWAS+QGIPRT+ 
Sbjct  382  EIDVGIGLRYDYGIFYASKTFYDQNKGRRVLWGWIGESDSEVADVKKGWASLQGIPRTVT  441

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPVEEVE LR + ++F KVEVKPGSVV LD+  + +LDI+AEFE+DK A
Sbjct  442  LDTKTGSNLLQWPVEEVESLRLRSNEFNKVEVKPGSVVPLDLDAATQLDIVAEFELDKKA  501

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K A S+  +SCT   GA  R  LGPFGLLV+A D   E TP+YFY+ K + G  KTFF
Sbjct  502  LEKTAESNEEFSCTTSHGARHRNALGPFGLLVLADDSLVEQTPVYFYVQK-SNGTLKTFF  560

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS ANDV K+ YG  VPVL+GE  ++R+LVDHSI+ESFAQGGRT I+SR+YPT 
Sbjct  561  CTDQSRSSAANDVNKQIYGNFVPVLEGEKFTLRVLVDHSIIESFAQGGRTTISSRVYPTR  620

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   AKLFLFNNA +A +TAS+++WQM+
Sbjct  621  AIYGSAKLFLFNNAIEADVTASLKIWQMN  649



>ref|XP_004515737.1| PREDICTED: acid beta-fructofuranosidase-like [Cicer arietinum]
Length=658

 Score =   440 bits (1131),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 208/339 (61%), Positives = 259/339 (76%), Gaps = 5/339 (1%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDF+P+S     GLDTS+NG  +KHV+K SLDDDR+DYYA+G Y E   K+  DD 
Sbjct  317   MWECVDFFPVSKKSENGLDTSFNGDEVKHVMKVSLDDDRHDYYALGIYDEKKVKFVADDL  376

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
               D GIGLRYDYG +YASK+FYD  K RRV WGW+ E DSE +D+ KGWASVQ IPR + 
Sbjct  377   KNDVGIGLRYDYGIFYASKTFYDEKKHRRVLWGWIGESDSEYADVAKGWASVQSIPRIVK  436

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
              D KTG+NL+QWPV EVE LR + ++F+ ++ KPG+V+ LD+  + +LDILAEFE+DK+A
Sbjct  437   LDKKTGSNLLQWPVAEVESLRLKSNEFKNLKAKPGTVMSLDIETATQLDILAEFEIDKEA  496

Query  542   FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
               K A +++ Y C  + GASQRG LGPFGLLV+A D  SE+TP+YFY+ K + GN KT F
Sbjct  497   LEKTAHTNLEYECSISGGASQRGALGPFGLLVLADDGLSEYTPVYFYVVKGSNGNLKTSF  556

Query  716   CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
             C+D  RSS ANDV K+ +G  VPVL GE LS+RILVDHSIVESFAQGGRTC+TSR+YPT 
Sbjct  557   CSDQSRSSQANDVHKQIFGSVVPVLKGEKLSLRILVDHSIVESFAQGGRTCVTSRVYPTR  616

Query  896   AIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
             AI   A+LFLFNNAT+AT+TAS+++WQ   M+SA  H F
Sbjct  617   AIYGAARLFLFNNATEATVTASLKIWQ---MNSAFIHPF  652



>ref|XP_002303584.2| hypothetical protein POPTR_0003s12640g [Populus trichocarpa]
 gb|EEE78563.2| hypothetical protein POPTR_0003s12640g [Populus trichocarpa]
Length=612

 Score =   438 bits (1127),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 207/329 (63%), Positives = 257/329 (78%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP++KHV+KTSLDD R D YA+GTY + + KW PD+P
Sbjct  273  MWECVDFYPVSKTGQNGLDTSANGPHVKHVVKTSLDDVRKDSYALGTYDDKTGKWYPDNP  332

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+  DYG +YASK+FYD  K RRV WGWV E D+E  D++KGWAS+QGIPRTIL
Sbjct  333  EIDVGIGIMLDYGMFYASKTFYDQDKGRRVLWGWVAESDTEVDDVKKGWASLQGIPRTIL  392

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KT +NL+QWPVEEVE+LR +  +F  +EVK GSV+ L++  + +LDI AEFE+DK A
Sbjct  393  LDTKTCSNLLQWPVEEVERLRLKGKEFNNIEVKTGSVMPLELDGATQLDIAAEFELDKKA  452

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                A S++ +SC  + GA+QRG LGPFGLLV+A D  +EHT +YFY+AK   G  KTFF
Sbjct  453  LESTAESNVDFSCSTSGGAAQRGALGPFGLLVLADDSLAEHTSVYFYVAKGNNGTHKTFF  512

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS+ANDV+K+ YG  VPVL+GE LS+RILVDHSIVESFAQGGRT ITSR+YPT 
Sbjct  513  CTDQSRSSVANDVKKEIYGSYVPVLEGEKLSVRILVDHSIVESFAQGGRTVITSRVYPTR  572

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNA +AT+T+S+++WQM+
Sbjct  573  AIYGAARLFLFNNAIEATVTSSLKIWQMN  601



>ref|XP_006573732.1| PREDICTED: acid beta-fructofuranosidase-like [Glycine max]
Length=675

 Score =   440 bits (1131),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 211/329 (64%), Positives = 258/329 (78%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S+    GLDTS NG N+KHV+K SLDDDR+DYYA+GTY E + K+ PDD 
Sbjct  332  MWECVDFFPVSSKGENGLDTSINGENVKHVVKVSLDDDRHDYYALGTYDEKNVKFTPDDF  391

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLRYDYG +YASK+FYD SK RRV WGW+ E DSE +D+ KGWASVQGIPRT+ 
Sbjct  392  NNDVGIGLRYDYGIFYASKTFYDQSKGRRVLWGWIGESDSEYADVAKGWASVQGIPRTVA  451

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NLIQWPV EVE LR +  +F+ ++VKPGSVV L++G + +LDI+AEFE+DK A
Sbjct  452  LDKKTGSNLIQWPVAEVESLRLRSDEFQNLKVKPGSVVPLEIGTAAQLDIVAEFEIDKKA  511

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K   S+  Y C  + G+++RG +GPFGLLV+A DD SE+TP YFY+ K + G  KT F
Sbjct  512  LEKTGQSNKEYKCSTSGGSTERGTIGPFGLLVLADDDLSEYTPTYFYVVKGSHGQLKTSF  571

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSSLA DV KK +G  VPVL  E LS+RILVDHSIVESFAQGGRTC+TSR+YPT 
Sbjct  572  CSDQSRSSLATDVSKKIFGSFVPVLKDEKLSVRILVDHSIVESFAQGGRTCVTSRVYPTK  631

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNAT+AT+TASV+VWQM+
Sbjct  632  AIYGAARLFLFNNATEATVTASVKVWQMN  660



>gb|AFO84092.1| vacuolar invertase [Actinidia chinensis]
Length=632

 Score =   438 bits (1127),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 208/327 (64%), Positives = 253/327 (77%), Gaps = 1/327 (0%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+STT   GLDTS NGP IKHVLK SLDD++ D+YA+GTY   ++KW PDDP
Sbjct  293  MWECVDFYPVSTTGRNGLDTSVNGPGIKHVLKASLDDEKKDFYALGTYDTINDKWTPDDP  352

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D G+GLR DYG YYASK+FYD +K+RR+ WGW+ E DSE  DL KGWASVQ IPRT++
Sbjct  353  ELDVGVGLRVDYGKYYASKTFYDHNKQRRILWGWIGETDSEYDDLMKGWASVQTIPRTVV  412

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTGTN++QWPVEEVE+LR    +F  VE+ PGS+V L++  + +LDI A FEVDK+A
Sbjct  413  FDVKTGTNILQWPVEEVEELRRNSIEFNGVELAPGSIVPLNIRSATQLDITATFEVDKEA  472

Query  542  FGKAAGSDIPYSC-TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFC  718
                   D+ Y+C TAGA  RG LGPFGL+V+A     E TP+YFYI+KD  G +KTFFC
Sbjct  473  LEGVLEVDVGYNCSTAGAGVRGALGPFGLIVLADHSLFELTPVYFYISKDVGGGYKTFFC  532

Query  719  ADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSA  898
            AD +RSSLA +V KK +G  VPVLDGE L+MR+LVDHSIVESFAQGGRT ITSRIYPT A
Sbjct  533  ADEIRSSLALEVNKKVHGGMVPVLDGEKLTMRLLVDHSIVESFAQGGRTVITSRIYPTKA  592

Query  899  IGEDAKLFLFNNATDATITASVEVWQM  979
            +   A+ FLFNNAT  ++TAS+ VW+M
Sbjct  593  VDGAARAFLFNNATGVSVTASLTVWEM  619



>gb|KHN42709.1| Acid beta-fructofuranosidase [Glycine soja]
Length=675

 Score =   439 bits (1130),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 211/329 (64%), Positives = 258/329 (78%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S+    GLDTS NG N+KHV+K SLDDDR+DYYA+GTY E + K+ PDD 
Sbjct  332  MWECVDFFPVSSKGENGLDTSINGENVKHVVKVSLDDDRHDYYALGTYDEKNVKFTPDDF  391

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLRYDYG +YASK+FYD SK RRV WGW+ E DSE +D+ KGWASVQGIPRT+ 
Sbjct  392  KNDVGIGLRYDYGIFYASKTFYDQSKGRRVLWGWIGESDSEYADVAKGWASVQGIPRTVA  451

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NLIQWPV EVE LR +  +F+ ++VKPGSVV L++G + +LDI+AEFE+DK A
Sbjct  452  LDKKTGSNLIQWPVAEVESLRLRSDEFQNLKVKPGSVVPLEIGTAAQLDIVAEFEIDKKA  511

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K   S+  Y C  + G+++RG +GPFGLLV+A DD SE+TP YFY+ K + G  KT F
Sbjct  512  LEKTGQSNKEYKCSTSGGSTERGTIGPFGLLVLADDDLSEYTPTYFYVVKGSHGQLKTSF  571

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSSLA DV KK +G  VPVL  E LS+RILVDHSIVESFAQGGRTC+TSR+YPT 
Sbjct  572  CSDQSRSSLATDVSKKIFGSFVPVLKDEKLSVRILVDHSIVESFAQGGRTCVTSRVYPTK  631

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNAT+AT+TASV+VWQM+
Sbjct  632  AIYGAARLFLFNNATEATVTASVKVWQMN  660



>gb|KHN34956.1| Acid beta-fructofuranosidase [Glycine soja]
Length=667

 Score =   439 bits (1129),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 209/329 (64%), Positives = 258/329 (78%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S+    GL+TS NG N+KHV+K SLDDDR+DYYA+GTY E + K+ PDD 
Sbjct  324  MWECVDFFPVSSKGENGLNTSINGENVKHVVKVSLDDDRHDYYALGTYDEKNVKFTPDDF  383

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLRYDYG +YASK+FYD SK RRV WGW+ E DSE +D+ KGWASVQGIPRT+ 
Sbjct  384  KNDVGIGLRYDYGIFYASKTFYDQSKGRRVLWGWIGESDSEYADVAKGWASVQGIPRTVT  443

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPV EVE LR +  +F+ ++V PGSVV L++G + +LDI+AEFE+DK+A
Sbjct  444  LDKKTGSNLLQWPVAEVESLRLRSEEFQNLKVTPGSVVPLEIGTAAQLDIVAEFEIDKEA  503

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K   S+  Y C  + GA++RG +GPFGLLV+A DD SE+TP YFY+ K + G  KT F
Sbjct  504  LEKTGQSNKEYKCSTSGGATERGAIGPFGLLVLADDDLSEYTPTYFYVVKGSHGQLKTSF  563

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSSLA DV KK +G  VPVL  E LS+RILVDHSIVESFAQGGRTC+TSR+YPT 
Sbjct  564  CSDQSRSSLATDVSKKIFGSFVPVLKDEKLSVRILVDHSIVESFAQGGRTCVTSRVYPTK  623

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNAT+AT+TASV+VWQM+
Sbjct  624  AIYGAARLFLFNNATEATVTASVKVWQMN  652



>gb|KDP25630.1| hypothetical protein JCGZ_20786 [Jatropha curcas]
Length=659

 Score =   438 bits (1127),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 201/329 (61%), Positives = 252/329 (77%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S  +  GL+TS NGP +KHV+K SLDDDR+DYYA+GTY + +  W PD P
Sbjct  320  MWECVDFYPVSIYDRNGLETSANGPEVKHVVKASLDDDRHDYYALGTYDDKNATWYPDIP  379

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIGLRYDYG +YASK+FYD  + RRV WGW+ E DSE +D++KGWAS+QGIPRT+ 
Sbjct  380  EIDVGIGLRYDYGIFYASKTFYDQHRGRRVLWGWIGESDSEAADVKKGWASLQGIPRTVA  439

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD K+G+NL+QWPVEEVE LR +  +F+ VEVKPGSVV LD+  + +LDI AEFE+DK+ 
Sbjct  440  FDTKSGSNLLQWPVEEVENLRLRSKEFKNVEVKPGSVVPLDLEAATQLDIFAEFEIDKNV  499

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                A +D  +SC+   GA+    LGPFGLLV+A +  +E TP+YFY+ K   G  KTFF
Sbjct  500  LENIAETDEEFSCSTSNGAAHHSALGPFGLLVLADESLAEQTPVYFYVTKGFNGTLKTFF  559

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS+ANDV K+ YG  VPVL+GE  ++R LVDHSI+ESFAQGGRTCITSR+YPT 
Sbjct  560  CTDQTRSSVANDVNKQIYGNFVPVLEGEKFTLRTLVDHSIIESFAQGGRTCITSRVYPTR  619

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   AKLFLFNNA +  +TAS+++WQM+
Sbjct  620  AIYGAAKLFLFNNAIETNVTASLKIWQMN  648



>ref|XP_010053435.1| PREDICTED: acid beta-fructofuranosidase-like [Eucalyptus grandis]
 gb|KCW77732.1| hypothetical protein EUGRSUZ_D02029 [Eucalyptus grandis]
Length=653

 Score =   437 bits (1124),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 204/329 (62%), Positives = 254/329 (77%), Gaps = 5/329 (2%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S     GLDTS NGP +KHV+K SLDDDR+DYYAIGTY E +  W PD P
Sbjct  318  MWECVDFFPVSDD---GLDTSVNGPGVKHVMKVSLDDDRHDYYAIGTYNEEANTWVPDSP  374

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+RYDYG +YASK+FYD +K RR+ WGW+TE DSE +D+QKGWAS+Q +PRTI+
Sbjct  375  EIDVGIGIRYDYGIFYASKTFYDQNKSRRILWGWITESDSEYADVQKGWASLQALPRTIV  434

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPVEEV+ LR    +F+ VEV+ G+VV LDV  + ++DI+AEFE+DK A
Sbjct  435  LDTKTGSNLLQWPVEEVDSLRLSSKEFDSVEVEAGTVVPLDVETATQVDIVAEFELDKQA  494

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
               A  +D  Y C+A  GASQR  LGPFGLLV+A DD SE TP+YFY+ K   G  KT  
Sbjct  495  LEAAPEADADYVCSASGGASQRSALGPFGLLVLADDDLSEQTPVYFYVVKGPNGTLKTSI  554

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS+A DV K+ YG  VPVL+GE LS+RILVDHSIVE+FAQGGR+CIT+R+YPT 
Sbjct  555  CTDQSRSSVATDVHKQVYGSFVPVLEGEKLSLRILVDHSIVETFAQGGRSCITARVYPTK  614

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A++FLFNNAT+A + AS+++WQM+
Sbjct  615  AIYGAARVFLFNNATEANVKASLKIWQMN  643



>gb|ACT21538.1| acid invertase [Vigna radiata]
Length=579

 Score =   432 bits (1111),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 200/329 (61%), Positives = 257/329 (78%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S   G GLDTS NG  +KHV+K SLDDDR+DYYAIGTY +    + PDD 
Sbjct  236  MWECVDFFPVSKKNGNGLDTSVNGAEVKHVMKVSLDDDRHDYYAIGTYDDNKVLFTPDDV  295

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D G+GLRYDYG +YASK+FYD +K RR+ WGW+ E DSE +D+ KGWASVQ IPRT+ 
Sbjct  296  KNDVGVGLRYDYGIFYASKTFYDQNKDRRILWGWIGESDSEYADVTKGWASVQSIPRTVR  355

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPV+EVE LR +  +F+ ++ KPGSVV LD+  + +LD++AEFE+D ++
Sbjct  356  LDTKTGSNLLQWPVDEVESLRLRSDEFKSLKAKPGSVVSLDIETATQLDVVAEFEIDTES  415

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K A S+  ++C++  GA+QRG LGPFGLLV+A +  SE+TP+YFY+ K   GN +T F
Sbjct  416  LEKTAESNEEFTCSSSGGAAQRGALGPFGLLVLADEGLSEYTPVYFYVIKGRNGNLRTSF  475

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSS ANDVRK+ +G  VPVL GE  S+R+LVDHSIVESFAQGGRTC+TSR+YPT 
Sbjct  476  CSDQSRSSQANDVRKQIFGSVVPVLKGEKFSLRMLVDHSIVESFAQGGRTCVTSRVYPTK  535

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNAT+AT+TAS++VWQM+
Sbjct  536  AIYGAARLFLFNNATEATVTASLKVWQMN  564



>gb|ABI17894.1| vacuolar invertase [Coffea canephora]
Length=586

 Score =   432 bits (1111),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 204/332 (61%), Positives = 252/332 (76%), Gaps = 2/332 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+STT   GLDTS NGP  KHVLK SLD++++DYYA+GTY   + KW PDDP
Sbjct  248  MWECVDFYPVSTTGDNGLDTSANGPGTKHVLKASLDENKHDYYALGTYDPKNNKWTPDDP  307

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYD +KKRR+ WGW+ E DSE +DL KGWASVQ IPRT++
Sbjct  308  ELDVGIGLRLDYGKYYASKTFYDQNKKRRILWGWIGETDSEAADLMKGWASVQTIPRTVV  367

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTGTN++QWPVEE E LR   ++F+ V+++PGS+  L++G + +LDI+A FEVD +A
Sbjct  368  FDKKTGTNILQWPVEEAESLRFNATEFDTVKLEPGSIAPLNIGSATQLDIIASFEVDSEA  427

Query  542  FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                  +D+ Y+CT   GA+ RG LGPFGLLV+A    SE TP+YFYI+K T G+ +T F
Sbjct  428  LEATVEADVGYNCTTSGGAASRGKLGPFGLLVLADGSLSELTPVYFYISKSTDGSAETHF  487

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSS A DV K  YG TVPVLDGE LS R+LVDHS+VESFAQGGR  ITSR+YPT 
Sbjct  488  CSDESRSSKAPDVGKLVYGSTVPVLDGEKLSARLLVDHSVVESFAQGGRRVITSRVYPTK  547

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            AI   A+LFLFNNAT  ++TAS ++W M   D
Sbjct  548  AIYGAARLFLFNNATGVSVTASAKIWHMRSAD  579



>emb|CDP05324.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   430 bits (1105),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 203/332 (61%), Positives = 252/332 (76%), Gaps = 2/332 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+STT   GLDTS NGP  KHVLK SLD++++DYYA+GTY   + KW PDDP
Sbjct  201  MWECVDFYPVSTTGDNGLDTSANGPGTKHVLKASLDENKHDYYALGTYDPKNNKWTPDDP  260

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYD +KKRR+ WGW+ E DSE +DL KGWASVQ IPRT++
Sbjct  261  ELDVGIGLRLDYGKYYASKTFYDQNKKRRILWGWIGETDSEAADLMKGWASVQTIPRTVV  320

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTGTN++QWPVEE E LR   ++F+ V+++PGS+  L++G + +LDI+A FEVD +A
Sbjct  321  FDKKTGTNILQWPVEEAESLRFNATEFDTVKLEPGSIAPLNIGSATQLDIIASFEVDSEA  380

Query  542  FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                  +D+ Y+CT   GA+ RG LGPFGLLV+A    SE TP+YFYI+K T G+ +T F
Sbjct  381  LEATVEADVGYNCTTSGGAASRGKLGPFGLLVLADGSLSELTPVYFYISKSTDGSAETHF  440

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSS A DV K  YG TVPVL+GE LS R+LVDHS+VESFAQGGR  ITSR+YPT 
Sbjct  441  CSDESRSSKAPDVGKLVYGSTVPVLEGEKLSARLLVDHSVVESFAQGGRRVITSRVYPTK  500

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            AI   A+LFLFNNAT  ++TAS ++W M   D
Sbjct  501  AIYGAARLFLFNNATGVSVTASAKIWHMRSAD  532



>ref|XP_009384549.1| PREDICTED: beta-fructofuranosidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=645

 Score =   433 bits (1114),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 209/347 (60%), Positives = 257/347 (74%), Gaps = 12/347 (3%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSY-NGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDD  178
             MWECVDFYP+ST    GLDTS   GP +KHVLK S+DDDRNDYYAIGTY+  +  W PDD
Sbjct  299   MWECVDFYPVSTESATGLDTSAATGPGVKHVLKASMDDDRNDYYAIGTYEAATNAWVPDD  358

Query  179   PTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTI  358
             P  D GIGLRYDYG +YASK+FYDP K+RRV WGW+ E DSE +DL+KGWAS+Q IPRT+
Sbjct  359   PEKDVGIGLRYDYGMFYASKTFYDPVKQRRVLWGWIGETDSERTDLRKGWASLQTIPRTV  418

Query  359   LFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
             LFD +TG+NL+QWPV++VE LRS   +F  + +  GSVV LDVG + ++DI+AEF V+K 
Sbjct  419   LFDQQTGSNLLQWPVDDVETLRSGSQEFSNISIPAGSVVPLDVGTATQVDIVAEFGVNKS  478

Query  539   AFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
             A   A  + + Y+C  + GA+ RG LGPFGLLV+A DD SE T +YFY  + T G+  T 
Sbjct  479   ALAGAVDAAVGYNCSTSGGAAGRGVLGPFGLLVLADDDLSEQTAVYFYFVRSTDGSISTH  538

Query  713   FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
             FC D LRSS A D+ K+ YG  VPVLDGE+LS+RILVDHS++ESFAQGGRTCITSR+YPT
Sbjct  539   FCHDELRSSEAADIVKRVYGSLVPVLDGETLSVRILVDHSVIESFAQGGRTCITSRVYPT  598

Query  893   SAIGEDAKLFLFNNATDATITA-SVEVWQM--------SEMDSAAPH  1006
             SA     +LFLFNNAT   +TA S+++WQM        SE DS + H
Sbjct  599   SATYGGGRLFLFNNATGVDVTAKSLKIWQMGSAFIRPFSEHDSVSLH  645



>gb|KEH31660.1| soluble acid invertase FRUCT2 [Medicago truncatula]
Length=531

 Score =   429 bits (1102),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 203/329 (62%), Positives = 250/329 (76%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S     GLDTS NG  +KHV+K SLDDDR+DYY++G Y E   K+  DD 
Sbjct  190  MWECVDFFPVSMKSENGLDTSVNGEEVKHVMKVSLDDDRHDYYSLGNYDEKKVKFTADDL  249

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLRYDYG +YASK+FYD  K RRV WGW+ E DSE +D+ KGWASVQ IPR + 
Sbjct  250  KNDVGIGLRYDYGIFYASKTFYDQKKDRRVLWGWIGESDSEYADVAKGWASVQSIPRIVK  309

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPV EVE LR +  +F+ ++VKPGSVV LD+  + +LDILAEFE++K+A
Sbjct  310  LDKKTGSNLLQWPVAEVESLRLKSDEFKNLKVKPGSVVSLDIDTATQLDILAEFEIEKEA  369

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K A S++ Y C  + GAS+RG LGPFGL V+A    SE+TP+YFY+ K + G  KT F
Sbjct  370  LEKTAHSNVEYECSNSGGASKRGALGPFGLYVLADGALSEYTPVYFYVVKGSDGKLKTSF  429

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSSLANDV K+ YG  VPVL+GE LS+RILVDHSIVESFAQGGRTCITSR+YPT 
Sbjct  430  CSDQSRSSLANDVHKQIYGSVVPVLEGEKLSLRILVDHSIVESFAQGGRTCITSRVYPTR  489

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNA +  +TAS++VWQM+
Sbjct  490  AIYGAARLFLFNNAIETNVTASLKVWQMN  518



>sp|P29001.1|INVA_VIGRR RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Contains: RecName: Full=Acid 
beta-fructofuranosidase 30 kDa subunit; Contains: RecName: 
Full=Acid beta-fructofuranosidase 38 kDa subunit; Flags: 
Precursor [Vigna radiata var. radiata]
 dbj|BAA01107.1| invertase [Vigna radiata]
 prf||1905412A acid invertase
Length=649

 Score =   432 bits (1112),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 200/329 (61%), Positives = 257/329 (78%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S   G GLDTS NG  +KHV+K SLDDDR+DYYAIGTY +    + PDD 
Sbjct  306  MWECVDFFPVSKKNGNGLDTSVNGAEVKHVMKVSLDDDRHDYYAIGTYDDNKVLFTPDDV  365

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D G+GLRYDYG +YASK+FYD +K RR+ WGW+ E DSE +D+ KGWASVQ IPRT+ 
Sbjct  366  KNDVGVGLRYDYGIFYASKTFYDQNKDRRILWGWIGESDSEYADVTKGWASVQSIPRTVR  425

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPV+EVE LR +  +F+ ++ KPGSVV LD+  + +LD++AEFE+D ++
Sbjct  426  LDTKTGSNLLQWPVDEVESLRLRSDEFKSLKAKPGSVVSLDIETATQLDVVAEFEIDTES  485

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K A S+  ++C++  GA+QRG LGPFGLLV+A +  SE+TP+YFY+ K   GN +T F
Sbjct  486  LEKTAESNEEFTCSSSGGAAQRGALGPFGLLVLADEGLSEYTPVYFYVIKGRNGNLRTSF  545

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSS ANDVRK+ +G  VPVL GE  S+R+LVDHSIVESFAQGGRTC+TSR+YPT 
Sbjct  546  CSDQSRSSQANDVRKQIFGSVVPVLKGEKFSLRMLVDHSIVESFAQGGRTCVTSRVYPTK  605

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNAT+AT+TAS++VWQM+
Sbjct  606  AIYGAARLFLFNNATEATVTASLKVWQMN  634



>ref|XP_004511663.1| PREDICTED: acid beta-fructofuranosidase-like [Cicer arietinum]
Length=646

 Score =   431 bits (1109),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 207/329 (63%), Positives = 254/329 (77%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST    GLDTS  G ++KHV+K SLDDDR+DYY IG Y+E    + PDD 
Sbjct  305  MWECVDFYPVSTKLEKGLDTSAYGVDVKHVMKVSLDDDRHDYYTIGNYEENGADFVPDDI  364

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLRYDYG +YASK+FYD +K+RRV W W+ E DSE +D+ KGWASV GIPRT++
Sbjct  365  QNDVGIGLRYDYGIFYASKTFYDQNKERRVLWSWIGESDSEYADVTKGWASVMGIPRTVV  424

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPVEEVE LR + +KFE ++  PGSVV LD+  + +LDI+AEFE+DK+A
Sbjct  425  LDKKTGSNLLQWPVEEVESLRLKSNKFENLKAMPGSVVSLDIETATQLDIVAEFEIDKEA  484

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K   ++  Y+C  + GA+ RG LGPFGLLV+A D  SE+TPIYFY+ K   GN KT F
Sbjct  485  IEKTDQTNEEYNCKTSGGAAHRGALGPFGLLVLANDGLSEYTPIYFYVVKGNDGNLKTSF  544

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSSLA DV K  +G  VPVL+ E LS+RILVDHSIVESFAQGGRT +TSR+YPT 
Sbjct  545  CSDQSRSSLATDVDKSVFGSFVPVLENEKLSLRILVDHSIVESFAQGGRTTVTSRVYPTR  604

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI  DAKLFLFNNAT+AT+TAS++VWQM+
Sbjct  605  AIYGDAKLFLFNNATEATVTASLKVWQMN  633



>dbj|BAP47496.1| invertase [Gentiana triflora]
Length=658

 Score =   432 bits (1110),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 210/337 (62%), Positives = 252/337 (75%), Gaps = 7/337 (2%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST EG GLDTSYNGP IKH+LK S+DDD+NDYYA+GTY    +KW PD+P
Sbjct  318  MWECVDFYPVSTVEGNGLDTSYNGPGIKHLLKASMDDDKNDYYALGTYDIVKQKWTPDNP  377

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID G+GLRYDYG +YASK+FYD +K+RR+ WGW+ E DSE  DL KGWASVQ IPRT++
Sbjct  378  EIDVGLGLRYDYGKFYASKTFYDQNKQRRILWGWIGETDSEAIDLFKGWASVQTIPRTVV  437

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD +TGTN++QWPVEE+E LR   ++F  V++ PGSVV LDVG   +LDI+A FEVDK A
Sbjct  438  FDKETGTNILQWPVEEMESLRQGGNEFNNVKLPPGSVVPLDVGSGAQLDIVASFEVDKVA  497

Query  542  FGKAAGS-----DIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGN  700
              +A        +  Y CT   GAS RG LGPFGL+V A    SE TP+YFYI K   G 
Sbjct  498  LEEATTEEEEADNTSYQCTTSGGASSRGKLGPFGLIVFADASLSELTPVYFYITKGPDGK  557

Query  701  FKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSR  880
             +T FC+D  RSS A DV K+ YG TVPVL GE LS+RILVDHSIVESFAQGGRT ITSR
Sbjct  558  IQTHFCSDESRSSQAPDVSKEIYGSTVPVLAGEKLSVRILVDHSIVESFAQGGRTVITSR  617

Query  881  IYPTSAIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            +YPT AI   A+LFLFNNAT  T++AS ++W ++  D
Sbjct  618  VYPTKAIYTAARLFLFNNATGVTVSASAKIWHLNSAD  654



>ref|XP_011022761.1| PREDICTED: acid beta-fructofuranosidase-like [Populus euphratica]
Length=648

 Score =   430 bits (1106),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 202/329 (61%), Positives = 255/329 (78%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP++KHV+KTSLD    DYYA+GTY + + KW PD+P
Sbjct  309  MWECVDFYPVSKTGQNGLDTSANGPHVKHVVKTSLDYVGKDYYALGTYDDKTGKWYPDNP  368

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIG+  DYG +YASK+FYD  K RRV WGWV E D+E  D++KGWAS+QGIPRT+L
Sbjct  369  EIDVGIGIMLDYGMFYASKTFYDQDKGRRVLWGWVAESDTEADDVRKGWASLQGIPRTVL  428

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KT +NL+QWPVEEVE+LR +  +F  +EVK GSV+ L++  + +LDI AEFE+DK A
Sbjct  429  LDTKTCSNLLQWPVEEVERLRLKGKEFNNIEVKAGSVMPLELDGATQLDIAAEFELDKKA  488

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                A S++ +SC  + GA+QRG LGPFGLLV+A +  +EHT +YFY+AK   G  KTFF
Sbjct  489  LESTAESNVDFSCSTSGGAAQRGALGPFGLLVLADNSLAEHTSVYFYVAKGNNGTHKTFF  548

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS+ANDV+K+ YG  VPVL+GE LS+RILVDHSIVESFAQGGRT +TSR+YP  
Sbjct  549  CTDQSRSSVANDVKKEIYGSYVPVLEGEKLSVRILVDHSIVESFAQGGRTVVTSRVYPIR  608

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNA +AT+T+S+++WQM+
Sbjct  609  AIYGAARLFLFNNAIEATVTSSLKIWQMN  637



>ref|XP_011101120.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=652

 Score =   431 bits (1107),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 254/332 (77%), Gaps = 3/332 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWEC+DFYPIS TE  GLDTS NG  IKHV+K SLDDD+NDYYA+GTY     KW PDDP
Sbjct  313  MWECIDFYPISLTESNGLDTSANGQGIKHVMKVSLDDDKNDYYALGTYDPVKNKWTPDDP  372

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLRYDYG YYASK+FYD +KKRR+ WGW+ E D+E  D+ KGWASVQ IPRT++
Sbjct  373  ELDVGIGLRYDYGKYYASKTFYDQNKKRRILWGWIRETDAEALDILKGWASVQSIPRTVV  432

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG+N++QWPVEEVE LRS   +F   +++PGSVV ++V    +LDI+A FE+DK+ 
Sbjct  433  FDQKTGSNILQWPVEEVESLRSDSLEF-NAKLEPGSVVPIEVDSGSQLDIVASFELDKET  491

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
            F     +DI Y C  + GA  RG LGPFG++V+A ++  E TPIYFYIAK   G  +T F
Sbjct  492  FEVTTEADIGYDCPTSGGAVNRGMLGPFGIVVLADENLLELTPIYFYIAKGPHGKVETHF  551

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD LRSS+A DV K  YG  VPVLDGE+L++R LVDHSIVESFAQGGR  ITSRIYPT+
Sbjct  552  CADELRSSVAPDVDKIVYGSKVPVLDGENLTIRSLVDHSIVESFAQGGRRVITSRIYPTT  611

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            AIG  A++FLFNNAT A++ AS+++W+MS  +
Sbjct  612  AIGGAARVFLFNNATRASVNASIKIWKMSSAN  643



>ref|XP_003608758.1| Acid beta-fructofuranosidase [Medicago truncatula]
Length=640

 Score =   429 bits (1104),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 203/329 (62%), Positives = 250/329 (76%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S     GLDTS NG  +KHV+K SLDDDR+DYY++G Y E   K+  DD 
Sbjct  299  MWECVDFFPVSMKSENGLDTSVNGEEVKHVMKVSLDDDRHDYYSLGNYDEKKVKFTADDL  358

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLRYDYG +YASK+FYD  K RRV WGW+ E DSE +D+ KGWASVQ IPR + 
Sbjct  359  KNDVGIGLRYDYGIFYASKTFYDQKKDRRVLWGWIGESDSEYADVAKGWASVQSIPRIVK  418

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPV EVE LR +  +F+ ++VKPGSVV LD+  + +LDILAEFE++K+A
Sbjct  419  LDKKTGSNLLQWPVAEVESLRLKSDEFKNLKVKPGSVVSLDIDTATQLDILAEFEIEKEA  478

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K A S++ Y C  + GAS+RG LGPFGL V+A    SE+TP+YFY+ K + G  KT F
Sbjct  479  LEKTAHSNVEYECSNSGGASKRGALGPFGLYVLADGALSEYTPVYFYVVKGSDGKLKTSF  538

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSSLANDV K+ YG  VPVL+GE LS+RILVDHSIVESFAQGGRTCITSR+YPT 
Sbjct  539  CSDQSRSSLANDVHKQIYGSVVPVLEGEKLSLRILVDHSIVESFAQGGRTCITSRVYPTR  598

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNA +  +TAS++VWQM+
Sbjct  599  AIYGAARLFLFNNAIETNVTASLKVWQMN  627



>gb|AFV59228.1| vacuolar invertase CvINV [Elsholtzia haichowensis]
Length=637

 Score =   429 bits (1104),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 202/332 (61%), Positives = 252/332 (76%), Gaps = 2/332 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S TE  GLDTS NGP +KHVLK+SLDDD+NDYYA+GTY     KW PDDP
Sbjct  297  MWECVDFYPVSLTEENGLDTSVNGPGVKHVLKSSLDDDKNDYYALGTYDPIENKWTPDDP  356

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLRYDYG YYASK+FYD +KKRR+ WGW+ E D+E+ D+ KGW+ VQ IPRT++
Sbjct  357  ELDVGIGLRYDYGKYYASKTFYDQNKKRRILWGWIRETDAESLDVLKGWSGVQSIPRTVV  416

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD +TG+N++QWPVEEVE LRS+  +F  V++ PGS+V L V    +LD++A F++D+ A
Sbjct  417  FDKETGSNILQWPVEEVESLRSESVEFNDVKLAPGSIVPLSVDSPSQLDLVATFDIDEKA  476

Query  542  FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                +  +  Y CT   GA+ RG LGPFG++V A    SE TPIYFYIAK   G  +T F
Sbjct  477  AEGLSEGESSYDCTTSGGAANRGVLGPFGIVVFADQTLSELTPIYFYIAKGLNGKIQTHF  536

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD LRSS+A+DV K  YG TVPVLDGE LS+R LVDHSIVESFAQGGR  ITSRIYPT 
Sbjct  537  CADELRSSIASDVDKIVYGSTVPVLDGEKLSIRSLVDHSIVESFAQGGRRVITSRIYPTK  596

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            AI E +++ LFNNAT A++ AS+++W+M+  D
Sbjct  597  AINEASRILLFNNATGASVIASIKIWKMNSAD  628



>gb|AES90955.2| soluble acid invertase FRUCT2 [Medicago truncatula]
Length=643

 Score =   429 bits (1104),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 203/329 (62%), Positives = 250/329 (76%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S     GLDTS NG  +KHV+K SLDDDR+DYY++G Y E   K+  DD 
Sbjct  302  MWECVDFFPVSMKSENGLDTSVNGEEVKHVMKVSLDDDRHDYYSLGNYDEKKVKFTADDL  361

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLRYDYG +YASK+FYD  K RRV WGW+ E DSE +D+ KGWASVQ IPR + 
Sbjct  362  KNDVGIGLRYDYGIFYASKTFYDQKKDRRVLWGWIGESDSEYADVAKGWASVQSIPRIVK  421

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPV EVE LR +  +F+ ++VKPGSVV LD+  + +LDILAEFE++K+A
Sbjct  422  LDKKTGSNLLQWPVAEVESLRLKSDEFKNLKVKPGSVVSLDIDTATQLDILAEFEIEKEA  481

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K A S++ Y C  + GAS+RG LGPFGL V+A    SE+TP+YFY+ K + G  KT F
Sbjct  482  LEKTAHSNVEYECSNSGGASKRGALGPFGLYVLADGALSEYTPVYFYVVKGSDGKLKTSF  541

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSSLANDV K+ YG  VPVL+GE LS+RILVDHSIVESFAQGGRTCITSR+YPT 
Sbjct  542  CSDQSRSSLANDVHKQIYGSVVPVLEGEKLSLRILVDHSIVESFAQGGRTCITSRVYPTR  601

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNA +  +TAS++VWQM+
Sbjct  602  AIYGAARLFLFNNAIETNVTASLKVWQMN  630



>ref|XP_006878590.1| hypothetical protein AMTR_s00011p00252750 [Amborella trichopoda]
 gb|ERM94735.1| hypothetical protein AMTR_s00011p00252750 [Amborella trichopoda]
Length=640

 Score =   429 bits (1103),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 204/341 (60%), Positives = 256/341 (75%), Gaps = 8/341 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S TE +GLDTS NGP +KHVLK SLDD+++DYYAIG Y E +E W PDDP
Sbjct  304   MWECVDFYPVSLTENVGLDTSVNGPGVKHVLKASLDDNKHDYYAIGVYDEATETWLPDDP  363

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
               D GIGLRYDYG +YASK+FYD  K+RR+ WGW+ E DSE +D+QKGWAS+Q IPR + 
Sbjct  364   VNDVGIGLRYDYGKFYASKTFYDQVKQRRILWGWIGETDSEQADIQKGWASLQTIPRVVT  423

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             +D K+GTNL+QWP+EEVE LR+     + ++V PGSVVH+D+  + +LD+ A FEV K+A
Sbjct  424   YDTKSGTNLVQWPIEEVESLRTSNVSLDNIKVDPGSVVHVDINGA-QLDVNAVFEVSKEA  482

Query  542   FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
               K   +D+ Y+C  + GA+ RG LGPFGLLV+A++  SE T +YFYIAK   GN +TFF
Sbjct  483   I-KNTEADVLYNCSTSGGAAGRGVLGPFGLLVLAEESLSEQTAVYFYIAKGVDGNLQTFF  541

Query  716   CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
             C D  RSS A D+ ++ YG TVPVL GE LS+RILVDHSIVESFAQGGRTCITSR+YPT 
Sbjct  542   CHDETRSSKATDLVERVYGSTVPVLSGEKLSVRILVDHSIVESFAQGGRTCITSRVYPTR  601

Query  896   AIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNFNK  1018
             AI    +LFLFNNA+ +    S+ +WQM+   SA  H F +
Sbjct  602   AI-YGPRLFLFNNASTSVTVTSLNIWQMT---SALIHPFEQ  638



>gb|AFV59227.2| vacuolar invertase NvINV [Elsholtzia haichowensis]
Length=637

 Score =   429 bits (1102),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 202/332 (61%), Positives = 252/332 (76%), Gaps = 2/332 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S TE  GLDTS NGP +KHVLK+SLDDD+NDYYA+GTY     KW PDDP
Sbjct  297  MWECVDFYPVSLTEENGLDTSVNGPGVKHVLKSSLDDDKNDYYALGTYDLIENKWTPDDP  356

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLRYDYG YYASK+FYD +KKRR+ WGW+ E D+E+ D+ KGW+ VQ IPRT++
Sbjct  357  ELDVGIGLRYDYGKYYASKTFYDQNKKRRILWGWIRETDAESLDVLKGWSGVQSIPRTVV  416

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD +TG+N++QWPVEEVE LRS+  +F  V++ PGS+V L V    +LD++A F++D+ A
Sbjct  417  FDKETGSNILQWPVEEVESLRSESVEFNDVKLAPGSIVPLSVDSPSQLDLVATFDIDEKA  476

Query  542  FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                +  +  Y CT   GA+ RG LGPFG++V A    SE TPIYFYIAK   G  +T F
Sbjct  477  AEGLSEGESSYDCTTSGGAANRGVLGPFGIVVFADQTLSELTPIYFYIAKGLNGKIQTHF  536

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD LRSS+A+DV K  YG TVPVLDGE LS+R LVDHSIVESFAQGGR  ITSRIYPT 
Sbjct  537  CADELRSSIASDVDKIVYGSTVPVLDGEKLSIRSLVDHSIVESFAQGGRRVITSRIYPTK  596

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            AI E +++ LFNNAT A++ AS+++W+M+  D
Sbjct  597  AINEASRILLFNNATGASVIASIKIWKMNSAD  628



>gb|AEX15265.1| vacuolar invertase [Musa acuminata AAA Group]
Length=645

 Score =   429 bits (1103),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 208/347 (60%), Positives = 256/347 (74%), Gaps = 12/347 (3%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSY-NGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDD  178
             MWECVDFYP+ST    GLDTS   GP +KHVLK S+DDDR+DYYAIGTY+  +  W PDD
Sbjct  299   MWECVDFYPVSTESATGLDTSAATGPGMKHVLKASMDDDRHDYYAIGTYEAATNAWVPDD  358

Query  179   PTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTI  358
             P  D GIGLRYDYG +YASK+FYDP K+RRV WGW+ E DSE +DL+KGWAS+Q IPRT+
Sbjct  359   PEKDVGIGLRYDYGMFYASKTFYDPVKQRRVLWGWIGETDSERTDLRKGWASLQTIPRTV  418

Query  359   LFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
             LFD KT +NL+QWPV++VE LRS   +F  + +  GSVV LDVG + ++DI+AEF V+K 
Sbjct  419   LFDQKTESNLLQWPVDDVETLRSGSQEFSNISIPAGSVVPLDVGTATQVDIVAEFGVNKS  478

Query  539   AFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
             A   A  + + Y+C  + GA+ RG LGPFGLLV+A DD SE T +YFY  + T G+  T 
Sbjct  479   ALAGAVDAAVGYNCSTSGGAAGRGVLGPFGLLVLADDDLSEQTAVYFYFVRSTDGSISTH  538

Query  713   FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
             FC D LRSS A D+ K+ YG  VPVLDGE+LS+RILVDHS++ESFAQGGRTCITSR+YPT
Sbjct  539   FCHDELRSSEAADIVKRVYGSLVPVLDGETLSVRILVDHSVIESFAQGGRTCITSRVYPT  598

Query  893   SAIGEDAKLFLFNNATDATITA-SVEVWQM--------SEMDSAAPH  1006
             SA     +LFLFNNAT   +TA S+++WQM        SE DS + H
Sbjct  599   SATYGGGRLFLFNNATGVDVTAKSLKIWQMGSAFIRPFSEHDSVSLH  645



>gb|KHN04338.1| Acid beta-fructofuranosidase [Glycine soja]
Length=555

 Score =   426 bits (1094),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 201/329 (61%), Positives = 252/329 (77%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S     GLDTS NG  +KHV+K SLDDDR+DYY+IGTY E +  + PDD 
Sbjct  214  MWECVDFFPVSKENENGLDTSINGAEVKHVMKVSLDDDRHDYYSIGTYDEKNVLFTPDDA  273

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D G+GLRYDYG +YASK+FYD +K+RRV WGW+ E DSE +D+ KGWASVQ IPRT+ 
Sbjct  274  KNDVGVGLRYDYGIFYASKTFYDQNKERRVLWGWIGESDSEYADVAKGWASVQSIPRTVE  333

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPV E+E LR +  +F+ ++ KPGSVV +D+  + +LDI+AEFE+DK+ 
Sbjct  334  LDRKTGSNLLQWPVAEIESLRLRSDEFKNLKAKPGSVVSVDIETATQLDIVAEFEIDKET  393

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K   S+  Y+C  + G+ QRG LGPFGLLV+A +  SE+TP YFY+ K + GN KT F
Sbjct  394  LDKIPQSNEEYTCSTSGGSKQRGALGPFGLLVLADEGLSEYTPQYFYVIKGSNGNLKTSF  453

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS ANDVRK+  G  VPVL GE  S+RILVDHSIVESFAQGGRT +TSR+YPT 
Sbjct  454  CADQSRSSQANDVRKQIVGSAVPVLKGEKFSLRILVDHSIVESFAQGGRTVVTSRVYPTK  513

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNAT+AT+TAS++VWQM+
Sbjct  514  AIYGAARLFLFNNATEATVTASLKVWQMN  542



>ref|XP_011076337.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=657

 Score =   429 bits (1103),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 211/333 (63%), Positives = 249/333 (75%), Gaps = 3/333 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWEC+DFYP+S TE  GLDTS NGP IKHVLK SLDDD+NDYYA+GTY     KW PDDP
Sbjct  316  MWECIDFYPVSLTEENGLDTSANGPGIKHVLKASLDDDKNDYYALGTYDPIKNKWTPDDP  375

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLRYDYG YYASK+FYD +K+RR+ WGW+ E D+E  DL KGWA VQ IPRT++
Sbjct  376  DLDVGIGLRYDYGKYYASKTFYDQNKQRRILWGWIRETDAEELDLLKGWACVQSIPRTVV  435

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG+N++QWPVEEVE LRS   +F  V + PGSVV L V  + ELDI+A FEV K+ 
Sbjct  436  FDQKTGSNILQWPVEEVESLRSDSFEFNDVRLGPGSVVPLAVDSASELDIVASFEVHKET  495

Query  542  FGKA-AGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              +A A +D  Y C  + GA+ RG LGPFG++V+A D  SE TPIYFYIAK T G   T 
Sbjct  496  VDEATAEADTGYDCPTSGGAANRGILGPFGIVVLADDTLSELTPIYFYIAKGTNGKAVTH  555

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD LRSS A DV K  YG  VP+L  E LS+R LVDHSIVESFAQGGRT ITSR+YPT
Sbjct  556  FCADELRSSKAADVDKIVYGSKVPLLQHEKLSIRSLVDHSIVESFAQGGRTVITSRVYPT  615

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
             AIG  A++FLFNNAT  ++TASV++W+M   D
Sbjct  616  KAIGRAARVFLFNNATGLSVTASVKIWKMDSAD  648



>ref|XP_007157332.1| hypothetical protein PHAVU_002G061200g [Phaseolus vulgaris]
 gb|ESW29326.1| hypothetical protein PHAVU_002G061200g [Phaseolus vulgaris]
Length=649

 Score =   429 bits (1102),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 203/329 (62%), Positives = 252/329 (77%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+ +    GLDTS NG N+KHV+K SLDDDR+DYYA+GTY E + K+ PDD 
Sbjct  306  MWECVDFFPVYSKGENGLDTSINGENVKHVMKVSLDDDRHDYYAVGTYDEKNVKFTPDDL  365

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLRYDYG +YASK+FYD +K RRV W W+ E DSE +D+ KGWAS+QGIPRT+ 
Sbjct  366  KNDVGIGLRYDYGIFYASKTFYDQNKGRRVLWSWIGESDSEYADVAKGWASIQGIPRTVT  425

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG++L+QWPV EVE+LR    +FE ++VKPGSVV L +G + +LDI+AEFE+D  A
Sbjct  426  LDKKTGSSLLQWPVAEVERLRLGSDEFENLKVKPGSVVPLQIGTAAQLDIVAEFEIDNKA  485

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                  S++ Y C  + GA++RG LGPFGLLV+A  D SE+TP YFY+ K + G  KT F
Sbjct  486  LEMTGQSNMEYECSTSGGAAERGALGPFGLLVLADHDLSEYTPTYFYVVKGSDGQLKTSF  545

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSSLA DV KK +G +VPVL  E LS+RILVDHS+VESFAQGGRTC+TSR+YPT 
Sbjct  546  CSDQSRSSLATDVGKKIFGSSVPVLKDEKLSVRILVDHSVVESFAQGGRTCVTSRVYPTK  605

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNAT  T+TASV+VWQM+
Sbjct  606  AIYGAARLFLFNNATQVTVTASVKVWQMN  634



>gb|AFD62255.1| acid invertase [Kummerowia stipulacea]
Length=644

 Score =   427 bits (1099),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/329 (61%), Positives = 251/329 (76%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS NG  +KHV+K SLDDDR+DYY+IGTY E    + PDD 
Sbjct  303  MWECVDFYPVSEKNENGLDTSANGAEVKHVMKVSLDDDRHDYYSIGTYDEKKVLFTPDDS  362

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D G+GLRYDYG +YASK+FYD +K+RR+ WGW+ E DSE +D+ KGWASVQ IPRT+ 
Sbjct  363  KNDVGVGLRYDYGIFYASKTFYDQNKQRRILWGWIGESDSEYADVAKGWASVQSIPRTVK  422

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPV EVE LR +  +F+ ++ KPGSVV LD+  + +LDI+AEFE+D + 
Sbjct  423  LDTKTGSNLLQWPVAEVEGLRLRSDEFQSLKAKPGSVVSLDIEAATQLDIVAEFEIDNET  482

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K   S+  Y+C  + G++QRG LGPFGLLV+A D  SE+TP+YFY+ K T G  KT F
Sbjct  483  LEKIPESNEEYTCSTSGGSAQRGALGPFGLLVLADDGLSEYTPVYFYVIKGTNGTLKTSF  542

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSS+ANDV K+ YG  VPVL+GE  S+RILVDHSIVES+AQGGRT +TSR+YPT 
Sbjct  543  CSDQSRSSVANDVHKQIYGSVVPVLNGEKFSLRILVDHSIVESYAQGGRTVVTSRVYPTK  602

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LF FNNAT+AT+T S+EVWQM+
Sbjct  603  AIYGAARLFFFNNATEATVTTSLEVWQMN  631



>sp|Q43857.1|INVA_VICFA RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Flags: Precursor [Vicia faba]
 emb|CAA89992.1| vacuolar invertase; beta-fructofuranosidase [Vicia faba var. 
minor]
Length=642

 Score =   427 bits (1099),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 201/329 (61%), Positives = 250/329 (76%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S     GLDTS+ G  +KHV+K SLDDDR+DYYA+GTY E   K+  DD 
Sbjct  298  MWECVDFFPVSMKSENGLDTSFTGDEVKHVMKVSLDDDRHDYYALGTYDEKKVKFIADDF  357

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLRYDYG +YASK+FYD  K RRV WGW+ E DSE +D+ KGWASVQ IPR + 
Sbjct  358  ENDVGIGLRYDYGIFYASKTFYDQKKDRRVLWGWIGESDSEYADVAKGWASVQSIPRIVK  417

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPV EVE LR +  +F+ ++VKPG+VV +D+  + +LDI+AEFE+DK+A
Sbjct  418  LDKKTGSNLLQWPVAEVESLRLRSDEFQNLKVKPGAVVSVDIETATQLDIVAEFEIDKEA  477

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K A S++ Y C  + GAS+RG LGPFGL V+A +  SE+TP+YFY+ K   G   T F
Sbjct  478  LEKTAQSNVEYECNTSGGASRRGALGPFGLYVLADNGLSEYTPVYFYVVKGINGKLHTSF  537

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSSLANDV K+ YG  VPVL+GE LS+RILVDHSIVESFAQGGRTCITSR+YPT 
Sbjct  538  CSDQSRSSLANDVHKQIYGSVVPVLEGEKLSLRILVDHSIVESFAQGGRTCITSRVYPTR  597

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNA +  +TAS++VWQM+
Sbjct  598  AIYGAARLFLFNNAIETNVTASLKVWQMN  626



>ref|XP_006307369.1| hypothetical protein CARUB_v10008995mg [Capsella rubella]
 gb|EOA40267.1| hypothetical protein CARUB_v10008995mg [Capsella rubella]
Length=483

 Score =   421 bits (1082),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 207/349 (59%), Positives = 255/349 (73%), Gaps = 14/349 (4%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S TE  GLDTS NGP++KH++K S+DD R D+YA+GTY E +  W PDDP
Sbjct  130   MWECVDFYPVSKTESNGLDTSVNGPDVKHIVKASMDDTRFDHYAVGTYFESNGTWIPDDP  189

Query  182   TIDTGIG--LRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
             TID G+   LRYDYG +YASK+FYD +K RR+ W W+ E DSE SD+QKGW+S+QGIPRT
Sbjct  190   TIDVGMSSSLRYDYGKFYASKTFYDQNKGRRILWSWIGESDSEASDVQKGWSSLQGIPRT  249

Query  356   ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
             +  D KTG NL+QWPVEE++ LR    KF+ +EV PGSVV +DVG + +LDI AEFE+ K
Sbjct  250   VALDTKTGKNLVQWPVEEIKSLRLSSKKFD-LEVSPGSVVPVDVGTATQLDIEAEFEIKK  308

Query  536   DAFGKAAGSDI------PYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDT  691
             ++  K  G          +SC  + G++ RG LGPFG  V+A +  SE TP+YFYIAK  
Sbjct  309   ESLEKILGDSSVVAEAEEFSCEKSGGSTVRGALGPFGFSVLATESLSEQTPVYFYIAKGK  368

Query  692   TGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCI  871
                 KTFFC D  RSS+ANDV K  YG  VPVL GE L+MRILVDHSIVE+F QGGRTCI
Sbjct  369   DSKLKTFFCTDTSRSSVANDVIKPIYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTCI  428

Query  872   TSRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNFNK  1018
             TSR+YPT+AI   AKLFLFNNA D T+TAS +VWQ   M+SA  H +++
Sbjct  429   TSRVYPTTAIYGAAKLFLFNNALDTTVTASFKVWQ---MNSAFIHPYSE  474



>ref|XP_003525803.1| PREDICTED: acid beta-fructofuranosidase-like [Glycine max]
Length=645

 Score =   426 bits (1095),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 201/329 (61%), Positives = 252/329 (77%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S     GLDTS NG  +KHV+K SLDDDR+DYY+IGTY E +  + PDD 
Sbjct  304  MWECVDFFPVSKENENGLDTSINGAEVKHVMKVSLDDDRHDYYSIGTYDEKNVLFTPDDA  363

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D G+GLRYDYG +YASK+FYD +K+RRV WGW+ E DSE +D+ KGWASVQ IPRT+ 
Sbjct  364  KNDVGVGLRYDYGIFYASKTFYDQNKERRVLWGWIGESDSEYADVAKGWASVQSIPRTVE  423

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPV E+E LR +  +F+ ++ KPGSVV +D+  + +LDI+AEFE+DK+ 
Sbjct  424  LDRKTGSNLLQWPVAEIESLRLRSDEFKNLKAKPGSVVSVDIETATQLDIVAEFEIDKET  483

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K   S+  Y+C  + G+ QRG LGPFGLLV+A +  SE+TP YFY+ K + GN KT F
Sbjct  484  LDKIPQSNEEYTCSTSGGSKQRGALGPFGLLVLADEGLSEYTPQYFYVIKGSNGNLKTSF  543

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS ANDVRK+  G  VPVL GE  S+RILVDHSIVESFAQGGRT +TSR+YPT 
Sbjct  544  CADQSRSSQANDVRKQIVGSAVPVLKGEKFSLRILVDHSIVESFAQGGRTVVTSRVYPTK  603

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNAT+AT+TAS++VWQM+
Sbjct  604  AIYGAARLFLFNNATEATVTASLKVWQMN  632



>emb|CDY30056.1| BnaC05g09640D [Brassica napus]
Length=659

 Score =   426 bits (1095),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 206/334 (62%), Positives = 253/334 (76%), Gaps = 8/334 (2%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP++KH++K S+DD R D+YAIGTY + +  W PDDP
Sbjct  309  MWECVDFYPVSKTLVKGLDTSVNGPDVKHIVKASMDDTRIDHYAIGTYFDSNGTWTPDDP  368

Query  182  TIDTGIG--LRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            TID GI   LRYDYG +YASK+FYD +K RR+ WGW+ E DSE++D+QKGW+S+QGIPRT
Sbjct  369  TIDVGISTSLRYDYGKFYASKTFYDQNKGRRILWGWIGESDSESADVQKGWSSLQGIPRT  428

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KTG NL+QWPVEEV+ LR    KF+ +EV PGS+VH+DVG + +LDI AEFE+ K
Sbjct  429  VVLDTKTGKNLVQWPVEEVKSLRLSSKKFD-MEVGPGSLVHIDVGSAAQLDIEAEFEIKK  487

Query  536  DAFGKAAG---SDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGN  700
            ++  K  G   +   +SC  + G++ RG LGPFG  V+A +  SE TP+YFY+AK     
Sbjct  488  ESLDKILGDASATEEFSCQKSGGSTVRGALGPFGFSVLAHESLSEQTPVYFYVAKGKDSK  547

Query  701  FKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSR  880
              TFFCAD  RSS ANDV K  YG +VPVL GE L+MRILVDHSIVE+F QGGRTCITSR
Sbjct  548  LTTFFCADSSRSSFANDVVKPIYGSSVPVLKGEKLTMRILVDHSIVEAFGQGGRTCITSR  607

Query  881  IYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            +YPT AI   AKLFLFNNA DATITAS +VWQM+
Sbjct  608  VYPTKAIYGAAKLFLFNNAIDATITASFKVWQMN  641



>gb|KFK40573.1| hypothetical protein AALP_AA2G014000 [Arabis alpina]
Length=354

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 202/347 (58%), Positives = 251/347 (72%), Gaps = 13/347 (4%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S T+  GL+TS NG ++KH++K S+DD R D+YAIGTY +   +W PDDP
Sbjct  1     MWECVDFYPVSKTKANGLETSVNGADVKHIMKASIDDTRIDHYAIGTYYDSKGRWVPDDP  60

Query  182   TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
              ID G+  GLRYDYG +YASK+FYD  K RR+ W W+ E DSE +D+QKGWASVQGIPRT
Sbjct  61    CIDVGVNTGLRYDYGKFYASKTFYDQHKGRRILWSWIGESDSEAADVQKGWASVQGIPRT  120

Query  356   ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
             ++ D KTG NL+QWP++E+E LR +  KF  ++V+PG+VV +DVG + +LDI AEF + K
Sbjct  121   VVLDTKTGKNLLQWPIKEIESLRLRSKKFH-MKVRPGTVVPVDVGPASQLDIEAEFTIKK  179

Query  536   DAFGKAAG-----SDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
             D F    G     +D  +SC  + G++ RG  GPFG  V+A    SE TP+YFY+ K   
Sbjct  180   DHFEVILGNDSMEADKEFSCKKSGGSTVRGVFGPFGFSVLADQSLSEQTPVYFYVTKGKD  239

Query  695   GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
                KTFFC D  RSS ANDV K  YG  VPVL GE L+MRI+VDHSIVE+F QGGRTCIT
Sbjct  240   SKLKTFFCTDTSRSSKANDVVKPIYGNFVPVLKGEKLTMRIIVDHSIVEAFGQGGRTCIT  299

Query  875   SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNFN  1015
             SR+YPT AIG   KLFLFNNATDAT+TAS +VWQ   M+SA  H F+
Sbjct  300   SRVYPTKAIGGATKLFLFNNATDATVTASFKVWQ---MNSAYIHPFS  343



>ref|XP_009794076.1| PREDICTED: acid beta-fructofuranosidase AIV-18 [Nicotiana sylvestris]
Length=643

 Score =   424 bits (1091),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 200/332 (60%), Positives = 251/332 (76%), Gaps = 2/332 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST E  GLDTSYNGP IKHVLK SLDDD++DYYAIGTY     KW PD+P
Sbjct  303  MWECVDFYPVSTVEANGLDTSYNGPGIKHVLKASLDDDKHDYYAIGTYDPVKNKWTPDNP  362

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYDP ++RR+ WGW+ E DSE +DL KGWASVQ IPRT+L
Sbjct  363  ELDVGIGLRLDYGKYYASKTFYDPKEQRRILWGWIGETDSEAADLLKGWASVQSIPRTVL  422

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D +T T+++QWPV+E+E LR      ++V ++PGS+  + V  + +LD+ A FEVDK A
Sbjct  423  YDKETRTHVLQWPVKEIESLRIGDPLVKQVNLQPGSIELVHVDSAAQLDVEASFEVDKAA  482

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                  +D+ ++C  + GA++RG LGPFG++VIA    SE TP+YFYIAK T G  +T+F
Sbjct  483  LAGTIEADVGFNCSTSGGAAKRGILGPFGVVVIADQTLSELTPVYFYIAKGTGGRAETYF  542

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT 
Sbjct  543  CADETRSSEAPGVAKQVYGSSVPVLDGEQHSMRLLVDHSIVESFAQGGRTVITSRIYPTK  602

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            AI   A+LF+FNNAT A++TAS+++W +   D
Sbjct  603  AINGAARLFVFNNATGASVTASLKIWSLKSAD  634



>gb|EYU24965.1| hypothetical protein MIMGU_mgv1a004782mg [Erythranthe guttata]
Length=510

 Score =   420 bits (1079),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 201/335 (60%), Positives = 249/335 (74%), Gaps = 5/335 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWEC+DFYP+S T+  GLDTS NGP +KHV+K SLDDD+NDYYAIGTY     KW PD+P
Sbjct  165  MWECIDFYPVSVTDENGLDTSVNGPGVKHVMKVSLDDDKNDYYAIGTYDPIGNKWTPDNP  224

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLRYDYG YYASK+FYD +  RR+ WGW+ E D+E  D+ KGW+ VQ IPRT++
Sbjct  225  VLDVGIGLRYDYGKYYASKTFYDQNTHRRILWGWIRETDAEELDILKGWSCVQSIPRTVV  284

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKS-KFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
            FD KTG+N++QWPVEEVEKLRS  S  F  V++ PGS++ + V    +LDI+A FEVD+D
Sbjct  285  FDKKTGSNILQWPVEEVEKLRSHTSVDFNDVKLGPGSIIPIKVDSPSQLDIIASFEVDED  344

Query  539  AFGKAAGSDI--PYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFK  706
            A  + + ++    Y C  + GA+ RG LGPFG++V+A D  SE TPIYFYIAK   G  +
Sbjct  345  ATFETSANETESSYDCPTSGGAANRGKLGPFGIIVLADDGLSESTPIYFYIAKGANGTTE  404

Query  707  TFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIY  886
            T FCAD LRSS A DV K  YG TVPVL GE LS+R LVDHSIVESFAQGGRT I SRIY
Sbjct  405  THFCADELRSSKAADVDKLVYGSTVPVLHGEKLSIRSLVDHSIVESFAQGGRTVIASRIY  464

Query  887  PTSAIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            PT+A G   ++FLFNNAT  ++TAS+++W+M   D
Sbjct  465  PTAANGSSGRVFLFNNATGVSVTASIKIWKMDSAD  499



>gb|AFD62256.1| acid invertase [Kummerowia stipulacea]
Length=644

 Score =   424 bits (1090),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 198/329 (60%), Positives = 250/329 (76%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS NG  +KHV+K SLDDDR+ YY+IGTY E    + PDD 
Sbjct  303  MWECVDFYPVSEKNENGLDTSANGAEVKHVMKVSLDDDRHGYYSIGTYDEKKVLFTPDDS  362

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D G+GLRYDYG +YASK+FYD +K+RR+ WGW+ E DSE +D+ KGWASVQ IPRT+ 
Sbjct  363  KNDVGVGLRYDYGIFYASKTFYDQNKQRRILWGWIGESDSEYADVAKGWASVQSIPRTVK  422

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPV EVE LR +  +F+ ++ KPGSVV LD+  + +LDI+AEFE+D + 
Sbjct  423  LDTKTGSNLLQWPVAEVEGLRLRSDEFQSLKAKPGSVVSLDIEAATQLDIVAEFEIDNET  482

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K   S+  Y+C  + G++QRG LGPFGLLV+A D  SE+TP+YFY+ K T G  KT F
Sbjct  483  LEKIPESNEEYTCSTSGGSAQRGALGPFGLLVLADDGLSEYTPVYFYVIKGTNGTLKTSF  542

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSS+ANDV K+ YG  VPVL+GE  S+RILVDHS+VES+AQGGRT +TSR+YPT 
Sbjct  543  CSDQSRSSVANDVHKQIYGSVVPVLNGEKFSLRILVDHSMVESYAQGGRTVVTSRVYPTK  602

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LF FNNAT+AT+T S+EVWQM+
Sbjct  603  AIYGAARLFFFNNATEATVTTSLEVWQMN  631



>ref|XP_003580229.1| PREDICTED: beta-fructofuranosidase 1-like [Brachypodium distachyon]
Length=679

 Score =   425 bits (1092),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 211/337 (63%), Positives = 254/337 (75%), Gaps = 11/337 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEG----IGLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKW  166
            MWECVDFYP+STT      IGL+TS   GP +KHV+K SLDDDRNDYYAIGTY    + W
Sbjct  333  MWECVDFYPVSTTSRPGGEIGLETSVPPGPGVKHVVKVSLDDDRNDYYAIGTYDAKDDTW  392

Query  167  RPDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGI  346
             PDD  ID GIGLRYDYG +YASK+FYDP  +RRV WGW+ E DSE +D+ KGWA +Q +
Sbjct  393  TPDDAAIDVGIGLRYDYGRFYASKTFYDPVGRRRVLWGWIVETDSERADILKGWAGLQSV  452

Query  347  PRTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFE  526
            PRT+L D KTG+NL+QWPV EVE LR +   F+ + V PGSVV LDVGK+ +LDI A F+
Sbjct  453  PRTVLMDTKTGSNLLQWPVVEVENLRMRGKSFDGLAVPPGSVVPLDVGKASQLDIEAAFQ  512

Query  527  V--DKDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
            V  D    G A G++  Y+C  +AGA+ RG LGPFGLLV+A +  SE T +YFY+ KD  
Sbjct  513  VHLDSSVAGGAEGAE-SYNCSASAGAAGRGVLGPFGLLVLADEGLSEQTAVYFYLVKDAN  571

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
            G F TFFC D LRSS AND+ KK YG  VPVLDGE+LS+RILVDHSIVESFAQGGRTCIT
Sbjct  572  GKFTTFFCQDALRSSKANDLDKKVYGSLVPVLDGENLSVRILVDHSIVESFAQGGRTCIT  631

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            SR YPT AI + A++FLFNNAT+  ITA S+++W+M+
Sbjct  632  SRAYPTKAIYDSARVFLFNNATNVNITAKSLKIWEMN  668



>gb|AGW23637.1| soluble acid invertase [Lilium davidii]
Length=635

 Score =   423 bits (1087),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 201/333 (60%), Positives = 252/333 (76%), Gaps = 6/333 (2%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDD  178
            MWEC+DFYP+ST   +GLDTS   GP+++HVLK SLDDD++DYYAIGTY   +EKW P+D
Sbjct  292  MWECIDFYPVSTNSEVGLDTSVPPGPSVRHVLKASLDDDKHDYYAIGTYDPVAEKWVPED  351

Query  179  PTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTI  358
               D GIGLRYDYG YYASK+F+D +K+RRV WGW  E DSE +DL KGWASV  IPRT+
Sbjct  352  VEADVGIGLRYDYGRYYASKTFFDTAKRRRVLWGWTGETDSEQADLLKGWASVMTIPRTV  411

Query  359  LFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
            LFD KTG+NL+QWPVEEVE LR     F+ + +  GSVV L++ ++ +LDI+AEFE++  
Sbjct  412  LFDQKTGSNLLQWPVEEVESLRLSSRDFKNINIGIGSVVPLNISRATQLDIVAEFEIEGK  471

Query  539  AFGKAAGSDIPYSCT----AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFK  706
            +      +DI Y+C+    A A+ RG LGPFG LV++  D SE T +YFY+A++  G  +
Sbjct  472  SLTATVEADIGYNCSTSRGAAAAGRGVLGPFGFLVLSDQDLSEQTAVYFYVARNVDGELE  531

Query  707  TFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIY  886
            TFFC D LRSS A+D+ K+ YG TVPVL GE L++RILVDHSIVESFAQGGRTCITSRIY
Sbjct  532  TFFCQDELRSSKADDIVKRVYGSTVPVLSGEILTVRILVDHSIVESFAQGGRTCITSRIY  591

Query  887  PTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            PT AI   AKLFLFNN T A +TA S+++WQM+
Sbjct  592  PTKAIDAAAKLFLFNNGTGAMVTAKSIKIWQMN  624



>ref|XP_008778382.1| PREDICTED: beta-fructofuranosidase 1-like [Phoenix dactylifera]
Length=544

 Score =   420 bits (1079),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 207/347 (60%), Positives = 256/347 (74%), Gaps = 12/347 (3%)
 Frame = +2

Query  2     MWECVDFYPISTTEGI-----GLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEK  163
             MWECVDF+P++  EG      G+DTS   G  ++HVLK SLD DRNDYYAIGTY   +  
Sbjct  198   MWECVDFFPVAVEEGTAAAVEGMDTSAAAGAGVRHVLKASLDQDRNDYYAIGTYDMATNT  257

Query  164   WRPDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQG  343
             WRP+D  +D GIGLRYD+G +YASK+FYDP K+RRV WGW+ E DSE +DL KGWAS+QG
Sbjct  258   WRPEDEGMDVGIGLRYDWGQFYASKTFYDPEKRRRVLWGWIGETDSERTDLLKGWASLQG  317

Query  344   IPRTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEF  523
             IPRT+LFD KT  NL+QWPVEEVEKLR     F ++ +  GSV  LDV  + +LDI AEF
Sbjct  318   IPRTVLFDTKTRGNLLQWPVEEVEKLRMSSKDFGRITIDTGSVFPLDVTGAIQLDIEAEF  377

Query  524   EVDKDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTG  697
             E++K+A   A  +D+ Y+C  + GA++RG LGPFGLLV+A D  SE T +YFYIA+ T G
Sbjct  378   EIEKEALMMAVEADVGYNCSTSGGATKRGMLGPFGLLVLANDRLSEKTAVYFYIARGTDG  437

Query  698   NFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITS  877
             N +T FC D L SS A+D+ K+  G TVPVLDGE+LS+RILVDHSIVESFAQGGRTCITS
Sbjct  438   NLRTHFCHDELESSRASDIVKRVVGSTVPVLDGETLSVRILVDHSIVESFAQGGRTCITS  497

Query  878   RIYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMSEMDSAAPHNFN  1015
             R+YPT AI   AK+FLFNNAT A++T  S+ +W+   MDS   H + 
Sbjct  498   RVYPTEAIYNAAKVFLFNNATSASVTVKSLTIWK---MDSTFSHPYT  541



>gb|AEV46289.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   422 bits (1085),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 203/329 (62%), Positives = 249/329 (76%), Gaps = 3/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD+P
Sbjct  298  MWECVDFYPVSTEKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLTKNKWTPDNP  357

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGL+ DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  358  ELDCGIGLKLDYGKYYASKTFYDPKKQRRVLWGWIGETDSESADLQKGWASVQSIPRTVL  417

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR+     ++V ++PGS+  L V  + ELDI A FEVDK A
Sbjct  418  YDKKTGTHLLQWPVEEIESLRAGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEVDKVA  477

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    SE TP+YFYI+K   G  +T 
Sbjct  478  LQGIIEADHVGFSCSTSGGAASRGILGPFGVVVIADQKLSELTPVYFYISKGADGRAETH  537

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  538  FCADQTRSSEAPGVAKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPT  597

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQM  979
             A+   A+LF+FNNAT A++TASV++W +
Sbjct  598  KAVNGAARLFVFNNATGASVTASVKIWSL  626



>ref|NP_001274993.1| beta-fructosidase [Solanum tuberosum]
 gb|AEV46297.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   422 bits (1085),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 202/333 (61%), Positives = 250/333 (75%), Gaps = 3/333 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD+P
Sbjct  298  MWECVDFYPVSTEKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLTKNKWTPDNP  357

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGL+ DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  358  ELDCGIGLKLDYGKYYASKTFYDPKKQRRVLWGWIGETDSESADLQKGWASVQSIPRTVL  417

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR+     ++  ++PGS+  L V  + ELDI A FEVDK A
Sbjct  418  YDKKTGTHLLQWPVEEIESLRAGDPIVKQANLQPGSIELLHVDSAAELDIEASFEVDKVA  477

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    SE TP+YFYI+K   G  +T 
Sbjct  478  LQGIIEADHVGFSCSTSGGAASRGILGPFGIVVIADQTLSELTPVYFYISKGADGRAETH  537

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS+A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  538  FCADQTRSSVAPGVAKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPT  597

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
             A+   A+LF+FNNAT A++TASV++W +   +
Sbjct  598  KAVNGAARLFVFNNATGASVTASVKIWSLESAN  630



>sp|P29000.1|INVA_SOLLC RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Flags: Precursor [Solanum 
lycopersicum]
 pir||S31157 beta-fructofuranosidase (EC 3.2.1.26) precursor - currant tomato
 emb|CAA78060.1| vacuolar invertase precursor [Solanum lycopersicum]
 emb|CAA78061.1| vacuolar invertase precursor [Solanum pimpinellifolium]
 emb|CAA78062.1| beta-fructofuranosidase [Solanum lycopersicum]
 emb|CAA78063.1| beta-fructofuranosidase [Solanum pimpinellifolium]
 gb|AAA34132.1| acid invertase [Solanum lycopersicum]
Length=636

 Score =   421 bits (1083),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 204/329 (62%), Positives = 249/329 (76%), Gaps = 3/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD+P
Sbjct  295  MWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNP  354

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  355  ELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGETDSESADLQKGWASVQSIPRTVL  414

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR      ++V+++PGS+  L V  + ELDI A FEVDK A
Sbjct  415  YDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVA  474

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    SE TP+YFYI+K   G  +T 
Sbjct  475  LQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETH  534

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  535  FCADQTRSSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPT  594

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQM  979
             A+   A+LF+FNNAT A++TASV++W +
Sbjct  595  KAVNGAARLFVFNNATGASVTASVKIWSL  623



>gb|KHN09790.1| Acid beta-fructofuranosidase [Glycine soja]
Length=619

 Score =   421 bits (1082),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 201/329 (61%), Positives = 249/329 (76%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S     GLDTS NG  +KHV+K SLDDDR+DYYAIGTY E S  + PDD 
Sbjct  278  MWECVDFFPVSKKNENGLDTSVNGDEVKHVMKVSLDDDRHDYYAIGTYDEKSVLFTPDDA  337

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D G+GLRYDYG +YASK+FYD +K+RR+ WGW+ E DSE +D+ KGWASVQ IPRT+ 
Sbjct  338  KNDVGVGLRYDYGIFYASKTFYDQNKERRLLWGWIGESDSEYADVAKGWASVQSIPRTVE  397

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPV EVE LR +  +F+ ++ KPGSVV +D+  + +LDI+AEFE+DK+ 
Sbjct  398  LDRKTGSNLLQWPVAEVESLRLRSDEFKNLKAKPGSVVSIDIETATQLDIVAEFEIDKET  457

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K   S+  Y+C  + G+ QRG LGPFGLLV+A +   E+TP YFY+ K + GN KT F
Sbjct  458  LEKTPESNEEYTCGNSGGSKQRGALGPFGLLVLADEGLFEYTPQYFYVIKGSNGNLKTSF  517

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS ANDVRK+  G  VPVL  E  S+RILVDHSIVESFAQGGRT +TSR+YPT 
Sbjct  518  CADQSRSSQANDVRKQIVGSAVPVLKDEKFSLRILVDHSIVESFAQGGRTVVTSRVYPTK  577

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNAT+AT+TAS+ VWQM+
Sbjct  578  AIYGAARLFLFNNATEATVTASLNVWQMN  606



>gb|ADE44160.1| acid invertase [Solanum lycopersicum var. cerasiforme]
Length=636

 Score =   421 bits (1083),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 204/329 (62%), Positives = 249/329 (76%), Gaps = 3/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD+P
Sbjct  295  MWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNP  354

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  355  ELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGETDSESADLQKGWASVQSIPRTVL  414

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR      ++V+++PGS+  L V  + ELDI A FEVDK A
Sbjct  415  YDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVA  474

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    SE TP+YFYI+K   G  +T 
Sbjct  475  LQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETH  534

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  535  FCADQTRSSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPT  594

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQM  979
             A+   A+LF+FNNAT A++TASV++W +
Sbjct  595  KAVNGAARLFVFNNATGASVTASVKIWSL  623



>gb|AAG36943.1|AF274299_1 acid invertase [Brassica oleracea]
Length=662

 Score =   422 bits (1084),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 205/337 (61%), Positives = 251/337 (74%), Gaps = 11/337 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP++KH++K S+DD R D+YAIGTY + +  W PDDP
Sbjct  309  MWECVDFYPVSKTLVKGLDTSVNGPDVKHIVKASMDDTRIDHYAIGTYFDSNGTWTPDDP  368

Query  182  TIDTGIG--LRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            TID GI   LRYDYG +YASK+FYD +K RR+ WGW+ E DSE++D+QKGW+S+QGIPRT
Sbjct  369  TIDVGISTSLRYDYGKFYASKTFYDQNKGRRILWGWIGESDSESADVQKGWSSLQGIPRT  428

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KTG NL+QWPVEEV+ LR    KF+ +EV PGS+VH+DVG + +LDI AEFE+ K
Sbjct  429  VVLDTKTGKNLVQWPVEEVKSLRLSSKKFD-MEVGPGSLVHIDVGSAAQLDIEAEFEIKK  487

Query  536  DAFGKAAG------SDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDT  691
            ++  K  G          +SC  + G++ RG LGPFG  V+A +  SE TP+YFY+AK  
Sbjct  488  ESLEKILGDASAAAEAEEFSCQKSGGSTVRGALGPFGFSVLAHESLSEKTPVYFYVAKGK  547

Query  692  TGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCI  871
                 TFFC D  RSS ANDV K  YG +VPVL GE L+MRILVDHSIVE+F QGGRTCI
Sbjct  548  DSKLITFFCTDSSRSSFANDVVKPIYGSSVPVLKGEKLTMRILVDHSIVEAFGQGGRTCI  607

Query  872  TSRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            TSR+YPT AI   AKLFLFNNA DATITAS +VWQM+
Sbjct  608  TSRVYPTKAIYGAAKLFLFNNAIDATITASFKVWQMN  644



>ref|XP_002446857.1| hypothetical protein SORBIDRAFT_06g023760 [Sorghum bicolor]
 gb|EES11185.1| hypothetical protein SORBIDRAFT_06g023760 [Sorghum bicolor]
Length=679

 Score =   422 bits (1085),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 206/333 (62%), Positives = 253/333 (76%), Gaps = 6/333 (2%)
 Frame = +2

Query  2    MWECVDFYPISTT--EGIGLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRP  172
            MWECVDFYP++     G GL+TS   GP +KHV+K SLDDD++DYYAIGTY   ++ W P
Sbjct  335  MWECVDFYPVAVAANNGDGLETSVPPGPGVKHVVKASLDDDKHDYYAIGTYDPATDTWTP  394

Query  173  DDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPR  352
            DD   D GIGLRYDYG YYASK+FYDP  +RRV WGWV E DSE +D+ KGWASVQ IPR
Sbjct  395  DDAENDVGIGLRYDYGKYYASKTFYDPVLRRRVLWGWVGETDSERADILKGWASVQSIPR  454

Query  353  TILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD  532
            T+L D KTG+NL+QWPV EVE LR    +F+ V +  GSVV LDVGK+ +LDI A FEVD
Sbjct  455  TVLLDTKTGSNLLQWPVVEVENLRMSGKRFDDVALHRGSVVPLDVGKATQLDIEAVFEVD  514

Query  533  KDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFK  706
              A      +D+ ++C  +AGA+ RG LGPFGLLV+A +D SE T +YFY+ K T G+ +
Sbjct  515  AAAVEGVTEADVTFNCSTSAGAAGRGLLGPFGLLVLADEDLSEQTAVYFYLVKGTDGSLQ  574

Query  707  TFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIY  886
            TFFC D LR+S AND+ K+ YG  VPVLDGE+LS+RILVDHSIVESFAQGGRTCITSR+Y
Sbjct  575  TFFCQDELRASKANDLVKRVYGSLVPVLDGENLSVRILVDHSIVESFAQGGRTCITSRVY  634

Query  887  PTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            PT AI + A++FLFNNATD  + A SV++WQ++
Sbjct  635  PTRAIYDSARVFLFNNATDVHVKAKSVKIWQLN  667



>gb|AEV46287.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46288.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   421 bits (1082),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 203/329 (62%), Positives = 248/329 (75%), Gaps = 3/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD+P
Sbjct  298  MWECVDFYPVSTEKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLTKNKWTPDNP  357

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGL+ DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  358  ELDCGIGLKLDYGKYYASKTFYDPKKQRRVLWGWIGETDSESADLQKGWASVQSIPRTVL  417

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR      ++V ++PGS+  L V  + ELDI A FEVDK A
Sbjct  418  YDKKTGTHLLQWPVEEIESLRVGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEVDKVA  477

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    SE TP+YFYI+K   G  +T 
Sbjct  478  LQGIIEADHVGFSCSTSGGAASRGILGPFGVVVIADQKLSELTPVYFYISKGADGRAETH  537

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  538  FCADQTRSSEAPGVAKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPT  597

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQM  979
             A+   A+LF+FNNAT A++TASV++W +
Sbjct  598  KAVNGAARLFVFNNATGASVTASVKIWSL  626



>gb|ADM47340.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46290.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46291.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46292.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46293.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   421 bits (1081),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 202/329 (61%), Positives = 249/329 (76%), Gaps = 3/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD+P
Sbjct  298  MWECVDFYPVSTEKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLTKNKWTPDNP  357

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGL+ DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  358  ELDCGIGLKLDYGKYYASKTFYDPKKQRRVLWGWIGETDSESADLQKGWASVQSIPRTVL  417

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR+     ++V ++PGS+  L V  + ELDI A FEVDK A
Sbjct  418  YDKKTGTHLLQWPVEEIESLRAGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEVDKVA  477

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    SE TP+YFYI+K   G  +T 
Sbjct  478  LQGIIEADHVGFSCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFYISKGADGRAETH  537

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  538  FCADQTRSSEAPGVAKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPT  597

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQM  979
             A+   A+LF+FNNAT +++TASV++W +
Sbjct  598  KAVNGAARLFVFNNATGSSVTASVKIWSL  626



>ref|XP_003549902.1| PREDICTED: acid beta-fructofuranosidase-like isoform 1 [Glycine 
max]
Length=645

 Score =   421 bits (1081),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 201/329 (61%), Positives = 249/329 (76%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S     GLDTS NG  +KHV+K SLDDDR+DYYAIGTY E S  + PDD 
Sbjct  304  MWECVDFFPVSKKNENGLDTSVNGDEVKHVMKVSLDDDRHDYYAIGTYDEKSVLFTPDDA  363

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D G+GLRYDYG +YASK+FYD +K+RR+ WGW+ E DSE +D+ KGWASVQ IPRT+ 
Sbjct  364  KNDVGVGLRYDYGIFYASKTFYDQNKERRLLWGWIGESDSEYADVAKGWASVQSIPRTVE  423

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPV EVE LR +  +F+ ++ KPGSVV +D+  + +LDI+AEFE+DK+ 
Sbjct  424  LDRKTGSNLLQWPVAEVESLRLRSDEFKNLKAKPGSVVSIDIETATQLDIVAEFEIDKET  483

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K   S+  Y+C  + G+ QRG LGPFGLLV+A +   E+TP YFY+ K + GN KT F
Sbjct  484  LEKTPESNEEYTCGNSGGSKQRGALGPFGLLVLADEGLFEYTPQYFYVIKGSNGNLKTSF  543

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS ANDVRK+  G  VPVL  E  S+RILVDHSIVESFAQGGRT +TSR+YPT 
Sbjct  544  CADQSRSSQANDVRKQIVGSAVPVLKDEKFSLRILVDHSIVESFAQGGRTVVTSRVYPTK  603

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNAT+AT+TAS+ VWQM+
Sbjct  604  AIYGAARLFLFNNATEATVTASLNVWQMN  632



>gb|ABF18956.1| acid invertase [Solanum tuberosum]
Length=639

 Score =   421 bits (1081),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 202/329 (61%), Positives = 249/329 (76%), Gaps = 3/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD+P
Sbjct  298  MWECVDFYPVSTEKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLTKNKWTPDNP  357

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGL+ DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  358  ELDCGIGLKLDYGKYYASKTFYDPKKQRRVLWGWIGETDSESADLQKGWASVQSIPRTVL  417

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR+     ++V ++PGS+  L V  + ELDI A FEVDK A
Sbjct  418  YDKKTGTHLLQWPVEEIESLRAGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEVDKVA  477

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    SE TP+YF+I+K   G  +T 
Sbjct  478  LQGIIEADHVGFSCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFFISKGADGRAETH  537

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  538  FCADQTRSSEAPGVAKRVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPT  597

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQM  979
             A+   A+LF+FNNAT A++TASV++W +
Sbjct  598  KAVNGAARLFVFNNATGASVTASVKIWSL  626



>gb|AAL75450.1|AF465613_1 minor allergen beta-fructofuranosidase precursor [Solanum lycopersicum]
Length=636

 Score =   420 bits (1080),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 203/329 (62%), Positives = 249/329 (76%), Gaps = 3/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD+P
Sbjct  295  MWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNP  354

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYDP ++RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  355  ELDCGIGLRLDYGKYYASKTFYDPKRERRVLWGWIGETDSESADLQKGWASVQSIPRTVL  414

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR      ++V+++PGS+  L V  + ELDI A FEVDK A
Sbjct  415  YDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVA  474

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    SE TP+YFYI+K   G  +T 
Sbjct  475  LQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETH  534

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  535  FCADQTRSSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPT  594

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQM  979
             A+   A+LF+FNNAT A++TASV++W +
Sbjct  595  KAVNGAARLFVFNNATGASVTASVKIWSL  623



>gb|AAQ17074.1| acid invertase [Solanum tuberosum]
Length=639

 Score =   420 bits (1080),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 202/333 (61%), Positives = 250/333 (75%), Gaps = 3/333 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD+P
Sbjct  298  MWECVDFYPVSTEKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLTKNKWTPDNP  357

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGL+ DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  358  ELDCGIGLKLDYGKYYASKTFYDPKKQRRVLWGWIGETDSESADLQKGWASVQSIPRTVL  417

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR+     ++V ++PGS+  L V  + ELDI A FEVDK A
Sbjct  418  YDKKTGTHLLQWPVEEIESLRAGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEVDKVA  477

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    SE TP+YF+I+K   G  +T 
Sbjct  478  LQGIIEADHVGFSCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFFISKGADGRAETH  537

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  538  FCADQTRSSEAPGVAKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPT  597

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
             A+   A+LF+FNNAT A++TASV++W +   +
Sbjct  598  KAVNGAARLFVFNNATGASVTASVKIWSLESAN  630



>gb|AEV46294.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46295.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   420 bits (1079),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 202/329 (61%), Positives = 248/329 (75%), Gaps = 3/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD P
Sbjct  298  MWECVDFYPVSTEKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLTKNKWTPDKP  357

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGL+ DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  358  ELDCGIGLKLDYGKYYASKTFYDPKKQRRVLWGWIGETDSESADLQKGWASVQSIPRTVL  417

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR+     ++V ++PGS+  L V  + ELDI A FEVDK A
Sbjct  418  YDKKTGTHLLQWPVEEIESLRAGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEVDKVA  477

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    SE TP+YF+I+K   G  +T 
Sbjct  478  LQGIIEADHVGFSCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFFISKGADGRAETH  537

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  538  FCADQTRSSEAPGVAKRVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPT  597

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQM  979
             A+   A+LF+FNNAT A++TASV++W +
Sbjct  598  KAVNGAARLFVFNNATGASVTASVKIWSL  626



>gb|ACC93585.1| beta-fructofuranosidase [Solanum tuberosum]
Length=639

 Score =   419 bits (1078),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 202/329 (61%), Positives = 248/329 (75%), Gaps = 3/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD P
Sbjct  298  MWECVDFYPVSTEKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLTKNKWTPDKP  357

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGL+ DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  358  ELDCGIGLKLDYGKYYASKTFYDPKKQRRVLWGWIGETDSESADLQKGWASVQSIPRTVL  417

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR+     ++V ++PGS+  L V  + ELDI A FEVDK A
Sbjct  418  YDKKTGTHLLQWPVEEIESLRAGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEVDKVA  477

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    SE TP+YF+I+K   G  +T 
Sbjct  478  LQGIIEADHVGFSCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFFISKGADGRAETH  537

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  538  FCADQTRSSEAPGVAKRVYGSSVPVLDGEKRSMRLLVDHSIVESFAQGGRTVITSRIYPT  597

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQM  979
             A+   A+LF+FNNAT A++TASV++W +
Sbjct  598  KAVNGAARLFVFNNATGASVTASVKIWSL  626



>gb|AEV46296.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   419 bits (1077),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 201/333 (60%), Positives = 249/333 (75%), Gaps = 3/333 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD+P
Sbjct  298  MWECVDFYPVSTEKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLTKNKWTPDNP  357

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGL+ DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  358  ELDCGIGLKLDYGKYYASKTFYDPKKQRRVLWGWIGETDSESADLQKGWASVQSIPRTVL  417

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KT T+L+QWPVEE+E LR+     ++  ++PGS+  L V  + ELDI A FEVDK A
Sbjct  418  YDKKTRTHLLQWPVEEIESLRAGDPIVKQANLQPGSIELLHVDSAAELDIEASFEVDKVA  477

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    SE TP+YFYI+K   G  +T 
Sbjct  478  LQGIIEADHVGFSCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFYISKGADGRAQTH  537

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS+A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  538  FCADQTRSSVAPGVAKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPT  597

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
             A+   A+LF+FNNAT A++TASV++W +   +
Sbjct  598  KAVNGAARLFVFNNATGASVTASVKIWSLESAN  630



>ref|NP_001234843.1| acid invertase [Solanum lycopersicum]
 gb|AAB30874.1| acid invertase [Solanum lycopersicum]
Length=636

 Score =   419 bits (1077),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 202/333 (61%), Positives = 251/333 (75%), Gaps = 3/333 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GL+TSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD+P
Sbjct  295  MWECVDFYPVSTKKTNGLETSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNP  354

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  355  ELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGETDSESADLQKGWASVQSIPRTVL  414

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR      ++V+++PGS+  L V  + ELDI A FEVDK A
Sbjct  415  YDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVA  474

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    S+ TP+YFYI+K   G  +T 
Sbjct  475  LQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSDVTPVYFYISKGADGRAETH  534

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  535  FCADQTRSSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPT  594

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
             A+   A+LF+FNNAT A++TASV++W +  ++
Sbjct  595  KAVNGAARLFVFNNATGASVTASVKIWSLESVN  627



>ref|NP_563901.1| acid beta-fructofuranosidase 4 [Arabidopsis thaliana]
 sp|Q39041.2|INVA4_ARATH RecName: Full=Acid beta-fructofuranosidase 4, vacuolar; Short=At 
beta fruct4; Short=AtBETAFRUCT4; AltName: Full=Acid invertase 
4; Short=AI 4; AltName: Full=Acid sucrose hydrolase 4; 
AltName: Full=Vacuolar invertase 4; Short=Inv-V4; Short=VAC-INV 
4; Short=VI 4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG12569.1|AC022522_2 beta-fructosidase [Arabidopsis thaliana]
 emb|CAA72321.1| beta-fructosidase [Arabidopsis thaliana]
 gb|AAK76683.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AAN13204.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AEE28855.1| acid beta-fructofuranosidase 4 [Arabidopsis thaliana]
Length=664

 Score =   419 bits (1078),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 204/337 (61%), Positives = 252/337 (75%), Gaps = 11/337 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T G GLDTS NGP++KH++K S+DD R D+YA+GTY + +  W PDDP
Sbjct  311  MWECVDFYPVSKTAGNGLDTSVNGPDVKHIVKASMDDTRFDHYAVGTYFDSNGTWIPDDP  370

Query  182  TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            TID G+   LRYDYG +YASKSFYD +K RRV W W+ E DSE SD+QKGW+S+QGIPRT
Sbjct  371  TIDVGMTASLRYDYGKFYASKSFYDQNKGRRVLWSWIGESDSEASDVQKGWSSLQGIPRT  430

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KTG NL+QWPVEE++ LR    +F+ +EV PGSVV +DVG + +LDI AEFE++K
Sbjct  431  VVLDTKTGKNLVQWPVEEIKSLRLSSKQFD-LEVGPGSVVPVDVGSAAQLDIEAEFEINK  489

Query  536  DAFGKAAGSDI------PYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDT  691
            ++  K  G+         +SC  + G++ RG LGPFG  V+A +  SE TP+YFY+AK  
Sbjct  490  ESLDKIIGNASVVAEAEEFSCEKSGGSTVRGALGPFGFSVLATESLSEQTPVYFYVAKGK  549

Query  692  TGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCI  871
                KTFFC D  RSS+ANDV K  YG  VPVL GE L+MRILVDHSIVE+F QGGRTCI
Sbjct  550  DSELKTFFCTDTSRSSVANDVVKPIYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTCI  609

Query  872  TSRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            TSR+YPT+AI   AKLFLFNNA DAT+TAS  VWQM+
Sbjct  610  TSRVYPTTAIYGAAKLFLFNNALDATVTASFTVWQMN  646



>emb|CAA66330.1| beta-fructosidase [Arabidopsis thaliana]
Length=660

 Score =   419 bits (1078),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 204/337 (61%), Positives = 252/337 (75%), Gaps = 11/337 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T G GLDTS NGP++KH++K S+DD R D+YA+GTY + +  W PDDP
Sbjct  307  MWECVDFYPVSKTAGNGLDTSVNGPDVKHIVKASMDDTRFDHYAVGTYFDSNGTWIPDDP  366

Query  182  TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            TID G+   LRYDYG +YASKSFYD +K RRV W W+ E DSE SD+QKGW+S+QGIPRT
Sbjct  367  TIDVGMTASLRYDYGKFYASKSFYDQNKGRRVLWSWIGESDSEASDVQKGWSSLQGIPRT  426

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KTG NL+QWPVEE++ LR    +F+ +EV PGSVV +DVG + +LDI AEFE++K
Sbjct  427  VVLDTKTGKNLVQWPVEEIKSLRLSSKQFD-LEVGPGSVVPVDVGSAAQLDIEAEFEINK  485

Query  536  DAFGKAAGSDI------PYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDT  691
            ++  K  G+         +SC  + G++ RG LGPFG  V+A +  SE TP+YFY+AK  
Sbjct  486  ESLDKIIGNASVVAEAEEFSCEKSGGSTVRGALGPFGFSVLATESLSEQTPVYFYVAKGK  545

Query  692  TGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCI  871
                KTFFC D  RSS+ANDV K  YG  VPVL GE L+MRILVDHSIVE+F QGGRTCI
Sbjct  546  DSELKTFFCTDTSRSSVANDVVKPIYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTCI  605

Query  872  TSRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            TSR+YPT+AI   AKLFLFNNA DAT+TAS  VWQM+
Sbjct  606  TSRVYPTTAIYGAAKLFLFNNALDATVTASFTVWQMN  642



>gb|AFU25742.1| soluble acid invertase 2 [Rhododendron hybrid cultivar]
Length=643

 Score =   419 bits (1077),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 200/337 (59%), Positives = 254/337 (75%), Gaps = 5/337 (1%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWEC+D    +T++  GLDTS+NGP IKHVLK SLD+++ DYYAIGTY   +  W PD+P
Sbjct  310   MWECIDITRRTTSDANGLDTSFNGPGIKHVLKASLDNEKKDYYAIGTYDPVNNTWTPDNP  369

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              +D GIGLR DYG YYASK+FYD +K+RR++W W+ E D+E+ DL KGWASVQ IPRT++
Sbjct  370   EMDVGIGLRVDYGVYYASKTFYDQNKQRRISWSWIGETDNESDDLLKGWASVQTIPRTVV  429

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             FD KTG+N++QWP EEVE+LR   ++F  VE+ PGSVV L++  + +LDI+A FEVDK A
Sbjct  430   FDKKTGSNILQWPAEEVERLRLNVTEFNGVELGPGSVVPLNISSATQLDIVATFEVDKAA  489

Query  542   FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                   +D  ++C  T GA  RG LGPFGLLV+A +  SE TP+YFYI+K   G++KTFF
Sbjct  490   LEATTEADAGHTCSTTGGAVSRGALGPFGLLVLADESLSELTPVYFYISKFIDGSYKTFF  549

Query  716   CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
             C+D +RSS A+ V K+  G TVPVL+GE  SMR+LVDHSIVESFAQGGRT ITSRIYPT 
Sbjct  550   CSDEMRSSKASSVNKRVNGGTVPVLEGEKYSMRLLVDHSIVESFAQGGRTVITSRIYPTR  609

Query  896   AIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPH  1006
             AI   A++FLFNNAT   +TAS+++WQ   MDSA  H
Sbjct  610   AIDGAARVFLFNNATGTNVTASLKIWQ---MDSAHIH  643



>gb|KDO65461.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=464

 Score =   412 bits (1060),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 203/337 (60%), Positives = 249/337 (74%), Gaps = 7/337 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP++    +GLDTS  GP IKHVLK SLDD + D+YAIGTY   ++KW PD+P
Sbjct  130   MWECVDFYPVAINGSVGLDTSATGPGIKHVLKASLDDTKVDHYAIGTYNPANDKWTPDNP  189

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
               D GIGL++DYG YYASKSFYDP KKRR+ WGW+ E D+E+ DL+KGWASVQ IPRT+L
Sbjct  190   EEDVGIGLKWDYGRYYASKSFYDPYKKRRIVWGWINETDTESDDLEKGWASVQTIPRTVL  249

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             +DNKTG+N++QWPVEE+E LR   + FE+V V+PGSVV LD+G + +LDI AEFE   + 
Sbjct  250   YDNKTGSNVVQWPVEEIESLRQNSTVFEEVVVEPGSVVPLDIGVATQLDISAEFET--EL  307

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
              G  A  +  Y C+ GA  R  +GPFGLLV A D  SE TPI+F  + +TT    T+FCA
Sbjct  308   LGSGAMEE-GYGCSGGAIDRSAMGPFGLLVNAHDSLSELTPIFFR-SSNTTKGTNTYFCA  365

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSSLA DV K+ +G  VPVL GE LSMRILVDHSIVESF QGGRT ITSRIYPT AI
Sbjct  366   DETRSSLAPDVFKQVHGSKVPVLQGEKLSMRILVDHSIVESFGQGGRTVITSRIYPTKAI  425

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
                A+LFLFNNAT   + A++++W+   ++SA  H F
Sbjct  426   YGAARLFLFNNATGVNVKATLKIWR---LNSAFIHPF  459



>sp|O24509.1|INVA_PHAVU RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Flags: Precursor [Phaseolus 
vulgaris]
 gb|AAB68679.1| soluble acid invertase [Phaseolus vulgaris]
Length=651

 Score =   418 bits (1075),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 196/331 (59%), Positives = 252/331 (76%), Gaps = 4/331 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSY--NGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPD  175
            MWECVDF+P+S     GLDTS   NG  +K+V+K SLDDDR+DYY IGTY E    + PD
Sbjct  306  MWECVDFFPVSKKNENGLDTSLSINGAEVKYVMKVSLDDDRHDYYTIGTYDENKVLFTPD  365

Query  176  DPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            D   D G+GLRYDYG +YASK+FYD +  RR+ WGW+ E DSE +D+ KGWASVQ IPRT
Sbjct  366  DVKNDVGVGLRYDYGIFYASKTFYDQNMDRRILWGWIGESDSEYADVTKGWASVQSIPRT  425

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            +  D KTG+NL+QWPV EVE LR +  +F+ ++ KPGSVV LD+  + +LD++AEFE+D 
Sbjct  426  VRLDKKTGSNLLQWPVAEVESLRLRSDEFKSLKAKPGSVVSLDIETATQLDVVAEFEIDA  485

Query  536  DAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKT  709
            ++  K A S+  ++C  + GA+QRG LGPFGLLV+A +  SE+TP+YFY+ K   GN KT
Sbjct  486  ESLQKTAQSNEEFTCSTSGGAAQRGALGPFGLLVLADEGLSEYTPVYFYVIKGRNGNLKT  545

Query  710  FFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYP  889
             FC+D  RSS  NDVRK+ +G  VPVL+GE  S+R+LVDHSIVESFAQGGRTC+TSR+YP
Sbjct  546  SFCSDQSRSSQPNDVRKQIFGNIVPVLEGEKFSLRMLVDHSIVESFAQGGRTCVTSRVYP  605

Query  890  TSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            T AI   A+LFLFNNAT+AT+TAS+++WQM+
Sbjct  606  TKAIYGAARLFLFNNATEATVTASLKIWQMN  636



>ref|XP_010933713.1| PREDICTED: beta-fructofuranosidase 1 [Elaeis guineensis]
Length=644

 Score =   418 bits (1075),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 207/331 (63%), Positives = 253/331 (76%), Gaps = 4/331 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDD  178
            MWECVDFYP+ST   +GLDTS   GP +KHVLK SLDD+++DYYAIGTY      W PDD
Sbjct  305  MWECVDFYPVSTASKVGLDTSTGPGPGVKHVLKASLDDNKHDYYAIGTYDGEEGTWTPDD  364

Query  179  PTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTI  358
              +D GIGLRYDYG YYASK+FYDP K+RRV WGW  E DSE +DL KGWASVQ IPRT+
Sbjct  365  QEMDVGIGLRYDYGKYYASKTFYDPVKERRVLWGWSGETDSEKTDLLKGWASVQTIPRTV  424

Query  359  LFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
             +D+KTG NL+QWPV+EVEKLR    +F  + +  GSV  LD+ K+ +LDI A+FE+D  
Sbjct  425  TYDDKTGRNLLQWPVDEVEKLRQSSQEFSNITLGVGSVAPLDISKATQLDIEAKFEIDAS  484

Query  539  AFGKAAGSDIPYSCTAG--ASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
            A  +A  +D+ Y+C+    A+ RG LGPFGLLV+A  D SE T +YFY+ + T G F TF
Sbjct  485  ALERAIEADVGYNCSTSGGAAGRGALGPFGLLVLADQDLSEQTAVYFYLGRGTDGGFGTF  544

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FC D LRSSLAND+ K+ YG +VPVLDGESL++RILVDHSIVESFAQGGRTCITSR+YPT
Sbjct  545  FCQDELRSSLANDLVKRVYGSSVPVLDGESLTVRILVDHSIVESFAQGGRTCITSRVYPT  604

Query  893  SAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
             AI   A++FLFNNAT A +TA S+++WQM+
Sbjct  605  EAIYGGARVFLFNNATGAPVTAKSIKIWQMN  635



>emb|CAA49831.1| beta-fructofuranosidase [Solanum tuberosum]
Length=634

 Score =   417 bits (1073),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 202/329 (61%), Positives = 247/329 (75%), Gaps = 3/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD+P
Sbjct  293  MWECVDFYPVSTEKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLTKNKWTPDNP  352

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGL+ DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  353  ELDCGIGLKLDYGKYYASKTFYDPKKQRRVLWGWIGETDSESADLQKGWASVQSIPRTVL  412

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR      ++V ++PGS+  L V  + ELDI A FEVDK A
Sbjct  413  YDKKTGTHLLQWPVEEIESLRVGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEVDKVA  472

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    SE TP+YFYI+K   G  +T 
Sbjct  473  LQGIIEADHVGFSCSTSGGAASRGILGPFGVVVIADQKLSELTPVYFYISKGADGRAETH  532

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS A  V K+ YG +VPVLDGE  SMR+L DHSIVESFAQGGRT ITSRIYPT
Sbjct  533  FCADQTRSSEAPGVAKQVYGSSVPVLDGEKHSMRLLEDHSIVESFAQGGRTVITSRIYPT  592

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQM  979
             A+   A+LF+FNNAT A++TASV++W +
Sbjct  593  KAVNGAARLFVFNNATGASVTASVKIWSL  621



>ref|XP_009619840.1| PREDICTED: acid beta-fructofuranosidase AIV-18-like [Nicotiana 
tomentosiformis]
 emb|CAC83577.2| vacuolar invertase [Nicotiana tabacum]
Length=643

 Score =   417 bits (1073),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 198/332 (60%), Positives = 249/332 (75%), Gaps = 2/332 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST E  GLDTSYNGP IKHVLK SLDDD++DYYAIGTY     KW PD+P
Sbjct  303  MWECVDFYPVSTDEANGLDTSYNGPGIKHVLKASLDDDKHDYYAIGTYDPVKNKWTPDNP  362

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYDP ++RR+ WGW+ E DSE +DL KGWASVQ IPRT+L
Sbjct  363  QLDVGIGLRLDYGKYYASKTFYDPKEQRRILWGWIGETDSEAADLLKGWASVQSIPRTVL  422

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D +T T+++QWPV+E+E LR      ++V ++PGS+  + V  + +LD+ A FEVDK A
Sbjct  423  YDKETRTHVLQWPVKEIESLRIGDPLVKRVNLQPGSIELVHVDSAAQLDVEASFEVDKAA  482

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                  +D+ ++C  + GA++RG LGPFG++VIA    SE TP+YFYIAK   G  +T+F
Sbjct  483  LEGTIEADVGFNCSTSGGAAKRGILGPFGVVVIADQTLSELTPVYFYIAKGPDGRAETYF  542

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS A  V K+ YG +VPVLD E  SMR+LVDHSIVESFAQGGRT ITSRIYPT 
Sbjct  543  CADETRSSEAPGVAKQVYGSSVPVLDDEQHSMRLLVDHSIVESFAQGGRTVITSRIYPTK  602

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            AI   A+LF+FNNAT A++TAS+++W +   D
Sbjct  603  AINGAARLFVFNNATRASVTASLKIWSLESAD  634



>gb|ABX55832.1| soluble acid invertase [Cucumis melo]
Length=636

 Score =   417 bits (1072),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 202/329 (61%), Positives = 248/329 (75%), Gaps = 3/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD+P
Sbjct  295  MWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNP  354

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  355  ELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGETDSESADLQKGWASVQSIPRTVL  414

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR      ++V+++ GS+  L    + ELDI A FEVDK A
Sbjct  415  YDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQSGSIELLRADSAAELDIEASFEVDKVA  474

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    SE TP+YFYI+K   G+ +T 
Sbjct  475  LQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGHAETH  534

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  535  FCADQTRSSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPT  594

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQM  979
             A+   A+LF+FNNAT A++TASV++W +
Sbjct  595  KAVNGAARLFVFNNATGASVTASVKIWSL  623



>ref|XP_007155629.1| hypothetical protein PHAVU_003G217900g [Phaseolus vulgaris]
 gb|ESW27623.1| hypothetical protein PHAVU_003G217900g [Phaseolus vulgaris]
Length=651

 Score =   417 bits (1073),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 196/331 (59%), Positives = 252/331 (76%), Gaps = 4/331 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSY--NGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPD  175
            MWECVDF+P+S     GLDTS   NG  +K+V+K SLDDDR+DYY IGTY E    + PD
Sbjct  306  MWECVDFFPVSKKNENGLDTSLSINGAEVKYVMKVSLDDDRHDYYTIGTYDENKVLFTPD  365

Query  176  DPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            D   D G+GLRYDYG +YASK+FYD +  RR+ WGW+ E DSE +D+ KGWASVQ IPRT
Sbjct  366  DVKNDVGVGLRYDYGIFYASKTFYDQNMDRRILWGWIGESDSEYADVTKGWASVQSIPRT  425

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            +  D KTG+NL+QWPV EVE LR +  +F+ ++ KPGSVV LD+  + +LD++AEF +D 
Sbjct  426  VRLDKKTGSNLLQWPVAEVESLRLRSDEFKSLKAKPGSVVSLDIETATQLDVVAEFVIDA  485

Query  536  DAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKT  709
            ++  K A S+  ++C  + GA+QRG LGPFGLLV+A +  SE+TP+YFY+ K   GN KT
Sbjct  486  ESLQKTAQSNEEFTCSTSGGAAQRGALGPFGLLVLADEGLSEYTPVYFYVIKGRNGNLKT  545

Query  710  FFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYP  889
             FC+D  RSS ANDVRK+ +G  VPVL+GE  S+R+LVDHSIVESFAQGGRTC+TSR+YP
Sbjct  546  SFCSDQSRSSQANDVRKQIFGNIVPVLEGEKFSLRMLVDHSIVESFAQGGRTCVTSRVYP  605

Query  890  TSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            T AI   A+LFLFNNAT+AT+TAS+++WQM+
Sbjct  606  TKAIYGAARLFLFNNATEATVTASLKIWQMN  636



>emb|CBI24585.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   414 bits (1063),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/333 (60%), Positives = 256/333 (77%), Gaps = 3/333 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS +GP IKHVLK S+DD+R+DYYA+G Y   ++ W PDDP
Sbjct  201  MWECVDFYPVSINGVYGLDTSAHGPGIKHVLKASMDDNRHDYYALGEYDPMTDTWTPDDP  260

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYD  KKRR+ +GW++E D E+ DL+KGWAS+Q IPRT+L
Sbjct  261  ELDVGIGLRLDYGKYYASKTFYDQVKKRRILYGWISEGDIESDDLKKGWASLQSIPRTVL  320

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             DNKTGT L+ WP+EEVE LR+  ++FE V ++PGSVV LD+G + +LDI+AEFEVD + 
Sbjct  321  HDNKTGTYLLLWPIEEVESLRTNSTEFEDVLLEPGSVVPLDIGSASQLDIVAEFEVDNET  380

Query  542  FGKAAGSDIPYSCTAG--ASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                  +D+ Y+C+    A+ RG LGPFG+LV+A D  SE TPIYFYIAKDT G++KTFF
Sbjct  381  LEAMVEADVIYNCSTSAGAAGRGALGPFGILVLADDTLSELTPIYFYIAKDTDGSYKTFF  440

Query  716  CADHLRSSLA-NDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            C D  RSSLA +DV ++ YG  VPVLD E  +MR+LVDHSIVE F+QGGR+CIT+R+YPT
Sbjct  441  CTDLSRSSLAVDDVDQRIYGSIVPVLDDEKPTMRVLVDHSIVEGFSQGGRSCITTRVYPT  500

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
             AI   A+LFLFNNAT   +TAS+++W+M+  D
Sbjct  501  EAIYGAARLFLFNNATGVNVTASIKIWEMASAD  533



>ref|NP_001169591.1| uncharacterized protein LOC100383472 [Zea mays]
 gb|ACN34201.1| unknown [Zea mays]
Length=485

 Score =   411 bits (1057),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/337 (61%), Positives = 249/337 (74%), Gaps = 10/337 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIG------LDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSE  160
            MWECVDFYP++   G        L+TS   GP +KHVLK SLDDD++DYYAIGTY   ++
Sbjct  135  MWECVDFYPVAAGSGAAADSGDGLETSAAPGPGVKHVLKASLDDDKHDYYAIGTYDPATD  194

Query  161  KWRPDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQ  340
             W PD    D GIGLRYDYG YYASK+FYDP  +RRV WGWV E DSE +D+ KGWASVQ
Sbjct  195  TWTPDSAEDDVGIGLRYDYGKYYASKTFYDPVLRRRVLWGWVGETDSERADILKGWASVQ  254

Query  341  GIPRTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAE  520
             IPRT+L D KTG+NL+QWPV EVE LR     F+ V +  GSVV LDVGK+ +LDI A 
Sbjct  255  SIPRTVLLDTKTGSNLLQWPVVEVENLRMSGKSFDGVALDRGSVVPLDVGKATQLDIEAV  314

Query  521  FEVDKDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
            FEVD         +D+ ++C  +AGA+ RG LGPFGLLV+A DD SE T +YFY+ K T 
Sbjct  315  FEVDASDAAAVTEADVTFNCSTSAGAAGRGLLGPFGLLVLADDDLSEQTAVYFYLLKGTD  374

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
            G+ +TFFC D LR+S AND+ K+ YG  VPVLDGE+LS+RILVDHSIVESFAQGGRTCIT
Sbjct  375  GSLQTFFCQDELRASKANDLVKRVYGSLVPVLDGENLSVRILVDHSIVESFAQGGRTCIT  434

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            SR+YPT AI + A++FLFNNAT A + A SV++WQ++
Sbjct  435  SRVYPTRAIYDSARVFLFNNATHAHVKAKSVKIWQLN  471



>ref|XP_009148607.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar-like [Brassica 
rapa]
Length=662

 Score =   417 bits (1073),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 203/337 (60%), Positives = 250/337 (74%), Gaps = 11/337 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP++KH++K S+DD R D+YAIGTY + +  W PDDP
Sbjct  309  MWECVDFYPVSKTLVKGLDTSVNGPDVKHIVKASMDDTRIDHYAIGTYFDSNGTWIPDDP  368

Query  182  TIDTGIG--LRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            TID GI   LRYDYG +YASK+FYD +K RR+ WGW+ E DSE++D+QKGW+S+QGIPRT
Sbjct  369  TIDVGISTSLRYDYGKFYASKTFYDQNKGRRILWGWIGESDSESADVQKGWSSLQGIPRT  428

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KTG NL+QWPV+EV+ LR    KF+ +EV PGS V++DVG + +LDI AEFE+ K
Sbjct  429  VVLDTKTGKNLVQWPVDEVKSLRLSSKKFD-MEVGPGSFVNIDVGSAAQLDIEAEFEIKK  487

Query  536  DAFGKAAG------SDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDT  691
            ++  K  G          +SC  + G++ RG LGPFG  V+A +  SE TP+YFY+AK  
Sbjct  488  ESLDKILGDASAAAEAEEFSCQKSGGSTVRGALGPFGFSVLAHESLSEQTPVYFYVAKGK  547

Query  692  TGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCI  871
                KTFFC D  RSS ANDV K  YG +VPVL+GE L+MRILVDHSIVE+F QGGRTC 
Sbjct  548  DSKLKTFFCTDSSRSSFANDVVKPVYGSSVPVLEGEKLTMRILVDHSIVEAFGQGGRTCT  607

Query  872  TSRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            TSR+YPT AI   AKLFLFNNA DATITAS  VWQM+
Sbjct  608  TSRVYPTKAIYGAAKLFLFNNAIDATITASFNVWQMN  644



>prf||1905419A invertase
Length=635

 Score =   416 bits (1070),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/329 (62%), Positives = 248/329 (75%), Gaps = 4/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD+P
Sbjct  295  MWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNP  354

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  355  ELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGETDSESADLQKGWASVQSIPRTVL  414

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR      ++V+++PGS+  L V  + ELDI A FEVDK A
Sbjct  415  YDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVA  474

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG +VIA    SE TP+YFYI+K   G  +T 
Sbjct  475  LQGIIEADHVGFSCSTSGGAASRGILGPFG-IVIADQTLSELTPVYFYISKGADGRAETH  533

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  534  FCADQTRSSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPT  593

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQM  979
             A+   A+LF+FNNAT A++TASV++W +
Sbjct  594  KAVNGAARLFVFNNATGASVTASVKIWSL  622



>sp|P93761.1|INV1_CAPAN RecName: Full=Acid beta-fructofuranosidase AIV-18; AltName: Full=Acid 
invertase; AltName: Full=Acid sucrose hydrolase [Capsicum 
annuum]
 gb|AAB48484.1| acid beta-fructosidase [Capsicum annuum]
Length=640

 Score =   416 bits (1070),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 198/332 (60%), Positives = 245/332 (74%), Gaps = 2/332 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP IKHVLK SLDD++ D+Y IGTY     K+ PD+P
Sbjct  300  MWECVDFYPVSTLDANGLDTSYNGPGIKHVLKASLDDNKQDHYVIGTYDPVKNKFSPDNP  359

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  360  DLDCGIGLRLDYGRYYASKTFYDPKKQRRVLWGWIGETDSESADLQKGWASVQSIPRTVL  419

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTGT+L+QWPV E+E LRS   K ++V ++PGS+  L V  + + DI A FEVD+  
Sbjct  420  FDKKTGTHLLQWPVAEIESLRSGDPKVKEVNLQPGSIELLHVDSAAQFDIEASFEVDRVT  479

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                  +D+ Y+C  + GA+ RG LGPFG++VIA    SE TP+YFYI++   G  +  F
Sbjct  480  LEGIIEADVGYNCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFYISRGADGRAEAHF  539

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS A  V K+ YG +VPVLDGE   MR+LVDHSIVESFAQGGRT ITSRIYPT 
Sbjct  540  CADQTRSSEAPGVAKQVYGSSVPVLDGEKHRMRLLVDHSIVESFAQGGRTVITSRIYPTK  599

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            A+   A+LF+FNNAT A +TAS+++W +   D
Sbjct  600  AVNGAARLFVFNNATGAIVTASLKIWSLESAD  631



>ref|XP_006417255.1| hypothetical protein EUTSA_v10007016mg [Eutrema salsugineum]
 gb|ESQ35608.1| hypothetical protein EUTSA_v10007016mg [Eutrema salsugineum]
Length=660

 Score =   417 bits (1072),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 201/337 (60%), Positives = 250/337 (74%), Gaps = 11/337 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T+  GL+TS NGP++KH++K S+DD R D+YA+GTY + +  W PDDP
Sbjct  307  MWECVDFYPVSKTDVNGLETSVNGPDVKHIVKASMDDTRIDHYAVGTYFDSNGTWIPDDP  366

Query  182  TIDTGIG--LRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            TID GI   LRYDYG +YASK+FYD +K RR+ WGW++E DSE +D+QKGW+S+QGIPRT
Sbjct  367  TIDVGISTSLRYDYGKFYASKTFYDQNKSRRILWGWISESDSEAADVQKGWSSLQGIPRT  426

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KTG NL+QWPVEE++ LR    KF+ +EV PGS++ +DVG + +LDI AEFE+ K
Sbjct  427  VVLDTKTGKNLVQWPVEEIKSLRLSSKKFD-MEVSPGSMIPIDVGSAAQLDIEAEFEIKK  485

Query  536  DAFGKAAGSDI------PYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDT  691
            ++  K  G+         +SC  + G++ RG LGPFG  V+A +  SE TPIYFY+AK  
Sbjct  486  ESIDKILGNASVVAEAEEFSCQNSGGSTVRGALGPFGFSVLADEKLSEQTPIYFYVAKGK  545

Query  692  TGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCI  871
                KTFFC D  RSS ANDV K  YG  VPVL GE L+MRILVDHSIVE F QGGRTCI
Sbjct  546  DSKLKTFFCTDTSRSSFANDVIKPIYGSVVPVLKGEKLTMRILVDHSIVEGFGQGGRTCI  605

Query  872  TSRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            TSR+YPT AI   AKLFLFNNA DAT+TAS  VWQM+
Sbjct  606  TSRVYPTKAIYGAAKLFLFNNAIDATVTASFTVWQMN  642



>ref|XP_009406946.1| PREDICTED: beta-fructofuranosidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=551

 Score =   413 bits (1062),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 202/334 (60%), Positives = 245/334 (73%), Gaps = 7/334 (2%)
 Frame = +2

Query  2    MWECVDFYPIST---TEGIGLDTS-YNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWR  169
            MWECVDFYP+ST     G GLDTS   G  +KHVLK S+DDDRNDYYAIG+Y      W 
Sbjct  199  MWECVDFYPVSTGGVAAGEGLDTSAVAGDGVKHVLKASMDDDRNDYYAIGSYDLEKNVWV  258

Query  170  PDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIP  349
            PDD   D GIGLRYD+GT+YASK+FYDP+K+RRV WGWV E+DSE +D++KGWAS+Q IP
Sbjct  259  PDDAEADVGIGLRYDWGTFYASKTFYDPAKRRRVLWGWVGEMDSEGADVRKGWASIQAIP  318

Query  350  RTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEV  529
            RT++FD KTG NLIQWPVEEVE LR     F  + V PGSV+ LDVG + +LDI AEF +
Sbjct  319  RTVVFDVKTGGNLIQWPVEEVESLRMSSRNFSGITVAPGSVIPLDVGSATQLDIEAEFVI  378

Query  530  DKDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNF  703
            D+ A      +D+ Y+C  + GA+ RG LGPFGLLV+A    SE T +YFY+A+   G  
Sbjct  379  DEAALMATTEADVGYNCSTSGGAAARGMLGPFGLLVLADKALSEQTAVYFYVARRRDGRL  438

Query  704  KTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRI  883
            +  FC D  RSS AND+ K+  G TVPVLDGE LS+RILVDHSIVESFAQ GRTCITSR+
Sbjct  439  RAHFCQDESRSSKANDIVKRVVGSTVPVLDGEKLSLRILVDHSIVESFAQKGRTCITSRV  498

Query  884  YPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            YPT AI  DA++FLFNNAT+  + A S+  WQ++
Sbjct  499  YPTEAIYGDARVFLFNNATNCNVVAKSLTTWQLN  532



>gb|AAK71504.1| soluble acid invertase FRUCT2 [Ipomoea batatas]
Length=657

 Score =   417 bits (1071),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 205/333 (62%), Positives = 246/333 (74%), Gaps = 3/333 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVD YP+STT   GLDTS NG ++KHVLK SLDDD++DYYA+GTY     KW PD+ 
Sbjct  316  MWECVDLYPVSTTGENGLDTSVNGLDVKHVLKASLDDDKHDYYALGTYDPAKNKWTPDNT  375

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYD +K+RR+ WGW+ E D E  DL KGWAS+Q IPRTI+
Sbjct  376  DLDVGIGLRLDYGKYYASKTFYDQNKQRRILWGWIGETDLEAVDLMKGWASLQAIPRTIV  435

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTGTN++QWPVEEVE LRS      +  ++PGSVV + V +  +LDI A FEVD+  
Sbjct  436  FDKKTGTNVLQWPVEEVESLRSGDPITAEANLEPGSVVPIHVSEGTQLDITASFEVDETL  495

Query  542  FGKAAGS-DIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
                + S D  Y C  + GA  RG LGPFGLLV+A +  SE TP+YFY+AK   G  KT 
Sbjct  496  LETTSESHDSGYDCSNSGGAVTRGSLGPFGLLVVADEKLSELTPVYFYVAKGADGKAKTH  555

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS+A+ V K+ YG +VPVLDGE+ S RIL+DHSIVESFAQGGRT ITSRIYPT
Sbjct  556  FCADQTRSSMASGVEKEVYGSSVPVLDGENYSARILIDHSIVESFAQGGRTVITSRIYPT  615

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
             AI   AK+FLFNNAT AT+TASV++WQM+  D
Sbjct  616  KAIFGAAKVFLFNNATKATVTASVKMWQMNSAD  648



>emb|CDX98080.1| BnaA06g08310D [Brassica napus]
Length=662

 Score =   417 bits (1071),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/349 (59%), Positives = 255/349 (73%), Gaps = 14/349 (4%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S T   GLDTS NGP +KH++K S+DD R D+YAIGTY + +  W PDDP
Sbjct  309   MWECVDFYPVSKTLVKGLDTSVNGPVVKHIVKASMDDTRIDHYAIGTYFDSNGTWIPDDP  368

Query  182   TIDTGIG--LRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
             TID GI   LRYDYG +YASK+FYD +K RR+ WGW+ E DSE++D+QKGW+S+QGIPRT
Sbjct  369   TIDVGISTSLRYDYGKFYASKTFYDQNKGRRILWGWIGESDSESADVQKGWSSLQGIPRT  428

Query  356   ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
             ++ D KTG NL+QWPV+EV+ LR    KF+ +EV PGS V++DVG + +LDI AEFE+ K
Sbjct  429   VVLDTKTGKNLVQWPVDEVKSLRLSSKKFD-MEVGPGSFVNIDVGSAAQLDIEAEFEIKK  487

Query  536   DAFGKAAG------SDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDT  691
             ++  K  G          +SC  + G++ RG LGPFG  V+A +  SE TP+YFY+AK  
Sbjct  488   ESLDKILGDASAAAEAEEFSCQKSGGSTVRGALGPFGFSVLAHESLSEQTPVYFYVAKGK  547

Query  692   TGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCI  871
                 KTFFC D  RSS ANDV K  YG +VPV+ GE L+MRILVDHSIVE+F QGGRTCI
Sbjct  548   DSKLKTFFCTDSSRSSFANDVVKPIYGSSVPVMKGEKLTMRILVDHSIVEAFGQGGRTCI  607

Query  872   TSRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNFNK  1018
             TSR+YPT AI   AKLFLFNNA DATITAS  VWQ   M+SA  H +++
Sbjct  608   TSRVYPTKAIYGAAKLFLFNNAIDATITASFNVWQ---MNSAFIHPYSE  653



>ref|XP_010418267.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like [Camelina 
sativa]
Length=648

 Score =   416 bits (1069),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 203/336 (60%), Positives = 251/336 (75%), Gaps = 10/336 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T+  GLDTS  GP++KH++K S+DD R D+YAIGTY + +  W PD+P
Sbjct  302  MWECVDFYPVSKTKVNGLDTSVKGPDVKHIVKASMDDTRIDHYAIGTYYDSNGTWVPDNP  361

Query  182  TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            +ID GI  GLRYDYG +YASK+FYD +KKRR+ WGW+ E DSE +D+QKGW+SVQGIPRT
Sbjct  362  SIDVGISTGLRYDYGKFYASKTFYDQNKKRRILWGWIGESDSEAADVQKGWSSVQGIPRT  421

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KTG NL+QWPVEE+E LR    KF  ++V PG+VV +DVG + +LDI AEF++ K
Sbjct  422  VVLDTKTGKNLVQWPVEEIESLRLSNKKFH-MKVGPGTVVPIDVGSAAQLDIEAEFKIKK  480

Query  536  D----AFGK-AAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
            +     FG+ +  +D  +SC    G++ RG LGPFG  V+A    SEHTP+YFY+ K   
Sbjct  481  EDLEIIFGEDSVEADEEFSCQNGGGSTVRGALGPFGFSVLADQSLSEHTPVYFYVTKGKD  540

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
               KTFFC D  RS++ANDV K  YG  VPVL GE L+MRILVDHSIVE FAQGGRTCIT
Sbjct  541  SKLKTFFCTDTSRSTMANDVVKPVYGSFVPVLKGEKLTMRILVDHSIVEGFAQGGRTCIT  600

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            SR+YPT AI    KLFLFNNA DATITAS +VWQM+
Sbjct  601  SRVYPTKAIYGATKLFLFNNAIDATITASFKVWQMN  636



>gb|ACC93584.1| beta-fructofuranosidase, partial [Solanum tuberosum]
Length=635

 Score =   415 bits (1067),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 200/329 (61%), Positives = 246/329 (75%), Gaps = 3/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     KW PD P
Sbjct  294  MWECVDFYPVSTEKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLTKNKWTPDKP  353

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGL+ DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  354  ELDCGIGLKLDYGKYYASKTFYDPKKQRRVLWGWIGETDSESADLQKGWASVQSIPRTVL  413

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR+     ++V ++PGS+  L V  + ELDI A FEVDK A
Sbjct  414  YDKKTGTHLLQWPVEEIESLRAGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEVDKVA  473

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    SE TP+YF+I+K   G  +  
Sbjct  474  LQGIIEADHVGFSCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFFISKGADGRAEAH  533

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  534  FCADQTRSSEAPGVAKRVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPT  593

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQM  979
             A+   A+L +FNNAT A++TASV++W +
Sbjct  594  KAVNGAARLVVFNNATGASVTASVKIWSL  622



>gb|AFP23357.1| soluble acid invertase [Litchi chinensis]
Length=643

 Score =   415 bits (1067),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 200/337 (59%), Positives = 246/337 (73%), Gaps = 6/337 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP++    +GLDTS  GP IKHVLK SLDD + D+YA+GTY   S+ W PD+P
Sbjct  311   MWECVDFYPVAINGSMGLDTSAGGPGIKHVLKASLDDTKLDHYALGTYDPDSDTWTPDNP  370

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
               D GIGLRYD G YYASK+FYD  +KRR+ WGW+ E D+E  DL+KGWASVQ IPRT+L
Sbjct  371   EEDVGIGLRYDNGRYYASKTFYDQYRKRRILWGWINETDTEYDDLEKGWASVQTIPRTVL  430

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             FDNKTG N++QWPV+EVE LR +  +FE V ++PGS+V LD+G + +LDI AEFE +   
Sbjct  431   FDNKTGINIVQWPVQEVESLRQRSIEFEDVLIEPGSIVPLDIGTATQLDIFAEFETE---  487

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
               ++AG +  YSC  GA  R  LGPFGLLVIA D  SE TP++F     T G   T+FC 
Sbjct  488   LLESAGEEEGYSCKGGAINRNKLGPFGLLVIADDSLSELTPVFFRPTNTTNGTLDTYFCT  547

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RS+LA +V+K  YG TVPVL+GE  +MR+LVDHSIVESFAQGGRT ITSRIYPT AI
Sbjct  548   DETRSTLAPEVQKHIYGSTVPVLEGERYAMRVLVDHSIVESFAQGGRTVITSRIYPTEAI  607

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
                A+LFLFNNAT   + A++++WQ   M+SA  H F
Sbjct  608   YGSARLFLFNNATGVNVKATLKIWQ---MNSAFIHPF  641



>gb|KDO65460.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=528

 Score =   411 bits (1056),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 203/337 (60%), Positives = 249/337 (74%), Gaps = 7/337 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP++    +GLDTS  GP IKHVLK SLDD + D+YAIGTY   ++KW PD+P
Sbjct  194   MWECVDFYPVAINGSVGLDTSATGPGIKHVLKASLDDTKVDHYAIGTYNPANDKWTPDNP  253

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
               D GIGL++DYG YYASKSFYDP KKRR+ WGW+ E D+E+ DL+KGWASVQ IPRT+L
Sbjct  254   EEDVGIGLKWDYGRYYASKSFYDPYKKRRIVWGWINETDTESDDLEKGWASVQTIPRTVL  313

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             +DNKTG+N++QWPVEE+E LR   + FE+V V+PGSVV LD+G + +LDI AEFE   + 
Sbjct  314   YDNKTGSNVVQWPVEEIESLRQNSTVFEEVVVEPGSVVPLDIGVATQLDISAEFET--EL  371

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
              G  A  +  Y C+ GA  R  +GPFGLLV A D  SE TPI+F  + +TT    T+FCA
Sbjct  372   LGSGAMEE-GYGCSGGAIDRSAMGPFGLLVNAHDSLSELTPIFFR-SSNTTKGTNTYFCA  429

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSSLA DV K+ +G  VPVL GE LSMRILVDHSIVESF QGGRT ITSRIYPT AI
Sbjct  430   DETRSSLAPDVFKQVHGSKVPVLQGEKLSMRILVDHSIVESFGQGGRTVITSRIYPTKAI  489

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
                A+LFLFNNAT   + A++++W+   ++SA  H F
Sbjct  490   YGAARLFLFNNATGVNVKATLKIWR---LNSAFIHPF  523



>ref|XP_002265534.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Vitis vinifera]
Length=649

 Score =   414 bits (1065),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/333 (60%), Positives = 256/333 (77%), Gaps = 3/333 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS +GP IKHVLK S+DD+R+DYYA+G Y   ++ W PDDP
Sbjct  308  MWECVDFYPVSINGVYGLDTSAHGPGIKHVLKASMDDNRHDYYALGEYDPMTDTWTPDDP  367

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG YYASK+FYD  KKRR+ +GW++E D E+ DL+KGWAS+Q IPRT+L
Sbjct  368  ELDVGIGLRLDYGKYYASKTFYDQVKKRRILYGWISEGDIESDDLKKGWASLQSIPRTVL  427

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             DNKTGT L+ WP+EEVE LR+  ++FE V ++PGSVV LD+G + +LDI+AEFEVD + 
Sbjct  428  HDNKTGTYLLLWPIEEVESLRTNSTEFEDVLLEPGSVVPLDIGSASQLDIVAEFEVDNET  487

Query  542  FGKAAGSDIPYSCTAG--ASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                  +D+ Y+C+    A+ RG LGPFG+LV+A D  SE TPIYFYIAKDT G++KTFF
Sbjct  488  LEAMVEADVIYNCSTSAGAAGRGALGPFGILVLADDTLSELTPIYFYIAKDTDGSYKTFF  547

Query  716  CADHLRSSLA-NDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            C D  RSSLA +DV ++ YG  VPVLD E  +MR+LVDHSIVE F+QGGR+CIT+R+YPT
Sbjct  548  CTDLSRSSLAVDDVDQRIYGSIVPVLDDEKPTMRVLVDHSIVEGFSQGGRSCITTRVYPT  607

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
             AI   A+LFLFNNAT   +TAS+++W+M+  D
Sbjct  608  EAIYGAARLFLFNNATGVNVTASIKIWEMASAD  640



>ref|XP_010546426.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar [Tarenaya 
hassleriana]
Length=682

 Score =   415 bits (1067),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 199/331 (60%), Positives = 248/331 (75%), Gaps = 6/331 (2%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+STT   GLDTS NGP ++HV+K S+D+ R DYYAIGTY E +  W PDD 
Sbjct  314  MWECVDFFPVSTTSVNGLDTSVNGPEVRHVMKASMDETRIDYYAIGTYFEENGTWVPDDA  373

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
            T+D G GLRYDYG +YASK+FYD +K RR+ W WV+E DSE++D++KGW+S+Q IPRT+ 
Sbjct  374  TMDVGFGLRYDYGKFYASKTFYDQNKGRRILWSWVSESDSESADVKKGWSSLQSIPRTVA  433

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG NL+QWPVEE+E LR   ++F KVEV PG++V +DVG + +LDI AEFE++K A
Sbjct  434  LDTKTGKNLVQWPVEEIESLRLNSTEF-KVEVGPGTIVPVDVGPAAQLDIEAEFEIEKAA  492

Query  542  F----GKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKT  709
                 G +A ++   SC  GA+ RG LGPFGL VI+ +  SE TP+YFY+ K      KT
Sbjct  493  LERLAGDSAAAEEELSCR-GAASRGALGPFGLSVISDEGLSEQTPVYFYVTKGKDSKLKT  551

Query  710  FFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYP  889
            FFC D  RSS+ANDV K  YG   PV +GE L+MRILVDHSI+E F QGGRTCIT+R+YP
Sbjct  552  FFCTDTSRSSVANDVDKGIYGGFTPVFEGEKLTMRILVDHSIIEGFGQGGRTCITTRVYP  611

Query  890  TSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            T AI E AKLFLFNNAT A +TAS +VWQM+
Sbjct  612  TKAIYEGAKLFLFNNATGANVTASFKVWQMN  642



>gb|AAM52062.1| vacuolar acid invertase PsI-1 [Pisum sativum]
Length=647

 Score =   414 bits (1064),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/326 (60%), Positives = 245/326 (75%), Gaps = 2/326 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S     G DTS NG  +KHV+K SLDDDR+DYY++GTY E   K+  DD 
Sbjct  302  MWECVDFFPVSKKSENGSDTSINGVEVKHVMKVSLDDDRHDYYSLGTYDEKKVKFIADDF  361

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D G+GLRYDYG +YASK+FYD  K RRV WGW+ E DSE +D+ KGWASVQ IPR + 
Sbjct  362  KNDVGVGLRYDYGIFYASKTFYDQKKNRRVLWGWIGESDSEYADVAKGWASVQSIPRIVK  421

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPV EVE LR +  +F+ ++VKPG+VV LD+  + +LDI AEFE+DK+A
Sbjct  422  LDKKTGSNLLQWPVAEVESLRLKSDEFKNLKVKPGAVVSLDIETATQLDIDAEFEIDKEA  481

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K A S++ Y C  + GAS+RG LGPFGL V+A    SE+TP+YFY+ K + G   T F
Sbjct  482  LEKTAQSNVEYECSTSGGASRRGALGPFGLYVLADKGLSEYTPVYFYVVKGSNGKLNTPF  541

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C+D  RSSLANDV K+ YG  VPVL+GE LS+RILVDHSIVESFAQGGRTCITSR+YPT 
Sbjct  542  CSDQSRSSLANDVHKQIYGSVVPVLEGEKLSLRILVDHSIVESFAQGGRTCITSRVYPTR  601

Query  896  AIGEDAKLFLFNNATDATITASVEVW  973
            AI   A+LFLFN+A +  +TAS++VW
Sbjct  602  AIYGAARLFLFNHAIETNVTASLKVW  627



>ref|XP_006653622.1| PREDICTED: beta-fructofuranosidase 1-like [Oryza brachyantha]
Length=622

 Score =   412 bits (1060),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 202/337 (60%), Positives = 249/337 (74%), Gaps = 10/337 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGI--GLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYK-EPSEKWR  169
            MWECVDFYP+S T G+  GL+TS   GP +KHVLK SLDDDRNDYYAIGTY  + ++ W 
Sbjct  277  MWECVDFYPVSATPGVEVGLETSTEPGPGVKHVLKASLDDDRNDYYAIGTYDGKAADTWT  336

Query  170  PDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIP  349
            PDD  ID GIGLRYDYG +YASK+FYDP  +RRV WGW+ E DSE +D+ KGWASVQ IP
Sbjct  337  PDDAEIDVGIGLRYDYGKFYASKTFYDPVGRRRVLWGWIGETDSERADILKGWASVQSIP  396

Query  350  RTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEV  529
            RT+L D KTG NL+QWPV EVE LR +   F+ + + PG++V LDVGK+ +LDI A F+V
Sbjct  397  RTVLLDTKTGGNLLQWPVVEVENLRMRVKSFDGLAISPGTIVPLDVGKATQLDIEAVFQV  456

Query  530  DK---DAFGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
            +    D           YSC+   GA  RG +GPFGLLV+A  + +E T ++FY+ K   
Sbjct  457  NNLITDGVTAVDAGAAAYSCSTGGGAVGRGLMGPFGLLVLADQELTEQTAVFFYLVKGAD  516

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
            GN  TFFC D LRSS AND+  + YG  VPVL+GESLS+RILVDHSIVESFAQGGRTCIT
Sbjct  517  GNLTTFFCQDELRSSKANDLVNRVYGSLVPVLNGESLSIRILVDHSIVESFAQGGRTCIT  576

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            SR+YPT AI E AK+FLFNNAT+  +TA S+++W+++
Sbjct  577  SRVYPTKAIYESAKIFLFNNATNVGVTAKSLKIWELN  613



>ref|XP_010906620.1| PREDICTED: beta-fructofuranosidase 1-like [Elaeis guineensis]
Length=653

 Score =   413 bits (1062),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 198/334 (59%), Positives = 248/334 (74%), Gaps = 7/334 (2%)
 Frame = +2

Query  2    MWECVDFYPISTTEGI----GLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWR  169
            MWECVDF+P++  EG     G+DTS  G  ++HVLK S D+DR DYYAIGTY   +  WR
Sbjct  309  MWECVDFFPVAVEEGPAAVEGMDTSAAGDGVRHVLKASRDNDRQDYYAIGTYNAVTNTWR  368

Query  170  PDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIP  349
            P+D  +D GIGL+YD+G +YASK+FYDP K+RRV WGW+ E DSE +DL KGWAS+Q IP
Sbjct  369  PEDEGMDVGIGLQYDWGNFYASKTFYDPEKRRRVLWGWIGETDSERTDLLKGWASLQAIP  428

Query  350  RTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEV  529
            RT+LFD KT +NL+QWPVEEVEKLR     F  + +  GSV  +++    +LDI AEFE+
Sbjct  429  RTVLFDTKTKSNLLQWPVEEVEKLRMSSKNFSMITIDAGSVFPINITGGTQLDIEAEFEI  488

Query  530  DKDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNF  703
            +K A   A  +D+ Y+C  ++GA+ RG LGPFGLLV+A    SE T +YFYIA+ T GN 
Sbjct  489  EKAALATAVEADVGYNCSTSSGATDRGMLGPFGLLVLANGRLSEKTAVYFYIARGTDGNL  548

Query  704  KTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRI  883
             T FC D LRSS A+D+ K+  G TVPVLDGE LS+RILVDHSIVESFAQGGRTCITSR+
Sbjct  549  HTHFCHDELRSSSASDIVKRVVGSTVPVLDGERLSVRILVDHSIVESFAQGGRTCITSRV  608

Query  884  YPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            YPT AI   AK+FLFNNAT A++TA S+ +W+M+
Sbjct  609  YPTEAIYNAAKVFLFNNATSASVTAKSLTIWKMN  642



>pir||S49256 beta-fructofuranosidase (EC 3.2.1.26) - red goosefoot  (fragment)
Length=513

 Score =   409 bits (1050),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 188/337 (56%), Positives = 253/337 (75%), Gaps = 2/337 (1%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+STT   GLDTS  GP +KH+LK SLDD++ D+YA+GTY   S+ W PD+P
Sbjct  179   MWECVDFYPVSTTGQNGLDTSAYGPGMKHLLKASLDDNKQDHYALGTYDVASQTWTPDNP  238

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              +D GIGLR DYG YYASK+F+D +K+RR+ WGWV E D+E  DL KGW+S+Q +PR + 
Sbjct  239   EMDVGIGLRLDYGKYYASKTFFDQNKQRRILWGWVGETDTEADDLLKGWSSLQSVPRVVT  298

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             +D KTGTN+IQWPV+EVE LR+    ++ + ++PGS+++L++  + +LD+ AEF +D++A
Sbjct  299   YDAKTGTNVIQWPVKEVESLRTDSIVYDNLVLQPGSIINLNITSAAQLDVSAEFMMDQEA  358

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
                  G D+  +C+A A+ R  LGPFG+LV+A    SE TP+YFYIAK + G  K +FC 
Sbjct  359   LKSTVGDDVINNCSA-AAIRQALGPFGVLVLADGSLSEFTPVYFYIAKTSDGTVKNWFCT  417

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSS A+ V K+ YG  VPVL+GE  SMR+LVDHSIVE+F QGGRTCITSRIYPT AI
Sbjct  418   DQSRSSKASSVDKQVYGGPVPVLEGEKYSMRLLVDHSIVEAFGQGGRTCITSRIYPTKAI  477

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
               +A++FLFNNATD ++TASV++W++   D  +P+ F
Sbjct  478   NGEARVFLFNNATDLSVTASVKIWKLKSAD-ISPYKF  513



>ref|XP_002889923.1| beta-fructosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66182.1| beta-fructosidase [Arabidopsis lyrata subsp. lyrata]
Length=663

 Score =   414 bits (1063),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 202/337 (60%), Positives = 250/337 (74%), Gaps = 11/337 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS  GP++KH++K S+DD R D+YA+GTY + +  W PDDP
Sbjct  310  MWECVDFYPVSKTAVNGLDTSVKGPDVKHIVKASMDDTRFDHYAVGTYFDSNGTWIPDDP  369

Query  182  TIDTGIG--LRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            TID G+   LRYDYG +YASK+FYD +K RRV W W+ E DSE +D+QKGW+SVQGIPRT
Sbjct  370  TIDVGMSTSLRYDYGKFYASKTFYDQNKGRRVLWSWIGESDSEAADVQKGWSSVQGIPRT  429

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KTG NL+QWPVEE++ LR    +F+ ++V PGSVV +DVG + +LDI AEFE++K
Sbjct  430  VVLDTKTGKNLVQWPVEEIKSLRLSSKQFD-IKVGPGSVVPVDVGSAAQLDIEAEFEINK  488

Query  536  DAFGKAAGSDI------PYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDT  691
            ++  K  G+         +SC  + G++ RG LGPFG  V+A +  SE TP+YFY+AK  
Sbjct  489  ESLDKILGNASVMAEAEEFSCEKSGGSTVRGALGPFGFSVLATESLSEQTPVYFYVAKGK  548

Query  692  TGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCI  871
                KTFFC D  RSS+ANDV K  YG  VPVL GE L+MRILVDHSIVE+F QGGRTCI
Sbjct  549  DSELKTFFCIDTSRSSVANDVVKLIYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTCI  608

Query  872  TSRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            TSR+YPTSAI   AKLFLFNNA DATITAS  VWQM+
Sbjct  609  TSRVYPTSAIYGAAKLFLFNNALDATITASFRVWQMN  645



>gb|KDO65459.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=642

 Score =   412 bits (1060),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 203/337 (60%), Positives = 249/337 (74%), Gaps = 7/337 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP++    +GLDTS  GP IKHVLK SLDD + D+YAIGTY   ++KW PD+P
Sbjct  308   MWECVDFYPVAINGSVGLDTSATGPGIKHVLKASLDDTKVDHYAIGTYNPANDKWTPDNP  367

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
               D GIGL++DYG YYASKSFYDP KKRR+ WGW+ E D+E+ DL+KGWASVQ IPRT+L
Sbjct  368   EEDVGIGLKWDYGRYYASKSFYDPYKKRRIVWGWINETDTESDDLEKGWASVQTIPRTVL  427

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             +DNKTG+N++QWPVEE+E LR   + FE+V V+PGSVV LD+G + +LDI AEFE   + 
Sbjct  428   YDNKTGSNVVQWPVEEIESLRQNSTVFEEVVVEPGSVVPLDIGVATQLDISAEFET--EL  485

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
              G  A  +  Y C+ GA  R  +GPFGLLV A D  SE TPI+F  + +TT    T+FCA
Sbjct  486   LGSGAMEE-GYGCSGGAIDRSAMGPFGLLVNAHDSLSELTPIFFR-SSNTTKGTNTYFCA  543

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSSLA DV K+ +G  VPVL GE LSMRILVDHSIVESF QGGRT ITSRIYPT AI
Sbjct  544   DETRSSLAPDVFKQVHGSKVPVLQGEKLSMRILVDHSIVESFGQGGRTVITSRIYPTKAI  603

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
                A+LFLFNNAT   + A++++W+   ++SA  H F
Sbjct  604   YGAARLFLFNNATGVNVKATLKIWR---LNSAFIHPF  637



>gb|AAA50305.1| beta-fructosidase [Solanum tuberosum]
Length=639

 Score =   412 bits (1059),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 200/329 (61%), Positives = 246/329 (75%), Gaps = 3/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST +  GLDTSYNGP +KHVLK SLDD++ D+YAIGTY     K  PD+P
Sbjct  298  MWECVDFYPVSTEKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLTKNKCTPDNP  357

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGL+ DYG YYASK+FYDP K+RRV WGW+ E DSE++DLQKGWASVQ IPRT+L
Sbjct  358  ELDCGIGLKLDYGKYYASKTFYDPKKQRRVLWGWIGETDSESADLQKGWASVQSIPRTVL  417

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTGT+L+QWPVEE+E LR      ++V ++PGS+  L V  + ELDI A FEVDK A
Sbjct  418  YDKKTGTHLLQWPVEEIESLRGGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEVDKVA  477

Query  542  F-GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              G      + +SC  + GA+ RG LGPFG++VIA    S+ TP+YFYI+K   G  +T 
Sbjct  478  LQGIIEADHVGFSCSTSGGAASRGILGPFGVVVIADQKLSDVTPVYFYISKGADGRAETH  537

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS A  V K+ YG +VPVLDGE  SMR+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  538  FCADQTRSSEAPGVAKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPT  597

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQM  979
             A+   A+LF+FNN T A++TASV++W +
Sbjct  598  KAVNGAARLFVFNNRTGASVTASVKIWSL  626



>gb|AAK71505.2| soluble acid invertase Ib2FRUCT3 [Ipomoea batatas]
Length=661

 Score =   412 bits (1060),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 205/332 (62%), Positives = 244/332 (73%), Gaps = 4/332 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST   IGLDTS N P IKHVLK SLDDD++DYYAIGTY   +  W PD+P
Sbjct  322  MWECVDFYPVSTIGAIGLDTSANVPGIKHVLKASLDDDKHDYYAIGTYDPFNNTWTPDNP  381

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ID GIGLR DYG YYASK+FYD +K RR+ WGW+ E DSE  DL KGWASVQ IPRT++
Sbjct  382  EIDVGIGLRIDYGKYYASKTFYDQNKGRRILWGWIGETDSEADDLMKGWASVQTIPRTVV  441

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KT T+L+QWPVEEVE LRS       V ++PGSVV + V  S +LDI A FEV+   
Sbjct  442  LDTKTYTHLLQWPVEEVESLRSGDPTLTDVNLQPGSVVPIHVNTSTQLDISAWFEVENTT  501

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                A  D+ Y+C++  GA  RG LGPFGLLVIA +  SE TP+YFYIAK T G  +T F
Sbjct  502  SSMEA--DVGYNCSSSGGAVTRGALGPFGLLVIADETLSELTPVYFYIAKGTDGKAETHF  559

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  RSS ++ V K+ YG TVPVL+GE+ + RILVDHSIVESFAQGGRT ITSRIYPT 
Sbjct  560  CTDQTRSSESSSVGKEVYGSTVPVLEGETYTTRILVDHSIVESFAQGGRTVITSRIYPTK  619

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            AI   A++FLFNNAT+A++ ASV++W+M   D
Sbjct  620  AIYGAARVFLFNNATEASVKASVKIWEMGSAD  651



>emb|CDY15984.1| BnaC08g41390D [Brassica napus]
Length=680

 Score =   413 bits (1062),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/335 (60%), Positives = 247/335 (74%), Gaps = 9/335 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGPN+KH++K S+DD R D+YA+GTY + +  W PDDP
Sbjct  329  MWECVDFYPVSKTAVNGLDTSVNGPNVKHIVKASMDDTRFDHYAVGTYFDSNGTWIPDDP  388

Query  182  TIDTGIG--LRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            TID G+   LRYDYG +YASK+FYD +K RR+ W W+ E DSE +D+QKGW+S+QGIPRT
Sbjct  389  TIDVGMSASLRYDYGKFYASKTFYDQNKGRRILWSWIGESDSEAADVQKGWSSLQGIPRT  448

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KTG NL+QWPVEE++ LR    +F+ +EV PGSVV +DV  + +LDI AEFE++K
Sbjct  449  VVLDTKTGKNLVQWPVEEIKSLRLSSKQFD-MEVGPGSVVPVDVDSAAQLDIEAEFEINK  507

Query  536  DAFGKAAGSDI----PYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTG  697
            ++  K  G        +SC  + GAS RG LGPFG  V+A    SE TP+YFY+AK    
Sbjct  508  ESLDKILGDASVVAEEFSCQKSGGASVRGALGPFGFSVLADKSLSEQTPVYFYVAKGKDS  567

Query  698  NFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITS  877
              KTFFC D  RS+ ANDV K  YG +VPVL GE L+MRILVDHSIVE FAQ GRTCITS
Sbjct  568  KLKTFFCIDTSRSTFANDVVKPIYGSSVPVLKGEKLTMRILVDHSIVEGFAQAGRTCITS  627

Query  878  RIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            R+YPT AI   AKLF+FNNA DATITAS +VWQM+
Sbjct  628  RVYPTKAIYGAAKLFVFNNAIDATITASFKVWQMN  662



>ref|XP_010473488.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar [Camelina 
sativa]
Length=648

 Score =   412 bits (1058),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/336 (60%), Positives = 247/336 (74%), Gaps = 10/336 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T+  GLDTS  GP++KH++K S+DD R D+YAIGTY + +  W PD+P
Sbjct  302  MWECVDFYPVSKTKVNGLDTSVKGPDVKHIVKASMDDTRIDHYAIGTYDDSNGTWVPDNP  361

Query  182  TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            +ID GI  GLRYDYG +YASK+FYD +KKRR+ WGW+ E DSE +D+QKGW+SVQGIPRT
Sbjct  362  SIDVGISTGLRYDYGKFYASKTFYDQNKKRRILWGWIGESDSEAADVQKGWSSVQGIPRT  421

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KTG NL+QWPVEE++ LR    KF  ++V PG+VV +DVG + +LDI AEF + K
Sbjct  422  VVLDTKTGKNLVQWPVEEIKSLRLSNKKFH-MKVGPGTVVPVDVGSAAQLDIEAEFTIKK  480

Query  536  DAFGKAAG-----SDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
            D      G     +D  +SC    G++ RG LGPFG  V+A    SEHTP+YFY+ K   
Sbjct  481  DDLEIILGEDSVEADEEFSCQNGGGSTVRGALGPFGFSVLADQSLSEHTPVYFYVTKGKD  540

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
               KTFFC D  RS++ANDV K  YG  VPVL GE L+MRILVDHSIVE FAQGG+TCIT
Sbjct  541  SKLKTFFCTDTSRSTMANDVVKPVYGSFVPVLKGEKLTMRILVDHSIVEGFAQGGKTCIT  600

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            SR+YPT AI    KLFLFNNA DAT+TAS +VWQM+
Sbjct  601  SRVYPTKAIYGATKLFLFNNAIDATVTASFKVWQMN  636



>ref|NP_001275874.1| beta-fructofuranosidase, soluble isoenzyme I-like [Citrus sinensis]
 dbj|BAF34363.1| beta-fructofuranosidase [Citrus sinensis]
Length=642

 Score =   411 bits (1057),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 203/337 (60%), Positives = 248/337 (74%), Gaps = 7/337 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP++    +GLDTS  GP IKHVLK SLDD + D+YAIGTY   ++KW PD+P
Sbjct  308   MWECVDFYPVAINGSVGLDTSATGPGIKHVLKASLDDTKVDHYAIGTYNPANDKWTPDNP  367

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
               D GIGL++DYG YYASKSFYDP KKRR+ WGW+ E D+E+ DL+KGWASVQ IPRT+L
Sbjct  368   EEDVGIGLKWDYGRYYASKSFYDPYKKRRIVWGWINETDTESDDLEKGWASVQTIPRTVL  427

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             +DNKTG+N++QWPVEE+E LR   + FE+V V+PGSVV LD+G + +LDI AEFE   + 
Sbjct  428   YDNKTGSNVVQWPVEEIESLRQNSTVFEEVVVEPGSVVPLDIGVATQLDISAEFET--EL  485

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
              G  A  +  Y C+ GA  R  +GPFGLLV A D  SE TPI+F  + +TT    T+FCA
Sbjct  486   LGSGAMEE-GYGCSGGAIDRSAMGPFGLLVNAHDSLSELTPIFFR-SSNTTKGTNTYFCA  543

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSSLA DV K+  G  VPVL GE LSMRILVDHSIVESF QGGRT ITSRIYPT AI
Sbjct  544   DETRSSLAPDVFKQVRGSKVPVLQGEKLSMRILVDHSIVESFGQGGRTVITSRIYPTKAI  603

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
                A+LFLFNNAT   + A++++W+   ++SA  H F
Sbjct  604   YGAARLFLFNNATGVNVKATLKIWR---LNSAFIHPF  637



>ref|XP_008796841.1| PREDICTED: LOW QUALITY PROTEIN: beta-fructofuranosidase 1 [Phoenix 
dactylifera]
Length=648

 Score =   411 bits (1057),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 200/331 (60%), Positives = 251/331 (76%), Gaps = 4/331 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTS-YNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDD  178
            MWEC+DFYP+ST    GLDTS   GP +KHVLK SLDD+++DYYAIGTY      W PDD
Sbjct  309  MWECLDFYPVSTVSAAGLDTSTXAGPGVKHVLKASLDDNKHDYYAIGTYDGEEGTWTPDD  368

Query  179  PTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTI  358
              +D GIGLRYDYG YYASK+FYDP K+RRV WGW+ E DSE +DL KGWASVQ IPRT+
Sbjct  369  QEMDVGIGLRYDYGKYYASKTFYDPVKERRVLWGWIGETDSERTDLLKGWASVQTIPRTV  428

Query  359  LFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
            ++DNKTG NL+QWPV+E E LR    ++  +++  GSVV LD+ ++ +LDI AEFE+D  
Sbjct  429  IYDNKTGRNLLQWPVDEAESLRLSSKEYSNIKLSNGSVVPLDISEATQLDIEAEFEIDAL  488

Query  539  AFGKAAGSDIPYSCTAG--ASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
            +  +   +D+ Y+C+    A+ RG LGPFGLLV+A  D SE T +YFY+ + T G   TF
Sbjct  489  SLKQTIEADVGYNCSTSGGAAGRGALGPFGLLVLADQDLSEQTAVYFYLGRGTNGGLSTF  548

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FC D LRSS+AND+ ++ YG +VPVLDGE L++RILVDHSIVESFAQGGRTCITSR+YPT
Sbjct  549  FCQDELRSSMANDLVRRVYGSSVPVLDGERLTVRILVDHSIVESFAQGGRTCITSRVYPT  608

Query  893  SAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
             AI   A++FLFNNAT A +TA S+++WQMS
Sbjct  609  EAIYGAARVFLFNNATGAPVTAKSLKIWQMS  639



>ref|XP_004976364.1| PREDICTED: beta-fructofuranosidase 1-like [Setaria italica]
Length=672

 Score =   412 bits (1059),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 205/336 (61%), Positives = 253/336 (75%), Gaps = 9/336 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEG-----IGLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEK  163
            MWECVDFYP++T  G      GL+TS   GP +KHV+K SLDDD++DYYAIGTY   ++ 
Sbjct  325  MWECVDFYPVATGSGGAGENSGLETSAPPGPGVKHVVKASLDDDKHDYYAIGTYDAAADT  384

Query  164  WRPDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQG  343
            W PDD   D GIGLRYDYG +YASK+FYDP  +RRV WGWV E DSE +D+ KGWAS+Q 
Sbjct  385  WTPDDTVNDVGIGLRYDYGKFYASKTFYDPVLRRRVLWGWVGETDSERADILKGWASLQS  444

Query  344  IPRTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEF  523
            IPRT+L D KTG+NL+QWPV EVE LR     F  V +  GSVV LDVGK+ +LDI AEF
Sbjct  445  IPRTVLLDTKTGSNLLQWPVVEVENLRMSGKSFGGVALGHGSVVPLDVGKATQLDIEAEF  504

Query  524  EVDKDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTG  697
            EVD  A      +++ ++C  +AGA+ RG LGPFGLLV+A +D SE T +YFY+ K T G
Sbjct  505  EVDAAAVEAVTEAEVGFNCSTSAGAAGRGMLGPFGLLVLADEDRSEQTAVYFYLVKGTDG  564

Query  698  NFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITS  877
            + KTFFC D LR S AND+ K+ YG  VPVL+GE+LS+RILVDHSIVESFAQGGRTCITS
Sbjct  565  SLKTFFCQDELRGSKANDLVKRVYGSVVPVLNGENLSVRILVDHSIVESFAQGGRTCITS  624

Query  878  RIYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            R+YPT AI + A++FLFNNAT+  +TA SV++WQ++
Sbjct  625  RVYPTRAIYDSARVFLFNNATNVHVTAKSVKIWQLN  660



>gb|AAG36942.1|AF274298_1 acid invertase [Brassica oleracea]
Length=663

 Score =   411 bits (1057),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 200/337 (59%), Positives = 247/337 (73%), Gaps = 11/337 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGPN+KH++K S+DD R D+YA+GTY + +  W PDDP
Sbjct  310  MWECVDFYPVSKTAVNGLDTSVNGPNVKHIVKASMDDTRFDHYAVGTYFDSNGTWIPDDP  369

Query  182  TIDTGIG--LRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            TID G+   LRYDYG +YASK+FYD +K RR+ W W+ E DSE +D+QKGW+S+QGIPRT
Sbjct  370  TIDVGMSASLRYDYGKFYASKTFYDQNKGRRILWSWIGESDSEAADVQKGWSSLQGIPRT  429

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KTG NL+QWPVEE++ LR    +F+ +EV PGSVV +DV  + +LDI AEFE++K
Sbjct  430  VVLDTKTGKNLVQWPVEEIKSLRLSSKQFD-MEVGPGSVVPVDVDSAAQLDIEAEFEINK  488

Query  536  DAFGKAAGSDI------PYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDT  691
            ++  K  G          +SC  + GAS RG LGPFG  V+A    SE TP+YFY+AK  
Sbjct  489  ESLDKILGDASVVVEAEEFSCQKSGGASVRGALGPFGFSVLADKSLSEQTPVYFYVAKGK  548

Query  692  TGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCI  871
                KTFFC D  RS+ ANDV K  YG +VPVL GE L+MRILVDHSIVE FAQ GRTCI
Sbjct  549  DSKLKTFFCTDTSRSTFANDVVKPIYGSSVPVLKGEKLTMRILVDHSIVEGFAQAGRTCI  608

Query  872  TSRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            +SR+YPT AI   AKLF+FNNA DATITAS +VWQM+
Sbjct  609  SSRVYPTKAIYGAAKLFVFNNAIDATITASFKVWQMN  645



>ref|XP_010430328.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like isoform 
X1 [Camelina sativa]
 ref|XP_010430329.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like isoform 
X2 [Camelina sativa]
Length=648

 Score =   411 bits (1056),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 200/336 (60%), Positives = 247/336 (74%), Gaps = 10/336 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T+  GLDTS  GP++KH++K S+DD R D+YAIGTY + +  W PD+P
Sbjct  302  MWECVDFYPVSKTKINGLDTSVKGPDVKHIVKASMDDTRIDHYAIGTYDDSNGTWVPDNP  361

Query  182  TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            +ID GI  GLRYDYG +YASK+FYD +KKRR+ WGW+ E DSE +D+QKGW+SVQGIPRT
Sbjct  362  SIDVGISTGLRYDYGKFYASKTFYDQNKKRRILWGWIGESDSEAADVQKGWSSVQGIPRT  421

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KTG NL+QWPVEE++ LR    KF  ++V PG+VV +DVG + +LDI AEF++ K
Sbjct  422  VVLDTKTGKNLVQWPVEEIKSLRLSNKKFH-MKVGPGTVVPIDVGSAAQLDIEAEFKIKK  480

Query  536  DAFGKAAG-----SDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
            D      G     +D  +SC    G++ RG LGPFG  V+A    SEHTP+YFY+ K   
Sbjct  481  DDLEIILGEDSVEADEEFSCQNGGGSTVRGALGPFGFSVLADQSLSEHTPVYFYVTKGKD  540

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
               KTFFC D  RS++ANDV K  YG  VPVL  E L+MRILVDHSIVE FAQGGRTCIT
Sbjct  541  SKLKTFFCTDTSRSTMANDVVKPVYGSFVPVLKEEKLTMRILVDHSIVEGFAQGGRTCIT  600

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            SR+YPT AI    KLFLFNNA DAT+TAS +VWQM+
Sbjct  601  SRVYPTKAIYGATKLFLFNNAIDATVTASFKVWQMN  636



>ref|XP_006421676.1| hypothetical protein CICLE_v10004465mg [Citrus clementina]
 gb|ESR34916.1| hypothetical protein CICLE_v10004465mg [Citrus clementina]
Length=685

 Score =   412 bits (1058),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 202/337 (60%), Positives = 248/337 (74%), Gaps = 7/337 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP++    +GLDTS  GP IKHVLK SLDD + D+YAIGTY   ++KW PD+P
Sbjct  351   MWECVDFYPVAINGSVGLDTSATGPGIKHVLKASLDDTKVDHYAIGTYNPENDKWTPDNP  410

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
               D GIGL++DYG YYASKSFYDP KKRR+ WGW+ E D+E+ DL+KGWASVQ IPRT+L
Sbjct  411   EEDVGIGLKWDYGRYYASKSFYDPYKKRRIVWGWINETDTESDDLEKGWASVQTIPRTVL  470

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             +DNKTG+N++QWPVEE+E LR   + FE+V V+PGSVV LD+G + +LDI AEFE   + 
Sbjct  471   YDNKTGSNVVQWPVEEIESLRQNSTVFEEVVVEPGSVVPLDIGVATQLDISAEFET--EL  528

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
              G  A  +  Y C+ GA  R  +GPFGLLV A D  SE TPI+F  + +TT    T+FC 
Sbjct  529   LGSGATEE-GYGCSGGAVDRSAMGPFGLLVNAHDSLSELTPIFFR-SSNTTNGTNTYFCT  586

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSSLA DV K+ +G  VPVL GE LSMRILVDHSIVESF QGGRT ITSRIYPT AI
Sbjct  587   DETRSSLAPDVFKQVHGSKVPVLQGEKLSMRILVDHSIVESFGQGGRTVITSRIYPTKAI  646

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
                A+LFLFNNAT   + A++++W+   ++SA  H F
Sbjct  647   YGAARLFLFNNATGVNVKATLKIWR---LNSAFIHPF  680



>ref|XP_010264216.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Nelumbo nucifera]
Length=660

 Score =   410 bits (1055),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 203/331 (61%), Positives = 251/331 (76%), Gaps = 4/331 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+STT+  GLDTS NGP +KHVLK SLDD + DYYA+GTY   ++ W PD+P
Sbjct  317  MWECVDFFPVSTTDENGLDTSVNGPGVKHVLKASLDDTKEDYYALGTYYVENDTWIPDNP  376

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIG+ YDYG +YASK+FYD SK+RRV WGW+ E DSE +D++KGWASVQ IPR + 
Sbjct  377  VADVGIGMIYDYGNFYASKTFYDQSKQRRVLWGWIGETDSENADIEKGWASVQSIPRVVT  436

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD+KT +N++QWPV+E E LR    +F+KVEV  GSVV L+V  + +LDI+AEF VD  +
Sbjct  437  FDHKTRSNILQWPVKETESLRLSSDEFDKVEVPAGSVVPLNVSTATQLDIIAEFVVDNAS  496

Query  542  FGKAAG--SDIPYSCTAG--ASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKT  709
                    +D  Y C+    A+ RG LGPFGLLV+A    +E TP+YFYIAKD  G+ KT
Sbjct  497  LEGTGTIEADGGYDCSTSGGAAGRGALGPFGLLVLADKSLAEQTPVYFYIAKDIDGHLKT  556

Query  710  FFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYP  889
            FFCAD  RSSLANDV K  YG  VPVLDGE L+MR+LVDHSIVESFAQGGRT ITSR+YP
Sbjct  557  FFCADESRSSLANDVGKHVYGSLVPVLDGEKLTMRLLVDHSIVESFAQGGRTVITSRVYP  616

Query  890  TSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            T AI   A++FLFNNAT A++TAS+++WQM+
Sbjct  617  TEAIYGAARVFLFNNATGASVTASLKIWQMN  647



>emb|CDY26548.1| BnaA09g47290D [Brassica napus]
Length=663

 Score =   410 bits (1055),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/337 (59%), Positives = 246/337 (73%), Gaps = 11/337 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGPN+KH++K S+DD R D+YA+GTY + +  W PDDP
Sbjct  310  MWECVDFYPVSKTAINGLDTSVNGPNVKHIVKASMDDTRFDHYAVGTYFDSNGTWIPDDP  369

Query  182  TIDTGIG--LRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            TID G+   LRYDYG +YASK+FYD +K RR+ W W+ E DSE +D+QKGW+S+QGIPRT
Sbjct  370  TIDVGMSASLRYDYGKFYASKTFYDQNKGRRILWSWIGESDSEAADVQKGWSSLQGIPRT  429

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KTG NL+QWPVEE++ LR    +F+ +EV PGSVV +DV  + +LDI AEFE+ K
Sbjct  430  VVLDTKTGKNLVQWPVEEIKSLRLSSKQFD-MEVGPGSVVPVDVNTATQLDIEAEFEIKK  488

Query  536  DAFGKAAGSDI------PYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDT  691
            +   K  G          +SC  + G++ RG LGPFG  V+A    SE TP+YFY+AK  
Sbjct  489  ETLDKILGDSSVVAEAEEFSCQKSGGSTVRGALGPFGFSVLADKSLSEQTPVYFYVAKGK  548

Query  692  TGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCI  871
                K FFC D  RS+ ANDV K  YG +VPVL+GE L+MRILVDHSIVE FAQGGRTCI
Sbjct  549  DSKLKAFFCTDTSRSTFANDVVKPIYGSSVPVLEGEKLTMRILVDHSIVEGFAQGGRTCI  608

Query  872  TSRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            TSR+YPT AI   AKLF+FNNA DAT+TAS +VWQM+
Sbjct  609  TSRVYPTKAIYGAAKLFVFNNAIDATVTASFKVWQMN  645



>ref|XP_008668436.1| PREDICTED: uncharacterized protein LOC100383472 isoform X1 [Zea 
mays]
 tpg|DAA36680.1| TPA: invertase1 [Zea mays]
Length=670

 Score =   410 bits (1055),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 205/337 (61%), Positives = 249/337 (74%), Gaps = 10/337 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIG------LDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSE  160
            MWECVDFYP++   G        L+TS   GP +KHVLK SLDDD++DYYAIGTY   ++
Sbjct  320  MWECVDFYPVAAGSGAAADSGDGLETSAAPGPGVKHVLKASLDDDKHDYYAIGTYDPATD  379

Query  161  KWRPDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQ  340
             W PD    D GIGLRYDYG YYASK+FYDP  +RRV WGWV E DSE +D+ KGWASVQ
Sbjct  380  TWTPDSAEDDVGIGLRYDYGKYYASKTFYDPVLRRRVLWGWVGETDSERADILKGWASVQ  439

Query  341  GIPRTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAE  520
             IPRT+L D KTG+NL+QWPV EVE LR     F+ V +  GSVV LDVGK+ +LDI A 
Sbjct  440  SIPRTVLLDTKTGSNLLQWPVVEVENLRMSGKSFDGVALDRGSVVPLDVGKATQLDIEAV  499

Query  521  FEVDKDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
            FEVD         +D+ ++C  +AGA+ RG LGPFGLLV+A DD SE T +YFY+ K T 
Sbjct  500  FEVDASDAAAVTEADVTFNCSTSAGAAGRGLLGPFGLLVLADDDLSEQTAVYFYLLKGTD  559

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
            G+ +TFFC D LR+S AND+ K+ YG  VPVLDGE+LS+RILVDHSIVESFAQGGRTCIT
Sbjct  560  GSLQTFFCQDELRASKANDLVKRVYGSLVPVLDGENLSVRILVDHSIVESFAQGGRTCIT  619

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            SR+YPT AI + A++FLFNNAT A + A SV++WQ++
Sbjct  620  SRVYPTRAIYDSARVFLFNNATHAHVKAKSVKIWQLN  656



>gb|AAB47171.1| vacuolar invertase 1, GIN1 [Vitis vinifera=grape berries, Sultana, 
berries, Peptide, 642 aa]
Length=642

 Score =   410 bits (1053),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 199/333 (60%), Positives = 254/333 (76%), Gaps = 3/333 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS +GP IKHVLK S+DD+R+DYYA+G Y   ++ W PDDP
Sbjct  301  MWECVDFYPVSINGVYGLDTSAHGPGIKHVLKASMDDNRHDYYALGEYDPMTDTWTPDDP  360

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DY  YYASK+FYD  KKRR+ +GW++E D E+ DL+KGWAS+Q IPRT+L
Sbjct  361  ELDVGIGLRLDYERYYASKTFYDQVKKRRILYGWISEGDIESDDLKKGWASLQSIPRTVL  420

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             DNKTGT L+ WP+EEVE LR+  ++FE V ++PGS+V LD+G + +LDI+AEFEVD + 
Sbjct  421  HDNKTGTYLLLWPIEEVESLRTNSTEFEDVLLEPGSIVPLDIGSASQLDIVAEFEVDNET  480

Query  542  FGKAAGSDIPYSCTAG--ASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                  +D+ Y+C+    A+ RG LGPFGLLV+A D  SE TPIYFYIAKDT G++KTFF
Sbjct  481  LEAMVEADVIYNCSTSAGAAGRGALGPFGLLVLADDTLSELTPIYFYIAKDTDGSYKTFF  540

Query  716  CADHLRSSLA-NDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            C D  RSSLA +DV ++ YG  VP LD E  +MR+LVDHSIVE F+QGGR+CIT+R+YPT
Sbjct  541  CTDLSRSSLAVDDVDQRIYGSIVPALDDEKPTMRVLVDHSIVEGFSQGGRSCITTRVYPT  600

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
             AI   A+LFLFNNAT   +TAS+++W+M+  D
Sbjct  601  EAIYGAARLFLFNNATGVNVTASIKIWEMASAD  633



>ref|XP_009118103.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar [Brassica 
rapa]
Length=663

 Score =   410 bits (1055),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/337 (59%), Positives = 246/337 (73%), Gaps = 11/337 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGPN+KH++K S+DD R D+YA+GTY + +  W PDDP
Sbjct  310  MWECVDFYPVSKTAINGLDTSVNGPNVKHIVKASMDDTRFDHYAVGTYFDSNGTWIPDDP  369

Query  182  TIDTGIG--LRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            TID G+   LRYDYG +YASK+FYD +K RR+ W W+ E DSE +D+QKGW+S+QGIPRT
Sbjct  370  TIDVGMSASLRYDYGKFYASKTFYDQNKGRRILWSWIGESDSEAADVQKGWSSLQGIPRT  429

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KTG NL+QWPVEE++ LR    +F+ +EV PGSVV +DV  + +LDI AEFE+ K
Sbjct  430  VVLDTKTGKNLVQWPVEEIKSLRLSSKQFD-MEVGPGSVVPVDVNTATQLDIEAEFEIKK  488

Query  536  DAFGKAAGSDI------PYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDT  691
            +   K  G          +SC  + G++ RG LGPFG  V+A    SE TP+YFY+AK  
Sbjct  489  ETLDKILGDSSVVAEAEEFSCQKSGGSTVRGALGPFGFSVLADKSLSEQTPVYFYVAKGK  548

Query  692  TGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCI  871
                K FFC D  RS+ ANDV K  YG +VPVL+GE L+MRILVDHSIVE FAQGGRTCI
Sbjct  549  DSKLKAFFCTDTSRSTFANDVVKPIYGSSVPVLEGEKLTMRILVDHSIVEGFAQGGRTCI  608

Query  872  TSRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            TSR+YPT AI   AKLF+FNNA DAT+TAS +VWQM+
Sbjct  609  TSRVYPTKAIYGAAKLFVFNNAIDATVTASFKVWQMN  645



>sp|P49175.1|INV1_MAIZE RecName: Full=Beta-fructofuranosidase 1; AltName: Full=Invertase 
1; AltName: Full=Sucrose 1; Flags: Precursor [Zea mays]
 gb|AAA83439.1| invertase [Zea mays]
Length=670

 Score =   410 bits (1055),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 205/337 (61%), Positives = 249/337 (74%), Gaps = 10/337 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIG------LDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSE  160
            MWECVDFYP++   G        L+TS   GP +KHVLK SLDDD++DYYAIGTY   ++
Sbjct  320  MWECVDFYPVAAGSGAAAGSGDGLETSAAPGPGVKHVLKASLDDDKHDYYAIGTYDPATD  379

Query  161  KWRPDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQ  340
             W PD    D GIGLRYDYG YYASK+FYDP  +RRV WGWV E DSE +D+ KGWASVQ
Sbjct  380  TWTPDSAEDDVGIGLRYDYGKYYASKTFYDPVLRRRVLWGWVGETDSERADILKGWASVQ  439

Query  341  GIPRTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAE  520
             IPRT+L D KTG+NL+QWPV EVE LR     F+ V +  GSVV LDVGK+ +LDI A 
Sbjct  440  SIPRTVLLDTKTGSNLLQWPVVEVENLRMSGKSFDGVALDRGSVVPLDVGKATQLDIEAV  499

Query  521  FEVDKDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
            FEVD         +D+ ++C  +AGA+ RG LGPFGLLV+A DD SE T +YFY+ K T 
Sbjct  500  FEVDASDAAGVTEADVTFNCSTSAGAAGRGLLGPFGLLVLADDDLSEQTAVYFYLLKGTD  559

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
            G+ +TFFC D LR+S AND+ K+ YG  VPVLDGE+LS+RILVDHSIVESFAQGGRTCIT
Sbjct  560  GSLQTFFCQDELRASKANDLVKRVYGSLVPVLDGENLSVRILVDHSIVESFAQGGRTCIT  619

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            SR+YPT AI + A++FLFNNAT A + A SV++WQ++
Sbjct  620  SRVYPTRAIYDSARVFLFNNATHAHVKAKSVKIWQLN  656



>gb|ADF27779.1| soluble acid invertase 1 [Orobanche ramosa]
Length=661

 Score =   410 bits (1054),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 199/334 (60%), Positives = 248/334 (74%), Gaps = 4/334 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWEC+DFYP S  E  GLDTS NG  IKHV+K SLDDD+NDYYA+GTY   + KW  DDP
Sbjct  319  MWECIDFYPASLIEANGLDTSANGQGIKHVMKASLDDDKNDYYALGTYDPINNKWIADDP  378

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             ++ GIGLRYDYG YYASK+FYD  K+RR+ WGW+ E D+E  D+ KGW+ VQ IPRT+L
Sbjct  379  ELNVGIGLRYDYGKYYASKTFYDQKKQRRILWGWIRETDAEELDVLKGWSGVQSIPRTVL  438

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD-KD  538
            FD KTG+N++QWPVEE+E LRS   +F  V+++PGSV  L VG + +LD++A FE+D K+
Sbjct  439  FDKKTGSNILQWPVEEIESLRSDIVEFNDVKLRPGSVTPLKVGSASQLDLVASFEIDHKE  498

Query  539  AFGKAAG-SDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKT  709
            +     G ++  Y C  + GA++RG LGPFG++V+A +  SE TPIYFY AK   G  +T
Sbjct  499  SVEAIVGEAETGYDCPTSGGAAKRGVLGPFGVVVLADETLSELTPIYFYTAKGHNGKTET  558

Query  710  FFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYP  889
             FCAD LRSS A DV K  YG  VPVLDGE LS+R LVDHSI+ESFAQGGRT ITSRIYP
Sbjct  559  HFCADGLRSSEAADVDKIVYGSKVPVLDGEKLSIRSLVDHSIIESFAQGGRTVITSRIYP  618

Query  890  TSAIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            T AI   A++FLFNNAT  ++TASV++W+M   D
Sbjct  619  TKAIDGSARVFLFNNATGISVTASVKIWKMESAD  652



>ref|XP_011101190.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=621

 Score =   409 bits (1050),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 199/339 (59%), Positives = 250/339 (74%), Gaps = 10/339 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWEC+D YPIS  E  GLDTS NGP+IKHV+K SL DD NDYYA+GTY     KW PDDP
Sbjct  273  MWECIDLYPISLKEANGLDTSANGPDIKHVMKASLFDDGNDYYALGTYDPIENKWTPDDP  332

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D G+GLRYDY  YYASK+FYD +KKRR+ WGW+ E D+E   + KGWA VQ IPRT+L
Sbjct  333  ELDVGVGLRYDYRKYYASKTFYDQNKKRRILWGWIKETDAEELHILKGWACVQSIPRTVL  392

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG N++QWPVEEVE LRS   +F  V+++PGSVV ++V    +LDI+A FE+DK+A
Sbjct  393  FDPKTGNNILQWPVEEVESLRSDSFEF-NVKLEPGSVVPIEVDSGSQLDIVASFELDKEA  451

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
            F +   +D+ Y C  + G+  RG LGPFG++++A ++  E TPIYFYIAK      +T F
Sbjct  452  FEETTEADVGYDCPTSGGSVNRGMLGPFGIIILADENLLELTPIYFYIAKGHNRKVETHF  511

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD LRSS+A DV K  YG  VPVLDGE+L++R LVDHSIVESFAQGGR  ITSRIYPT 
Sbjct  512  CADELRSSVAADVDKIVYGSKVPVLDGENLTIRSLVDHSIVESFAQGGRRVITSRIYPTK  571

Query  896  AIGEDAKLFLFNNATDAT-------ITASVEVWQMSEMD  991
            AI  +A++FLFNN+T A+       +TASV++W+MS  +
Sbjct  572  AIDGEARIFLFNNSTGASVAAVETRVTASVKIWKMSSAN  610



>dbj|BAJ95733.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score =   406 bits (1043),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 202/336 (60%), Positives = 253/336 (75%), Gaps = 9/336 (3%)
 Frame = +2

Query  2    MWECVDFYPIST--TEGIGLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRP  172
            MWECVDFYP+S      +GLDTS   GP +KHVLK SLDDDR+DYY IGTY   +++W P
Sbjct  195  MWECVDFYPVSADLAADVGLDTSTAPGPGVKHVLKASLDDDRHDYYGIGTYDAGTDRWTP  254

Query  173  DDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPR  352
            DD  ID GIGLRYDYG +YASKSFYDP  +RRV WGW+ E DSE +DL KGWAS+Q IPR
Sbjct  255  DDAAIDVGIGLRYDYGKFYASKSFYDPVGRRRVLWGWIGESDSERADLLKGWASLQSIPR  314

Query  353  TILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD  532
            T+L D KTG+NL+QWPV EVE LR +  +F+ +++ PGSVV LDVG++ +LD+ A F+V 
Sbjct  315  TVLLDTKTGSNLLQWPVVEVENLRMRGKRFDGLDMPPGSVVPLDVGRATQLDVEAVFQVQ  374

Query  533  ---KDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTG  697
                 A   AAG++ PY+C  +AG++ RG LGPFGLLV+A D  SE T +YFY+ +   G
Sbjct  375  AGAPAAGSAAAGAEAPYNCSASAGSAGRGLLGPFGLLVLADDGLSEQTAVYFYLVRGADG  434

Query  698  NFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITS  877
               T FC D  RSS AND+ K  YG +VPVLDGE LS+RILVDHSIVESFAQGGRTCITS
Sbjct  435  KLSTHFCQDAFRSSKANDLVKAVYGSSVPVLDGEDLSVRILVDHSIVESFAQGGRTCITS  494

Query  878  RIYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            R+YPT AI + A++FLFNNAT+  +TA S+++W+++
Sbjct  495  RVYPTKAIYDSARVFLFNNATNLNVTAKSIKIWELN  530



>gb|AFH77956.1| vacuolar invertase [Manihot esculenta]
Length=639

 Score =   409 bits (1051),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 194/329 (59%), Positives = 241/329 (73%), Gaps = 8/329 (2%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP++    +GLDTS NGP+ KHVLK SLDD + D+YA+GTY   +++W PD+P
Sbjct  308  MWECVDFYPVAINGSLGLDTSANGPDTKHVLKASLDDTKIDHYALGTYDPVTDRWTPDNP  367

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLR DYG YYASK+FYD  KKRR+ WGW+ E D+E  DL+KGWASVQ IPR +L
Sbjct  368  KEDVGIGLRVDYGRYYASKTFYDQQKKRRILWGWINETDTEEDDLEKGWASVQTIPRAVL  427

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD--K  535
            FDNKTGTNL+QWPVEE+E LR   + FE++ + PGSVV LD+G + +LDI AEFE +   
Sbjct  428  FDNKTGTNLLQWPVEEIESLRLNSTDFEEILIGPGSVVPLDIGVATQLDIFAEFETELIS  487

Query  536  DAFGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
            D+  +       Y C+ GA  R  LGPFG+LVIA    SE TP++F     T G  KT+F
Sbjct  488  DSVVEE------YDCSGGAVDRSPLGPFGILVIADQTLSELTPVFFRPVNSTDGTLKTYF  541

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            CAD  RSS A DV K+ YG TVPVL+GE L MR+LVDHSIVESFAQGGRT +TSR+YPT 
Sbjct  542  CADETRSSKAPDVFKQVYGSTVPVLEGEKLGMRVLVDHSIVESFAQGGRTVMTSRVYPTE  601

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI   A+LFLFNNAT   + A++++WQ++
Sbjct  602  AIYGAARLFLFNNATSVNVKATLKIWQLN  630



>gb|EPS61897.1| soluble acid invertase 1, partial [Genlisea aurea]
Length=561

 Score =   406 bits (1043),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 197/329 (60%), Positives = 250/329 (76%), Gaps = 5/329 (2%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWEC+DFYPISTT   GLDTS NGP +KHVLK SLDDD+NDYYA+G+Y     +WRPDDP
Sbjct  223  MWECIDFYPISTTGKNGLDTSANGPGVKHVLKASLDDDKNDYYALGSYDPLENRWRPDDP  282

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLRYDYG YYASK+FYD   KRR+ WGW+ E D+E  D+ KGWASVQ IPRT++
Sbjct  283  VLDVGIGLRYDYGEYYASKTFYDQETKRRILWGWIRETDAEQVDILKGWASVQCIPRTVV  342

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +D KTG+N++QWPVEEVE LR +  +F  V+++PGSVV +++  + +LDI A FEVD ++
Sbjct  343  YDVKTGSNILQWPVEEVESLRRESFEFNGVKLEPGSVVPVEIDSTSQLDIEAWFEVD-NS  401

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
             G   GSD  Y+C  + GA+ RG LGPFG++++A +  +E TPIYFYIA    G     F
Sbjct  402  TGDVGGSD-GYNCSTSGGAAGRGILGPFGIVLLADEKLTELTPIYFYIAGKPGGVLDYHF  460

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT-  892
            C D LRSS A+DV K  YG +VPVLDGE L++R+LVDHSIVESFAQGGR  ITSR+YPT 
Sbjct  461  CTDVLRSSTASDVHKLVYGSSVPVLDGEKLTLRLLVDHSIVESFAQGGRRVITSRVYPTK  520

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQM  979
            S  G ++++ LFNNAT A +TAS++VW+M
Sbjct  521  STRGAESRVLLFNNATAAGVTASIKVWKM  549



>ref|XP_010919479.1| PREDICTED: beta-fructofuranosidase 1 isoform X2 [Elaeis guineensis]
Length=653

 Score =   409 bits (1051),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 205/342 (60%), Positives = 255/342 (75%), Gaps = 7/342 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDD  178
             MWECVDFYP+ST   +GLDTS   G  +KHVLK SLD+ + DYYAIGTY      W PD+
Sbjct  309   MWECVDFYPVSTGSKVGLDTSTGPGTQVKHVLKASLDEKKQDYYAIGTYDGDEGTWTPDE  368

Query  179   PTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTI  358
             P +D GIGLRYDYG +YASK+FYDP K+RRV WGW  E DSE +DL KGWAS+Q IPRT+
Sbjct  369   PEMDVGIGLRYDYGKFYASKTFYDPVKERRVLWGWTAETDSEWTDLLKGWASLQAIPRTV  428

Query  359   LFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
             L+D+KT +NLIQWPV+EVE LRS K +F  ++V  GSVV LDV  + ELDI AEFE+D  
Sbjct  429   LYDDKTKSNLIQWPVDEVESLRSSKQEFSNIKVSTGSVVPLDVTHATELDIEAEFEIDLS  488

Query  539   AFGKAAGSDIPYSCTAG--ASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
             A  +   +D+ Y+C+    A+ RG LGPFGLLV+A  D  E T +YF++ + T G   TF
Sbjct  489   ALERTVEADVGYNCSTSGGAAGRGALGPFGLLVLADQDLKEQTAVYFFLRRGTDGGLGTF  548

Query  713   FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
             FC D  RSS+AND+ K+ YG  VPVLDGE+L++RILVDHSI+ESFAQGGR CITSR+YPT
Sbjct  549   FCQDETRSSMANDLVKRVYGSLVPVLDGENLTVRILVDHSIIESFAQGGRACITSRVYPT  608

Query  893   SAIGEDAKLFLFNNATDATITA-SVEVWQMSEMDSAAPHNFN  1015
              AI   A++FLFNNATDA++TA S+++WQ   MDSA  H ++
Sbjct  609   RAIYGGARVFLFNNATDASMTAKSLKIWQ---MDSAFIHPYS  647



>ref|XP_010919478.1| PREDICTED: beta-fructofuranosidase 1 isoform X1 [Elaeis guineensis]
Length=656

 Score =   409 bits (1051),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 205/342 (60%), Positives = 255/342 (75%), Gaps = 7/342 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDD  178
             MWECVDFYP+ST   +GLDTS   G  +KHVLK SLD+ + DYYAIGTY      W PD+
Sbjct  312   MWECVDFYPVSTGSKVGLDTSTGPGTQVKHVLKASLDEKKQDYYAIGTYDGDEGTWTPDE  371

Query  179   PTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTI  358
             P +D GIGLRYDYG +YASK+FYDP K+RRV WGW  E DSE +DL KGWAS+Q IPRT+
Sbjct  372   PEMDVGIGLRYDYGKFYASKTFYDPVKERRVLWGWTAETDSEWTDLLKGWASLQAIPRTV  431

Query  359   LFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
             L+D+KT +NLIQWPV+EVE LRS K +F  ++V  GSVV LDV  + ELDI AEFE+D  
Sbjct  432   LYDDKTKSNLIQWPVDEVESLRSSKQEFSNIKVSTGSVVPLDVTHATELDIEAEFEIDLS  491

Query  539   AFGKAAGSDIPYSCTAG--ASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
             A  +   +D+ Y+C+    A+ RG LGPFGLLV+A  D  E T +YF++ + T G   TF
Sbjct  492   ALERTVEADVGYNCSTSGGAAGRGALGPFGLLVLADQDLKEQTAVYFFLRRGTDGGLGTF  551

Query  713   FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
             FC D  RSS+AND+ K+ YG  VPVLDGE+L++RILVDHSI+ESFAQGGR CITSR+YPT
Sbjct  552   FCQDETRSSMANDLVKRVYGSLVPVLDGENLTVRILVDHSIIESFAQGGRACITSRVYPT  611

Query  893   SAIGEDAKLFLFNNATDATITA-SVEVWQMSEMDSAAPHNFN  1015
              AI   A++FLFNNATDA++TA S+++WQ   MDSA  H ++
Sbjct  612   RAIYGGARVFLFNNATDASMTAKSLKIWQ---MDSAFIHPYS  650



>ref|XP_002510944.1| Beta-fructofuranosidase, soluble isoenzyme I precursor, putative 
[Ricinus communis]
 gb|EEF51546.1| Beta-fructofuranosidase, soluble isoenzyme I precursor, putative 
[Ricinus communis]
Length=639

 Score =   408 bits (1049),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 193/327 (59%), Positives = 238/327 (73%), Gaps = 4/327 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP++     GLDTS NGP +KHVLK SLD+ + DYYA+GTY   ++KW PD+P
Sbjct  305  MWECVDFYPVAINGSKGLDTSVNGPGVKHVLKASLDNTKLDYYALGTYDPVTDKWTPDNP  364

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLR DYG YYASKSFYD  K+RR+ WGW+ E D+E  DLQKGWASVQ IPR +L
Sbjct  365  EEDVGIGLRVDYGRYYASKSFYDQYKQRRILWGWINETDTEQDDLQKGWASVQTIPRNVL  424

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FDNKTG NL+QWPVEE+E LR   + F+++ + PGSVV L++G + +LDI AEFE +   
Sbjct  425  FDNKTGANLLQWPVEEIESLRVNSTDFQEIVIAPGSVVPLEIGTATQLDIFAEFETEL--  482

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
               +  S   Y C+ GA  R  LGPFGLLV+A +  SE TP++F     T    KT+FCA
Sbjct  483  --ISESSTEEYGCSGGAVDRSSLGPFGLLVLADESLSELTPVFFRPVNSTDDTLKTYFCA  540

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS A +V K+ YG TVPVLD E L MR+LVDHSIVESFAQGGRT ITSRIYPT AI
Sbjct  541  DETRSSKAPEVFKQVYGSTVPVLDDEKLRMRVLVDHSIVESFAQGGRTVITSRIYPTEAI  600

Query  902  GEDAKLFLFNNATDATITASVEVWQMS  982
               A+LFLFNNATD  + A++++W+++
Sbjct  601  YGAARLFLFNNATDVNVKATLKIWELT  627



>emb|CDY46906.1| BnaA09g12880D [Brassica napus]
Length=654

 Score =   408 bits (1049),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 203/347 (59%), Positives = 252/347 (73%), Gaps = 13/347 (4%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S T+  GLDTS NGP++KH++K S+DD R D+YAIGTY + +  W PD+P
Sbjct  302   MWECVDFYPVSKTKDKGLDTSVNGPDVKHIIKASMDDTRIDHYAIGTYYDSNATWVPDNP  361

Query  182   TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
             +ID GI  GLRYDYG +YASK+FYD  K RR+ WGW+ E DSE +D+QKGW+SVQGIPRT
Sbjct  362   SIDVGISTGLRYDYGKFYASKTFYDQHKGRRILWGWIGESDSEAADVQKGWSSVQGIPRT  421

Query  356   ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
             +  D KTG NL+QWPV+E+E LR  + KF  ++V+PG+VV +DVG + +LDI AEF++ K
Sbjct  422   VALDTKTGKNLVQWPVKEIESLRLGRKKFH-MKVEPGTVVPVDVGPAAQLDIEAEFKIKK  480

Query  536   D----AFGK-AAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
             D     FG  +   D  +SC  + GA+ RG LGPFG  V+A    SE T +YFY+ K   
Sbjct  481   DDLEVVFGDDSVEDDKEFSCETSGGATVRGALGPFGFSVLADQSLSEQTQVYFYVTKGKD  540

Query  695   GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
                KTFFC D  RS++ANDV K  YG  VPVL GE L+MRILVDHSI+E F QGGRTCIT
Sbjct  541   SKLKTFFCTDTSRSTMANDVVKPVYGSFVPVLRGEKLTMRILVDHSIIEGFGQGGRTCIT  600

Query  875   SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNFN  1015
             SR+YPT AI    +LFLFNNA DATITAS +VWQ   M+SA  H F+
Sbjct  601   SRVYPTKAIYGATRLFLFNNAIDATITASFKVWQ---MNSAFIHPFS  644



>ref|XP_006300839.1| hypothetical protein CARUB_v10019930mg [Capsella rubella]
 gb|EOA33737.1| hypothetical protein CARUB_v10019930mg [Capsella rubella]
Length=648

 Score =   408 bits (1048),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 198/336 (59%), Positives = 249/336 (74%), Gaps = 10/336 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWEC+DFYP+S T+  GLDTS  GP++KH++K S+DD R D+YAIGTY + +  W PD+P
Sbjct  302  MWECIDFYPVSKTKVKGLDTSVKGPDVKHIVKASMDDTRIDHYAIGTYYDSNGTWFPDNP  361

Query  182  TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            +ID GI  GLRYDYG +YASK+FYD +K RR+ WGW+ E DSE +D+QKGW+SVQGIPRT
Sbjct  362  SIDVGISTGLRYDYGKFYASKTFYDQNKGRRILWGWIGESDSEAADVQKGWSSVQGIPRT  421

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KTG NL+QWPVEE++ LR    KF  ++V PG++V +DVG + +LDI AEF++ K
Sbjct  422  VVLDTKTGKNLVQWPVEEIKSLRLSSKKFH-MKVGPGTMVPVDVGSAAQLDIEAEFKIKK  480

Query  536  D----AFGK-AAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
            D     FG  +   D  +SC  + G++ RG LGPFG  V+A    SEHTP+YFY+ K   
Sbjct  481  DDLEIIFGDDSVEGDKEFSCQNSGGSTVRGALGPFGFSVLADQSLSEHTPVYFYVTKGKD  540

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
               K++FC D  RS++ANDV K  YG  VPVL GE L+MRILVDHSIVE FAQGGRTCIT
Sbjct  541  SKLKSYFCTDTSRSTMANDVVKPVYGSFVPVLKGEKLTMRILVDHSIVEGFAQGGRTCIT  600

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            SR+YPT AI    KLFLFNNA DATITAS +VWQM+
Sbjct  601  SRVYPTKAIYGATKLFLFNNAIDATITASFKVWQMN  636



>ref|XP_010672026.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Beta vulgaris subsp. vulgaris]
Length=645

 Score =   407 bits (1047),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 188/337 (56%), Positives = 254/337 (75%), Gaps = 2/337 (1%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S T   GLDTS  G  +KH+LK SLDD++ D+YA+GTY   ++ W PD+P
Sbjct  311   MWECVDFYPVSITGQNGLDTSAYGSGMKHLLKASLDDNKQDHYALGTYDMTTQTWTPDNP  370

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              +D G+GLR DYG YYASK+F+D +K+RR+ WGWV E D+E  DL KGWAS+Q IPR + 
Sbjct  371   DMDVGLGLRLDYGKYYASKTFFDQNKQRRILWGWVGETDTEADDLLKGWASLQTIPRVVT  430

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             +D KTGTN++QWPV+EVE LR+   +++ + ++PGS+++LD+    +LDI AEF VD++A
Sbjct  431   YDAKTGTNILQWPVKEVESLRTDSREYDNLLLQPGSIINLDIASGAQLDISAEFVVDQEA  490

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
                  G D+  +C+A A+ R  LGPFGLLV+A +  SE TPIYFYIAK + G  K +FC 
Sbjct  491   LKLTVGDDVINNCSA-AAVRQALGPFGLLVLADESLSELTPIYFYIAKASDGTVKNWFCT  549

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSS A+ V K+ YG  VPVL+GE  SMR+LVDHSI+E+F QGGRTCITSRIYPT AI
Sbjct  550   DQSRSSKASSVDKQIYGGPVPVLEGEKYSMRLLVDHSIIEAFGQGGRTCITSRIYPTKAI  609

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
               +AK+F+FNNATD+++TASV++W++  ++  +P+ F
Sbjct  610   NGNAKVFIFNNATDSSVTASVKIWELDSIN-LSPYIF  645



>ref|XP_010493951.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar [Camelina 
sativa]
Length=669

 Score =   408 bits (1048),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 203/338 (60%), Positives = 249/338 (74%), Gaps = 12/338 (4%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP++KH++K S+DD R D+YA+GTY E +  W PDDP
Sbjct  315  MWECVDFYPVSKTARNGLDTSVNGPDVKHIVKASMDDTRFDHYAVGTYFESNGTWIPDDP  374

Query  182  TIDTGIG--LRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            TID G+   LRYDYG +YASK+FYD +K RR+ W W+ E DSE SD+QKGW+S+QGIPRT
Sbjct  375  TIDVGMSSSLRYDYGKFYASKTFYDQNKGRRILWSWIGESDSEASDVQKGWSSLQGIPRT  434

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            +  D KTG NL+Q PVEE++ LR    KF+ +E+ PGSVV +DVG + +LDI AEFE+ K
Sbjct  435  VSLDTKTGKNLVQSPVEEIKSLRLSSKKFD-LELSPGSVVPVDVGTATQLDIEAEFEIKK  493

Query  536  DA----FGKAA--GSDIPYSCT---AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKD  688
            ++    FG A+       +SC    AG++ R  LGPFG  V+A +  SE TP+YFYIAK 
Sbjct  494  ESLDKFFGDASVVAEAEEFSCEKNGAGSTVRNALGPFGFSVLATESLSEQTPVYFYIAKG  553

Query  689  TTGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTC  868
                 KTFFC D  RSS+ANDV K  YG  VPVL GE L+MRILVDHSIVE+F QGGRTC
Sbjct  554  KDSKLKTFFCTDTSRSSVANDVIKPIYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTC  613

Query  869  ITSRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            ITSR+YPT+AI   AKLFLFNNA DAT+TAS +VWQM+
Sbjct  614  ITSRVYPTTAIYGAAKLFLFNNALDATVTASFKVWQMN  651



>ref|XP_010458650.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar-like [Camelina 
sativa]
Length=669

 Score =   408 bits (1048),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 202/338 (60%), Positives = 249/338 (74%), Gaps = 12/338 (4%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP++KH++K S+DD R D+YA+GTY E +  W PDDP
Sbjct  315  MWECVDFYPVSKTARKGLDTSVNGPDVKHIVKASMDDTRFDHYAVGTYFESNGTWIPDDP  374

Query  182  TIDTGIG--LRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            TID G+   LRYDYG +YASK+FYD +K RR+ W W+ E DSE +D+QKGW+S+QGIPRT
Sbjct  375  TIDVGMSSSLRYDYGKFYASKTFYDQNKGRRILWSWIGESDSEAADVQKGWSSLQGIPRT  434

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            +  D KTG NL+Q PVEE++ LR    KF+ +E+ PGSVV +DVG + +LDI AEFE+ K
Sbjct  435  VALDTKTGKNLVQSPVEEIKSLRLSSKKFD-LELSPGSVVPVDVGTATQLDIEAEFEIKK  493

Query  536  DA----FGKAA--GSDIPYSCT---AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKD  688
            ++    FG A+       +SC    AG++ R  LGPFG  V+A +  SE TP+YFYIAK 
Sbjct  494  ESLDKFFGDASVVAEAEEFSCEKNGAGSTVRNALGPFGFSVLATESLSEQTPVYFYIAKG  553

Query  689  TTGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTC  868
                 KTFFC D  RSS+ANDV K  YG  VPVL GE L+MRILVDHSIVE+F QGGRTC
Sbjct  554  KDSKLKTFFCTDTSRSSVANDVIKPIYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTC  613

Query  869  ITSRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            ITSR+YPT+AI   AKLFLFNNA DAT+TAS +VWQM+
Sbjct  614  ITSRVYPTTAIYGAAKLFLFNNALDATVTASFKVWQMN  651



>emb|CAH67112.1| H0502G05.3 [Oryza sativa Indica Group]
 emb|CAH67470.1| OSIGBa0159I10.15 [Oryza sativa Indica Group]
Length=649

 Score =   407 bits (1046),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 204/336 (61%), Positives = 249/336 (74%), Gaps = 10/336 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGI--GLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRP  172
            MWECVD YP+ST+  +  GL+TS   GP +KHVLK SLDDDRNDYYAIGTY   ++ W P
Sbjct  306  MWECVDLYPVSTSPAVEDGLETSTPPGPGVKHVLKASLDDDRNDYYAIGTYDGETDTWTP  365

Query  173  DDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPR  352
            D+  ID GIGLRYDYG +YASK+FYDP  +RRV WGW+ E DSE +D+ KGWAS+Q IPR
Sbjct  366  DNADIDVGIGLRYDYGKFYASKTFYDPVGRRRVLWGWIGETDSERADILKGWASLQSIPR  425

Query  353  TILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD  532
            T++ D KTG+NL+QWPV EVE LR +   F+ ++V PGSVV LDVGK+ +LDI A FEVD
Sbjct  426  TVMLDTKTGSNLLQWPVVEVENLRMRGKSFDGLDVSPGSVVPLDVGKATQLDIEAVFEVD  485

Query  533  ---KDAFGKAAGSDIPYSCTAGASQRGG--LGPFGLLVIAKDDFSEHTPIYFYIAKDTTG  697
                D     AG+   YSC  G    G   +GPFGLLV+A D  SE T ++FY+ K   G
Sbjct  486  TSAADGVVTEAGA-AAYSCGTGGGAVGRGLMGPFGLLVLADDQLSERTAVFFYLVKGVDG  544

Query  698  NFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITS  877
            N  TFFC D LRSS AND+ K+ YG  VPVLDGE+LS+RILVDHSIVE FAQGGRTCITS
Sbjct  545  NLTTFFCQDELRSSKANDLVKRVYGSLVPVLDGENLSIRILVDHSIVEGFAQGGRTCITS  604

Query  878  RIYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            R+YPT AI E AK+FLFNNAT+  +TA S+++W+++
Sbjct  605  RVYPTKAIYESAKIFLFNNATNVRVTAKSLKIWELN  640



>ref|NP_001053422.1| Os04g0535600 [Oryza sativa Japonica Group]
 dbj|BAF15336.1| Os04g0535600 [Oryza sativa Japonica Group]
 dbj|BAG89376.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94058.1| unnamed protein product [Oryza sativa Japonica Group]
Length=656

 Score =   407 bits (1047),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 204/336 (61%), Positives = 249/336 (74%), Gaps = 10/336 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGI--GLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRP  172
            MWECVD YP+ST+  +  GL+TS   GP +KHVLK SLDDDRNDYYAIGTY   ++ W P
Sbjct  313  MWECVDLYPVSTSPAVEDGLETSTPPGPGVKHVLKASLDDDRNDYYAIGTYDGETDTWTP  372

Query  173  DDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPR  352
            D+  ID GIGLRYDYG +YASK+FYDP  +RRV WGW+ E DSE +D+ KGWAS+Q IPR
Sbjct  373  DNADIDVGIGLRYDYGKFYASKTFYDPVGRRRVLWGWIGETDSERADILKGWASLQSIPR  432

Query  353  TILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD  532
            T++ D KTG+NL+QWPV EVE LR +   F+ ++V PGSVV LDVGK+ +LDI A FEVD
Sbjct  433  TVMLDTKTGSNLLQWPVVEVENLRMRGKSFDGLDVSPGSVVPLDVGKATQLDIEAVFEVD  492

Query  533  ---KDAFGKAAGSDIPYSCTAGASQRGG--LGPFGLLVIAKDDFSEHTPIYFYIAKDTTG  697
                D     AG+   YSC  G    G   +GPFGLLV+A D  SE T ++FY+ K   G
Sbjct  493  TSAADGVVTEAGA-AAYSCGTGGGAVGRGLMGPFGLLVLADDQLSERTAVFFYLVKGVDG  551

Query  698  NFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITS  877
            N  TFFC D LRSS AND+ K+ YG  VPVLDGE+LS+RILVDHSIVE FAQGGRTCITS
Sbjct  552  NLTTFFCQDELRSSKANDLVKRVYGSLVPVLDGENLSIRILVDHSIVEGFAQGGRTCITS  611

Query  878  RIYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            R+YPT AI E AK+FLFNNAT+  +TA S+++W+++
Sbjct  612  RVYPTKAIYESAKIFLFNNATNVRVTAKSLKIWELN  647



>ref|XP_008787011.1| PREDICTED: beta-fructofuranosidase 1 [Phoenix dactylifera]
Length=658

 Score =   406 bits (1043),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/342 (60%), Positives = 258/342 (75%), Gaps = 7/342 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDD  178
             MWECVDFYP+ST   +GLDTS   GP +KHVLK SLD ++ DYYAIGTY      W PD+
Sbjct  312   MWECVDFYPVSTGSAVGLDTSTGPGPAVKHVLKASLDVNKRDYYAIGTYDGDKGTWTPDE  371

Query  179   PTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTI  358
             P +D GIGLRYDYG +YASKSFYDP K+RRV WGW  E DSE +DL KGWAS+Q IPRTI
Sbjct  372   PEMDVGIGLRYDYGKFYASKSFYDPVKERRVLWGWTGETDSERTDLVKGWASLQAIPRTI  431

Query  359   LFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
             ++D+KT  NLIQWPV+EVE LR    +F  +++  GSVV L+V ++ ++DI AEFE+D  
Sbjct  432   VYDDKTKRNLIQWPVDEVESLRLNSQEFSSIKLSTGSVVPLNVTEATQVDIEAEFEIDSS  491

Query  539   AFGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
             A  +A  +D+ Y+C+   GA+ RG LGPFGLLV+A  D  E T  YFY+ + T G+ +TF
Sbjct  492   ALERAVEADVGYNCSTGGGAAGRGALGPFGLLVLADPDLKEQTAAYFYLGRRTDGSLRTF  551

Query  713   FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
             FC D LRSSLAND+ ++ YG  VPVLDGESL++RILVDHSIVESFAQGGRT ITSR+YPT
Sbjct  552   FCQDELRSSLANDLVRRVYGSAVPVLDGESLTVRILVDHSIVESFAQGGRTSITSRVYPT  611

Query  893   SAIGEDAKLFLFNNATDATITA-SVEVWQMSEMDSAAPHNFN  1015
              A+ + A++FLFNNATDA++ A S+++WQ   MDSA  H ++
Sbjct  612   KAVYDAARVFLFNNATDASMIARSLKIWQ---MDSAFLHPYS  650



>ref|XP_010476187.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar-like [Camelina 
sativa]
Length=670

 Score =   406 bits (1044),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 200/338 (59%), Positives = 249/338 (74%), Gaps = 12/338 (4%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T   GLDTS NGP++KH++K S+DD R D+YA+GTY E +  W PDDP
Sbjct  316  MWECVDFYPVSKTARKGLDTSVNGPDVKHIVKASMDDTRFDHYAVGTYFESNGTWIPDDP  375

Query  182  TIDTGIG--LRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            +ID G+   LRYDYG +YASK+FYD +K RR+ W W+ E DSE +D+QKGW+SVQGIPRT
Sbjct  376  SIDVGMSSSLRYDYGKFYASKTFYDQNKGRRILWSWIGESDSEAADVQKGWSSVQGIPRT  435

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            +  D KTG NL+Q PVEE++ LR    KF+ +E+ PGSV+ +DVG + +LDI AEFE+ K
Sbjct  436  VALDTKTGKNLVQSPVEEIKSLRLSSKKFD-LELSPGSVIPVDVGTATQLDIEAEFEIKK  494

Query  536  DA----FGKAA--GSDIPYSCT---AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKD  688
            ++    FG A+       +SC    AG++ R  LGPFG  V+A +  SE TP+YFYIAK 
Sbjct  495  ESLDKFFGDASVVAEAEEFSCEKNGAGSTVRNALGPFGFSVLATESLSEQTPVYFYIAKG  554

Query  689  TTGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTC  868
                 KTFFC D  RSS+ANDV K  YG  VPVL GE L+MRILVDHSIVE+F QGGRTC
Sbjct  555  KDSKLKTFFCTDTSRSSVANDVIKPIYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTC  614

Query  869  ITSRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            ITSR+YPT+AI   AKLF+FNNA DAT+TAS +VWQM+
Sbjct  615  ITSRVYPTTAIYGAAKLFVFNNALDATVTASFKVWQMN  652



>ref|XP_010106222.1| hypothetical protein L484_003380 [Morus notabilis]
 gb|EXC08928.1| hypothetical protein L484_003380 [Morus notabilis]
Length=648

 Score =   405 bits (1041),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 203/337 (60%), Positives = 248/337 (74%), Gaps = 6/337 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP++     GLDTS NG  +KHVLK SLDD + D+YAIGTY   ++ W PD+P
Sbjct  312   MWECVDFYPVAINGSNGLDTSVNGVGVKHVLKASLDDTKVDHYAIGTYFARNDTWVPDNP  371

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
               D GIGL+ DYG YYASK+FYD +K+RR+ WGW+ E D+E +DL KGW+SVQ IPRT+L
Sbjct  372   KEDVGIGLKLDYGRYYASKTFYDQNKERRILWGWINETDTEDADLAKGWSSVQTIPRTVL  431

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             FDNKTGTN++QWPVEE+E LR   + F +V V+PG+VV LDVG + +LDI  +FEV+   
Sbjct  432   FDNKTGTNILQWPVEEIESLRLSSNNFTEVVVEPGTVVPLDVGTATQLDIFVDFEVESSE  491

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
               K  G+DI   C  GA  R  LGPFG+LV+A D+ SE TPIYF    ++ GN KT+FCA
Sbjct  492   -SKETGNDIS-GCGDGAVDRNKLGPFGILVLADDELSELTPIYFR-PSNSHGNAKTYFCA  548

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSS A DV K  YG  VPVLDGE LSMR+LVDHSIVESFAQGGR  ITSRIYPT AI
Sbjct  549   DETRSSKATDVFKLVYGSPVPVLDGEKLSMRVLVDHSIVESFAQGGRRVITSRIYPTKAI  608

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
                A+LFLFNNAT AT+ A++++WQ   ++SA  H F
Sbjct  609   YGAARLFLFNNATGATVKATLKIWQ---LNSAFIHPF  642



>ref|XP_009113064.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar [Brassica 
rapa]
Length=654

 Score =   405 bits (1040),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 202/347 (58%), Positives = 251/347 (72%), Gaps = 13/347 (4%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S T+  GLDTS NG ++KH++K S+DD R D+YAIGTY + +  W PD+P
Sbjct  302   MWECVDFYPVSKTKDKGLDTSVNGLDVKHIIKASMDDTRIDHYAIGTYYDSNATWVPDNP  361

Query  182   TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
             +ID GI  GLRYDYG +YASK+FYD  K RR+ WGW+ E DSE +D+QKGW+SVQGIPRT
Sbjct  362   SIDVGISTGLRYDYGKFYASKTFYDQHKGRRILWGWIGESDSEAADVQKGWSSVQGIPRT  421

Query  356   ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
             +  D KTG NL+QWPV+E+E LR  + KF  ++V+PG+VV +DVG + +LDI AEF++ K
Sbjct  422   VALDTKTGKNLVQWPVKEIESLRLGRKKFH-MKVEPGTVVPVDVGPAAQLDIEAEFKIKK  480

Query  536   D----AFGK-AAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
             D     FG  +   D  +SC  + GA+ RG LGPFG  V+A    SE T +YFY+ K   
Sbjct  481   DDLEVVFGDDSVEDDKEFSCETSGGATVRGALGPFGFSVLADQSLSEQTQVYFYVTKGKD  540

Query  695   GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
                KTFFC D  RS++ANDV K  YG  VPVL GE L+MRILVDHSI+E F QGGRTCIT
Sbjct  541   SKLKTFFCTDTSRSTMANDVVKPVYGSFVPVLKGEKLTMRILVDHSIIEGFGQGGRTCIT  600

Query  875   SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNFN  1015
             SR+YPT AI    +LFLFNNA DATITAS +VWQ   M+SA  H F+
Sbjct  601   SRVYPTKAIYGATRLFLFNNAIDATITASFKVWQ---MNSAFIHPFS  644



>ref|NP_001284469.1| acid beta-fructofuranosidase-like [Cucumis melo]
 gb|ACJ04702.1| invertase 2 [Cucumis melo]
Length=630

 Score =   404 bits (1038),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 194/327 (59%), Positives = 241/327 (74%), Gaps = 2/327 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS NG  +KHVLK SLDD + D+YAIGTY   ++ W PD+P
Sbjct  298  MWECVDFYPVSVDGSKGLDTSENGGGVKHVLKASLDDTKMDHYAIGTYFANNDTWVPDNP  357

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGL+YDYG YYASK+FYD +K+RR+ WGW+ E D+E +DL KGWASVQ +P+T+L
Sbjct  358  EEDVGIGLKYDYGRYYASKTFYDQNKERRILWGWINETDTEANDLAKGWASVQTVPKTVL  417

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG+N+IQWPVEEVE LR   ++F  V + PGSVV L+VG + +LDILAEFEV  + 
Sbjct  418  FDQKTGSNIIQWPVEEVESLRLGSNEFNDVLLVPGSVVELEVGPATQLDILAEFEV--EV  475

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
             G   G+     C  GA++R  LGPFG+LV+A    SE TPIYF +A  + G+ + +FCA
Sbjct  476  LGSENGAVSEEGCGGGAAERSSLGPFGVLVLAHQSLSEFTPIYFNVANSSKGSGEAYFCA  535

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS A DV K+ YG  +PVL+GE+ SMR+LVDHSIVESF QGGR  ITSRIYPT AI
Sbjct  536  DETRSSKAPDVFKQVYGSKIPVLEGENYSMRVLVDHSIVESFGQGGRRVITSRIYPTEAI  595

Query  902  GEDAKLFLFNNATDATITASVEVWQMS  982
               AKLFLFNN T A + A+V+VWQ++
Sbjct  596  YGAAKLFLFNNGTSANVKAAVKVWQLN  622



>ref|XP_011010942.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like, 
partial [Populus euphratica]
Length=520

 Score =   400 bits (1027),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/337 (58%), Positives = 240/337 (71%), Gaps = 7/337 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP++     GLDTS  G  IKHVLK SLDD + D+YAIG Y   ++KW PD+P
Sbjct  186   MWECVDFYPVAINGSTGLDTSAQGAGIKHVLKASLDDTKRDHYAIGVYDPVTDKWTPDNP  245

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
               D GIGL+ DYG YYASKSFYD +K+RR+ WGW+ E D+ET DL KGWASVQ IPR +L
Sbjct  246   KEDVGIGLQVDYGRYYASKSFYDQNKQRRILWGWINETDTETDDLAKGWASVQTIPRNVL  305

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             +DNKTGTN++QWPVEE+E LR + + F ++ V PGSVV LD+G++ +LDI AEFE++  +
Sbjct  306   YDNKTGTNILQWPVEEIESLRLRSTDFTEIVVGPGSVVPLDIGQATQLDIFAEFEIEIIS  365

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
               K       Y C+ GA  R  LGPFGLLVIA    SE TP++F     T G  +T+FCA
Sbjct  366   ETKHEK----YGCSGGAVDRSALGPFGLLVIADQTLSELTPVFFRPVNTTEGIVETYFCA  421

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSS A+DV K+ YG TVPV   E   MR+LVDHSIVESFAQGGR  ITSRIYPT AI
Sbjct  422   DETRSSKASDVYKQVYGSTVPVFTDEKFQMRVLVDHSIVESFAQGGRRVITSRIYPTKAI  481

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
               DA+LFLFNNAT   + A++++W   E++SA  H F
Sbjct  482   YGDARLFLFNNATGVNVKATLKIW---ELNSAFIHPF  515



>ref|XP_006391837.1| hypothetical protein EUTSA_v10023331mg [Eutrema salsugineum]
 gb|ESQ29123.1| hypothetical protein EUTSA_v10023331mg [Eutrema salsugineum]
Length=655

 Score =   404 bits (1038),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 198/336 (59%), Positives = 243/336 (72%), Gaps = 10/336 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T+  GLDTS NGP++KH++K S+DD R D+YAIGTY + +  W PD+P
Sbjct  303  MWECVDFYPVSKTKANGLDTSVNGPDVKHIVKASMDDTRIDHYAIGTYYDSNATWVPDNP  362

Query  182  TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
             ID GI  GLRYDYG YYASK+FYD  K+RR+ WGW+ E DSE +D+QKGW+SVQGIPRT
Sbjct  363  KIDVGISTGLRYDYGKYYASKTFYDQHKRRRILWGWIGESDSEAADVQKGWSSVQGIPRT  422

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KTG NL+QWPV+E+E LR    KF  ++V+PG+VV +DVG + +LDI AEF++ K
Sbjct  423  VVLDTKTGKNLVQWPVKEIESLRLSSKKFH-MKVEPGTVVPVDVGPAAQLDIEAEFKIKK  481

Query  536  DAFGKAAGSDI-----PYSC-TAGASQ-RGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
            D      G D       +SC T+G S  RG LGPFG  V+A    SE TP+YFY+ K   
Sbjct  482  DDLEVILGDDSVEDDKEFSCQTSGLSTVRGALGPFGFSVLADQSLSEQTPVYFYVTKGKD  541

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
               + F C D  RS+ ANDV K  YG  VPVL GE L+MRILVDHSIVE+F QGGRTCIT
Sbjct  542  SKLRAFLCTDTSRSTKANDVVKPVYGSFVPVLKGEKLTMRILVDHSIVEAFGQGGRTCIT  601

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            SR+YPT AI    KLFLFNNA DAT+T S +VWQM+
Sbjct  602  SRVYPTKAIYGATKLFLFNNAIDATVTVSFKVWQMN  637



>ref|XP_006300852.1| hypothetical protein CARUB_v10019944mg [Capsella rubella]
 gb|EOA33750.1| hypothetical protein CARUB_v10019944mg [Capsella rubella]
Length=640

 Score =   403 bits (1035),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 203/348 (58%), Positives = 245/348 (70%), Gaps = 14/348 (4%)
 Frame = +2

Query  5     WECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDPT  184
             WECVDFYP+S T+ IGLDTS  GP++KHV+K S+DD R D YAIGTY + +  W PD+P+
Sbjct  294   WECVDFYPVSKTKVIGLDTSVKGPDVKHVVKASMDDTRMDLYAIGTYVDANGTWFPDNPS  353

Query  185   IDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTI  358
             ID GI  GLRYDYGTYYASK+FYD +K RR+ WG+  E DS  +D+QKGWASVQ IPRT+
Sbjct  354   IDVGISTGLRYDYGTYYASKTFYDGNKGRRILWGFTIESDSVYADVQKGWASVQAIPRTV  413

Query  359   LFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
             + D KTG NLI WPVEE+E LR    K+  + V PG+V+ +DVG + +LDI AEF + KD
Sbjct  414   VLDTKTGNNLILWPVEEIESLRLNSKKYH-MTVGPGTVIPVDVGSASQLDIEAEFTIMKD  472

Query  539   AFGKAAGSDI------PYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
                   G D        YSC    G++ RG LGPFG  V+A    SEHTP+YFY+ K   
Sbjct  473   DLEIILGDDPVVADGKDYSCETNGGSTVRGALGPFGFSVLADQTLSEHTPVYFYVTKGKD  532

Query  695   GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
                KTFFC D+LRSS+ANDV K  YG  VPVL GE L+MRILVDHSI+E F QGGRTCIT
Sbjct  533   SKLKTFFCTDNLRSSMANDVVKSVYGSLVPVLKGEKLTMRILVDHSIIEGFGQGGRTCIT  592

Query  875   SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNFNK  1018
             SR YPT AI    KLFLFNNA DA +TAS +VWQ   M+SA  H +++
Sbjct  593   SRAYPTKAIYGATKLFLFNNAIDANVTASFKVWQ---MNSAFIHPYSE  637



>emb|CAA66237.1| invertase 5 [Tulipa gesneriana]
Length=628

 Score =   402 bits (1033),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 197/341 (58%), Positives = 249/341 (73%), Gaps = 5/341 (1%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDD  178
             MWECVDFYP+ T   +GLDTS   GP ++HVLK SLDDD++DYYAIGTY   S  W PDD
Sbjct  287   MWECVDFYPVLTNSTVGLDTSVPPGPGVRHVLKASLDDDKHDYYAIGTYDVVSGTWTPDD  346

Query  179   PTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTI  358
                D GIG RYDYG +YASK+F+D +K RRV WG+  E DSE ++  KGWASV  IPRTI
Sbjct  347   VESDVGIGWRYDYGKFYASKTFFDSAKGRRVLWGFTGETDSEQNNRLKGWASVLPIPRTI  406

Query  359   LFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
             LFD KTG+NL+ WPVEEVE+LR+ +  FE +++  G+VV LD+GK+ +LDI+AEFE+D  
Sbjct  407   LFDQKTGSNLLLWPVEEVERLRTSRQDFENIDIGIGAVVPLDIGKAIQLDIVAEFEIDGA  466

Query  539   AFGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
                 +  +D+ Y+C+   GA  RG LGPFG LV++ +D SE T IYFY+ +   G   TF
Sbjct  467   TLEASVEADLGYNCSTSDGAFGRGVLGPFGFLVLSDEDLSEQTAIYFYVGRKMDGALHTF  526

Query  713   FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
             FC D LRSS AND+ K+ +G  VPVL GE+ +MRIL+DHSIVESFAQGGRTCITSRIYPT
Sbjct  527   FCQDELRSSKANDLVKRVFGSIVPVLHGETFTMRILLDHSIVESFAQGGRTCITSRIYPT  586

Query  893   SAIGEDAKLFLFNNATDATITA-SVEVWQMSEMDSAAPHNF  1012
              A    A++F+FNNAT A +TA S+++WQM+   S  P+ F
Sbjct  587   KAFDGAARVFIFNNATGAKVTAKSIKIWQMNSA-SIIPYPF  626



>gb|AAM77272.1|AF519809_1 acid invertase [Lagenaria siceraria]
Length=663

 Score =   403 bits (1036),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 195/327 (60%), Positives = 242/327 (74%), Gaps = 2/327 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS NG  +KHVLK SLDD + D+YAIGTY   ++ W PD+P
Sbjct  331  MWECVDFYPVSVHGSKGLDTSVNGHGVKHVLKASLDDTKMDHYAIGTYFSNNDTWVPDNP  390

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGL+ DYG YYASK+FYD +K+RR+ WGW+ E D+E +DL KGWASVQ IPRT+L
Sbjct  391  EEDVGIGLKLDYGRYYASKTFYDQNKERRILWGWINETDTEANDLAKGWASVQTIPRTVL  450

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD+KTG+N+IQWPVEEVE LR   ++F  V V+PGSVV L+VG + +LDIL EFE+  +A
Sbjct  451  FDHKTGSNIIQWPVEEVESLRLGSTEFNDVLVEPGSVVELEVGTATQLDILTEFEL--EA  508

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
             G    +     C  GA++R  LGPFGLLV+A    SE TPIYF +A  + G+ + +FCA
Sbjct  509  LGSEKATISEEGCGGGAAERSSLGPFGLLVLAHQSLSELTPIYFNVANSSKGSREAYFCA  568

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS A DV K+ YG  +PVL+GE+ SMR+LVDHSIVESF QGGR  ITSRIYPT AI
Sbjct  569  DEKRSSKAPDVFKQVYGSKIPVLEGENFSMRVLVDHSIVESFGQGGRRVITSRIYPTEAI  628

Query  902  GEDAKLFLFNNATDATITASVEVWQMS  982
               AKLFLFNNAT A + A+V+VW+++
Sbjct  629  YGAAKLFLFNNATSANVKATVKVWRLN  655



>ref|XP_002888009.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64268.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=654

 Score =   403 bits (1035),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 196/336 (58%), Positives = 248/336 (74%), Gaps = 10/336 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T+  GLDTS NGP++KHV+K S+DD R D+YAIGTY + +  W PD+P
Sbjct  302  MWECVDFYPVSKTQVNGLDTSVNGPDVKHVIKASMDDTRIDHYAIGTYYDSNGTWVPDNP  361

Query  182  TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            +ID GI   LRYDYG +YASK+FYD +K RR+ WGW+ E DSE +D+QKGW+SVQGIPRT
Sbjct  362  SIDVGISTALRYDYGKFYASKTFYDQNKGRRILWGWIGESDSEAADVQKGWSSVQGIPRT  421

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEV--  529
            ++ D +T  NL+QWPVEE++ LR   +KF+ + + PG+VV +DVG + +LDI AEFE+  
Sbjct  422  VVLDTRTRKNLVQWPVEEIKSLRLSSNKFD-MTIGPGTVVPVDVGSATQLDIEAEFEIKT  480

Query  530  -DKDAF--GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
             D + F    +  +D  +SC  + G++ RG LGPFG  V+A +  SE TP+YFY+ K   
Sbjct  481  EDLELFFDDDSVEADKKFSCETSGGSTARGALGPFGFSVLADESLSEQTPVYFYVTKGKH  540

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
               KT FC D  RS++ANDV K  YG  VPVL GE L+MRILVDHSIVE FAQGGRTCIT
Sbjct  541  SKLKTVFCTDTSRSTMANDVVKPIYGSFVPVLKGEKLTMRILVDHSIVEGFAQGGRTCIT  600

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            SR+YPT AI    KLFLFNNA DAT+TAS +VWQM+
Sbjct  601  SRVYPTKAIYGATKLFLFNNAIDATVTASFKVWQMN  636



>emb|CAA61624.1| beta-fructofuranosidase [Arabidopsis thaliana]
Length=562

 Score =   399 bits (1026),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 194/337 (58%), Positives = 242/337 (72%), Gaps = 10/337 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T+  GLDTS NGP++KHV+K S+DD R D+YAIGTY + +  W PD+P
Sbjct  210  MWECVDFYPVSKTQVNGLDTSVNGPDVKHVIKASMDDTRIDHYAIGTYDDSNATWVPDNP  269

Query  182  TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            +ID GI  GLRYDYG YYASK+FYD +K RR+ WGW+ E DSE +D+QKGW+SVQGIPRT
Sbjct  270  SIDVGISTGLRYDYGKYYASKTFYDQNKGRRILWGWIGESDSEAADVQKGWSSVQGIPRT  329

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD-  532
            ++ D +T  NL+QWPVEE++ LR    KF+ + + PG+VV +DVG + +LDI AEFE+  
Sbjct  330  VVLDTRTHKNLVQWPVEEIKSLRLSSKKFD-MTIGPGTVVPVDVGSATQLDIEAEFEIKT  388

Query  533  ----KDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
                      +  +D  +SC    G++ RG LGPFG  V+A ++ SE TP+YFY+ K   
Sbjct  389  DDLKLFFDDDSVEADNKFSCETNGGSTARGALGPFGFSVLADENLSEQTPVYFYVTKGKH  448

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
                T FC D  RS+LANDV K  YG  VPVL GE L+MRILVDHSIVE FAQGGR+CIT
Sbjct  449  SKLNTVFCTDTSRSTLANDVVKPIYGSFVPVLKGEKLTMRILVDHSIVEGFAQGGRSCIT  508

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMSE  985
            SR+YPT AI    KLFLFNNA DAT+T S  VWQM+ 
Sbjct  509  SRVYPTKAIYGATKLFLFNNAIDATVTTSFTVWQMNN  545



>emb|CDY31826.1| BnaC09g13230D [Brassica napus]
Length=654

 Score =   402 bits (1033),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 198/347 (57%), Positives = 248/347 (71%), Gaps = 13/347 (4%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S T+  GLDTS NGP++KH++K S+DD R D+YAIGTY + +  W PD+P
Sbjct  302   MWECVDFYPVSKTKDKGLDTSVNGPDVKHIIKASMDDTRIDHYAIGTYYDSNATWVPDNP  361

Query  182   TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
             +ID GI  GLRYDYG +YASK+FYD  K RR+ WGW+ E DSE +D+QKGW+SVQGIPR 
Sbjct  362   SIDVGISTGLRYDYGKFYASKTFYDQHKGRRILWGWIGESDSEAADVQKGWSSVQGIPRI  421

Query  356   ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
             +  D KTG NL+QWPV+E+E LR +  KF  ++V+PG+VV +DVG + +LDI AEF++ K
Sbjct  422   VALDTKTGKNLVQWPVKEIESLRLRSKKFH-MKVEPGTVVPVDVGPAAQLDIEAEFKIKK  480

Query  536   DAF-----GKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
             +         +   D  +SC  + GA+ RG LGPFG  V+A    SE T +YFY+ K   
Sbjct  481   EDLEVVFADDSVEDDKEFSCETSGGATVRGALGPFGFSVLADQSLSEQTQVYFYVTKGKD  540

Query  695   GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
                KTFFC D  RS++ANDV K  YG  VPVL GE L+MRILVDHSI+E F QGGRTCIT
Sbjct  541   SKLKTFFCTDTSRSTMANDVVKPVYGSFVPVLKGEKLTMRILVDHSIIEGFGQGGRTCIT  600

Query  875   SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNFN  1015
             SR+YPT AI    +LFLFNNA DA ITAS +VWQ   M+SA  H F+
Sbjct  601   SRVYPTKAIYGATRLFLFNNANDAAITASFKVWQ---MNSAFIHPFS  644



>ref|XP_008794813.1| PREDICTED: beta-fructofuranosidase 1-like [Phoenix dactylifera]
Length=664

 Score =   402 bits (1033),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 196/349 (56%), Positives = 253/349 (72%), Gaps = 14/349 (4%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIG----LDTSYN----GPNIKHVLKTSLDDDRNDYYAIGTYKEPS  157
             MWECVDF+P++  EG      +DTS      GP ++HVLK S+DDDR+DYYAIGTY   +
Sbjct  316   MWECVDFFPVAAAEGPEAAEGMDTSAAAAAAGPGVRHVLKASMDDDRHDYYAIGTYDAET  375

Query  158   EKWRPDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASV  337
               WRP+D  +D GIGLRYD+G +YASK+FYDP+++RRV WGW+ E DSE +D+ KGWAS+
Sbjct  376   NTWRPEDERMDVGIGLRYDWGKFYASKTFYDPARRRRVLWGWIGETDSERADVLKGWASL  435

Query  338   QGIPRTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILA  517
             Q IPRT+LFD KT +NL+QWPVEEVE+LR     F  + +  GSV+ L++ ++ +LDI A
Sbjct  436   QAIPRTVLFDTKTRSNLLQWPVEEVERLRMSSKNFSGIVIDSGSVLSLNITRATQLDIEA  495

Query  518   EFEVDKDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDT  691
              FE++ +A      +D+ Y+C  + GA++RG LGPFGLLV+A +  SE T +YFYIA+ T
Sbjct  496   VFEIEGEALAMTVEADVGYNCSTSGGAAERGMLGPFGLLVLANERLSEQTAVYFYIARGT  555

Query  692   TGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCI  871
              GN +T  C D LRSS AND+ K+  G TVPVLDGE LS+RILVDHSIVESFAQGGRTCI
Sbjct  556   DGNLRTHICHDELRSSRANDIIKRVVGSTVPVLDGERLSVRILVDHSIVESFAQGGRTCI  615

Query  872   TSRIYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMSEMDSAAPHNFN  1015
             TSR+YPT AI    K FLFNN T A++ A S+ +W   EMDS   H ++
Sbjct  616   TSRVYPTEAIYSATKAFLFNNGTGASVIARSLTIW---EMDSTFDHPYS  661



>ref|XP_011000150.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Populus euphratica]
 ref|XP_011000151.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Populus euphratica]
Length=642

 Score =   401 bits (1031),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/337 (58%), Positives = 240/337 (71%), Gaps = 7/337 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP++     GLDTS  G  IKHVLK SLDD + D+YAIG Y   ++KW PD+P
Sbjct  308   MWECVDFYPVAINGSTGLDTSAQGAGIKHVLKASLDDTKRDHYAIGVYDPVTDKWTPDNP  367

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
               D GIGL+ DYG YYASKSFYD +K+RR+ WGW+ E D+ET DL KGWASVQ IPR +L
Sbjct  368   KEDVGIGLQVDYGRYYASKSFYDQNKQRRILWGWINETDTETDDLAKGWASVQTIPRNVL  427

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             +DNKTGTN++QWPVEE+E LR + + F ++ V PGSVV LD+G++ +LDI AEFE++  +
Sbjct  428   YDNKTGTNILQWPVEEIESLRLRSTDFTEIVVGPGSVVPLDIGQATQLDIFAEFEIEIIS  487

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
               K       Y C+ GA  R  LGPFGLLVIA    SE TP++F     T G  +T+FCA
Sbjct  488   ETKHEK----YGCSGGAVDRSALGPFGLLVIADQTLSELTPVFFRPVNTTEGIVETYFCA  543

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSS A+DV K+ YG TVPV   E   MR+LVDHSIVESFAQGGR  ITSRIYPT AI
Sbjct  544   DETRSSKASDVYKQVYGSTVPVFTDEKFQMRVLVDHSIVESFAQGGRRVITSRIYPTKAI  603

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
               DA+LFLFNNAT   + A++++W   E++SA  H F
Sbjct  604   YGDARLFLFNNATGVNVKATLKIW---ELNSAFIHPF  637



>ref|XP_007131343.1| hypothetical protein PHAVU_011G005900g [Phaseolus vulgaris]
 gb|ESW03337.1| hypothetical protein PHAVU_011G005900g [Phaseolus vulgaris]
Length=627

 Score =   400 bits (1029),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/327 (60%), Positives = 241/327 (74%), Gaps = 7/327 (2%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS NGP +KHVLK+SLDD R D+YAIG Y   ++ W PDDP
Sbjct  298  MWECVDFYPVSVNGPDGLDTSVNGPGVKHVLKSSLDDTRGDHYAIGRYFIENDTWVPDDP  357

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGL+ DYG +YASK+FYD +KKRRV WGW+ E DSET+DL+KGWAS+Q IPRT++
Sbjct  358  NKDVGIGLKLDYGRFYASKTFYDQNKKRRVLWGWINESDSETADLKKGWASLQSIPRTVV  417

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KT T+L+QWPVEE+E LR +  +FE+V VKPGSVV LD+G + +LDI AEFE++  A
Sbjct  418  FDKKTETHLLQWPVEEIESLRLRSYEFEEVVVKPGSVVPLDIGPATQLDIFAEFEIEYLA  477

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
              K  G      C  GA  R  LGPFG+L IA D  SE TPIYF+++        +FFC 
Sbjct  478  -SKGTGKKENVGCGNGAFDRSSLGPFGILAIADDKLSELTPIYFHLSN------TSFFCV  530

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS A+DV K  +G  VPV+  E LSMR+LVDHSI+ESFAQGGRT I+SR+YPT AI
Sbjct  531  DETRSSKASDVSKLVFGSEVPVVGDERLSMRVLVDHSIIESFAQGGRTVISSRVYPTEAI  590

Query  902  GEDAKLFLFNNATDATITASVEVWQMS  982
             E A+LF+FNNATD  I AS+++WQ++
Sbjct  591  YEAARLFVFNNATDINIKASLKIWQLN  617



>gb|AAF87245.1|AF276703_1 vacuolar acid invertase [Oryza sativa]
Length=652

 Score =   401 bits (1031),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 204/342 (60%), Positives = 249/342 (73%), Gaps = 16/342 (5%)
 Frame = +2

Query  2    MWECVDFYPISTTEGI--GLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRP  172
            MWECVD YP+ST+  +  GL+TS   GP +KHVLK SLDDDRNDYYAIGTY   ++ W P
Sbjct  303  MWECVDLYPVSTSPAVEDGLETSTPPGPGVKHVLKASLDDDRNDYYAIGTYDGETDTWTP  362

Query  173  DDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPR  352
            D+  ID GIGLRYDYG +YASK+FYDP  +RRV WGW+ E DSE +D+ KGWAS+Q IPR
Sbjct  363  DNADIDVGIGLRYDYGKFYASKTFYDPVGRRRVLWGWIGETDSERADILKGWASLQSIPR  422

Query  353  TILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD  532
            T++ D KTG+NL+QWPV EVE LR +   F+ ++V PGSVV LDVGK+ +LDI A FEVD
Sbjct  423  TVMLDTKTGSNLLQWPVVEVENLRMRGKSFDGLDVSPGSVVPLDVGKATQLDIEAVFEVD  482

Query  533  ---KDAFGKAAGSDIPYSCTAGASQRGG--LGPFGLLVIAKDDFSEHTPIYFYIAKDTTG  697
                D     AG+   YSC  G    G   +GPFGLLV+A D  SE T ++FY+ K   G
Sbjct  483  TSAADGVVTEAGA-AAYSCGTGGGAVGRGLMGPFGLLVLADDQLSERTAVFFYLVKGVDG  541

Query  698  NFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRIL------VDHSIVESFAQGG  859
            N  TFFC D LRSS AND+ K+ YG  VPVLDGE+LS+RIL      VDHSIVE FAQGG
Sbjct  542  NLTTFFCQDELRSSKANDLVKRVYGSLVPVLDGENLSIRILVSLSSNVDHSIVEGFAQGG  601

Query  860  RTCITSRIYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            RTCITSR+YPT AI E AK+FLFNNAT+  +TA S+++W+++
Sbjct  602  RTCITSRVYPTKAIYESAKIFLFNNATNVRVTAKSLKIWELN  643



>ref|XP_004307805.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
isoform 1 [Fragaria vesca subsp. vesca]
Length=644

 Score =   401 bits (1030),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 196/340 (58%), Positives = 244/340 (72%), Gaps = 12/340 (4%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWEC+DFYP++     GLDTS N P++KHVLK SLDD + D+YA+GTY   +E W PD+P
Sbjct  308   MWECIDFYPVAINGSKGLDTSVNDPSVKHVLKASLDDTKVDHYALGTYFIENETWVPDNP  367

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              +D GIGL+YDYG YYASK+FYD +K+RR+ WGW+ E D+E+ DL KGWASVQ IPR++L
Sbjct  368   ALDVGIGLKYDYGRYYASKTFYDQNKERRILWGWINETDTESDDLAKGWASVQTIPRSVL  427

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD---  532
             FDNKTGTNLIQWPVEE+E+LR   + F  V V+ G+VV LD+G + +LDI  EFE++   
Sbjct  428   FDNKTGTNLIQWPVEEIEELRLNSTDFSDVLVEAGAVVELDIGTATQLDIFVEFEIESLG  487

Query  533   KDAFGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
              +    + G      C  GA+ R   GPFG+LVIA +  SE TPIYF IA  T G+  T+
Sbjct  488   SETLNSSVG------CGGGATDRTSFGPFGILVIADEILSELTPIYFNIANSTEGDVTTY  541

Query  713   FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
             FCAD  RSS A DV K+ YG  VPVL+GE    R+LVDHSIVESFAQGGRT ITSRIYPT
Sbjct  542   FCADERRSSKAPDVFKQVYGSEVPVLEGEKHFARVLVDHSIVESFAQGGRTVITSRIYPT  601

Query  893   SAIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
              AI   AKLFLFNNAT   + A++++WQ   ++SA  H F
Sbjct  602   EAIYGAAKLFLFNNATGLNVKATLKIWQ---LNSAFIHPF  638



>emb|CAA64781.1| beta-fructosidase [Arabidopsis thaliana]
Length=639

 Score =   401 bits (1030),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 195/336 (58%), Positives = 242/336 (72%), Gaps = 10/336 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T+  GLDTS NGP++KHV+K S+DD R D+YAIGTY + +  W PD+P
Sbjct  287  MWECVDFYPVSKTQLNGLDTSVNGPDVKHVIKASMDDTRIDHYAIGTYDDSNATWVPDNP  346

Query  182  TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            +ID GI  GLRYDYG YYASK+FYD +K RR+ WGW+ E DSE +D+QKGW+SVQGIPRT
Sbjct  347  SIDVGISTGLRYDYGKYYASKTFYDQNKGRRILWGWIGESDSEAADVQKGWSSVQGIPRT  406

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD-  532
            ++ D +T  NL+QWPVEE++ LR    KF+ + + PG+VV +DVG + +LDI AEFE+  
Sbjct  407  VVLDTRTHKNLVQWPVEEIKSLRLSSKKFD-MTIGPGTVVPVDVGSATQLDIEAEFEIKT  465

Query  533  ----KDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
                      +  +D  +SC    G++ RG LGPFG  V+A +  SE TP+YFY+ K   
Sbjct  466  DDLKLFFDDDSVEADNKFSCETNGGSTARGALGPFGFSVLADEGLSEQTPVYFYVTKGKH  525

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
                T FC D  RS+LANDV K  YG  VPVL GE L+MRILVDHSIVE FAQGGR+CIT
Sbjct  526  SKLNTVFCTDTSRSTLANDVVKPIYGSFVPVLKGEKLTMRILVDHSIVEGFAQGGRSCIT  585

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            SR+YPT AI    KLFLFNNA DAT+TAS  VWQM+
Sbjct  586  SRVYPTKAIYGATKLFLFNNAIDATVTASFTVWQMN  621



>gb|KDP22418.1| hypothetical protein JCGZ_26249 [Jatropha curcas]
Length=627

 Score =   400 bits (1029),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 190/326 (58%), Positives = 236/326 (72%), Gaps = 4/326 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP++    +GLDTS NG   KHVLK SLD+ + D+YA+GTY   ++ W PD+P
Sbjct  293  MWECVDFYPVAINGSVGLDTSANGLGTKHVLKASLDNTKVDHYALGTYDPITDTWTPDNP  352

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLR DYG YYASK+FYD  K+RR+ WGW+ E D+E  DL KGWASVQ IPR +L
Sbjct  353  KEDVGIGLRVDYGRYYASKTFYDQHKERRILWGWINETDTEEDDLDKGWASVQTIPRAVL  412

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FDNKTGTNL+QWPVEE+E LR   + FE++ V PGS+V L++G + +LDI AEFE +  +
Sbjct  413  FDNKTGTNLLQWPVEEIESLRLNSTDFEEIVVGPGSIVPLEIGVATQLDIFAEFETELIS  472

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
                      Y C  GA  R  LGPFGLLV+A +  SE TP++F     T G+FKT+FC+
Sbjct  473  NSVVEE----YGCNGGAVNRSSLGPFGLLVLADETLSELTPVFFRPVNSTDGSFKTYFCS  528

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS A DV K+ YG TVPVLD E L MR+LVDHSIVESFAQGGRT ITSRIYPT AI
Sbjct  529  DEKRSSKAPDVCKQVYGSTVPVLDDEKLRMRVLVDHSIVESFAQGGRTVITSRIYPTEAI  588

Query  902  GEDAKLFLFNNATDATITASVEVWQM  979
              +A+LFLFNNAT   + A++++W++
Sbjct  589  DGNARLFLFNNATSVNVKATLKIWEL  614



>gb|AAD43622.1|AC005698_21 T3P18.21 [Arabidopsis thaliana]
Length=650

 Score =   401 bits (1030),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 195/336 (58%), Positives = 242/336 (72%), Gaps = 10/336 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T+  GLDTS NGP++KHV+K S+DD R D+YAIGTY + +  W PD+P
Sbjct  298  MWECVDFYPVSKTQLNGLDTSVNGPDVKHVIKASMDDTRIDHYAIGTYDDSNATWVPDNP  357

Query  182  TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            +ID GI  GLRYDYG YYASK+FYD +K RR+ WGW+ E DSE +D+QKGW+SVQGIPRT
Sbjct  358  SIDVGISTGLRYDYGKYYASKTFYDQNKGRRILWGWIGESDSEAADVQKGWSSVQGIPRT  417

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD-  532
            ++ D +T  NL+QWPVEE++ LR    KF+ + + PG+VV +DVG + +LDI AEFE+  
Sbjct  418  VVLDTRTHKNLVQWPVEEIKSLRLSSKKFD-MTIGPGTVVPVDVGSATQLDIEAEFEIKT  476

Query  533  ----KDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
                      +  +D  +SC    G++ RG LGPFG  V+A +  SE TP+YFY+ K   
Sbjct  477  DDLKLFFDDDSVEADNKFSCETNGGSTARGALGPFGFSVLADEGLSEQTPVYFYVTKGKH  536

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
                T FC D  RS+LANDV K  YG  VPVL GE L+MRILVDHSIVE FAQGGR+CIT
Sbjct  537  SKLNTVFCTDTSRSTLANDVVKPIYGSFVPVLKGEKLTMRILVDHSIVEGFAQGGRSCIT  596

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            SR+YPT AI    KLFLFNNA DAT+TAS  VWQM+
Sbjct  597  SRVYPTKAIYGATKLFLFNNAIDATVTASFTVWQMN  632



>ref|NP_564798.1| acid beta-fructofuranosidase 3 [Arabidopsis thaliana]
 sp|Q43348.1|INVA3_ARATH RecName: Full=Acid beta-fructofuranosidase 3, vacuolar; Short=At 
beta fruct3; Short=AtBETAFRUCT3; AltName: Full=Acid invertase 
3; Short=AI 3; AltName: Full=Acid sucrose hydrolase 3; 
AltName: Full=Vacuolar invertase 3; Short=Inv-V3; Short=VAC-INV 
3; Short=VI 3; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA67560.1| beta-fructosidase [Arabidopsis thaliana]
 gb|AAK82531.1| At1g62660/F23N19_3 [Arabidopsis thaliana]
 gb|AAL32559.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AAL36260.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AAM45114.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AEE33991.1| beta-fructofuranosidase [Arabidopsis thaliana]
Length=648

 Score =   401 bits (1030),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 195/336 (58%), Positives = 242/336 (72%), Gaps = 10/336 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T+  GLDTS NGP++KHV+K S+DD R D+YAIGTY + +  W PD+P
Sbjct  296  MWECVDFYPVSKTQLNGLDTSVNGPDVKHVIKASMDDTRIDHYAIGTYDDSNATWVPDNP  355

Query  182  TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            +ID GI  GLRYDYG YYASK+FYD +K RR+ WGW+ E DSE +D+QKGW+SVQGIPRT
Sbjct  356  SIDVGISTGLRYDYGKYYASKTFYDQNKGRRILWGWIGESDSEAADVQKGWSSVQGIPRT  415

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD-  532
            ++ D +T  NL+QWPVEE++ LR    KF+ + + PG+VV +DVG + +LDI AEFE+  
Sbjct  416  VVLDTRTHKNLVQWPVEEIKSLRLSSKKFD-MTIGPGTVVPVDVGSATQLDIEAEFEIKT  474

Query  533  ----KDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
                      +  +D  +SC    G++ RG LGPFG  V+A +  SE TP+YFY+ K   
Sbjct  475  DDLKLFFDDDSVEADNKFSCETNGGSTARGALGPFGFSVLADEGLSEQTPVYFYVTKGKH  534

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
                T FC D  RS+LANDV K  YG  VPVL GE L+MRILVDHSIVE FAQGGR+CIT
Sbjct  535  SKLNTVFCTDTSRSTLANDVVKPIYGSFVPVLKGEKLTMRILVDHSIVEGFAQGGRSCIT  594

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            SR+YPT AI    KLFLFNNA DAT+TAS  VWQM+
Sbjct  595  SRVYPTKAIYGATKLFLFNNAIDATVTASFTVWQMN  630



>ref|XP_003533514.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Glycine max]
Length=630

 Score =   400 bits (1029),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 198/328 (60%), Positives = 238/328 (73%), Gaps = 3/328 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS NGP++KHVLK SLDD + D+YAIGTY   ++ W PD+P
Sbjct  292  MWECVDFYPVSVNGPNGLDTSENGPDVKHVLKASLDDTKVDHYAIGTYFIENDTWVPDNP  351

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGL+ DYG YYASK+FYD  K+RR+ WGW+ E DSET+DL+KGWAS+Q IPRT++
Sbjct  352  NEDVGIGLKLDYGRYYASKTFYDQQKQRRILWGWINESDSETADLKKGWASLQTIPRTVV  411

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KT TNL+ WPVEEVE LR   S+FE V VKPGSVV LD+G + +LDI AEFE++ D 
Sbjct  412  FDKKTRTNLLHWPVEEVESLRLSNSEFEGVVVKPGSVVPLDIGPATQLDIFAEFEIE-DL  470

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT-GNFKTFFC  718
              K  G D    C  GA  R   GPFG+L IA D  SE TPIYF+++  T  G+  T FC
Sbjct  471  ASKGIGKD-NVDCGNGAVDRSAFGPFGILAIADDQLSELTPIYFHLSSTTKDGSLTTSFC  529

Query  719  ADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSA  898
             D  RSS A DV K  +G   PVL  E LSMR+LVDHSI+ESFAQGGRT ITSR+YPT A
Sbjct  530  VDETRSSKAPDVSKLIFGSKAPVLSDEKLSMRVLVDHSIIESFAQGGRTVITSRVYPTEA  589

Query  899  IGEDAKLFLFNNATDATITASVEVWQMS  982
            I   A+LFLFNNATD  I AS+++WQ++
Sbjct  590  IYGAARLFLFNNATDINIKASLKIWQLN  617



>gb|KHN11662.1| Beta-fructofuranosidase, soluble isoenzyme I [Glycine soja]
Length=534

 Score =   397 bits (1020),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 197/328 (60%), Positives = 238/328 (73%), Gaps = 3/328 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS NGP++KHVLK SLDD + D+YAIGTY   ++ W PD+P
Sbjct  196  MWECVDFYPVSVNGPNGLDTSENGPDVKHVLKASLDDTKVDHYAIGTYFIENDTWVPDNP  255

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGL+ DYG YYASK+FYD  K+RR+ WGW+ E DSET+DL+KGWAS+Q IPRT++
Sbjct  256  NEDVGIGLKLDYGRYYASKTFYDQQKQRRILWGWINESDSETADLKKGWASLQTIPRTVV  315

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KT TNL+ WPV+EVE LR   S+FE V VKPGSVV LD+G + +LDI AEFE++ D 
Sbjct  316  FDKKTRTNLLHWPVKEVESLRLSNSEFEGVVVKPGSVVPLDIGPATQLDIFAEFEIE-DL  374

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT-GNFKTFFC  718
              K  G D    C  GA  R   GPFG+L IA D  SE TPIYF+++  T  G+  T FC
Sbjct  375  ASKGIGKD-NVDCGNGAVDRSAFGPFGILAIADDQLSELTPIYFHLSSTTKDGSLTTSFC  433

Query  719  ADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSA  898
             D  RSS A DV K  +G   PVL  E LSMR+LVDHSI+ESFAQGGRT ITSR+YPT A
Sbjct  434  VDETRSSKAPDVSKLIFGSKAPVLSDEKLSMRVLVDHSIIESFAQGGRTVITSRVYPTEA  493

Query  899  IGEDAKLFLFNNATDATITASVEVWQMS  982
            I   A+LFLFNNATD  I AS+++WQ++
Sbjct  494  IYGAARLFLFNNATDINIKASLKIWQLN  521



>gb|KHN42772.1| Beta-fructofuranosidase, soluble isoenzyme I [Glycine soja]
Length=534

 Score =   397 bits (1019),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 193/327 (59%), Positives = 238/327 (73%), Gaps = 1/327 (0%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S +   GLDTS N PN+KHVLK S+D+ R D+YA+GTY   ++ W PD+P
Sbjct  196  MWECVDFYPVSISGSRGLDTSENEPNVKHVLKASMDETRVDHYALGTYFIENDTWVPDNP  255

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGL  DYG YYASK+FYDP K+RR+ WGW+ E D+E+ DL+KGWAS+Q IPRT+L
Sbjct  256  LEDVGIGLVLDYGRYYASKTFYDPEKERRILWGWINETDTESDDLRKGWASLQTIPRTVL  315

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD+KTGTNL+ WPVEEVE LR    +FE V VKPGSVV L++  + +LD+ AEFE++   
Sbjct  316  FDSKTGTNLLLWPVEEVESLRLSSDEFEGVVVKPGSVVPLNISLATQLDMFAEFEIETLE  375

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
              K+ G +     + GA+ R   GPFGLL IA D  SE TPIYF ++  T G+  TFFC 
Sbjct  376  -SKSIGKNNIGCGSGGATNRSAFGPFGLLAIADDTLSEQTPIYFRLSNTTLGSSTTFFCV  434

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS A DV K  YG  VPVL  E LSMR+LVDHSI+ESFAQGGRT ITSR+YPT AI
Sbjct  435  DETRSSKAADVAKPIYGSKVPVLSDEKLSMRVLVDHSIIESFAQGGRTVITSRVYPTEAI  494

Query  902  GEDAKLFLFNNATDATITASVEVWQMS  982
               A+LFLFNNAT   I A++++WQ+S
Sbjct  495  YGAARLFLFNNATGINIKATLKIWQLS  521



>ref|XP_004143623.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Cucumis sativus]
 ref|XP_004163106.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Cucumis sativus]
 gb|KGN50433.1| hypothetical protein Csa_5G174590 [Cucumis sativus]
Length=630

 Score =   400 bits (1027),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 192/327 (59%), Positives = 241/327 (74%), Gaps = 2/327 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS NG  +KHVLK SLDD + D+YAIGTY   ++ W PD+P
Sbjct  298  MWECVDFYPVSVDGSKGLDTSENGGGVKHVLKASLDDTKMDHYAIGTYFANNDTWVPDNP  357

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGL+ DYG YYASK+FYD +K+RR+ WGW+ E D+E +DL KGWASVQ +PRT+L
Sbjct  358  EEDVGIGLKLDYGRYYASKTFYDQNKERRILWGWINETDTEANDLAKGWASVQTVPRTVL  417

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTG+N+IQWPVEEVE LR   ++F  V ++PGSVV L+VG + +LDILAEFEV  +A
Sbjct  418  FDQKTGSNIIQWPVEEVESLRLGSNEFNDVLLEPGSVVELEVGPATQLDILAEFEV--EA  475

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
             G    +     C  GA++R  +GPFG+LV+A    SE TPIYF +A  + G+ + +FCA
Sbjct  476  LGSENATVSEEGCGGGAAERSSIGPFGVLVLAHQSLSEFTPIYFNVANSSKGSGEAYFCA  535

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS A DV K+ YG  +PVL+GE+ SMR+LVDHSIVESF QGGR  ITSRIYPT AI
Sbjct  536  DETRSSKAPDVFKQVYGSKIPVLEGENYSMRVLVDHSIVESFGQGGRRVITSRIYPTEAI  595

Query  902  GEDAKLFLFNNATDATITASVEVWQMS  982
               AKLFLFNN T A + A+V+VW+++
Sbjct  596  YGAAKLFLFNNGTSANVKATVKVWRLN  622



>ref|XP_009112697.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like [Brassica 
rapa]
Length=655

 Score =   400 bits (1029),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 199/347 (57%), Positives = 251/347 (72%), Gaps = 13/347 (4%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S T+  GLDTS NGP+++H++K S+DD R D+YAIGTY + +  W PD+P
Sbjct  302   MWECVDFYPVSKTKHHGLDTSVNGPDVRHIVKASMDDTRIDHYAIGTYYDSNGTWVPDNP  361

Query  182   TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
             +ID GI  GLRYDYG +YASK+FYD  K RR+ WGW+ E DSE +D+QKGW+S+Q IPRT
Sbjct  362   SIDVGISTGLRYDYGKFYASKTFYDQHKGRRILWGWIGESDSEAADVQKGWSSLQAIPRT  421

Query  356   ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
             ++ D KT  NLIQWPV+E+E LR +  KF K ++ PG+VV +DVG +D++DI AEF++  
Sbjct  422   VVLDTKTKKNLIQWPVKEIESLRLRSKKFHK-KIGPGTVVPVDVGPADQIDIEAEFKLKN  480

Query  536   D----AFGK-AAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
             +     FG  +   D  +SC  + GA+ RG LGPFG  V+A    SE T +YFY+ K   
Sbjct  481   EDLEVIFGDDSVEDDKDFSCETSGGATLRGALGPFGFSVLADQSLSEQTLVYFYVTKGKD  540

Query  695   GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
                KTFFC D  +S++ANDV K  YG  VPVL GE L+MRILVDHSIVE F QGGRTCIT
Sbjct  541   SKLKTFFCTDTSKSTMANDVVKPVYGSFVPVLKGEKLTMRILVDHSIVEGFGQGGRTCIT  600

Query  875   SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNFN  1015
             SR+YPT AI    KLFLFNNATDAT+TAS +VWQ   M+SA  H F+
Sbjct  601   SRVYPTKAIYGATKLFLFNNATDATVTASFKVWQ---MNSAFIHPFS  644



>emb|CAA70855.1| sucrose sucrose 1-fructosyltransferase [Cynara cardunculus var. 
scolymus]
Length=637

 Score =   399 bits (1026),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 193/331 (58%), Positives = 246/331 (74%), Gaps = 3/331 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVD YP+STT   GLD   NGPN+KHVLK S D+DR+D+YA+GTY   ++KW PDDP
Sbjct  294  MWECVDLYPVSTTHTNGLDMVDNGPNVKHVLKQSGDEDRHDWYALGTYDVVNDKWYPDDP  353

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLRYD+G +YASK+FYD  KKRRV WG+V E D    D+ KGWA++  IPRTI+
Sbjct  354  ENDVGIGLRYDFGKFYASKTFYDQHKKRRVLWGYVGETDPPKYDVYKGWANILNIPRTIV  413

Query  362  FDNKTGTNLIQWPVEEVEKLRSQK-SKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
             D KT TNLIQWP+ EVE LRS K ++F+ VE+KPGS++ L++G + +LDI A FEVD+ 
Sbjct  414  LDTKTNTNLIQWPIAEVENLRSNKYNEFKDVELKPGSLIPLEIGTATQLDITATFEVDQT  473

Query  539  AFGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
                   +D+ ++CT   G++ RG LGPFGL+V+A  + SE  P+YFYIAKDT G+ KT+
Sbjct  474  MLESTLEADVLFNCTTSEGSAGRGVLGPFGLVVLADAERSEQLPVYFYIAKDTDGSSKTY  533

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS   D+ K  YG +VPVL+GE  +MR+LVDHSIVE FAQGGRT +TSR+YP 
Sbjct  534  FCADESRSSNDVDIGKWVYGSSVPVLEGEKFNMRLLVDHSIVEGFAQGGRTVVTSRVYPA  593

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMSE  985
             AI   AKLFLFNNAT  ++ AS+++W+M E
Sbjct  594  KAIYGAAKLFLFNNATGISVKASLKIWKMKE  624



>gb|AAF19535.1|AC007190_3 F23N19.3 [Arabidopsis thaliana]
Length=728

 Score =   402 bits (1034),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 195/336 (58%), Positives = 242/336 (72%), Gaps = 10/336 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T+  GLDTS NGP++KHV+K S+DD R D+YAIGTY + +  W PD+P
Sbjct  298  MWECVDFYPVSKTQLNGLDTSVNGPDVKHVIKASMDDTRIDHYAIGTYDDSNATWVPDNP  357

Query  182  TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            +ID GI  GLRYDYG YYASK+FYD +K RR+ WGW+ E DSE +D+QKGW+SVQGIPRT
Sbjct  358  SIDVGISTGLRYDYGKYYASKTFYDQNKGRRILWGWIGESDSEAADVQKGWSSVQGIPRT  417

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD-  532
            ++ D +T  NL+QWPVEE++ LR    KF+ + + PG+VV +DVG + +LDI AEFE+  
Sbjct  418  VVLDTRTHKNLVQWPVEEIKSLRLSSKKFD-MTIGPGTVVPVDVGSATQLDIEAEFEIKT  476

Query  533  ----KDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
                      +  +D  +SC    G++ RG LGPFG  V+A +  SE TP+YFY+ K   
Sbjct  477  DDLKLFFDDDSVEADNKFSCETNGGSTARGALGPFGFSVLADEGLSEQTPVYFYVTKGKH  536

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
                T FC D  RS+LANDV K  YG  VPVL GE L+MRILVDHSIVE FAQGGR+CIT
Sbjct  537  SKLNTVFCTDTSRSTLANDVVKPIYGSFVPVLKGEKLTMRILVDHSIVEGFAQGGRSCIT  596

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            SR+YPT AI    KLFLFNNA DAT+TAS  VWQM+
Sbjct  597  SRVYPTKAIYGATKLFLFNNAIDATVTASFTVWQMN  632



>dbj|BAM66574.1| fructan:fructan 1-fructosyltransferase [Asparagus officinalis]
Length=624

 Score =   399 bits (1025),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 193/334 (58%), Positives = 244/334 (73%), Gaps = 7/334 (2%)
 Frame = +2

Query  2    MWECVDFYPISTT---EGIGLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWR  169
            MWEC D YP+S +     +GL+ S   G N+KHVLK  L+D+ +DYYAIGTY     KW 
Sbjct  276  MWECTDLYPVSVSGPSTHLGLENSVPPGENVKHVLKAGLNDEWHDYYAIGTYDREGNKWT  335

Query  170  PDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIP  349
            PDD ++D GIGLRYD+G +YAS++FYDP K+RRV WG+V E D+ + D+QKGWASV+G+P
Sbjct  336  PDDESLDVGIGLRYDWGKFYASRTFYDPVKRRRVLWGYVGETDTRSVDVQKGWASVEGLP  395

Query  350  RTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEV  529
            RT+LFD KTG+NL+ WP EEVE LRS    F  + +  GS VHLDV  +++LDI AEF +
Sbjct  396  RTVLFDVKTGSNLLTWPAEEVESLRSSSKNFSNIAIAAGSTVHLDVEDANQLDIEAEFVI  455

Query  530  DKDAFGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNF  703
             K+    A  +D+ Y+C+   GASQRG LGPFGLLV+A  D SE T  YFY+ + T G+ 
Sbjct  456  KKEELELAIQADVNYNCSTSDGASQRGLLGPFGLLVLANQDLSEQTATYFYVGRGTDGSL  515

Query  704  KTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRI  883
            +T  C D LRSS AN + K+  G TVPVLD E+L++RILVDHSIVES+AQGGR   TSR+
Sbjct  516  QTHLCQDELRSSKANQITKRVVGHTVPVLDDETLTLRILVDHSIVESYAQGGRASTTSRV  575

Query  884  YPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            YPT AI EDAK+FLFNNAT AT+ A SV++WQMS
Sbjct  576  YPTQAIYEDAKVFLFNNATGATVIAKSVKIWQMS  609



>ref|XP_010533769.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like [Tarenaya 
hassleriana]
Length=678

 Score =   401 bits (1030),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 250/340 (74%), Gaps = 7/340 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGI-GLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDD  178
             MWECVDF+P+STT  + GLDTS NG +++H++K SLDD RND+YAIGTY + +  W PDD
Sbjct  334   MWECVDFFPVSTTSSVNGLDTSVNGLDVRHIVKASLDDTRNDHYAIGTYYDENGTWVPDD  393

Query  179   PTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTI  358
               ID GIGLRYDYG +YASK+FYD +K RR+ WGW+ E DSE +D++KGW+S+Q IPRTI
Sbjct  394   AEIDVGIGLRYDYGKFYASKTFYDQNKSRRILWGWIGESDSEGADIKKGWSSLQSIPRTI  453

Query  359   LFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
             + D KTG NL+QWPV+E+E LR    KF+ +EV PG++V ++VG + +LDI AEFE++K+
Sbjct  454   VLDTKTGKNLVQWPVQEIESLRLSIKKFD-MEVGPGTIVPVEVGPAAQLDIEAEFEIEKE  512

Query  539   AFGKA----AGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFK  706
             +  +     + +D  +SC +  + RG LGPFG  V+A +  SE T +YFY+AK       
Sbjct  513   SLERFIREDSSTDGEFSCQS-TTTRGALGPFGFSVLADESLSEQTRVYFYVAKGKDSKLN  571

Query  707   TFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIY  886
             TFFC D  RSS+ANDV K+ YG   PVL+GE LSMRILVDHSI+E F QGGRTCITSR+Y
Sbjct  572   TFFCTDTSRSSVANDVDKRIYGSFTPVLEGEKLSMRILVDHSIIEGFGQGGRTCITSRVY  631

Query  887   PTSAIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPH  1006
             PT A+   AKLF FN+AT + +TAS +VWQM+     +PH
Sbjct  632   PTKAVHGGAKLFFFNDATGSNVTASFKVWQMNNAFIRSPH  671



>gb|AAB58909.1| sucrose:sucrose 1-fructosyl transferase [Cichorium intybus]
Length=640

 Score =   399 bits (1026),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 190/331 (57%), Positives = 247/331 (75%), Gaps = 3/331 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVD YP+STT   GLD   NGPN+K++LK S D+DR+D+YA+GT+    +KW PDDP
Sbjct  297  MWECVDLYPVSTTHTNGLDMKDNGPNVKYILKQSGDEDRHDWYAVGTFDPEKDKWYPDDP  356

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLRYDYG +YASK+FYD  +KRRV WG+V E D   SDL KGWA++  IPR+++
Sbjct  357  ENDVGIGLRYDYGKFYASKTFYDQHQKRRVLWGYVGETDPPKSDLLKGWANILNIPRSVV  416

Query  362  FDNKTGTNLIQWPVEEVEKLRSQK-SKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
             D +TGTNLIQWP+EEVEKLRS K  +F+ VE++PGS+V L++G + +LDI A FE+D+ 
Sbjct  417  LDTQTGTNLIQWPIEEVEKLRSTKYDEFKDVELRPGSLVPLEIGTATQLDISATFEIDQK  476

Query  539  AFGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
                   +D+ ++CT   G+  RG LGPFG++V+A  + SE  P+YFYIAKDT G  KT+
Sbjct  477  KLQSTLEADVLFNCTTSEGSVGRGVLGPFGIVVLADANRSEQLPVYFYIAKDTDGTSKTY  536

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS   DV K  YG +VPVL GE+ +MR+LVDHSIVE FAQGGRT +TSR+YPT
Sbjct  537  FCADESRSSTDKDVGKWVYGSSVPVLGGENYNMRLLVDHSIVEGFAQGGRTVVTSRVYPT  596

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMSE  985
             AI   AK+FLFNNAT  ++  S+++W+M+E
Sbjct  597  KAIYGAAKIFLFNNATGISVKVSLKIWKMAE  627



>gb|AAK62665.1| At1g62660/F23N19_3 [Arabidopsis thaliana]
 gb|AAN18078.1| At1g62660/F23N19_3 [Arabidopsis thaliana]
Length=648

 Score =   399 bits (1026),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 194/336 (58%), Positives = 242/336 (72%), Gaps = 10/336 (3%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T+  GLDTS NGP++KHV+K S+DD R D+YAIGTY + +  W PD+P
Sbjct  296  MWECVDFYPVSKTQLNGLDTSVNGPDVKHVIKASMDDTRIDHYAIGTYDDSNATWVPDNP  355

Query  182  TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            +ID GI  GLRYDYG YYASK+FYD +K RR+ WGW+ E DSE +D+QKGW+SV+GIPRT
Sbjct  356  SIDVGISTGLRYDYGKYYASKTFYDQNKGRRILWGWIGESDSEAADVQKGWSSVKGIPRT  415

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD-  532
            ++ D +T  NL+QWPVEE++ LR    KF+ + + PG+VV +DVG + +LDI AEFE+  
Sbjct  416  VVLDTRTHKNLVQWPVEEIKSLRLSSKKFD-MTIGPGTVVPVDVGSATQLDIEAEFEIKT  474

Query  533  ----KDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
                      +  +D  +SC    G++ RG LGPFG  V+A +  SE TP+YFY+ K   
Sbjct  475  DDLKLFFDDDSVEADNKFSCETNGGSTARGALGPFGFSVLADEGLSEQTPVYFYVTKGKH  534

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
                T FC D  RS+LANDV K  YG  VPVL GE L+MRILVDHSIVE FAQGGR+CIT
Sbjct  535  SKLNTVFCTDTSRSTLANDVVKPIYGSFVPVLKGEKLTMRILVDHSIVEGFAQGGRSCIT  594

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            SR+YPT AI    KLFLFNNA DAT+TAS  VWQM+
Sbjct  595  SRVYPTKAIYGATKLFLFNNAIDATVTASFTVWQMN  630



>emb|CAA04120.2| fructan fructan 1-fructosyltransferase [Cynara cardunculus var. 
scolymus]
Length=617

 Score =   398 bits (1022),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/330 (57%), Positives = 240/330 (73%), Gaps = 2/330 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVD YP+STT    LD +  GP IKHVLK S +    D+Y+IGTY   ++KW PD+P
Sbjct  280  MWECVDLYPVSTTNDSALDVAAYGPGIKHVLKESWEGHAMDFYSIGTYDAFNDKWTPDNP  339

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG ++ASKS YDP KKRRV WG+V E DS   D+ +GWA++  + RTI+
Sbjct  340  ELDVGIGLRCDYGRFFASKSLYDPLKKRRVTWGYVAESDSYDQDVSRGWATIYNVARTIV  399

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTGT+L+QWPVEE+E LRS   +F+ + ++PGS++ LDVG + +LDI+A FEVD++A
Sbjct  400  LDRKTGTHLLQWPVEEIESLRSNGHEFKNITLEPGSIIPLDVGSATQLDIVATFEVDQEA  459

Query  542  FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                + ++  Y CT  +GA+QRG  GPFG+ V+A    SE TP+YFYIAK+T G   T F
Sbjct  460  LKATSDTNDEYGCTTSSGAAQRGSFGPFGIAVLAHGTLSELTPVYFYIAKNTKGGVDTHF  519

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D LRSS   D  K  YG TVPVLDGE  +MRILVDHS+VE FAQGGRT ITSR+YPT 
Sbjct  520  CTDKLRSSYDYDGEKVVYGSTVPVLDGEEFTMRILVDHSVVEGFAQGGRTVITSRVYPTK  579

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSE  985
            AI E AKLF+FNNAT  ++ A+++VWQMS+
Sbjct  580  AIYEAAKLFVFNNATTTSVKATLKVWQMSQ  609



>ref|XP_007218855.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
 gb|EMJ20054.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
Length=513

 Score =   394 bits (1013),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/337 (57%), Positives = 241/337 (72%), Gaps = 4/337 (1%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S     GL+TS NGP +KHVLK SLDD + DYYAIGTY   +  W PDDP
Sbjct  176   MWECVDFYPVSINGSKGLETSANGPGVKHVLKASLDDKKMDYYAIGTYFVENNTWIPDDP  235

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              ID GIGL+YDYG YYASK+FYD +K+RR+  GW+ E D+ET DL+KGW+S+Q IPR +L
Sbjct  236   KIDVGIGLKYDYGRYYASKTFYDQNKERRILLGWINETDTETDDLEKGWSSLQTIPRVVL  295

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             FDN TGTNL+QWPVEE+E LR   ++F  V V+ G+VV LD+G + +LDIL +FE+    
Sbjct  296   FDNATGTNLLQWPVEEIEDLRLNTTEFSDVLVEAGTVVPLDIGTATQLDILVDFEIQVLE  355

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
                  G+     C  GA+ R  LGPFG+LV+A +  SE TP+YF ++  T G+  T+FCA
Sbjct  356   TECVNGNG-SVGCGDGATDRSTLGPFGILVLADETLSELTPVYFRVSNSTDGDVTTYFCA  414

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSS A +V K  YG  VPVLDGE+ S R+LVDHSIVESFAQGGRT I SRIYPT AI
Sbjct  415   DETRSSKAPEVYKTVYGGQVPVLDGETYSARVLVDHSIVESFAQGGRTVIASRIYPTEAI  474

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
                A+LFLFNNAT   + A++++W   E++SA  H F
Sbjct  475   YGAARLFLFNNATGVNVKATLKIW---ELNSAFIHPF  508



>ref|XP_003526374.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Glycine max]
Length=646

 Score =   399 bits (1024),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/327 (59%), Positives = 238/327 (73%), Gaps = 1/327 (0%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S +   GLDTS N PN+KHVLK S+D+ R D+YA+GTY   ++ W PD+P
Sbjct  308  MWECVDFYPVSISGSRGLDTSENEPNVKHVLKASMDETRVDHYALGTYFIENDTWVPDNP  367

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGL  DYG YYASK+FYDP K+RR+ WGW+ E D+E+ DL+KGWAS+Q IPRT+L
Sbjct  368  LEDVGIGLVLDYGRYYASKTFYDPEKERRILWGWINETDTESDDLRKGWASLQTIPRTVL  427

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD+KTGTNL+ WPVEEVE LR    +FE V VKPGSVV L++  + +LD+ AEFE++   
Sbjct  428  FDSKTGTNLLLWPVEEVESLRLSSDEFEGVVVKPGSVVPLNISLATQLDMFAEFEIETLE  487

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
              K+ G +     + GA+ R   GPFGLL IA D  SE TPIYF ++  T G+  TFFC 
Sbjct  488  -SKSIGKNNIGCGSGGATNRSAFGPFGLLAIADDTLSEQTPIYFRLSNTTLGSSTTFFCV  546

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS A DV K  YG  VPVL  E LSMR+LVDHSI+ESFAQGGRT ITSR+YPT AI
Sbjct  547  DETRSSKAADVAKPIYGSKVPVLSDEKLSMRVLVDHSIIESFAQGGRTVITSRVYPTEAI  606

Query  902  GEDAKLFLFNNATDATITASVEVWQMS  982
               A+LFLFNNAT   I A++++WQ+S
Sbjct  607  YGAARLFLFNNATGINIKATLKIWQLS  633



>ref|XP_010473489.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like [Camelina 
sativa]
Length=643

 Score =   398 bits (1023),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 198/336 (59%), Positives = 239/336 (71%), Gaps = 11/336 (3%)
 Frame = +2

Query  5    WECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDPT  184
            WECVDFYP+S T+ IGLDTS  GP++KHV+K S+DD R D YAIGTY + +  W PD+P+
Sbjct  297  WECVDFYPVSKTKVIGLDTSVKGPDVKHVVKASMDDTRMDLYAIGTYFDSNATWIPDNPS  356

Query  185  IDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTI  358
            ID GI   LRYDYGT+YASK+FYD +K RRV WG+  E D+  +D QKGWASVQ IPRT+
Sbjct  357  IDVGISTALRYDYGTFYASKTFYDQNKGRRVLWGFTIESDTVDADQQKGWASVQTIPRTV  416

Query  359  LFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
            + D KTG NLI WPVEE+E LR    KF  + V PG+VV +DVG + +LDI AEF + KD
Sbjct  417  VLDTKTGKNLILWPVEEIESLRLSSKKFN-MTVGPGTVVPVDVGSASQLDIEAEFVIKKD  475

Query  539  AF------GKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
                      A G D  +SC A  G++ RG LGPFG  V+A  + SEHTP+YFY+ K   
Sbjct  476  DLEIILGDNSAVGYDEDFSCEANGGSTVRGALGPFGFSVLADQNLSEHTPVYFYVTKGKD  535

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
               KTFFC D+LRS++ANDV    YG  VPVL GE L+MRILVDHS++E F QGGRTCIT
Sbjct  536  SKLKTFFCTDNLRSTMANDVVTSIYGSLVPVLKGEKLTMRILVDHSMIEGFGQGGRTCIT  595

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMS  982
            SR YPT AI    KLFLFNNA DA++TAS  VWQM+
Sbjct  596  SRAYPTKAIYGATKLFLFNNAIDASVTASFTVWQMN  631



>ref|XP_007038395.1| Glycosyl hydrolases family 32 protein isoform 1 [Theobroma cacao]
 gb|EOY22896.1| Glycosyl hydrolases family 32 protein isoform 1 [Theobroma cacao]
Length=646

 Score =   398 bits (1023),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 189/327 (58%), Positives = 245/327 (75%), Gaps = 3/327 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP++    +GLDTS  GP IKHVLK SLDD + D+YA+GTY   ++KW PD+P
Sbjct  310  MWECVDFYPVAINGSVGLDTSAFGPGIKHVLKASLDDTKVDHYALGTYDPVTDKWTPDNP  369

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGL+ DYG YYASK+F+D  K+RR+ WGW+ E D+ET+DL+KGWAS+Q IPR++L
Sbjct  370  EEDVGIGLKVDYGRYYASKTFFDQDKQRRILWGWINETDTETADLKKGWASLQTIPRSVL  429

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +DNKTGT+L+QWPV+EVE LR   + FE+V V+ GS+V LD+G + +LDILAEFE++   
Sbjct  430  YDNKTGTHLLQWPVKEVESLRLNSTVFEEVLVEAGSIVPLDIGPATQLDILAEFEIES--  487

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
              ++  +D    C  GA  R   GPFG+LVIA D  SE TP++F     + G+ KT+FCA
Sbjct  488  -LESNTTDEVSDCGDGAIDRSTFGPFGILVIADDSLSELTPVFFRPVNTSDGSLKTYFCA  546

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS ANDV K+ YG  VPVLD E+ +MR+LVDHSIVESFAQGGRT I+SRIYPT AI
Sbjct  547  DETRSSKANDVFKQVYGGKVPVLDDENYNMRVLVDHSIVESFAQGGRTVISSRIYPTEAI  606

Query  902  GEDAKLFLFNNATDATITASVEVWQMS  982
               A+LFLFNNAT   + A++++W+M+
Sbjct  607  YGAARLFLFNNATGVNVKATLKIWEMN  633



>gb|AFB83198.1| sucrose:sucrose 1-fructosyl transferase [Cichorium intybus]
Length=640

 Score =   397 bits (1021),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 189/331 (57%), Positives = 249/331 (75%), Gaps = 3/331 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVD YP+STT   GL+   NGPN+K++LK S D+DR+D+YAIGT+    +KW PDDP
Sbjct  297  MWECVDLYPVSTTHTNGLEMKDNGPNVKYILKQSGDEDRHDWYAIGTFDPEKDKWYPDDP  356

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLRYDYG +YASK+FYD  KKRRV WG+V E D   SDL KGWA++  IPR+++
Sbjct  357  ENDVGIGLRYDYGKFYASKTFYDQHKKRRVLWGYVGETDPPKSDLLKGWANILNIPRSVV  416

Query  362  FDNKTGTNLIQWPVEEVEKLRSQK-SKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
             D +T TNLIQWP+EEVEKLRS+K  +F+ VE++PGS++ L++G + +LDI A FE+D+ 
Sbjct  417  LDTQTETNLIQWPIEEVEKLRSKKYDEFKDVELRPGSLIPLEIGTATQLDISATFEIDEK  476

Query  539  AFGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
                   +D+ ++CT   G+  RG LGPFG++V+A  + SE  P+YFYIAKDT G  +T+
Sbjct  477  KLESTLEADVLFNCTTSEGSVGRGVLGPFGIVVLADANRSEQLPVYFYIAKDTDGTSRTY  536

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS   DV K  YG +VPVL+GE+ +MR+LVDHSIVE FAQGGRT +TSR+YPT
Sbjct  537  FCADESRSSKDKDVGKWVYGSSVPVLEGENYNMRLLVDHSIVEGFAQGGRTVVTSRVYPT  596

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMSE  985
             AI   AK+FLFNNAT  ++ AS+++W+M+E
Sbjct  597  MAIYGAAKIFLFNNATGISVKASLKIWKMAE  627



>gb|ACZ05614.1| vacuolar invertase 2 [Gossypium hirsutum]
Length=618

 Score =   397 bits (1019),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 192/327 (59%), Positives = 242/327 (74%), Gaps = 3/327 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP++    + LDTS  GP IKHVLK SLD+ + D+YAIGTY   ++KW PD+P
Sbjct  281  MWECVDFYPVAINGSVALDTSSLGPGIKHVLKASLDNTKVDHYAIGTYDPITDKWTPDNP  340

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGL+ DYG YYASK+F+D  K+RRV WGW+ E D+ET+DL+KGWAS+Q IPRT+L
Sbjct  341  EEDVGIGLKVDYGRYYASKTFFDQHKQRRVLWGWINETDTETADLKKGWASLQTIPRTVL  400

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +DNKTGTNL+QWPVEEVE LR   + F++V V+PGSVV LD+G + +LDILAEFE++   
Sbjct  401  YDNKTGTNLLQWPVEEVESLRLNSTMFKEVLVEPGSVVPLDIGTTTQLDILAEFEIEPLI  460

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
                   D   +C  GA  R   GPFGLLVIA    SE TPIYF     + G+ KT+FC+
Sbjct  461  PSTTNEID---NCGDGAVDRSTYGPFGLLVIADASLSELTPIYFRPLNASDGSLKTYFCS  517

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS A+DV K+ YG  VPVLD E+ +MR+LVDHSIVESFAQGGRT I+SRIYPT AI
Sbjct  518  DETRSSKASDVFKQVYGGKVPVLDDENYNMRVLVDHSIVESFAQGGRTVISSRIYPTEAI  577

Query  902  GEDAKLFLFNNATDATITASVEVWQMS  982
               A+LFLFNNAT   + A++++W+++
Sbjct  578  YGAARLFLFNNATGVNVKATLKIWELN  604



>ref|XP_010430330.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like [Camelina 
sativa]
Length=643

 Score =   397 bits (1019),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 197/335 (59%), Positives = 236/335 (70%), Gaps = 11/335 (3%)
 Frame = +2

Query  5    WECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDPT  184
            WECVDFYP+S TE IGLDTS  G ++KHV+K S+DD R D YAIGTY + +  W PD+P+
Sbjct  297  WECVDFYPVSKTEAIGLDTSVKGRDVKHVVKASMDDTRMDLYAIGTYFDSNATWIPDNPS  356

Query  185  IDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTI  358
            ID GI   LRYDYGT+YASK+FYD +K RRV WG+  E D+  +D QKGWASVQ IPRT+
Sbjct  357  IDVGISTALRYDYGTFYASKTFYDQNKGRRVLWGFTIESDTVAADQQKGWASVQTIPRTV  416

Query  359  LFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
            + D KTG NLI WPVEE+E LR    +F  + V PG+VV +DVG + +LDI AEF + KD
Sbjct  417  VLDTKTGKNLILWPVEEIESLRLSSKRF-NMTVGPGTVVPVDVGSASQLDIEAEFVIKKD  475

Query  539  AF------GKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
                      A G D  +SC A  G++ RG LGPFG  V+A    SEHTP+YFY+ K   
Sbjct  476  DLEINLGDNSAVGYDEDFSCEANGGSTVRGALGPFGFSVLADQSLSEHTPVYFYVTKGKD  535

Query  695  GNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCIT  874
               KTFFC D+LRS++ANDV    YG  VPVL GE L+MRILVDHS++E F QGGRTCIT
Sbjct  536  SKLKTFFCTDNLRSTMANDVVTSIYGSLVPVLKGEKLTMRILVDHSMIEGFGQGGRTCIT  595

Query  875  SRIYPTSAIGEDAKLFLFNNATDATITASVEVWQM  979
            SR YPT AI    KLFLFNNA DA++TAS  VWQM
Sbjct  596  SRAYPTKAIYGATKLFLFNNAIDASVTASFTVWQM  630



>ref|XP_010259193.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Nelumbo nucifera]
Length=676

 Score =   397 bits (1021),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 208/330 (63%), Positives = 252/330 (76%), Gaps = 3/330 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+STTE  GL+TS N P +KHVLK SLD+ + DYYA+GTY   ++ W PD+ 
Sbjct  315  MWECVDFYPVSTTEKKGLNTSDNWPGVKHVLKASLDNTKIDYYALGTYYVENDTWIPDNE  374

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D G GLRYDYG YYASK+FYD +K+RRV WGW+ E DSE  D++KGWASVQ IPR +L
Sbjct  375  MADVGFGLRYDYGKYYASKTFYDQNKQRRVLWGWIGESDSEDDDIKKGWASVQSIPRVVL  434

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KT +NL+QWPVEEVE LRS   +F KV V PG+VV LDVG + +LDI AEFE+D  A
Sbjct  435  FDQKTRSNLLQWPVEEVENLRSNLKEFNKVVVGPGTVVPLDVGTATQLDISAEFEIDGKA  494

Query  542  FGKAAGSDIP-YSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
               A   DI  Y+C    GA+ RG LGPFG+LV+A+D  +E TP+YFYI+KD+ G ++TF
Sbjct  495  LKGATRDDIVGYNCVVGGGAAGRGTLGPFGILVLAEDSLAEQTPVYFYISKDSGGEYRTF  554

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSSLA  V K   G  VPVL+GE L+MRILVDHSIVESF QGGRT ITSRIYPT
Sbjct  555  FCADQSRSSLAPHVGKFVSGSLVPVLEGEKLTMRILVDHSIVESFGQGGRTVITSRIYPT  614

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMS  982
             AI E A++FLFNNAT+A +TAS+++WQM+
Sbjct  615  KAIYESARVFLFNNATEANVTASLKIWQMN  644



>ref|XP_002321831.2| hypothetical protein POPTR_0015s14790g [Populus trichocarpa]
 gb|EEF05958.2| hypothetical protein POPTR_0015s14790g [Populus trichocarpa]
Length=636

 Score =   396 bits (1018),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/337 (57%), Positives = 239/337 (71%), Gaps = 7/337 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP++     GLDTS  G  IKHVLK SLDD + D+YAIG Y   ++KW PD+P
Sbjct  302   MWECVDFYPVAINGSTGLDTSAYGAGIKHVLKASLDDTKRDHYAIGVYDPVTDKWTPDNP  361

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
               D GIGL+ DYG YYASK+FYD + +RR+ WGW+ E D+ET DL KGWASVQ IPR +L
Sbjct  362   KEDVGIGLQVDYGRYYASKTFYDQNTQRRILWGWINETDTETDDLDKGWASVQTIPRKVL  421

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             +DNKTGTN++QWPVEE+E LR + + F ++ V PGSVV LD+G++ +LDI AEFE++  +
Sbjct  422   YDNKTGTNILQWPVEEIEGLRLRSTDFTEIVVGPGSVVPLDIGQATQLDIFAEFEIEIIS  481

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
               K       Y C+ GA  R  LGPFGLLV+A    SE TPI+F     T G  +T+FCA
Sbjct  482   ETKHEK----YGCSGGAVDRSALGPFGLLVVADQTLSELTPIFFRPVNTTEGIVETYFCA  537

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSS A+DV K+ YG TVPV   E   MR+LVDHSIVESFAQGGR  ITSRIYPT AI
Sbjct  538   DETRSSKASDVYKQVYGSTVPVFTDEKFQMRVLVDHSIVESFAQGGRRVITSRIYPTKAI  597

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
               DA+LFLFNNAT   + A++++W   E++SA  H F
Sbjct  598   YGDARLFLFNNATGVNVKATLKIW---ELNSAFIHPF  631



>gb|EEC77707.1| hypothetical protein OsI_16783 [Oryza sativa Indica Group]
 gb|EEE61409.1| hypothetical protein OsJ_15598 [Oryza sativa Japonica Group]
Length=673

 Score =   397 bits (1020),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 204/353 (58%), Positives = 249/353 (71%), Gaps = 27/353 (8%)
 Frame = +2

Query  2    MWECVDFYPISTTEGI--GLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRP  172
            MWECVD YP+ST+  +  GL+TS   GP +KHVLK SLDDDRNDYYAIGTY   ++ W P
Sbjct  313  MWECVDLYPVSTSPAVEDGLETSTPPGPGVKHVLKASLDDDRNDYYAIGTYDGETDTWTP  372

Query  173  DDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQ----  340
            D+  ID GIGLRYDYG +YASK+FYDP  +RRV WGW+ E DSE +D+ KGWAS+Q    
Sbjct  373  DNADIDVGIGLRYDYGKFYASKTFYDPVGRRRVLWGWIGETDSERADILKGWASLQVSMI  432

Query  341  -------------GIPRTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHL  481
                          IPRT++ D KTG+NL+QWPV EVE LR +   F+ ++V PGSVV L
Sbjct  433  IFILNANENKGEKSIPRTVMLDTKTGSNLLQWPVVEVENLRMRGKSFDGLDVSPGSVVPL  492

Query  482  DVGKSDELDILAEFEVD---KDAFGKAAGSDIPYSCTAGASQRGG--LGPFGLLVIAKDD  646
            DVGK+ +LDI A FEVD    D     AG+   YSC  G    G   +GPFGLLV+A D 
Sbjct  493  DVGKATQLDIEAVFEVDTSAADGVVTEAGA-AAYSCGTGGGAVGRGLMGPFGLLVLADDQ  551

Query  647  FSEHTPIYFYIAKDTTGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVD  826
             SE T ++FY+ K   GN  TFFC D LRSS AND+ K+ YG  VPVLDGE+LS+RILVD
Sbjct  552  LSERTAVFFYLVKGVDGNLTTFFCQDELRSSKANDLVKRVYGSLVPVLDGENLSIRILVD  611

Query  827  HSIVESFAQGGRTCITSRIYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            HSIVE FAQGGRTCITSR+YPT AI E AK+FLFNNAT+  +TA S+++W+++
Sbjct  612  HSIVEGFAQGGRTCITSRVYPTKAIYESAKIFLFNNATNVRVTAKSLKIWELN  664



>emb|CAD41525.3| OSJNBb0020O11.6 [Oryza sativa Japonica Group]
Length=666

 Score =   397 bits (1020),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 204/353 (58%), Positives = 249/353 (71%), Gaps = 27/353 (8%)
 Frame = +2

Query  2    MWECVDFYPISTTEGI--GLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRP  172
            MWECVD YP+ST+  +  GL+TS   GP +KHVLK SLDDDRNDYYAIGTY   ++ W P
Sbjct  306  MWECVDLYPVSTSPAVEDGLETSTPPGPGVKHVLKASLDDDRNDYYAIGTYDGETDTWTP  365

Query  173  DDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQ----  340
            D+  ID GIGLRYDYG +YASK+FYDP  +RRV WGW+ E DSE +D+ KGWAS+Q    
Sbjct  366  DNADIDVGIGLRYDYGKFYASKTFYDPVGRRRVLWGWIGETDSERADILKGWASLQVSMI  425

Query  341  -------------GIPRTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHL  481
                          IPRT++ D KTG+NL+QWPV EVE LR +   F+ ++V PGSVV L
Sbjct  426  IFILNANENKGEKSIPRTVMLDTKTGSNLLQWPVVEVENLRMRGKSFDGLDVSPGSVVPL  485

Query  482  DVGKSDELDILAEFEVD---KDAFGKAAGSDIPYSCTAGASQRGG--LGPFGLLVIAKDD  646
            DVGK+ +LDI A FEVD    D     AG+   YSC  G    G   +GPFGLLV+A D 
Sbjct  486  DVGKATQLDIEAVFEVDTSAADGVVTEAGA-AAYSCGTGGGAVGRGLMGPFGLLVLADDQ  544

Query  647  FSEHTPIYFYIAKDTTGNFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVD  826
             SE T ++FY+ K   GN  TFFC D LRSS AND+ K+ YG  VPVLDGE+LS+RILVD
Sbjct  545  LSERTAVFFYLVKGVDGNLTTFFCQDELRSSKANDLVKRVYGSLVPVLDGENLSIRILVD  604

Query  827  HSIVESFAQGGRTCITSRIYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            HSIVE FAQGGRTCITSR+YPT AI E AK+FLFNNAT+  +TA S+++W+++
Sbjct  605  HSIVEGFAQGGRTCITSRVYPTKAIYESAKIFLFNNATNVRVTAKSLKIWELN  657



>gb|AGU12782.1| vacuolar invertase 2a [Gossypium hirsutum]
Length=618

 Score =   394 bits (1013),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 192/327 (59%), Positives = 243/327 (74%), Gaps = 3/327 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP++    + LDTS  GP IKHVLK SLD+ + D+YAIGTY   ++KW PD+P
Sbjct  281  MWECVDFYPVAINGSVALDTSSLGPGIKHVLKASLDNTKVDHYAIGTYDPITDKWTPDNP  340

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGL+ DYG YYASK+F+D  K+RRV WGW+ E D+ET+DL+KGWAS+Q IPRT+L
Sbjct  341  EEDVGIGLKVDYGRYYASKTFFDQHKQRRVLWGWINETDTETADLKKGWASLQTIPRTVL  400

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +DNKTGTNL+QWPVEEVE LR   + F++V V+PGSVV LD+G + +LDILAEFE+  + 
Sbjct  401  YDNKTGTNLLQWPVEEVESLRLNSTMFKEVLVEPGSVVPLDIGTTTQLDILAEFEI--EP  458

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
               +  ++I  +C  GA  R   GPFGLLVIA    SE TPIYF     + G  KT+FC 
Sbjct  459  LISSTTNEIG-NCGDGAVDRSTYGPFGLLVIADASLSELTPIYFRPLNASGGTLKTYFCT  517

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS A+DV K+ YG  VPVLD E+ +MR+LVDHSIVESFAQGGRT I+SRIYPT AI
Sbjct  518  DETRSSKASDVFKQVYGGKVPVLDDENYNMRVLVDHSIVESFAQGGRTVISSRIYPTEAI  577

Query  902  GEDAKLFLFNNATDATITASVEVWQMS  982
               A+LFLFNNAT   + A++++W+++
Sbjct  578  YGAARLFLFNNATGVNVRATLKIWELN  604



>emb|CAA66238.1| invertase 6 [Tulipa gesneriana]
Length=625

 Score =   395 bits (1014),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 246/341 (72%), Gaps = 5/341 (1%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDD  178
             MWECVDFYP+ T   +GLDTS   GP ++HVLK SLDDD++DYYAIGTY   S  W PDD
Sbjct  284   MWECVDFYPVLTNSTVGLDTSVPPGPGVRHVLKASLDDDKHDYYAIGTYDVVSGTWTPDD  343

Query  179   PTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTI  358
                D GIG RYDYG +YASK+F+D  K RRV +G+  E DSE ++  KGWASV  IPRTI
Sbjct  344   VEADVGIGWRYDYGKFYASKTFFDWPKGRRVLFGFTGETDSEQNNRLKGWASVLPIPRTI  403

Query  359   LFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
             LFD KTG+NL+ WPVEEVE+LR  +  FE +++  G+VV LD+G++ +LDI+AEFE+D  
Sbjct  404   LFDQKTGSNLLLWPVEEVERLRFNRQDFENIDIGIGAVVPLDIGRAIQLDIVAEFEIDGA  463

Query  539   AFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
                 +  +D+ Y+C  + G   RG LGPFG LV++ +D SE T IYFY+ +   G  +TF
Sbjct  464   TLEASVEADLGYNCSTSGGTFGRGVLGPFGFLVLSDEDLSEQTAIYFYVGRKVDGALQTF  523

Query  713   FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
             FC D LRSS AND+ K+ +G  VPVL GE L+MRIL+DHSIVESFAQGGRTCITSRIYPT
Sbjct  524   FCQDELRSSKANDLVKRVFGSIVPVLHGEILTMRILLDHSIVESFAQGGRTCITSRIYPT  583

Query  893   SAIGEDAKLFLFNNATDATITA-SVEVWQMSEMDSAAPHNF  1012
              A    A++F+FNNAT A +TA S+++WQM    S  P+ F
Sbjct  584   KAFDGAARVFVFNNATGAKVTAKSIKIWQMKSA-SITPYPF  623



>ref|XP_007218853.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
 ref|XP_007218854.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
 gb|EMJ20052.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
 gb|EMJ20053.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
Length=639

 Score =   395 bits (1014),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 193/337 (57%), Positives = 241/337 (72%), Gaps = 4/337 (1%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S     GL+TS NGP +KHVLK SLDD + DYYAIGTY   +  W PDDP
Sbjct  302   MWECVDFYPVSINGSKGLETSANGPGVKHVLKASLDDKKMDYYAIGTYFVENNTWIPDDP  361

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              ID GIGL+YDYG YYASK+FYD +K+RR+  GW+ E D+ET DL+KGW+S+Q IPR +L
Sbjct  362   KIDVGIGLKYDYGRYYASKTFYDQNKERRILLGWINETDTETDDLEKGWSSLQTIPRVVL  421

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             FDN TGTNL+QWPVEE+E LR   ++F  V V+ G+VV LD+G + +LDIL +FE+    
Sbjct  422   FDNATGTNLLQWPVEEIEDLRLNTTEFSDVLVEAGTVVPLDIGTATQLDILVDFEIQVLE  481

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
                  G+     C  GA+ R  LGPFG+LV+A +  SE TP+YF ++  T G+  T+FCA
Sbjct  482   TECVNGNG-SVGCGDGATDRSTLGPFGILVLADETLSELTPVYFRVSNSTDGDVTTYFCA  540

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSS A +V K  YG  VPVLDGE+ S R+LVDHSIVESFAQGGRT I SRIYPT AI
Sbjct  541   DETRSSKAPEVYKTVYGGQVPVLDGETYSARVLVDHSIVESFAQGGRTVIASRIYPTEAI  600

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
                A+LFLFNNAT   + A++++W   E++SA  H F
Sbjct  601   YGAARLFLFNNATGVNVKATLKIW---ELNSAFIHPF  634



>emb|CAB60153.1| sucrose:sucrose 1-fructosyl transferase [Taraxacum officinale]
Length=632

 Score =   394 bits (1013),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 188/331 (57%), Positives = 247/331 (75%), Gaps = 3/331 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVD YP+STT   GLD   NGPN+K++LK S D+DR+D+YAIG++   ++KW PDDP
Sbjct  289  MWECVDLYPVSTTHTNGLDMMDNGPNVKYILKQSGDEDRHDWYAIGSFDPINDKWYPDDP  348

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLRYDYG +YASK+FYD  K RRV WG+V E D    DL KGWA++  IPRTI+
Sbjct  349  ENDVGIGLRYDYGKFYASKTFYDQHKSRRVLWGYVGETDPPKDDLLKGWANMLNIPRTIV  408

Query  362  FDNKTGTNLIQWPVEEVEKLRSQK-SKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
             D  TGTNLIQWP++EVE LRS+K  +F+ VE++PGS++ L++G + +LDI+A FE+D+ 
Sbjct  409  LDTVTGTNLIQWPIDEVENLRSKKYDEFKDVELRPGSIIPLEIGSATQLDIMATFEIDEK  468

Query  539  AFGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
                   +D+ ++CT   G+  RG LGPFG++V+A    SE  P+YFYIAK+T G+ KT+
Sbjct  469  MLESTLEADVLFNCTTSEGSVGRGVLGPFGIVVLADAKRSEQLPVYFYIAKNTDGSSKTY  528

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS+   V K  YG +VPVL+GE  +MR+LVDHSIVE FAQGGRT +TSR+YPT
Sbjct  529  FCADESRSSMDKSVGKWVYGDSVPVLEGEKHNMRLLVDHSIVEGFAQGGRTVVTSRVYPT  588

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMSE  985
             AI   AKLFLFNNAT  ++ AS+++W+M+E
Sbjct  589  KAIYGAAKLFLFNNATGISVKASLKIWKMAE  619



>ref|XP_010941127.1| PREDICTED: beta-fructofuranosidase 1-like [Elaeis guineensis]
Length=661

 Score =   395 bits (1015),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 197/346 (57%), Positives = 256/346 (74%), Gaps = 11/346 (3%)
 Frame = +2

Query  2     MWECVDFYPISTTEGI----GLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKW  166
             MWECVDF+P++  EG     G++ S   GP ++HVLK S+DDDR+DYYAIGTY   +  W
Sbjct  318   MWECVDFFPVAVAEGPEAAEGMEASAAAGPGVRHVLKASMDDDRHDYYAIGTYDAGTNTW  377

Query  167   RPDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGI  346
             +P+D  +D GIGLRYD+G +YASK+FYDP+++RRV WGW+ E DSE +D+ KGWAS+Q +
Sbjct  378   QPEDERMDVGIGLRYDWGMFYASKTFYDPARRRRVLWGWIGEADSEYADVLKGWASLQAV  437

Query  347   PRTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFE  526
             PRT+LFD KT +NL+QWPVEEVEKLR     F  + +  GSV  L++ ++ +LDI AEFE
Sbjct  438   PRTVLFDTKTRSNLLQWPVEEVEKLRMSNKNFSGITIDAGSVFPLNITRATQLDIEAEFE  497

Query  527   VDKDAFGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGN  700
             ++++A      +D+ Y+C+   GA+ RG LGPFGLLV+A +  SE T +YFYIA+   GN
Sbjct  498   IEEEALAMMVKADVGYNCSTGGGAAGRGMLGPFGLLVLANERLSERTAVYFYIARGIDGN  557

Query  701   FKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSR  880
              +T FC D LRSS AND+ K+  G TVPVLDGE LS+RILVDHSIVESFAQGGRTCITSR
Sbjct  558   LRTHFCHDELRSSRANDIIKRVVGSTVPVLDGERLSVRILVDHSIVESFAQGGRTCITSR  617

Query  881   IYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMSEMDSAAPHNFN  1015
             +YPT AI    K+FLFNNAT A++TA S+ +W   EMDS   H ++
Sbjct  618   VYPTEAIYGATKVFLFNNATSASVTARSLTIW---EMDSTFNHPYS  660



>ref|XP_008234397.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Prunus mume]
Length=637

 Score =   394 bits (1013),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 191/337 (57%), Positives = 242/337 (72%), Gaps = 6/337 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S     GL+TS NGP +KHVLK SLDD + DYYAIGTY   +  W PDDP
Sbjct  302   MWECVDFYPVSINGSKGLETSVNGPGVKHVLKASLDDKKMDYYAIGTYFVENNTWIPDDP  361

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              ID GIGL+YDYG YYASK+FYD +K+RR+  GW+ E D+ET DL+KGW+S+Q IPR++L
Sbjct  362   KIDVGIGLKYDYGRYYASKTFYDQNKERRILLGWINETDTETDDLEKGWSSLQTIPRSVL  421

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             FDN TGT+L+QWPVEE+E LR   ++F  V V+ G+VV LD+G + +LDI   FE+++  
Sbjct  422   FDNATGTHLLQWPVEEIEDLRLNSTEFSDVLVEAGTVVPLDIGTATQLDIFVVFEIEELE  481

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
                  GS     C  GA+ R  LGPFG+LV+A +  SE TP+YF ++  T G+  T+FCA
Sbjct  482   TESVNGS---VGCGDGATDRSTLGPFGILVLADETLSELTPVYFRVSNSTDGDVTTYFCA  538

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSS A +V K  YG  VPVLDGE+ S R+LVDHSIVESFAQGGRT I SR+YPT AI
Sbjct  539   DETRSSKAPEVYKTVYGGQVPVLDGETYSARVLVDHSIVESFAQGGRTVIASRVYPTEAI  598

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
                A+LFLFNNAT   + A++++WQ   ++SA  H F
Sbjct  599   YGAARLFLFNNATGVNVKATLKIWQ---LNSAFIHPF  632



>emb|CAA64953.1| invertase [Tulipa gesneriana]
Length=628

 Score =   394 bits (1011),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/341 (57%), Positives = 248/341 (73%), Gaps = 5/341 (1%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDD  178
             MWECVDFYP+ T   +GLDTS   GP ++HVLK SLDDD++DYYAIGTY   S  W PDD
Sbjct  287   MWECVDFYPVLTNSTVGLDTSVPPGPGVRHVLKASLDDDKHDYYAIGTYDVVSGTWIPDD  346

Query  179   PTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTI  358
                D GIG RYDYG +YASK+F+D +K RRV +G+  E DSE ++  KGWASV  IPRTI
Sbjct  347   VEADVGIGWRYDYGKFYASKTFFDWAKGRRVLFGFTGETDSEQNNRLKGWASVLPIPRTI  406

Query  359   LFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
             LFD KTG+NL+ WPVEEVE+LR  +  FE +++  G+VV LD+G++ +LDI+AEFE+D  
Sbjct  407   LFDQKTGSNLLLWPVEEVERLRFNRQDFENIDIGIGAVVPLDIGRAIQLDIVAEFEIDGA  466

Query  539   AFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
                 +  +D+ Y+C  + G   RG LGPFG LV++ +D SE T IYFY+ +   G  +TF
Sbjct  467   TLEASVEADLGYNCSTSGGTFGRGVLGPFGFLVLSDEDLSEQTAIYFYVGRKVDGALQTF  526

Query  713   FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
             FC D LRSS A+D+ K+ +G  VPVL GE L+MRIL+DHSIVESFAQGGRTCITSRIYPT
Sbjct  527   FCQDELRSSKADDLVKRVFGSIVPVLHGEILTMRILLDHSIVESFAQGGRTCITSRIYPT  586

Query  893   SAIGEDAKLFLFNNATDATITA-SVEVWQMSEMDSAAPHNF  1012
              A    A++F+FNNAT A +TA S+++WQM    S +P+ F
Sbjct  587   KAFDGAARVFVFNNATGAKVTAKSIKIWQMKSA-SISPYPF  626



>dbj|BAJ24841.1| fructan:fructan 1-fructosyltransferase [Arctium lappa]
Length=617

 Score =   393 bits (1009),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/330 (56%), Positives = 240/330 (73%), Gaps = 2/330 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVD +P+STT    LD +  G  IKHVLK S +    D+Y+IGTY   ++KW PD+P
Sbjct  280  MWECVDLFPVSTTNDSALDIAAYGSGIKHVLKESWEGHAMDFYSIGTYDAINDKWTPDNP  339

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG ++ASKS YDP KKRRV WG+V E DS   D+ +GWA++  + RTI+
Sbjct  340  ELDVGIGLRCDYGRFFASKSLYDPLKKRRVTWGYVAESDSADQDVSRGWATIYNVARTIV  399

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTGT+L+QWPVEE+E LRS   +F+++ ++PGS+V LD+G + +LDI+A FEVD++A
Sbjct  400  LDRKTGTHLLQWPVEELESLRSNVREFKEMTLEPGSIVPLDIGSATQLDIIATFEVDQEA  459

Query  542  FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                + ++  Y+CT  +GA++RG  GPFG+ V+A    SE TP+YFYIAK+T G   T F
Sbjct  460  LKATSDANDEYACTTSSGAAERGSFGPFGIAVLADGTLSELTPVYFYIAKNTKGGVDTHF  519

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D LRSSL  D  K  YG T+PVLDGE ++MR+LVDHS+VE FAQGGRT ITSR+YPT 
Sbjct  520  CTDKLRSSLDYDSEKVVYGSTIPVLDGEQITMRVLVDHSVVEGFAQGGRTVITSRVYPTK  579

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSE  985
            AI E AKLF+FNNAT   + A++ VWQMS 
Sbjct  580  AIYEGAKLFVFNNATTTNVKATLNVWQMSH  609



>gb|ABX90019.1| sucrose:sucrose 1-fructosyltransferase [Lactuca sativa]
Length=639

 Score =   394 bits (1011),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/331 (57%), Positives = 246/331 (74%), Gaps = 3/331 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVD YP+STT   GL+   NGP++K++LK S D+DR+D+YAIG++   ++KW PDDP
Sbjct  296  MWECVDLYPVSTTHTNGLEMKDNGPDVKYILKQSGDEDRHDWYAIGSFDPINDKWYPDDP  355

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLRYDYG +YASK+FYD  KKRRV WG+V E D    DL KGWA++  IPR+I+
Sbjct  356  ENDVGIGLRYDYGKFYASKTFYDQHKKRRVLWGYVGETDPPKDDLLKGWANILNIPRSIV  415

Query  362  FDNKTGTNLIQWPVEEVEKLRSQK-SKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKD  538
             D +TGTNLIQWP+EEVEKLRS+K  +F+ VE++PGS++ L++G + +LDI A FE+D+ 
Sbjct  416  LDTQTGTNLIQWPIEEVEKLRSKKYDEFKDVELRPGSLIPLEIGTATQLDISATFEIDEK  475

Query  539  AFGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTF  712
                   +D+ ++CT   G+  RG LGPFG++V+A    SE  P+YFYIAKDT G  KT+
Sbjct  476  MLESTLEADVLFNCTTSEGSVGRGVLGPFGVVVLADASRSEQLPVYFYIAKDTDGTSKTY  535

Query  713  FCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPT  892
            FCAD  RSS    + K  YG +VPVL+GE  +MR+LVDHSIVE FAQGGRT +TSR+YPT
Sbjct  536  FCADESRSSKDKSIGKWVYGSSVPVLEGEKYNMRLLVDHSIVEGFAQGGRTVVTSRVYPT  595

Query  893  SAIGEDAKLFLFNNATDATITASVEVWQMSE  985
             AI   AKLFLFNNAT  ++ AS+++W+M E
Sbjct  596  KAIYGAAKLFLFNNATGISVKASIKIWKMGE  626



>ref|XP_010062212.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Eucalyptus grandis]
 gb|KCW90831.1| hypothetical protein EUGRSUZ_A02888 [Eucalyptus grandis]
Length=654

 Score =   394 bits (1011),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 194/338 (57%), Positives = 239/338 (71%), Gaps = 5/338 (1%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+ST    GL+TS  GP +KHVLK SLDD + DYYAIGTY   S+ W PDDP
Sbjct  308   MWECVDFYPVSTNSSEGLETSVVGPGVKHVLKASLDDLKMDYYAIGTYDPVSDTWTPDDP  367

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
               D GIGL  DYG YYASK+F+D +  RR+ WGW+ E D++  DL KGWASVQ IPR + 
Sbjct  368   EADVGIGLLVDYGRYYASKTFFDQNTGRRILWGWINETDTDYDDLAKGWASVQTIPRVVT  427

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD-KD  538
             FDNKTG+N+++WPVEEVE LR   ++F+ + V+ GSVV L++  + +LDI  EFE++  D
Sbjct  428   FDNKTGSNILEWPVEEVESLRLDSTEFDDILVEAGSVVALNISSATQLDISVEFEIEGSD  487

Query  539   AFGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFC  718
             A       +    C A    R  LGPFGLLV+A +  SE TPIYF+IAK T G+  T FC
Sbjct  488   ALEALEVPEAIIEC-ATTQNRSTLGPFGLLVLADESLSELTPIYFHIAKSTNGSLTTLFC  546

Query  719   ADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSA  898
             AD  RSS A+++ KK YG  VPVL+ E  +MR+LVDHSI+ESFAQGGRT ITSR+YPT A
Sbjct  547   ADETRSSKASEIFKKVYGGPVPVLNDEKFTMRLLVDHSIIESFAQGGRTVITSRVYPTEA  606

Query  899   IGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
             I   AKLFLFNNAT   +TAS+E+WQ   M+SA  H F
Sbjct  607   IYGAAKLFLFNNATGVNVTASLEIWQ---MNSAFIHPF  641



>emb|CDY39804.1| BnaA09g10560D [Brassica napus]
Length=631

 Score =   392 bits (1008),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 193/340 (57%), Positives = 242/340 (71%), Gaps = 23/340 (7%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S T+  GLDTS NGP+++H++K S+DD R D+YAIGTY + +  W PD+P
Sbjct  302   MWECVDFYPVSKTKHHGLDTSVNGPDVRHIVKASMDDTRIDHYAIGTYYDSNGTWVPDNP  361

Query  182   TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
             +ID GI  GLRYDYG +YASK+FYD  K RR+ WGW+ E DSE +D+QKGW+SVQ IPRT
Sbjct  362   SIDVGISTGLRYDYGKFYASKTFYDQHKGRRILWGWIGESDSEAADVQKGWSSVQAIPRT  421

Query  356   ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
             ++ D KT  NLIQWPV+E+E LR +  KF K ++ PG+VV ++VG +D++DI A+ E   
Sbjct  422   VVLDTKTRKNLIQWPVKEIESLRLRSKKFHK-KIGPGTVVPVNVGPADQIDIEADCE---  477

Query  536   DAFGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                            + GA+ RG LGPFG  V+A    SE T +YFY+ K      KTFF
Sbjct  478   --------------TSGGATLRGALGPFGFSVLADQSLSEQTLVYFYVTKGKDSKLKTFF  523

Query  716   CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
             C D  +S++ANDV K+ YG  VPVL GE L+MRILVDHSIVE F QGGRTCITSR+YPT 
Sbjct  524   CTDTSKSTMANDVVKQVYGSFVPVLKGEKLTMRILVDHSIVEGFGQGGRTCITSRVYPTK  583

Query  896   AIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNFN  1015
             AI    KLFLFNNATDAT+TAS +VWQ   M+SA  H F+
Sbjct  584   AIYGATKLFLFNNATDATVTASFKVWQ---MNSAFIHPFS  620



>gb|AAL05427.2| vacuolar acid invertase [Prunus cerasus]
Length=636

 Score =   392 bits (1006),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 192/337 (57%), Positives = 239/337 (71%), Gaps = 6/337 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S     GL+TS NGP +KHVLK SLDD + D+YAIGTY   +  W PDDP
Sbjct  301   MWECVDFYPVSINGSTGLETSVNGPGVKHVLKASLDDTKMDHYAIGTYFLENNTWIPDDP  360

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              ID GIGL+YDYG YYASK+FYD +K+RR+  GW+ E  +ET DL+KGW+S+Q IPRT+L
Sbjct  361   KIDVGIGLKYDYGRYYASKTFYDQNKERRILLGWINETYTETDDLEKGWSSLQTIPRTVL  420

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             FDN TGT L+QWPVEE+E LR   ++F  V V+ G+VV LD+G + +LDI  +FE++   
Sbjct  421   FDNATGTQLLQWPVEEIEDLRLTSTEFSDVLVEAGTVVPLDIGTATQLDIFVDFEIEVLE  480

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
                  GS     C  GA+ R  LGPFG+LVIA +  SE TP+YF ++  T G+  T FCA
Sbjct  481   TESVNGS---VGCGGGATDRSTLGPFGILVIADETLSELTPVYFRVSNSTDGDITTHFCA  537

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSS A +V K  YG  VPVLDGE+ S R+LVDHSIVESFAQGGRT I SRIYPT AI
Sbjct  538   DETRSSKAPEVYKTVYGDQVPVLDGETYSARVLVDHSIVESFAQGGRTVIASRIYPTEAI  597

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
                A+LFLFNNAT   + A++++WQ   ++SA  H F
Sbjct  598   YGAARLFLFNNATGVNVKATLKIWQ---LNSAFIHPF  631



>gb|AFJ21575.1| vacuolar invertase [Agave tequilana]
 gb|AFJ21581.1| putative vacuolar invertase [Agave tequilana]
Length=646

 Score =   391 bits (1004),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/338 (57%), Positives = 243/338 (72%), Gaps = 7/338 (2%)
 Frame = +2

Query  2    MWECVDFYPISTTEG---IGLDTSYNGPN-IKHVLKTSLDDDRNDYYAIGTYKEPSEKWR  169
            MWEC+D YPI+T+      GLD S    N +KHVLK S  DD +DYYAIGTY   + KW 
Sbjct  304  MWECIDLYPIATSAAGANRGLDPSARPSNLVKHVLKASTSDDNSDYYAIGTYDPAANKWI  363

Query  170  PDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIP  349
            PDD ++D GIGLRYD+G +YASK+F+D  K+RRV WGW++E DSE++D+ KGWAS+QGIP
Sbjct  364  PDDESLDVGIGLRYDWGKFYASKTFFDEQKQRRVLWGWISETDSESADIAKGWASLQGIP  423

Query  350  RTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEV  529
            RT+LFD KT +NL+ WPVEEVE LR     F  + +  GS + LDVG + +LDI AEF +
Sbjct  424  RTVLFDMKTRSNLLTWPVEEVESLRFGLRDFSGITIGAGSTLPLDVGGAAQLDIEAEFLI  483

Query  530  DKDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNF  703
            +K+A    A +D+ Y C  + GA+ RG LGPFGLLV+A    +E T  YFY+++ T GN 
Sbjct  484  NKEALEATAEADVAYECGTSGGAAARGLLGPFGLLVLANHGLTEQTATYFYVSRGTDGNL  543

Query  704  KTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRI  883
            +T FC D LRSS A+D  KK  G TVPVL GE+LS+RILVDHSIVESFAQGGR   TSR+
Sbjct  544  RTHFCQDELRSSKASDTVKKVIGHTVPVLAGETLSLRILVDHSIVESFAQGGRASATSRV  603

Query  884  YPTSAIGEDAKLFLFNNATDATITA-SVEVWQMSEMDS  994
            YPT AI   A++FLFNNAT AT+TA ++++W M+   S
Sbjct  604  YPTEAIYNSARVFLFNNATGATVTARTLKIWHMNSTSS  641



>emb|CAH18892.1| 2,1-fructan:2,1-fructan 1-fructosyltransferase precursor [Viguiera 
discolor]
Length=609

 Score =   389 bits (1000),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 185/329 (56%), Positives = 236/329 (72%), Gaps = 2/329 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T    LD +  GP IKHV+K S +    D+Y+IGTY   ++KW PD+P
Sbjct  272  MWECVDFYPVSLTNDSALDIAAYGPGIKHVIKESWEGHAMDFYSIGTYDAITDKWTPDNP  331

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG ++ASKS YDP KKRR+ W +V E DS   DL +GWA V  + RTI+
Sbjct  332  ELDVGIGLRCDYGRFFASKSLYDPLKKRRITWAYVAESDSLDQDLSRGWAHVYNVGRTIV  391

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTGT+L+ WPVEEVE LR    +F+++E++PGS+V LD+G + +LDI+A FEVD+ A
Sbjct  392  LDRKTGTHLLHWPVEEVETLRYNGREFKEIELEPGSIVPLDIGTATQLDIVATFEVDQAA  451

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                + +D  Y CT   GA++RG LGPFGL+V+A    SE TP+YFYIAK   G   T +
Sbjct  452  LNATSETDDTYGCTTSLGATERGSLGPFGLVVLADGTLSELTPVYFYIAKKADGGVSTHY  511

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D LRSSL  D  K  YG TVPVLD E L+MR+LVDHS++E FAQGGR  ITSR+YPT 
Sbjct  512  CTDKLRSSLDYDDEKVVYGSTVPVLDDEELTMRLLVDHSVLEGFAQGGRIAITSRVYPTK  571

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI E+AKLFLFNNAT  ++ AS+++WQM+
Sbjct  572  AIYEEAKLFLFNNATGTSVKASLKIWQMA  600



>emb|CAH25486.1| 1,2-beta-fructan 1F-fructosyltransferase [Taraxacum officinale]
Length=618

 Score =   390 bits (1001),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/328 (56%), Positives = 237/328 (72%), Gaps = 2/328 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST     LD +  G +IKHV+K S +    D Y+IGTY    +KW PD+P
Sbjct  281  MWECVDFYPVSTINDSALDMAAYGSDIKHVIKESWEGHGMDLYSIGTYDAYKDKWTPDNP  340

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLR DYG ++ASKS YDP KKRRV WG+V E DS   DL +GWA++  + RT++
Sbjct  341  EFDVGIGLRVDYGRFFASKSLYDPLKKRRVTWGYVAESDSSDQDLNRGWATIYNVGRTVV  400

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTGT+L+ WPVEE+E LRS   +F ++E+ PGS++ LD+G + +LDI+A F+VD +A
Sbjct  401  LDRKTGTHLLHWPVEEIESLRSNAHEFHEIELVPGSILPLDIGMATQLDIVATFKVDPEA  460

Query  542  FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                +  +  Y CT  +GA+QRG LGPFG++V+A    SE TP+YFYIAK+  G   T F
Sbjct  461  LMAKSDINSEYGCTTSSGATQRGSLGPFGIVVLADVALSELTPVYFYIAKNIDGGLVTHF  520

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D LRSSL  D  +  YG TVPVLDGE L+MR+LVDHS+VE FAQGGRT +TSR+YPT 
Sbjct  521  CTDKLRSSLDYDGERVVYGSTVPVLDGEELTMRLLVDHSVVEGFAQGGRTVMTSRVYPTK  580

Query  896  AIGEDAKLFLFNNATDATITASVEVWQM  979
            AI E+AK+FLFNNAT A++ AS+++WQM
Sbjct  581  AIYEEAKIFLFNNATGASVKASLKIWQM  608



>ref|XP_009374489.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Pyrus x bretschneideri]
Length=646

 Score =   390 bits (1003),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 242/337 (72%), Gaps = 6/337 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S     GL+TS N   +KHVLK SLDD + D+YAIGTY   +E W PDDP
Sbjct  311   MWECVDFYPVSINGTKGLETSVNNDGVKHVLKASLDDTKLDHYAIGTYFIENETWVPDDP  370

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             TID GIGLRYDYG YYASK+FYD +K+RR+ WGW+ E D+ET DL+KGW+S+Q IPRT+L
Sbjct  371   TIDVGIGLRYDYGRYYASKTFYDQNKERRILWGWINETDTETDDLEKGWSSLQTIPRTVL  430

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             FD+KTGTNL+QWPVEE+E+LR   ++F  V V+ G+ V LD+G + +LDI  +FE++   
Sbjct  431   FDSKTGTNLLQWPVEEIEELRLNSTEFTDVLVEAGTTVPLDIGTATQLDIFVDFEIELLD  490

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
                  GS     C  GA+ R   GPFG+L +A +  SE TP+YF +   T G+  T+FCA
Sbjct  491   TESVNGSS---GCGDGAADRSTFGPFGILALADETLSELTPVYFRVTNSTDGDVTTYFCA  547

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSS A +V K  YG  VPVLDGE+ S R+LVDHSIVES+AQGGRT I+SR+YPT AI
Sbjct  548   DESRSSEAPEVFKHVYGGEVPVLDGETYSARVLVDHSIVESYAQGGRTVISSRVYPTEAI  607

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
                A+LFLFNNAT   + A++++WQ   ++SA  H F
Sbjct  608   YGAARLFLFNNATGVNVKATLKIWQ---LNSAFIHPF  641



>gb|AAB71136.1| acid invertase [Asparagus officinalis]
Length=662

 Score =   390 bits (1003),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 195/347 (56%), Positives = 249/347 (72%), Gaps = 10/347 (3%)
 Frame = +2

Query  2     MWECVDFYPISTT---EGIGLDTSYNGPN-IKHVLKTSLDDDRNDYYAIGTYKEPSEKWR  169
             MWEC+DFYPI+T+      GLD S      +KHVLK S DDDR D+YAIGTY   + KW 
Sbjct  311   MWECIDFYPIATSGAGANRGLDPSVRPSKLVKHVLKESSDDDRQDWYAIGTYDPDTNKWT  370

Query  170   PDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIP  349
             PDD ++D GIGLRYD G +YASK+FYD  KKRRV WGW+ E DSE++D+ KGWAS+QGIP
Sbjct  371   PDDESLDVGIGLRYDLGKFYASKTFYDQEKKRRVLWGWIGESDSESADILKGWASLQGIP  430

Query  350   RTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEV  529
             RT+L+D +TG+NLI WP+EEVE LRS    F  + +  GS  HLDV  + +LDI AEF++
Sbjct  431   RTVLYDLRTGSNLITWPIEEVESLRSNLHDFSGITIDKGSTFHLDVHGAAQLDIEAEFKI  490

Query  530   DKDAFGKAA--GSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTG  697
             ++++    A  G+ + Y+C+   GA++RG LGPFGLLV+A  D +E T  YFY+++   G
Sbjct  491   NEESLSAEAENGTGVMYNCSGGGGAAERGLLGPFGLLVLANSDLTEQTAAYFYVSRGVDG  550

Query  698   NFKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITS  877
               +T FC D +RSS AND+ K   G TVPVL GE+LS+RILVDHSIVESFAQGGR   TS
Sbjct  551   ELQTHFCQDEMRSSKANDIVKSVVGGTVPVLKGETLSLRILVDHSIVESFAQGGRASATS  610

Query  878   RIYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMSEMDSAAPHNFN  1015
             R+YPT AI   AK+FLFNNAT A+ITA S+++W M+   S  P +FN
Sbjct  611   RVYPTEAIYSSAKVFLFNNATGASITAQSLKIWHMNSTLS-RPFDFN  656



>gb|ABS72186.1| fructan:fructan 1-fructosyltransferase [Agave tequilana]
Length=635

 Score =   390 bits (1001),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 188/342 (55%), Positives = 241/342 (70%), Gaps = 7/342 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTE---GIGLDTSY-NGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWR  169
             MWECVD YP++T     G  L+ S   G N+KHVLK  L+D+ +DYYAIGTY   + KW 
Sbjct  287   MWECVDLYPVATAGPLVGRALENSVPAGENVKHVLKAGLNDEWHDYYAIGTYDREANKWT  346

Query  170   PDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIP  349
             PDD  ID GIGLRYD+G +YAS++FYDP K+RRV WG+V E DS   D++KGWASV+G+ 
Sbjct  347   PDDEIIDVGIGLRYDWGKFYASRTFYDPVKQRRVLWGYVGETDSREVDIRKGWASVEGLA  406

Query  350   RTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEV  529
             RT+LFD KTGTNL+ WPVEEVE LR     F  V + PG+ V LD+G +++LDI+AEFE+
Sbjct  407   RTVLFDEKTGTNLLTWPVEEVESLRMTSKNFSNVIISPGTTVQLDIGDANQLDIVAEFEI  466

Query  530   DKDAFGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNF  703
              K+       +D+ Y+C  + GA+ RG LGPFGLLV+A +D +E T  YFY+ + T G+ 
Sbjct  467   KKEELEAVIEADVTYNCSTSGGAATRGLLGPFGLLVLANEDLTEQTATYFYVGRGTDGSL  526

Query  704   KTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRI  883
             +T  C D LRSS A ++ K+  G TVPVL GE LS+RILVDHSIVES+AQGGR   TSR+
Sbjct  527   QTHLCQDELRSSKAYNIVKRVVGHTVPVLAGEMLSLRILVDHSIVESYAQGGRASTTSRV  586

Query  884   YPTSAIGEDAKLFLFNNATDATITA-SVEVWQMSEMDSAAPH  1006
             YPT AI E A++FLFNNAT AT+   SV++W M+       H
Sbjct  587   YPTEAIYEGARVFLFNNATAATVIGKSVKIWHMNSTHDTICH  628



>ref|XP_009340588.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Pyrus x bretschneideri]
Length=645

 Score =   390 bits (1001),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 241/337 (72%), Gaps = 6/337 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S     GL+TS N   +KHVLK SLDD + D+YAIGTY   +E W PDDP
Sbjct  310   MWECVDFYPVSINGTKGLETSVNNDGVKHVLKASLDDTKLDHYAIGTYFIENETWVPDDP  369

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             TID GIGLRYDYG YYASK+FYD +K+RR+ WGW+ E D+ET DL+KGW+S+Q IPRT+L
Sbjct  370   TIDVGIGLRYDYGRYYASKTFYDQNKERRILWGWINETDTETDDLEKGWSSLQTIPRTVL  429

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             FD+KTGTNL+QWPVEE+E LR   ++F  V V+ G+ V LD+G + +LDI  +FE++   
Sbjct  430   FDSKTGTNLLQWPVEEIEDLRLNSTEFTDVLVEAGTTVPLDIGTATQLDIFVDFEIELLD  489

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
                  GS     C  GA+ R   GPFG+L +A +  SE TP+YF +   T G+  T+FCA
Sbjct  490   TESVNGSS---GCGDGAADRSTFGPFGILALADETLSELTPVYFRVTNSTDGDVTTYFCA  546

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D  RSS A +V K  YG  VPVLDGE+ S R+LVDHSIVES+AQGGRT I+SR+YPT AI
Sbjct  547   DESRSSEAPEVFKHVYGGEVPVLDGETYSARVLVDHSIVESYAQGGRTVISSRVYPTEAI  606

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
                A+LFLFNNAT   + A++++WQ   ++SA  H F
Sbjct  607   YGAARLFLFNNATGVNVKATLKIWQ---LNSAFIHPF  640



>gb|KHG09862.1| Beta-fructofuranosidase, soluble isoenzyme I [Gossypium arboreum]
Length=523

 Score =   386 bits (991),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 186/327 (57%), Positives = 238/327 (73%), Gaps = 2/327 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP++    +GLDT+  GP IKHVLK SLDD + D+YAIGTY   ++KW PD+P
Sbjct  178  MWECVDFYPVAINGSVGLDTTALGPGIKHVLKASLDDTKVDHYAIGTYDMITDKWTPDNP  237

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGL+ DYG YYASK+F+D SK+RR+ +GWV E D+E  DL+KGWAS+Q IPR++L
Sbjct  238  EEDVGIGLKVDYGRYYASKTFFDQSKQRRILYGWVNETDTEADDLEKGWASIQTIPRSVL  297

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +DNKTGT+L+QWPVEEVE LR   + F+ V V+ GSVV LD+G + +LDILAEFE+  + 
Sbjct  298  YDNKTGTHLLQWPVEEVESLRLNATVFKDVVVEAGSVVPLDIGTATQLDILAEFEI--ET  355

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
                +  D    C  GA  R   GPFG+LVIA D  SE TPIYF     + G+ +T+FCA
Sbjct  356  LVSNSTEDEVSDCGDGAVDRSTYGPFGVLVIADDSLSELTPIYFRPLNISDGSLETYFCA  415

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS A DV K+ YG  VPVLD E+  MR+LVDHS+VESF +GGRT ITSR+YPT AI
Sbjct  416  DETRSSKAPDVTKRVYGGKVPVLDDENYKMRVLVDHSVVESFGEGGRTVITSRVYPTEAI  475

Query  902  GEDAKLFLFNNATDATITASVEVWQMS  982
               A+LFLFNNA+   + A++++W+M+
Sbjct  476  YGAARLFLFNNASGVNVKATLKIWEMN  502



>emb|CAH18891.1| 2,1-fructan:2,1-fructan 1-fructosyltransferase precursor [Echinops 
ritro]
Length=608

 Score =   388 bits (996),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/332 (55%), Positives = 241/332 (73%), Gaps = 2/332 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVD YP+ST     LD +  G  IKHVLK S +    D+Y+IGTY   ++KW PD+P
Sbjct  271  MWECVDLYPVSTMNDTALDVAAYGSGIKHVLKESWEGHAKDFYSIGTYDAINDKWWPDNP  330

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D G+G R DYG ++ASK+ YDP KKRRV WG+V E DS   D  +GW+++  + RT++
Sbjct  331  ELDLGMGWRCDYGRFFASKTLYDPLKKRRVTWGYVAESDSGDQDRSRGWSNIYNVARTVM  390

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTGTNL+QWPVEE+E LRS+  +F ++E++PGS++ L+VG + +LDI+A FEV+KDA
Sbjct  391  LDRKTGTNLLQWPVEEIESLRSKVHEFNEIELQPGSIIPLEVGSTTQLDIVATFEVNKDA  450

Query  542  FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
            F +   +   Y CT+  GASQRG LGPFG++V+A  +  E TP+YFYIAK+  G+  T F
Sbjct  451  FEETNVNYNEYGCTSSKGASQRGRLGPFGIIVLADGNLLELTPVYFYIAKNNDGSLTTHF  510

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D LRSS   D  K  YG TVPVL+GE L++R++VDHSI+E FAQGGRT ITSR+YPT 
Sbjct  511  CTDKLRSSFDYDDEKVVYGSTVPVLEGEKLTIRLMVDHSIIEGFAQGGRTVITSRVYPTK  570

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSEMD  991
            AI + AKLFLFNNATD T+ AS++VW M+  +
Sbjct  571  AIYDTAKLFLFNNATDITVKASLKVWHMASAN  602



>emb|CAA08811.1| 1,2-beta-fructan 1F-fructosyltransferase [Helianthus tuberosus]
Length=615

 Score =   388 bits (997),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 190/339 (56%), Positives = 239/339 (71%), Gaps = 5/339 (1%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S T    LD +  G  IKHV+K S +    D+Y+IGTY   ++KW PD+P
Sbjct  278   MWECVDFYPVSLTNDSALDMAAYGSGIKHVIKESWEGHGMDWYSIGTYDAINDKWTPDNP  337

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              +D GIGLR DYG ++ASKS YDP KKRR+ WG+V E DS   DL +GWA+V  + RTI+
Sbjct  338   ELDVGIGLRCDYGRFFASKSLYDPLKKRRITWGYVGESDSADQDLSRGWATVYNVGRTIV  397

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
              D KTGT+L+ WPVEEVE LR    +F++++++PGS++ LD+G + +LDI+A FEVD+ A
Sbjct  398   LDRKTGTHLLHWPVEEVESLRYNGQEFKEIKLEPGSIIPLDIGTATQLDIVATFEVDQAA  457

Query  542   FGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                 + +D  Y CT   GA+QRG LGPFGL V+A    SE TP+YFYIAK   G   T F
Sbjct  458   LNATSETDDIYGCTTSLGAAQRGSLGPFGLAVLADGTLSELTPVYFYIAKKADGGVSTHF  517

Query  716   CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
             C D LRSSL  D  +  YG TVPVLD E L+MR+LVDHSIVE FAQGGRT ITSR YPT 
Sbjct  518   CTDKLRSSLDYDGERVVYGGTVPVLDDEELTMRLLVDHSIVEGFAQGGRTVITSRAYPTK  577

Query  896   AIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
             AI E AKLFLFNNAT  ++ AS+++WQM+   SA  H +
Sbjct  578   AIYEQAKLFLFNNATGTSVKASLKIWQMA---SAPIHQY  613



>sp|Q5FC15.1|GFT_ASPOF RecName: Full=6(G)-fructosyltransferase; AltName: Full=6G-FFT; 
Short=6GFT; AltName: Full=6G-fructosyltransferase; AltName: 
Full=AoFT1 [Asparagus officinalis]
 dbj|BAD89564.1| 6G-fructosyltransferase [Asparagus officinalis]
Length=610

 Score =   387 bits (995),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 191/334 (57%), Positives = 245/334 (73%), Gaps = 7/334 (2%)
 Frame = +2

Query  2    MWECVDFYPISTTE---GIGLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWR  169
            MWECVD +P++++    G GLD S     N+KHVLK S++D+ +DYYAIG+Y   + +W 
Sbjct  264  MWECVDLFPVASSGPLIGRGLDRSMMLADNVKHVLKASMNDEWHDYYAIGSYDVATHRWV  323

Query  170  PDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIP  349
            PDD ++D GIG+R D+G +YAS++FYDP K+RRV WG+V E DS  +D+ KGWAS QGIP
Sbjct  324  PDDESVDVGIGMRIDWGKFYASRTFYDPVKERRVMWGYVGETDSGDADVAKGWASFQGIP  383

Query  350  RTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEV  529
            RT+LFD KTGTN++ WP+EEVE LR  +  F  + V  GS V L VG +++LDI AEFE+
Sbjct  384  RTVLFDVKTGTNVLTWPIEEVESLRMTRKDFSDIVVNKGSTVELHVGDANQLDIEAEFEM  443

Query  530  DKDAFGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNF  703
            DKDA   A  +DI Y+C++  GA  RG LGPFGL V+A  D +E T  YFY+++ T G+ 
Sbjct  444  DKDALETAIEADIGYNCSSSGGAVSRGVLGPFGLFVLANQDLTELTATYFYVSRATDGSL  503

Query  704  KTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRI  883
             T  C D +RSS AND+ K+  G T  VLDGE LS+RILVDHSIVESFAQGGRT  TSR+
Sbjct  504  HTHLCHDEMRSSKANDIVKRVVGGTFTVLDGELLSLRILVDHSIVESFAQGGRTSATSRV  563

Query  884  YPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            YPT AI E A++FLFNNAT ATITA +V+VWQM+
Sbjct  564  YPTEAIYERARVFLFNNATGATITAKAVKVWQMN  597



>ref|XP_003538727.1| PREDICTED: acid beta-fructofuranosidase-like [Glycine max]
Length=622

 Score =   388 bits (996),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/296 (62%), Positives = 228/296 (77%), Gaps = 2/296 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDF+P+S+    GL+TS NG N+KHV+K SLDDDR+DYYA+GTY E + K+ PDD 
Sbjct  327  MWECVDFFPVSSKGENGLNTSINGENVKHVVKVSLDDDRHDYYALGTYDEKNVKFTPDDF  386

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGLRYDYG +YASK+FYD SK RRV WGW+ E DSE +D+ KGWASVQGIPRT+ 
Sbjct  387  KNDVGIGLRYDYGIFYASKTFYDQSKGRRVLWGWIGESDSEYADVAKGWASVQGIPRTVT  446

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTG+NL+QWPV EVE LR +  +F+ ++V PGSVV L++G + +LDI+AEFE+DK+A
Sbjct  447  LDKKTGSNLLQWPVAEVESLRLRSEEFQNLKVTPGSVVPLEIGTAAQLDIVAEFEIDKEA  506

Query  542  FGKAAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
              K   S+  Y C  + GA++RG +GPFGLLV+A DD SE+TP YFY+ + + G  KT F
Sbjct  507  LEKTGQSNKEYKCSTSGGATERGAIGPFGLLVLADDDLSEYTPTYFYVVRGSDGQLKTSF  566

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRI  883
            C+D  RSSLA DV KK  G  VPVL  E LS+RILVDHSIVESFAQGGRTC+TSR+
Sbjct  567  CSDQSRSSLATDVSKKILGSLVPVLKDEKLSVRILVDHSIVESFAQGGRTCVTSRV  622



>emb|CAH18938.1| 2,1-fructan:2,1-fructan 1-fructosyltransferase precursor [Bellis 
perennis]
Length=522

 Score =   385 bits (988),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 186/340 (55%), Positives = 244/340 (72%), Gaps = 4/340 (1%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S T    LD +  G  IKHV+K S +    D+Y+IGTY   ++KW PD+P
Sbjct  185   MWECVDFYPVSLTNDSALDMAAYGSGIKHVIKESWEGHGMDWYSIGTYDAKTDKWTPDNP  244

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              +D GIG R DYG ++ASKS YDP KKRRV WG+V E DS   DL +GWA++  + RT++
Sbjct  245   ELDVGIGYRCDYGRFFASKSLYDPLKKRRVTWGYVGESDSADQDLSRGWATIYNVGRTVV  304

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
              D KTGT+L+ WPVEE+E LRS   +FE +EVKPGS V L++G + +LDI+A FEVD++A
Sbjct  305   LDRKTGTHLLHWPVEEIETLRSNVREFE-IEVKPGSTVPLEIGSATQLDIIATFEVDEEA  363

Query  542   FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                 + ++  Y CT  +GA++RG LGPFG+ V+A +  SE TP+YFYIAK++ G   T F
Sbjct  364   LEATSETNDEYGCTTSSGAAERGRLGPFGVAVLADETLSELTPVYFYIAKNSNGGVTTHF  423

Query  716   CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
             C D LRS+L  D  +K YG TVPVLD E  +MRILVDHS+VE FAQGGRT ITSR+YPT 
Sbjct  424   CTDKLRSALDYDNERKVYGSTVPVLDDEKPTMRILVDHSVVEGFAQGGRTVITSRVYPTK  483

Query  896   AIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNFN  1015
             AI E AK+FLFNNAT  ++ AS+++WQM+ +    P+ F+
Sbjct  484   AIYEGAKIFLFNNATGTSVKASLKIWQMATV-HVQPYPFS  522



>emb|CAA06838.1| sucrose sucrose 1-fructosyltransferase [Allium cepa]
Length=623

 Score =   388 bits (996),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 191/334 (57%), Positives = 244/334 (73%), Gaps = 7/334 (2%)
 Frame = +2

Query  2    MWECVDFYPISTTE---GIGLDTSY-NGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWR  169
            M ECVD YP++TT    G GL+    +G  IKHVLK S+DD+R+DYYAIGT+   S  W 
Sbjct  277  MLECVDLYPVATTGNQIGNGLEMKGGSGKGIKHVLKASMDDERHDYYAIGTFDLESFSWV  336

Query  170  PDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIP  349
            PDD TID G+GLRYDYG +YASK+FYD  KKRR+ WG+V E+DS+  D+ KGWASVQ I 
Sbjct  337  PDDDTIDVGVGLRYDYGKFYASKTFYDQEKKRRILWGYVGEVDSKADDILKGWASVQNIA  396

Query  350  RTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEV  529
            RTILFD KT +NL+ WPVEE++ LR+   +F  V V+PGS  HLDVG + +LDI AEFE+
Sbjct  397  RTILFDAKTRSNLLVWPVEELDALRTSGKEFNGVVVEPGSTYHLDVGTATQLDIEAEFEI  456

Query  530  DKDAFGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNF  703
            +K+A      +D+ Y+C+   GA+ RG LGPFGLLV+A +  +E T  YFY++++  G  
Sbjct  457  NKEAVDAVVEADVTYNCSTSDGAAHRGLLGPFGLLVLANEKMTEKTATYFYVSRNVDGGL  516

Query  704  KTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRI  883
            +T FC D LRSS AND+ K+  G TVPVL GE+ S+RILVDHSIVESFAQ GR   TSR+
Sbjct  517  QTHFCQDELRSSKANDITKRVVGHTVPVLHGETFSLRILVDHSIVESFAQKGRAVATSRV  576

Query  884  YPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            YPT AI +  ++FLFNNAT AT+TA SV++W M+
Sbjct  577  YPTEAIYDSTRVFLFNNATSATVTAKSVKIWHMN  610



>emb|CDY03265.1| BnaC09g10830D [Brassica napus]
Length=631

 Score =   388 bits (996),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 187/329 (57%), Positives = 235/329 (71%), Gaps = 20/329 (6%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S T+  GLDTS NGP+++H++K S+DD R D++AIGTY + +  W PD+P
Sbjct  302  MWECVDFYPVSKTKHHGLDTSVNGPDVRHIVKASMDDTRIDHFAIGTYYDSNGTWVPDNP  361

Query  182  TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
            +ID GI  GLRYDYG +YASK+FYD  K RR+ WGW+ E DSE +D+QKGW+SVQ IPRT
Sbjct  362  SIDVGISTGLRYDYGKFYASKTFYDQHKGRRILWGWIGESDSEAADVQKGWSSVQAIPRT  421

Query  356  ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
            ++ D KT  NLIQWPV+E+E LR +  KF K ++ PG+VV +DVG +D++DI A+ E   
Sbjct  422  VVLDKKTRKNLIQWPVKEIESLRLRSKKFHK-KIGPGTVVPVDVGPADQIDIEADCE---  477

Query  536  DAFGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
                           + GA+ RG LGPFG  ++A    SE T +YFY+ K      KTFF
Sbjct  478  --------------TSGGATLRGALGPFGFSILADQSLSEQTLVYFYVTKGKDSKLKTFF  523

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D  +S++ANDV K  YG  VPVL GE L+MRILVDHSIVE F QGGRTCITSR+YPT 
Sbjct  524  CTDTSKSTMANDVVKPVYGSFVPVLKGEKLTMRILVDHSIVEGFGQGGRTCITSRVYPTK  583

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMS  982
            AI    KLFLFNNA DAT+TAS +VWQM+
Sbjct  584  AIYGATKLFLFNNAIDATVTASFKVWQMN  612



>gb|AFU56882.1| vacuolar invertase [Malus domestica]
Length=645

 Score =   388 bits (997),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 243/337 (72%), Gaps = 6/337 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S     G++TS N   +KHVLK SLDD + D+YAIGTY   +E W PDDP
Sbjct  310   MWECVDFYPVSINGTKGVETSVND-GVKHVLKASLDDTKLDHYAIGTYFIENETWVPDDP  368

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             TID GIGLRYDYG YYASK+FYD +K+RR+ WGW+ E D+ T DL+KGW+S+Q IPRT+L
Sbjct  369   TIDVGIGLRYDYGRYYASKTFYDQNKERRILWGWINETDTATDDLEKGWSSLQTIPRTVL  428

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             FD+KTGTNL+QWPVEE+E LR   ++F  V V+ G+ V LD+G + +LDIL +FE+  + 
Sbjct  429   FDSKTGTNLLQWPVEEIEDLRLNSTEFTDVLVEAGTTVPLDIGTATQLDILVDFEI--EL  486

Query  542   FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
              G     +    C  GA+ R   GPFG+L +A +  SE TP+YF +   T G+  T+FCA
Sbjct  487   LGTEESVNGSSGCGDGAADRSTFGPFGILALADETLSEFTPVYFRVTNSTDGDVTTYFCA  546

Query  722   DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
             D LRSS A +V K+ YG  VPVLDGE+ S R+LVDHSIVES+AQGGRT I+SR+YPT AI
Sbjct  547   DELRSSRAPEVFKQVYGGEVPVLDGETYSARVLVDHSIVESYAQGGRTVISSRVYPTEAI  606

Query  902   GEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
                A+LFLFNNAT   + A++++WQ   ++SA  H F
Sbjct  607   YGAARLFLFNNATGVNVKATLKIWQ---LNSAFIHPF  640



>ref|XP_003598216.1| Acid beta-fructofuranosidase [Medicago truncatula]
Length=517

 Score =   384 bits (986),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 186/327 (57%), Positives = 229/327 (70%), Gaps = 1/327 (0%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS NGP++KHVLK SLDD R D YAIGTY   ++ W PD+P
Sbjct  179  MWECVDFYPVSINGSNGLDTSVNGPHVKHVLKASLDDTRVDSYAIGTYFIENDTWIPDNP  238

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGL  DYG YYASK+FYD  KKRR+ WGW+ E D+E+ DL+KGWAS+Q IPRT+L
Sbjct  239  LEDVGIGLLLDYGIYYASKTFYDQVKKRRILWGWINETDAESDDLEKGWASLQTIPRTVL  298

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTGTNL+QWPVEEVE LR    ++ +V V PGSVV L++ ++ +LDI AEFE++   
Sbjct  299  FDQKTGTNLLQWPVEEVESLRLSSDEYAEVVVTPGSVVPLNITQATQLDIFAEFEIES-L  357

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
              K   S+    C  G+  R   GPFG+L IA D  SE TPIYF ++  + G+    FC 
Sbjct  358  TSKENISNDNIDCGRGSIDRSDFGPFGILAIAHDTLSEQTPIYFRLSNTSLGSSTNLFCV  417

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS A DV K+ YG  VPV   E LSMR+LVDHSI+ESFAQGGR  I+ R+YPT AI
Sbjct  418  DGTRSSKAPDVEKRVYGSKVPVFSDEKLSMRVLVDHSIIESFAQGGRVVISGRVYPTEAI  477

Query  902  GEDAKLFLFNNATDATITASVEVWQMS  982
               AKLFLFNNAT+  I  S+++W ++
Sbjct  478  YGAAKLFLFNNATNINIKVSLKIWHLN  504



>gb|AHK05786.1| vacuolar invertase [Eriobotrya japonica]
Length=646

 Score =   387 bits (995),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 189/338 (56%), Positives = 242/338 (72%), Gaps = 7/338 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S     GL+TS N   +KH+LK SLDD + D+YAIGTY   +E W PDDP
Sbjct  310   MWECVDFYPVSINGTKGLETSVNNDGVKHILKASLDDTKLDHYAIGTYFIENETWVPDDP  369

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             TID GIGLRYDYG YYASK+FYD +K+RR+ WGW+ E D+ET DL+KGW+S+Q IPRT+L
Sbjct  370   TIDVGIGLRYDYGRYYASKTFYDQNKERRILWGWINETDTETDDLEKGWSSLQTIPRTVL  429

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD-KD  538
             FD+KTGTNL+QWPVEE+E LR   ++F +V V+ G+ V LD+G + +LDI  +FE++  D
Sbjct  430   FDSKTGTNLLQWPVEEIEDLRLNSNEFTEVLVEAGTTVPLDIGTATQLDIFVDFEIELLD  489

Query  539   AFGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFC  718
                   GS     C  GA+ R   GPFG+L +A +  SE TP+YF +   T G+  T+FC
Sbjct  490   TEESVNGSS---GCGDGAADRSTFGPFGILALADETLSELTPVYFRVTNSTDGDVTTYFC  546

Query  719   ADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSA  898
              D  RSS A +V K  YG  VPVLDGE+ S R+LVDHSIVES+AQGGRT I+SR+YPT A
Sbjct  547   TDESRSSKAPEVFKHVYGGEVPVLDGETYSARVLVDHSIVESYAQGGRTVISSRVYPTEA  606

Query  899   IGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
             I   A+LFLFNNAT   + A++++WQ   ++SA  H F
Sbjct  607   IYGAARLFLFNNATGVNVKATLKIWQ---LNSAFIHPF  641



>gb|AFB83199.1| fructan-fructan 1-fructosyltransferase [Cichorium intybus]
Length=622

 Score =   387 bits (993),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 181/328 (55%), Positives = 239/328 (73%), Gaps = 2/328 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+ST     LD +  G +IKHV+K S +    D+Y+IGTY   ++KW PD+P
Sbjct  285  MWECVDFYPVSTINDSALDIAAYGCDIKHVIKESWEGHGMDWYSIGTYDAMNDKWTPDNP  344

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG ++ASKS YDP KKRRV WG+V E DS   DL +GWA++  + RTI+
Sbjct  345  ELDVGIGLRVDYGRFFASKSLYDPLKKRRVTWGYVGESDSPVQDLNRGWATIYNVARTIV  404

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTGT+L+ WPVEE+E LR    +F+++E+ PGS++ LD+G + +LDI+A FEV+++ 
Sbjct  405  LDRKTGTHLLHWPVEEIESLRYDGREFKEIELAPGSIMPLDIGPATQLDIVATFEVEQEM  464

Query  542  FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
            F   + ++  Y CT  AGA++RG LGPFG+ V+A    SE TP+YFYI+K T G+  T F
Sbjct  465  FMGKSDTNGEYGCTTSAGATERGSLGPFGIAVLADGTLSELTPVYFYISKKTDGSVATHF  524

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D LRSSL  D  +  YG TVPVLDGE L+MR+LVDHS+VE FA GGRT +TSR+YPT 
Sbjct  525  CTDKLRSSLDYDGERVVYGSTVPVLDGEELTMRLLVDHSVVEGFAMGGRTVMTSRVYPTK  584

Query  896  AIGEDAKLFLFNNATDATITASVEVWQM  979
            AI E AK+FLFNNAT  ++ AS+++WQM
Sbjct  585  AIYEGAKIFLFNNATHTSVKASLKIWQM  612



>emb|CAA06839.1| invertase [Allium cepa]
Length=690

 Score =   389 bits (998),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 186/335 (56%), Positives = 241/335 (72%), Gaps = 8/335 (2%)
 Frame = +2

Query  2    MWECVDFYPISTTEGI----GLDTSYN-GPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKW  166
            MWECVDFYP++T +      GLD S    P +KHVLK S+DDDR+DYYAIGTY      W
Sbjct  342  MWECVDFYPVATADSSHANHGLDPSARPSPAVKHVLKASMDDDRHDYYAIGTYDPAQNTW  401

Query  167  RPDDPTIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGI  346
             PDD ++D GIGLRYD+G +YASK+FYD +KKRR+ W W+ E DSET+D+ KGWAS+QG+
Sbjct  402  VPDDASVDVGIGLRYDWGKFYASKTFYDHAKKRRILWSWIGETDSETADIAKGWASLQGV  461

Query  347  PRTILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFE  526
            PRT+L D KTG+NLI WPV E+E LR++   F  + V  GS   LDVG + +LDI AEF+
Sbjct  462  PRTVLLDVKTGSNLITWPVVEIESLRTRPRDFSGITVDAGSTFKLDVGGAAQLDIEAEFK  521

Query  527  VDKDAFGKAAGSDIPYSCTA--GASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGN  700
            +  +       +D+ Y+C++  GA++RG LGPFGLLV+A  D +E T  YFY+++   G 
Sbjct  522  ISSEELEAVKEADVSYNCSSSGGAAERGVLGPFGLLVLANQDLTEQTATYFYVSRGMDGG  581

Query  701  FKTFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSR  880
              T FC D  RSS A+D+ K+  G +VPVLDGES ++RILVDHSIVESFAQGGR   TSR
Sbjct  582  LNTHFCQDEKRSSKASDIVKRIVGHSVPVLDGESFALRILVDHSIVESFAQGGRASATSR  641

Query  881  IYPTSAIGEDAKLFLFNNATDATITA-SVEVWQMS  982
            +YPT AI  +A++F+FNNAT A +TA S++VW MS
Sbjct  642  VYPTEAIYNNARVFVFNNATGAKVTAQSLKVWHMS  676



>gb|ADP08983.1| vacuolar invertase 1 [Gossypium hirsutum]
Length=648

 Score =   387 bits (994),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 186/327 (57%), Positives = 237/327 (72%), Gaps = 2/327 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP++    +GLDT+  GP IKHVLK SLDD + D+YAIGTY   ++KW PD+P
Sbjct  303  MWECVDFYPVAINGSVGLDTTALGPGIKHVLKASLDDTKVDHYAIGTYDMITDKWTPDNP  362

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGL+ DYG YYASK+F+D SK+RR+ +GWV E DSE  DL+KGWAS+Q IPR++L
Sbjct  363  EEDVGIGLKVDYGRYYASKTFFDQSKQRRILYGWVNETDSEADDLEKGWASIQTIPRSVL  422

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +DNKTGT+L+QWPVEEVE LR   + F+ V V+ GSVV LD+G + +LDILAEFE++   
Sbjct  423  YDNKTGTHLLQWPVEEVESLRLNATVFKDVVVEAGSVVPLDIGTATQLDILAEFEIETLV  482

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
                   D    C  GA  R   GPFG+LVIA D  SE TPIYF     + G+ +T+FCA
Sbjct  483  LNST--EDEVSDCGDGAVDRSTYGPFGVLVIADDSLSELTPIYFRPLNTSDGSLETYFCA  540

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS A DV K+ YG  +PVLD E+ +MR+LVDHS+VESF  GGRT ITSR+YPT AI
Sbjct  541  DETRSSKAPDVTKRVYGGKIPVLDDENYNMRVLVDHSVVESFGGGGRTVITSRVYPTEAI  600

Query  902  GEDAKLFLFNNATDATITASVEVWQMS  982
               A+LFLFNNA+   + A++++W+M+
Sbjct  601  YGAARLFLFNNASGVNVKATLKIWEMN  627



>gb|AAD00558.1| fructan-fructan 1-fructosyltransferase [Cichorium intybus]
Length=617

 Score =   386 bits (991),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 178/331 (54%), Positives = 241/331 (73%), Gaps = 2/331 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVD YP+ST     LD +  GP++KHV+K S +    D+Y+IGTY   ++KW PD+P
Sbjct  280  MWECVDLYPVSTINDSALDIAAYGPDMKHVIKESWEGHGMDWYSIGTYDVINDKWTPDNP  339

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGLR DYG ++ASKS YDP KKRRV WG+V E DS   DL +GWA++  + RTI+
Sbjct  340  ELDVGIGLRVDYGRFFASKSLYDPLKKRRVTWGYVAESDSADQDLNRGWATIYNVARTIV  399

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
             D KTGT+L+ WP EE+E LR    +F+++E+ PGS++ LD+G + +LDI+A FEV+++ 
Sbjct  400  LDRKTGTHLLHWPAEEIESLRYDGREFKEIELAPGSIMPLDIGPATQLDIVATFEVEQET  459

Query  542  FGKAAGSDIPYSCT--AGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFF  715
            F + + ++  Y CT  AGA++RG LGPFG+ V+A    SE TP+YFYI+K T G+  T F
Sbjct  460  FMRTSDTNGEYGCTTSAGATERGSLGPFGIAVLADGTLSELTPVYFYISKKTDGSVATHF  519

Query  716  CADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTS  895
            C D LRSSL  D  +  YG TVPVLDGE L+MR+LVDHS+VE FA GGRT +TSR+YPT 
Sbjct  520  CTDKLRSSLDYDGERVVYGSTVPVLDGEELTMRLLVDHSVVEGFAMGGRTVMTSRVYPTK  579

Query  896  AIGEDAKLFLFNNATDATITASVEVWQMSEM  988
            AI E AK+FLFNNAT  ++ AS+++WQ++ +
Sbjct  580  AIYEGAKIFLFNNATHTSVKASLKIWQIASV  610



>gb|AES68467.2| soluble acid invertase FRUCT2 [Medicago truncatula]
Length=632

 Score =   386 bits (991),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 186/327 (57%), Positives = 229/327 (70%), Gaps = 1/327 (0%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLDTS NGP++KHVLK SLDD R D YAIGTY   ++ W PD+P
Sbjct  294  MWECVDFYPVSINGSNGLDTSVNGPHVKHVLKASLDDTRVDSYAIGTYFIENDTWIPDNP  353

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGL  DYG YYASK+FYD  KKRR+ WGW+ E D+E+ DL+KGWAS+Q IPRT+L
Sbjct  354  LEDVGIGLLLDYGIYYASKTFYDQVKKRRILWGWINETDAESDDLEKGWASLQTIPRTVL  413

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FD KTGTNL+QWPVEEVE LR    ++ +V V PGSVV L++ ++ +LDI AEFE++   
Sbjct  414  FDQKTGTNLLQWPVEEVESLRLSSDEYAEVVVTPGSVVPLNITQATQLDIFAEFEIESLT  473

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
              K   S+    C  G+  R   GPFG+L IA D  SE TPIYF ++  + G+    FC 
Sbjct  474  -SKENISNDNIDCGRGSIDRSDFGPFGILAIAHDTLSEQTPIYFRLSNTSLGSSTNLFCV  532

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS A DV K+ YG  VPV   E LSMR+LVDHSI+ESFAQGGR  I+ R+YPT AI
Sbjct  533  DGTRSSKAPDVEKRVYGSKVPVFSDEKLSMRVLVDHSIIESFAQGGRVVISGRVYPTEAI  592

Query  902  GEDAKLFLFNNATDATITASVEVWQMS  982
               AKLFLFNNAT+  I  S+++W ++
Sbjct  593  YGAAKLFLFNNATNINIKVSLKIWHLN  619



>ref|XP_007148711.1| hypothetical protein PHAVU_005G008200g [Phaseolus vulgaris]
 gb|ESW20705.1| hypothetical protein PHAVU_005G008200g [Phaseolus vulgaris]
Length=633

 Score =   385 bits (990),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 191/327 (58%), Positives = 231/327 (71%), Gaps = 6/327 (2%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP+S     GLD+S NGP +KHVLK SLDD R D YA+GTY   ++ W PDDP
Sbjct  300  MWECVDFYPVSINGSKGLDSSVNGPYVKHVLKASLDDKRVDSYALGTYFVENDTWVPDDP  359

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             +D GIGL  DYG YYASKSFYD  K+RR+ WGWV E D E+ DL+KGWAS+Q IPRT+L
Sbjct  360  FMDVGIGLLLDYGRYYASKSFYDEEKERRILWGWVNETDIESDDLRKGWASLQTIPRTVL  419

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            FDNKT TNL+ WPVEEVE LR    +FE + VKPGSVV L++  + +LDI AEFE++   
Sbjct  420  FDNKTRTNLLLWPVEEVESLRLSSDEFEGMVVKPGSVVPLNISLATQLDIFAEFEIEW-L  478

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
              K+ G +       GA+ R   GPFGLL IA D  SE TPIYF ++  T     TFFC 
Sbjct  479  NSKSNGKNNMGCGKGGATDRSAFGPFGLLAIADDSLSEQTPIYFRLSNTT-----TFFCV  533

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS A+DV K  YG  +P+L  E LSMR+LVDHSI+ESFAQGGR  ITSR+YPT AI
Sbjct  534  DETRSSKASDVSKAIYGSNIPILSDEKLSMRVLVDHSIIESFAQGGRRVITSRVYPTEAI  593

Query  902  GEDAKLFLFNNATDATITASVEVWQMS  982
               A+LF+FNNATD  I  S+++WQ++
Sbjct  594  YGAARLFVFNNATDINIKISLKIWQLN  620



>gb|ACQ82802.1| vacuolar invertase [Gossypium hirsutum]
Length=645

 Score =   385 bits (990),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 185/327 (57%), Positives = 239/327 (73%), Gaps = 2/327 (1%)
 Frame = +2

Query  2    MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
            MWECVDFYP++    +GLDT+  GP IKHVLK SLDD + D+YAIGTY   ++KW PD+P
Sbjct  300  MWECVDFYPVAINGSVGLDTTALGPGIKHVLKASLDDTKVDHYAIGTYDMITDKWTPDNP  359

Query  182  TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
              D GIGL+ DYG YYASK+F+D SK+RR+ +GWV E D+E  DL+KGWAS+Q IPR++L
Sbjct  360  EEDVGIGLKVDYGRYYASKTFFDQSKQRRILYGWVNETDTEADDLEKGWASIQTIPRSVL  419

Query  362  FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDKDA  541
            +DNKTGT+L+QWPVEEVE LR   + F+ V V+ GSVV LD+G + +LDILAEFE+  + 
Sbjct  420  YDNKTGTHLLQWPVEEVESLRLNATVFKDVVVEAGSVVPLDIGTATQLDILAEFEI--ET  477

Query  542  FGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFCA  721
                +  D    C  GA  R   GPFG+LVIA D  SE TPIYF     + G+ +T+FCA
Sbjct  478  LVSNSTEDEVSDCGDGAVDRNTYGPFGVLVIADDSLSELTPIYFRPLNISDGSLETYFCA  537

Query  722  DHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSAI  901
            D  RSS A +V K+ YG  VPVLD E+ +MR+LVDHS+VESF +GGRT ITSR+YPT AI
Sbjct  538  DETRSSKAPNVTKRVYGGKVPVLDDENYNMRVLVDHSVVESFGEGGRTVITSRVYPTEAI  597

Query  902  GEDAKLFLFNNATDATITASVEVWQMS  982
               A+LFLFNNA+   + A++++W+M+
Sbjct  598  YGAARLFLFNNASRVNVKATLKIWEMN  624



>gb|KFK40589.1| hypothetical protein AALP_AA2G015400 [Arabis alpina]
Length=650

 Score =   385 bits (990),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 193/354 (55%), Positives = 249/354 (70%), Gaps = 20/354 (6%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP+S T+  GLDTS NG ++KH++K S+DD R D+YAIGTY + +  W PD+P
Sbjct  291   MWECVDFYPVSKTKTKGLDTSVNGRDVKHIVKASMDDTRIDHYAIGTYYDSNATWVPDNP  350

Query  182   TIDTGI--GLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRT  355
              ID G+  GLRYDYG YYASK+FYD +K RR+ WGW+ E DSE +D+QKGW+SVQGIPRT
Sbjct  351   AIDVGVSTGLRYDYGKYYASKTFYDQNKGRRILWGWIGESDSEAADVQKGWSSVQGIPRT  410

Query  356   ILFDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVDK  535
             ++ D KT   L+QWP++E+E LR    KF  ++V+PG+VV ++VG + +LDI AEF + K
Sbjct  411   VVLDTKTKKTLVQWPIKEIESLRLTSKKFH-MKVEPGTVVPVEVGPAAQLDIEAEFTIKK  469

Query  536   D----AFGK-AAGSDIPYSC--TAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTT  694
                   FG  +  +D  +SC  + G++ RG LGPFG  V+A    SE TP+YFY+ K   
Sbjct  470   SDVDIIFGDDSVDTDKEFSCETSGGSTVRGALGPFGFSVLADQSLSEQTPVYFYVTKGKD  529

Query  695   GNFK-------TFFCADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQ  853
                        TFFC D  RS+ ANDV K  YG  VPVL GE L+MRI++DHSIVE+F Q
Sbjct  530   SKLSGKDSKLSTFFCTDTSRSTKANDVVKPVYGSFVPVLKGEKLTMRIIIDHSIVEAFGQ  589

Query  854   GGRTCITSRIYPTSAIGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNFN  1015
             GGRTCI+SR+YPT+AI    KL+LFNNA DAT+TAS +VWQ   M+SA  H F+
Sbjct  590   GGRTCISSRVYPTNAIYGATKLYLFNNAIDATVTASFKVWQ---MNSAFIHPFS  640



>ref|XP_008376436.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Malus domestica]
Length=645

 Score =   384 bits (987),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 191/338 (57%), Positives = 241/338 (71%), Gaps = 7/338 (2%)
 Frame = +2

Query  2     MWECVDFYPISTTEGIGLDTSYNGPNIKHVLKTSLDDDRNDYYAIGTYKEPSEKWRPDDP  181
             MWECVDFYP++     GLDTS N   +KHVLK SLDD + D+YAIGTY   +E W PDDP
Sbjct  309   MWECVDFYPVAINGSKGLDTSVNNGGVKHVLKASLDDTKLDHYAIGTYFIENETWVPDDP  368

Query  182   TIDTGIGLRYDYGTYYASKSFYDPSKKRRVNWGWVTEIDSETSDLQKGWASVQGIPRTIL  361
             TID GIGL+YDYG YYASK+FYD +K+RR+  GW+ E D+ET DL+K WAS+  IPRT+L
Sbjct  369   TIDVGIGLKYDYGRYYASKTFYDQNKERRILLGWINETDTETDDLKKRWASLHTIPRTVL  428

Query  362   FDNKTGTNLIQWPVEEVEKLRSQKSKFEKVEVKPGSVVHLDVGKSDELDILAEFEVD-KD  538
             FD+KTGTNL+QWPVEE+E LR   ++F  V V+ G+VV LD+G + +LDI  +FE++  D
Sbjct  429   FDSKTGTNLLQWPVEEIEDLRLNSTEFTDVLVEAGTVVPLDIGTATQLDIFVDFEIELLD  488

Query  539   AFGKAAGSDIPYSCTAGASQRGGLGPFGLLVIAKDDFSEHTPIYFYIAKDTTGNFKTFFC  718
                   GS     C  GA  R   GPFG+LVIA +  SE TP+YF +   T G+  T+FC
Sbjct  489   TEESVNGSS---GCGDGAVDRSTFGPFGILVIADESLSELTPVYFRVTNSTDGDVTTYFC  545

Query  719   ADHLRSSLANDVRKKTYGRTVPVLDGESLSMRILVDHSIVESFAQGGRTCITSRIYPTSA  898
             AD  RSS A +V K+ YG  VPVLDGE+ S R+LVDHSIVES+AQGGRT I+SR+YPT A
Sbjct  546   ADESRSSKAPEVFKQVYGGEVPVLDGETYSARVLVDHSIVESYAQGGRTVISSRVYPTEA  605

Query  899   IGEDAKLFLFNNATDATITASVEVWQMSEMDSAAPHNF  1012
             I   A+LFLFNNAT   + A++++WQ   ++SA  H F
Sbjct  606   IYGAARLFLFNNATGVNVKATLKIWQ---LNSAFIHPF  640



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2351319000596