BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14548_g3_i1 len=539 path=[3454:0-538]

Length=539
                                                                      Score     E

gb|AHG98056.1|  catalase                                                368   9e-126   
gb|AFC35182.1|  catalase dismutase                                      364   2e-124   
emb|CDW92180.1|  putative catalase                                      363   3e-124   
gb|KHG25152.1|  Catalase isozyme 1                                      371   4e-124   
emb|CDW92181.1|  putative catalase                                      363   4e-124   
gb|ACJ11733.1|  catalase                                                370   4e-124   Gossypium hirsutum [American cotton]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               370   1e-123   Gossypium hirsutum [American cotton]
gb|AAX88799.1|  catalase                                                369   2e-123   Euphorbia characias
emb|CAJ00337.1|  putative catalase                                      362   2e-123   Andrographis paniculata
gb|KHG12976.1|  Catalase isozyme 2                                      369   3e-123   
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               369   3e-123   Gossypium hirsutum [American cotton]
gb|AET97564.1|  catalase                                                368   3e-123   
ref|NP_001291326.1|  catalase isozyme 1                                 368   4e-123   
gb|AII80275.1|  catalase                                                361   5e-123   
gb|AJE26131.1|  catalase                                                367   9e-123   
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      367   1e-122   
ref|XP_010692546.1|  PREDICTED: catalase                                367   1e-122   
emb|CDP01802.1|  unnamed protein product                                366   1e-122   
gb|AAO12509.1|  catalase                                                356   1e-122   Morus alba
gb|AHB72694.1|  catalase                                                367   1e-122   
gb|AAL38024.1|AF443179_1  catalase                                      357   2e-122   Nicotiana tabacum [American tobacco]
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             364   3e-122   
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      366   3e-122   
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             365   3e-122   
emb|CDP01803.1|  unnamed protein product                                366   3e-122   
gb|AAO17721.1|  catalase                                                365   4e-122   Hypericum perforatum
gb|ACH63223.1|  catalase                                                365   5e-122   Rheum australe [Himalayan rhubarb]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           365   5e-122   
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    365   6e-122   
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           365   6e-122   
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             365   6e-122   
ref|XP_002306976.2|  catalase family protein                            365   7e-122   Populus trichocarpa [western balsam poplar]
ref|XP_010530333.1|  PREDICTED: catalase-2                              365   7e-122   
ref|XP_007018034.1|  Catalase 2                                         365   8e-122   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     364   8e-122   
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             365   9e-122   Populus trichocarpa [western balsam poplar]
gb|AFU90822.1|  catalase                                                364   1e-121   
gb|AAR14052.2|  catalase                                                363   2e-121   Solanum tuberosum [potatoes]
gb|AHA50082.1|  catalase                                                364   2e-121   
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          364   2e-121   Soldanella alpina
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      364   2e-121   
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             365   2e-121   
ref|XP_009138342.1|  PREDICTED: catalase-2                              363   3e-121   
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      363   3e-121   
gb|AAM97541.1|  catalase 2                                              363   3e-121   Capsicum annuum
gb|AAM97542.1|  catalase 3                                              363   3e-121   Capsicum annuum
gb|EPS69543.1|  catalase                                                363   3e-121   
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      363   3e-121   
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         363   4e-121   
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              363   4e-121   
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      363   4e-121   
ref|XP_002521709.1|  catalase, putative                                 363   5e-121   Ricinus communis
ref|XP_010094556.1|  Catalase isozyme 1                                 363   5e-121   
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              363   5e-121   
gb|ABY21704.1|  catalase-1 precursor                                    363   5e-121   Panax ginseng [Chinese ginseng]
dbj|BAJ33995.1|  unnamed protein product                                362   6e-121   
ref|XP_011022275.1|  PREDICTED: catalase-like                           362   6e-121   
gb|AAB86582.2|  catalase                                                362   6e-121   Raphanus sativus
gb|AAF71742.1|AF248491_1  catalase                                      362   6e-121   Raphanus sativus
gb|AAD17935.1|  catalase                                                362   7e-121   Brassica juncea [Indian mustard]
gb|AAD17936.1|  catalase                                                362   7e-121   Brassica juncea [Indian mustard]
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             362   7e-121   
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       362   8e-121   
gb|AIA61608.1|  catalase                                                362   8e-121   
gb|AAD17933.1|  catalase                                                362   8e-121   Brassica juncea [Indian mustard]
dbj|BAQ21275.1|  catalase                                               362   8e-121   
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               362   8e-121   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_002301920.1|  catalase family protein                            362   8e-121   Populus trichocarpa [western balsam poplar]
emb|CAI43948.1|  catalase                                               362   9e-121   Populus deltoides
ref|NP_195235.1|  catalase 2                                            362   9e-121   Arabidopsis thaliana [mouse-ear cress]
gb|AAK67359.2|AF390210_1  catalase                                      362   9e-121   Suaeda salsa
emb|CAA64220.1|  catalase                                               362   9e-121   Arabidopsis thaliana [mouse-ear cress]
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          362   9e-121   Helianthus annuus
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             363   9e-121   
gb|ADU56199.1|  catalase                                                362   1e-120   
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 362   1e-120   
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             362   1e-120   
gb|AIP93616.1|  CAT1                                                    362   1e-120   
dbj|BAH19523.1|  AT4G35090                                              361   1e-120   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031791.1|  catalase 2                                         361   1e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      362   1e-120   
gb|KFK30147.1|  catalase                                                362   1e-120   
gb|ADC95629.1|  catalase                                                362   1e-120   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         362   1e-120   
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      362   2e-120   
gb|AFN81243.1|  catalase 1                                              362   2e-120   
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             362   2e-120   
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      361   2e-120   
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         361   2e-120   
gb|AAC19397.1|  leaf catalase                                           361   2e-120   Mesembryanthemum crystallinum
emb|CAD42908.1|  catalase                                               361   2e-120   Prunus persica
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               361   2e-120   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ACA50528.1|  putative catalase 2                                     361   2e-120   Brassica napus [oilseed rape]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         361   3e-120   
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      361   3e-120   
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                361   3e-120   
gb|ACL27272.1|  catalase                                                360   4e-120   Nicotiana benthamiana
gb|AFU48609.1|  catalase 1                                              360   4e-120   
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      360   4e-120   
prf||2104177A  catalase                                                 360   4e-120
emb|CDP07287.1|  unnamed protein product                                360   4e-120   
ref|XP_007046520.1|  Catalase 2                                         360   5e-120   
gb|AGI65617.1|  catalase                                                359   5e-120   
ref|XP_010437527.1|  PREDICTED: catalase-2                              360   6e-120   
gb|AAK96854.1|  catalase                                                360   6e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         360   6e-120   
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             360   6e-120   
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             360   7e-120   
ref|XP_004300681.1|  PREDICTED: catalase-like                           360   7e-120   
ref|NP_001289779.1|  catalase isozyme 1                                 360   8e-120   
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      360   1e-119   
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      357   1e-119   
prf||1906388A  catalase                                                 359   1e-119
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              360   2e-119   
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              358   2e-119   
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      358   2e-119   
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              358   2e-119   
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      358   2e-119   
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      358   2e-119   
gb|ACV92695.1|  catalase                                                358   2e-119   Brassica oleracea
emb|CCP37650.1|  catalase-1                                             358   2e-119   
ref|NP_001234186.1|  catalase isozyme 2                                 358   2e-119   
gb|AAB71764.1|  catalase 1                                              358   3e-119   Nicotiana tabacum [American tobacco]
gb|AIS20825.1|  CAT                                                     358   3e-119   
gb|AAB62892.1|  catalase-1                                              358   3e-119   Nicotiana glutinosa
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                358   4e-119   
emb|CAA45564.1|  catalase                                               357   8e-119   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001048861.1|  Os03g0131200                                       357   8e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         356   2e-118   
dbj|BAA34714.1|  catalase                                               356   2e-118   Oryza sativa [red rice]
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         356   2e-118   
gb|AAR84577.1|  catalase 1b                                             354   2e-118   Lotus japonicus
ref|XP_009106100.1|  PREDICTED: catalase-2                              355   3e-118   
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 355   5e-118   
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      355   5e-118   
ref|XP_010061175.1|  PREDICTED: catalase-like                           355   6e-118   
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             355   6e-118   
ref|XP_003558892.1|  PREDICTED: catalase-1                              355   7e-118   
gb|AAR84578.1|  catalase 1a                                             354   9e-118   Lotus japonicus
gb|AAF61732.1|AF243517_1  catalase 2                                    354   2e-117   Helianthus annuus
dbj|BAA34205.1|  catalase                                               353   2e-117   Oryza sativa Japonica Group [Japonica rice]
gb|AAC17731.1|  catalase 1                                              353   5e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 352   5e-117   
ref|NP_564121.1|  catalase 1                                            352   6e-117   Arabidopsis thaliana [mouse-ear cress]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     355   6e-117   
ref|XP_009103333.1|  PREDICTED: catalase-1                              352   6e-117   
emb|CDY01363.1|  BnaA07g11360D                                          352   6e-117   
gb|KEH36313.1|  catalase heme-binding enzyme                            350   8e-117   
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      352   8e-117   
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              352   9e-117   
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      352   1e-116   
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              352   1e-116   
gb|AEG89525.1|  catalase                                                346   2e-116   
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    351   2e-116   
emb|CDY31877.1|  BnaC07g15270D                                          351   2e-116   
gb|AEQ94083.1|  putative catalase                                       344   3e-116   
dbj|BAJ90861.1|  predicted protein                                      350   3e-116   
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               350   3e-116   Cucurbita pepo
gb|AAB07026.1|  catalase 1                                              350   3e-116   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ88747.1|  predicted protein                                      352   3e-116   
ref|XP_010477308.1|  PREDICTED: catalase-1                              350   3e-116   
gb|KEH36312.1|  catalase heme-binding enzyme                            350   6e-116   
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 350   6e-116   
ref|NP_001235974.1|  catalase-3                                         349   8e-116   
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 362   9e-116   
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               349   1e-115   Ricinus communis
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         349   1e-115   
gb|AIZ77475.1|  catalase                                                349   1e-115   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         349   1e-115   
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       349   1e-115   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      348   1e-115   
emb|CAG23920.1|  catalase                                               349   1e-115   Festuca arundinacea [tall fescue]
emb|CAC37634.1|  catalase 1                                             342   2e-115   Pinus pinea [parasol pine]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          348   2e-115   
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      348   2e-115   
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 348   3e-115   
gb|AAF19965.1|AF207906_1  catalase 1                                    348   4e-115   Zantedeschia aethiopica [arum-lily]
gb|ACJ71242.1|  catalase 1                                              338   4e-115   Vigna unguiculata
ref|NP_001237556.1|  catalase-1/2                                       347   5e-115   
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      347   6e-115   
gb|EMT05040.1|  Catalase-1                                              348   8e-115   
gb|AAD37788.1|AF149283_1  catalase 1                                    345   9e-115   Phaseolus vulgaris [French bean]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             346   1e-114   
gb|AFC01205.1|  catalase                                                338   2e-114   
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 346   2e-114   
gb|AAG43363.1|AF151368_1  catalase                                      346   2e-114   Hevea brasiliensis [Para rubber tree]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 346   2e-114   
gb|AGQ21569.2|  catalase                                                338   2e-114   
gb|ABK24453.1|  unknown                                                 344   7e-114   Picea sitchensis
dbj|BAH37035.1|  catalase 1                                             344   1e-113   Pisum sativum [garden pea]
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             344   1e-113   
ref|NP_001240021.1|  catalase                                           343   2e-113   
ref|NP_001237571.1|  catalase-4                                         343   2e-113   
gb|AFD29285.1|  catalase                                                343   3e-113   
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          343   3e-113   Vigna radiata var. radiata [golden gram]
gb|ADZ45555.1|  catalase                                                343   4e-113   
gb|ADZ45556.1|  catalase                                                343   4e-113   
gb|AGE15298.2|  catalase 1                                              342   7e-113   
gb|AGC65520.1|  catalase                                                342   1e-112   
gb|ACJ71243.1|  catalase 2                                              332   1e-112   Vigna unguiculata
emb|CDY40645.1|  BnaA03g53180D                                          341   1e-112   
gb|ACL35349.1|  catalase                                                341   1e-112   Picea glauca
gb|ACB11496.1|  catalase                                                341   1e-112   Pinus sylvestris [Scotch pine]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 340   3e-112   
gb|ACJ71245.1|  catalase 2                                              337   4e-112   Vigna unguiculata
gb|ACJ71244.1|  catalase 2                                              337   4e-112   Vigna unguiculata
gb|AAF79625.1|AC027665_26  F5M15.5                                      353   7e-112   Arabidopsis thaliana [mouse-ear cress]
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            339   7e-112   Pisum sativum [garden pea]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             339   7e-112   
gb|ABM47415.1|  catalase                                                339   8e-112   Prunus avium [gean]
emb|CAB56850.1|  catalase                                               336   2e-111   Prunus persica
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 338   3e-111   
dbj|BAC79443.1|  catalase                                               338   3e-111   Acacia ampliceps
gb|AIR77003.1|  catalase                                                331   3e-111   
gb|AIX10947.1|  putative catalase                                       338   3e-111   
ref|NP_001268098.1|  catalase                                           337   4e-111   
emb|CDY29518.1|  BnaA06g14520D                                          337   7e-111   
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 335   7e-111   
ref|XP_002890395.1|  F5M15.5                                            350   7e-111   
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 335   1e-110   
gb|AIU99481.1|  catalase                                                336   1e-110   
ref|XP_009149540.1|  PREDICTED: catalase-1                              336   1e-110   
emb|CAP74531.1|  putative Td650 protein                                 328   1e-110   Triticum turgidum subsp. durum
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 336   2e-110   
gb|AIM43584.1|  catalase                                                336   2e-110   
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             336   2e-110   
emb|CAD42909.1|  catalase                                               336   2e-110   Prunus persica
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          335   2e-110   Sorghum bicolor [broomcorn]
gb|AIU99488.1|  catalase                                                335   2e-110   
gb|AIU99484.1|  catalase                                                335   2e-110   
emb|CDY31490.1|  BnaC05g15990D                                          335   3e-110   
gb|AIU99480.1|  catalase                                                335   5e-110   
ref|XP_002510677.1|  catalase, putative                                 347   5e-110   Ricinus communis
ref|NP_001241808.1|  catalase isozyme B                                 334   9e-110   
gb|AIU99486.1|  catalase                                                334   1e-109   
gb|AIU99482.1|  catalase                                                334   1e-109   
gb|AIU99479.1|  catalase                                                334   1e-109   
gb|AIU99487.1|  catalase                                                334   1e-109   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      333   2e-109   
gb|AIU99483.1|  catalase                                                333   2e-109   
gb|AGV54297.1|  peroxisomal catalase                                    333   2e-109   
gb|ACJ76836.3|  catalase                                                333   2e-109   Dimocarpus longan [longan]
gb|AEQ30070.1|  catalase                                                333   2e-109   
gb|AHF21552.1|  catalase                                                333   2e-109   
tpg|DAA43177.1|  TPA: catalase2                                         333   2e-109   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      333   2e-109   
gb|AIU99485.1|  catalase                                                333   3e-109   
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               333   3e-109   Zea mays [maize]
ref|XP_001784759.1|  predicted protein                                  332   3e-109   
ref|NP_001105415.1|  catalase isozyme 1                                 332   3e-109   Zea mays [maize]
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      333   3e-109   
emb|CAA42720.1|  catalase-1                                             332   4e-109   Zea mays [maize]
tpg|DAA43178.1|  TPA: catalase2                                         333   5e-109   
gb|ABV55108.1|  catalase 2                                              332   8e-109   Musa acuminata [banana]
ref|NP_001058635.1|  Os06g0727200                                       330   2e-108   Oryza sativa Japonica Group [Japonica rice]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    330   2e-108   Oryza sativa Indica Group [Indian rice]
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      330   3e-108   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      330   3e-108   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 331   5e-108   
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               330   5e-108   Hordeum vulgare [barley]
emb|CDP07288.1|  unnamed protein product                                329   8e-108   
gb|AAD50974.1|AF170272_1  catalase CAT1                                 329   8e-108   Manihot esculenta [manioc]
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               329   8e-108   Ricinus communis
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      328   1e-107   
ref|XP_001752315.1|  predicted protein                                  328   1e-107   
gb|ABB51561.1|  truncated catalase 2                                    326   1e-107   Avicennia marina
gb|AAG61140.2|AF332973_1  catalase 2                                    328   1e-107   Zantedeschia aethiopica [arum-lily]
gb|ADU56198.1|  catalase                                                328   2e-107   
emb|CDX72514.1|  BnaC07g45360D                                          327   2e-107   
gb|AII23739.1|  catalase                                                327   3e-107   
ref|XP_005645077.1|  catalase                                           327   3e-107   
dbj|BAA05494.1|  catalase                                               327   3e-107   Oryza sativa Japonica Group [Japonica rice]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          327   4e-107   Avicennia marina
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 327   4e-107   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         327   5e-107   Triticum aestivum [Canadian hard winter wheat]
gb|AAN78323.1|  catalase1                                               316   6e-107   Prunus armeniaca
dbj|BAA34204.1|  catalase                                               327   7e-107   Oryza sativa Japonica Group [Japonica rice]
emb|CDX76313.1|  BnaA08g10870D                                          326   8e-107   
emb|CDY17510.1|  BnaC03g65530D                                          325   1e-106   
gb|AAC17729.1|  catalase 1                                              323   1e-106   
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               326   1e-106   
gb|ADN94253.1|  catalase                                                326   1e-106   
prf||1803522A  catalase                                                 326   1e-106
gb|AAY59707.1|  catalase                                                325   4e-106   
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 325   4e-106   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 323   8e-106   
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     321   8e-106   
ref|NP_001105310.1|  catalase isozyme 2                                 324   8e-106   
gb|AAF61734.1|AF243519_1  catalase 4                                    324   9e-106   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             324   9e-106   
gb|EMS61345.1|  Catalase isozyme 1                                      327   2e-105   
gb|ACY30463.1|  catalase                                                318   2e-105   
gb|AFR53082.1|  CAT                                                     323   2e-105   
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      322   5e-105   
gb|AAF61733.1|AF243518_1  catalase 3                                    322   5e-105   
emb|CAB16750.1|  catalase                                               314   5e-105   
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          321   1e-104   
emb|CAE82295.1|  catalase                                               321   1e-104   
gb|AGT15888.1|  catalase                                                321   1e-104   
gb|AGT16310.1|  catalase                                                321   1e-104   
gb|AGT16054.1|  catalase                                                321   1e-104   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             320   2e-104   
gb|AGT16203.1|  catalase                                                320   2e-104   
gb|AGT16188.1|  catalase                                                320   2e-104   
gb|EMS51034.1|  Catalase isozyme 2                                      321   2e-104   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      320   2e-104   
gb|ADY02963.1|  catalase                                                320   2e-104   
dbj|BAJ92414.1|  predicted protein                                      320   2e-104   
gb|ACJ22771.1|  catalase 1                                              320   2e-104   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               320   2e-104   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    320   2e-104   
emb|CDX69111.1|  BnaC01g03420D                                          320   2e-104   
gb|ADB03784.1|  catalase                                                319   7e-104   
gb|ABY74514.1|  catalase                                                309   9e-104   
gb|ABF93811.1|  Catalase-1, putative, expressed                         314   2e-103   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             315   2e-103   
gb|ADQ28492.1|  catalase                                                318   2e-103   
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                317   3e-103   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          316   5e-103   
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             317   5e-103   
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          317   6e-103   
gb|EMT06167.1|  Catalase isozyme 2                                      322   8e-103   
emb|CAH61266.1|  catalase                                               316   9e-103   
gb|AHZ13843.1|  catalase                                                316   1e-102   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           315   2e-102
gb|ABN71233.2|  catalase                                                315   2e-102   
ref|NP_001045673.1|  Os02g0115700                                       315   2e-102   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   318   3e-102   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          315   3e-102   
gb|AAC19398.1|  root catalase                                           315   3e-102   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          315   4e-102   
gb|AHF27432.1|  catalase                                                313   4e-102   
gb|AAB70006.1|  catalase                                                314   6e-102   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      314   6e-102   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      313   9e-102   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      313   9e-102   
ref|XP_001696763.1|  catalase/peroxidase                                313   1e-101   
gb|AJF34884.1|  catalase                                                313   1e-101   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    313   1e-101   
gb|ADM96039.1|  catalase                                                313   1e-101   
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 313   1e-101   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 313   1e-101   
gb|AHF27429.1|  catalase                                                311   2e-101   
emb|CAA43814.1|  catalase                                               312   2e-101   
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      311   9e-101   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          311   1e-100
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               310   1e-100   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          310   2e-100   
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               310   2e-100   
gb|AHF27430.1|  catalase                                                310   2e-100   
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 310   2e-100   
gb|AAR97905.1|  catalase                                                309   4e-100   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               309   4e-100   
emb|CAA85470.1|  catalase                                               309   5e-100   
gb|AAC48918.1|  salicylic acid binding catalase                         308   7e-100   
emb|CAA73663.1|  catalase                                               308   7e-100   
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      308   7e-100   
gb|AFW66787.1|  catalase3                                               308   7e-100   
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      308   7e-100   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               308   8e-100   
gb|AAC17730.1|  catalase 2                                              305   9e-100   
gb|AFW66788.1|  catalase3                                               308   1e-99    
ref|XP_010692544.1|  PREDICTED: catalase-like                           307   2e-99    
gb|ABC01913.1|  catalase isozyme 1-like protein                         307   2e-99    
ref|XP_002950455.1|  catalase                                           308   2e-99    
ref|NP_001234827.1|  catalase isozyme 1                                 307   2e-99    
ref|NP_001274863.1|  catalase isozyme 1                                 307   2e-99    
dbj|BAF91369.1|  catalase                                               307   2e-99    
gb|AHF27433.1|  catalase                                                307   2e-99    
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    307   3e-99    
gb|ABB72796.1|  catalase isozyme 1-like protein                         307   3e-99    
gb|KDD77132.1|  catalase                                                307   3e-99    
gb|AFW66785.1|  catalase3 isoform 1                                     310   4e-98    
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         304   4e-98    
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             300   1e-97    
gb|ADR01107.1|  catalase 3                                              299   1e-97    
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               303   2e-97    
ref|NP_973873.1|  catalase 3                                            300   3e-97    
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             301   4e-97    
dbj|BAH20307.1|  AT1G20620                                              300   6e-97    
ref|NP_564120.1|  catalase 3                                            300   1e-96    
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         300   1e-96    
emb|CDY29519.1|  BnaA06g14510D                                          300   1e-96    
ref|XP_009110221.1|  PREDICTED: catalase-3                              300   1e-96    
emb|CDY33636.1|  BnaC08g19360D                                          300   1e-96    
ref|NP_001031073.1|  catalase 3                                         300   1e-96    
dbj|BAH56915.1|  AT1G20620                                              300   1e-96    
emb|CDY31878.1|  BnaC07g15280D                                          300   1e-96    
emb|CDY31488.1|  BnaC05g15970D                                          300   2e-96    
gb|AAT68776.1|  catalase                                                292   2e-96    
gb|AAD30291.2|AF139538_1  catalase 2                                    300   2e-96    
gb|AAD30292.1|AF139539_1  catalase 3                                    300   3e-96    
ref|XP_009149539.1|  PREDICTED: catalase-3                              301   3e-96    
gb|AAM65021.1|  unknown                                                 299   5e-96    
emb|CDY01364.1|  BnaA07g11370D                                          300   6e-96    
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               298   8e-96    
ref|XP_010498496.1|  PREDICTED: catalase-3                              297   2e-95    
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    297   3e-95    
gb|ACU82385.1|  catalase 1                                              285   4e-95    
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     295   2e-94    
gb|KHG21219.1|  Catalase isozyme 1                                      293   2e-94    
gb|AAC49807.1|  catalase 3                                              294   3e-94    
gb|ADF32069.1|  catalase 2                                              281   6e-94    
gb|ABB88582.1|  catalase                                                293   7e-94    
gb|ABK24449.1|  unknown                                                 293   1e-93    
gb|ABR16304.1|  unknown                                                 290   4e-93    
gb|ABK41476.1|  catalase                                                291   5e-93    
gb|ABK24543.1|  unknown                                                 291   5e-93    
gb|KFM23952.1|  Catalase isozyme 2                                      291   7e-93    
ref|XP_010105996.1|  Catalase isozyme 1                                 285   2e-92    
gb|ACN96904.1|  catalase 2                                              284   6e-92    
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              287   1e-91    
gb|ACL81498.1|  catalase                                                286   4e-91    
gb|KHG11966.1|  Catalase isozyme 2                                      278   2e-90    
ref|NP_001105416.1|  catalase isozyme 3                                 283   8e-90    
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        281   4e-89    
gb|AFU90823.1|  catalase                                                278   1e-88    
gb|AAA57551.1|  catalase                                                275   4e-88    
gb|AAP80622.1|AF475100_1  catalase isozyme                              268   9e-87    
ref|XP_001779509.1|  predicted protein                                  273   6e-86    
gb|AGG36403.1|  catalase                                                261   2e-85    
gb|AEA86312.1|  catalase isozyme                                        259   7e-85    
gb|AGG36409.1|  catalase                                                259   1e-84    
emb|CDY52649.1|  BnaAnng11640D                                          266   1e-83    
gb|AAL04437.1|  catalase                                                253   3e-83    
emb|CBA13361.1|  catalase                                               251   3e-82    
ref|XP_005708279.1|  catalase                                           263   5e-82    
emb|CBA13353.1|  catalase                                               249   1e-81    
ref|NP_001031072.3|  catalase 3                                         256   9e-81    
ref|XP_005536240.1|  catalase                                           256   1e-79    
gb|AHF27428.1|  catalase                                                248   6e-78    
gb|KHG11967.1|  Catalase isozyme 2                                      242   8e-78    
gb|ABN79860.2|  catalase                                                241   2e-76    
ref|WP_026798902.1|  catalase                                           245   1e-74    
gb|AFW69584.1|  catalase1                                               239   2e-74    
ref|WP_013486643.1|  catalase                                           241   1e-73    
gb|AFC35180.1|  catalase dismutase                                      230   2e-73    
ref|WP_012927443.1|  catalase                                           241   3e-73    
ref|WP_002638677.1|  catalase                                           239   8e-73    
ref|WP_028402967.1|  catalase                                           238   1e-72    
ref|WP_017728456.1|  catalase                                           239   3e-72    
ref|WP_014695718.1|  catalase                                           238   3e-72    
ref|WP_018932888.1|  catalase                                           237   8e-72    
ref|WP_035405433.1|  catalase                                           236   9e-72    
gb|KCW44990.1|  hypothetical protein EUGRSUZ_L01419                     233   1e-71    
gb|AHJ96357.1|  catalase X                                              237   1e-71    
ref|WP_026700615.1|  catalase                                           236   1e-71    
gb|ADI58890.1|  catalase                                                225   2e-71    
ref|WP_014459443.1|  catalase                                           237   2e-71    
ref|WP_040005560.1|  catalase                                           236   2e-71    
ref|XP_005712277.1|  unnamed protein product                            235   2e-71    
ref|WP_034343189.1|  catalase                                           236   2e-71    
emb|CEI82287.1|  Catalase                                               236   2e-71    
ref|WP_040375904.1|  catalase                                           236   3e-71    
dbj|GAF66948.1|  catalase                                               236   3e-71    
ref|WP_036198876.1|  catalase                                           236   4e-71    
emb|CCH52322.1|  Catalase                                               236   4e-71    
ref|WP_002617638.1|  catalase                                           235   4e-71    
ref|WP_026589248.1|  catalase                                           235   5e-71    
ref|WP_013083797.1|  catalase                                           236   6e-71    
ref|WP_034650802.1|  catalase                                           236   6e-71    
ref|WP_016764713.1|  catalase                                           236   6e-71    
ref|WP_026680321.1|  catalase                                           235   6e-71    
ref|WP_028412779.1|  catalase                                           236   7e-71    
ref|WP_029714611.1|  catalase                                           235   7e-71    
ref|WP_027955028.1|  catalase                                           235   7e-71    
ref|WP_033580618.1|  catalase                                           235   8e-71    
ref|WP_034270127.1|  catalase                                           235   8e-71    
emb|CDQ37122.1|  Catalase                                               234   9e-71    
ref|WP_013057708.1|  MULTISPECIES: catalase                             235   1e-70    
ref|WP_025751188.1|  catalase                                           235   1e-70    
ref|WP_026021329.1|  catalase                                           234   1e-70    
ref|WP_028409154.1|  catalase                                           235   1e-70    
emb|CDO03907.1|  Catalase                                               234   1e-70    
ref|WP_036576981.1|  catalase                                           234   1e-70    
ref|WP_036171055.1|  catalase                                           234   1e-70    
ref|WP_027481021.1|  catalase                                           234   1e-70    
ref|WP_008359888.1|  catalase                                           233   2e-70    
ref|WP_040954130.1|  catalase                                           234   2e-70    
ref|WP_038245842.1|  catalase                                           234   2e-70    
ref|WP_024719958.1|  catalase                                           233   2e-70    
dbj|GAK43239.1|  catalase                                               233   2e-70    
ref|WP_019379032.1|  catalase                                           234   2e-70    
ref|WP_012009409.1|  catalase                                           233   2e-70    
ref|WP_007497088.1|  catalase                                           233   2e-70    
ref|WP_021288860.1|  catalase                                           234   2e-70    
ref|WP_019986857.1|  catalase                                           234   2e-70    
gb|AHI58962.1|  catalase KatX2                                          233   2e-70    
ref|WP_035703421.1|  catalase                                           233   2e-70    
ref|WP_041091807.1|  catalase                                           233   2e-70    
ref|WP_008482116.1|  catalase                                           233   2e-70    
ref|WP_014396337.1|  catalase                                           233   2e-70    
ref|WP_039169268.1|  catalase                                           232   2e-70    
ref|WP_003211348.1|  catalase                                           232   2e-70    
ref|WP_008348997.1|  MULTISPECIES: catalase                             232   2e-70    
ref|WP_010529183.1|  catalase                                           233   3e-70    
ref|WP_017795504.1|  catalase                                           233   4e-70    
ref|WP_016886307.1|  catalase                                           233   4e-70    
ref|WP_003186342.1|  MULTISPECIES: catalase                             233   4e-70    
gb|EWH21912.1|  catalase                                                232   4e-70    



>gb|AHG98056.1| catalase, partial [Plectranthus barbatus]
Length=299

 Score =   368 bits (944),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  54   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  113

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+G+PQDYRHMEGSGVNTYT
Sbjct  114  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDLGVPQDYRHMEGSGVNTYT  173

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK HYVKFHWKPTCGVK LLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  174  LINKAGKVHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  232



>gb|AFC35182.1| catalase dismutase, partial [Populus x canadensis]
Length=284

 Score =   364 bits (935),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  4    APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  63

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FL DDIG+PQDYRHMEGSGVNTYT
Sbjct  64   PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLLDDIGVPQDYRHMEGSGVNTYT  123

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK++YVKFHWKPTCGVKSLLEDEAIKVGG+NHSHATQDLYDSI AGNYPEWKLF
Sbjct  124  LINKAGKAYYVKFHWKPTCGVKSLLEDEAIKVGGSNHSHATQDLYDSIKAGNYPEWKLF  182



>emb|CDW92180.1| putative catalase, partial [Xylia xylocarpa var. kerrii]
Length=287

 Score =   363 bits (933),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  14   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  73

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR++DFFSHHPESLHMFTFLFDD+G+PQDYRHMEGSGVNTYT
Sbjct  74   PDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMFTFLFDDVGVPQDYRHMEGSGVNTYT  133

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWKPTCGVK LLEDEAIKVGG+NHSHATQDLYDSIAAGNYPEWKL+
Sbjct  134  LINKAGKAQYVKFHWKPTCGVKCLLEDEAIKVGGSNHSHATQDLYDSIAAGNYPEWKLY  192



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   371 bits (952),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+ILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+G+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDLGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>emb|CDW92181.1| putative catalase, partial [Xylia xylocarpa var. kerrii]
Length=278

 Score =   363 bits (932),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  14   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  73

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+G+PQDYRHMEGSGVNTYT
Sbjct  74   PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDLGVPQDYRHMEGSGVNTYT  133

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLE+EAI+VGG+NHSHATQDLYDSIAAG+YPEWKL+
Sbjct  134  LINKAGKAHYVKFHWKPTCGVKCLLEEEAIRVGGSNHSHATQDLYDSIAAGSYPEWKLY  192



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   370 bits (951),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+ILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+G+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDLGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   370 bits (949),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+G+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDLGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AAX88799.1| catalase [Euphorbia characias]
Length=493

 Score =   369 bits (948),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDDIG+PQDYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGVPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE+EAIK+GGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEEAIKIGGANHSHATQDLYDSIAAGNYPEWKLF  270



>emb|CAJ00337.1| putative catalase [Andrographis paniculata]
Length=285

 Score =   362 bits (928),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDG+KF
Sbjct  12   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGIKF  71

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDDIGIPQDYRHM+GSGVNTYT
Sbjct  72   PDMVHSLKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGIPQDYRHMDGSGVNTYT  131

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN AGK HYVKFHW+PTCGVKSLLE+EAI+VGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  132  LINTAGKVHYVKFHWRPTCGVKSLLEEEAIRVGGANHSHATQDLYDSIAAGNYPEWKLF  190



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   369 bits (946),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDDIG+PQDYRHM+GSGV+TYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGVPQDYRHMDGSGVHTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGKSHYVKFHWKPTCGVKSLLEDEAI+VGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIRVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   369 bits (946),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDDIG+PQDYRHM+GSGV+TYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGVPQDYRHMDGSGVHTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGKSHYVKFHWKPTCGVKSLLEDEAI+VGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIRVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   368 bits (945),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR++DFFSHHPESLHMFTFLFDD+G+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMFTFLFDDLGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   368 bits (945),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR++DFFSHHPESL+MFTFLFDDIG+PQDYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRIMDFFSHHPESLNMFTFLFDDIGVPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AII80275.1| catalase, partial [Hibiscus cannabinus]
Length=310

 Score =   361 bits (927),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF
Sbjct  30   APGVQTPLIIRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  89

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR++DFFSHHPESLHMFTFLFDDIGIPQDYRHM+GSGV+TYT
Sbjct  90   PDMVHALKPNPKSHIQENWRIMDFFSHHPESLHMFTFLFDDIGIPQDYRHMDGSGVHTYT  149

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWKPTCGVK+LLEDEA++VGGANHSHATQDLYDSIAAG+YPEWKLF
Sbjct  150  LINKAGKATYVKFHWKPTCGVKNLLEDEAVRVGGANHSHATQDLYDSIAAGSYPEWKLF  208



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   367 bits (942),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+G+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLEDEAIKVGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   367 bits (942),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+G+PQDYRHMEG+GVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGVPQDYRHMEGAGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   367 bits (942),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQENWRV+DFFSHHPESLHMFTFLFDDIG+P +YRHMEGSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHIQENWRVMDFFSHHPESLHMFTFLFDDIGVPANYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK HYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKVHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>emb|CDP01802.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   366 bits (939),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  62   TPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  121

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQENWR++DFFSHHPESLHMFTFLFDDIG+PQDYRHM+GSGVNTYT
Sbjct  122  PDMVHSLKPNPKSHIQENWRIVDFFSHHPESLHMFTFLFDDIGVPQDYRHMDGSGVNTYT  181

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE+EAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  182  LINKAGKAHYVKFHWKPTCGVKSLLEEEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  240



>gb|AAO12509.1| catalase [Morus alba]
Length=195

 Score =   356 bits (913),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 175/176 (99%), Gaps = 0/176 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDG+KF
Sbjct  20   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGIKF  79

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQE WR+LDFFSHHPESLHMFTFLFDDIG+PQDYRHM+GSGVNTYT
Sbjct  80   PDMVHALKPNPKSHIQEFWRILDFFSHHPESLHMFTFLFDDIGVPQDYRHMDGSGVNTYT  139

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEW  10
            LI+KAGK+HYVKFHWKPTCGVKSLLEDEAI+VGGANHSHATQDLYDSIAAGNYPEW
Sbjct  140  LIDKAGKAHYVKFHWKPTCGVKSLLEDEAIRVGGANHSHATQDLYDSIAAGNYPEW  195



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   367 bits (941),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQENWRV+DFFSHHPESLHMFTFLFDDIG+P +YRHMEGSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHIQENWRVMDFFSHHPESLHMFTFLFDDIGVPANYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK HYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKVHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AAL38024.1|AF443179_1 catalase [Nicotiana tabacum]
Length=227

 Score =   357 bits (915),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  36   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  95

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSH PESLHMFTFLFDDIGIPQDYRHM+GSGV+T+T
Sbjct  96   PDMVHALKPNPKSHIQENWRVLDFFSHVPESLHMFTFLFDDIGIPQDYRHMDGSGVHTFT  155

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGKS YVKFHWKPTCGVKSLLE+EA ++GGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  156  LINKAGKSTYVKFHWKPTCGVKSLLEEEAARIGGANHSHATQDLYDSIAAGNYPEWKLF  214



>ref|XP_006382987.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382988.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382989.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60784.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60785.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60786.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=434

 Score =   364 bits (934),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FL DDIG+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLLDDIGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK++YVKFHWKPTCGVKSLLEDEAIKVGG+NHSHATQDLYDSI AGNYPEWKLF
Sbjct  212  LINKAGKAYYVKFHWKPTCGVKSLLEDEAIKVGGSNHSHATQDLYDSIKAGNYPEWKLF  270



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   366 bits (939),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+ILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR++DFFSHHPESLHMF+FLFDD+GIPQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMFSFLFDDVGIPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLE+EAI+VGG+NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEEEAIRVGGSNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_006382990.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382991.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60787.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60788.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=455

 Score =   365 bits (936),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FL DDIG+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLLDDIGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK++YVKFHWKPTCGVKSLLEDEAIKVGG+NHSHATQDLYDSI AGNYPEWKLF
Sbjct  212  LINKAGKAYYVKFHWKPTCGVKSLLEDEAIKVGGSNHSHATQDLYDSIKAGNYPEWKLF  270



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   366 bits (939),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   TPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQENWR++DFFSHHPESLHMFTFLFDDIG+PQDYRHM+GSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHIQENWRIVDFFSHHPESLHMFTFLFDDIGVPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE+EAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   365 bits (938),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQE+WR+LDFFSHHPESLHMF+FLFDDIGIPQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQEDWRILDFFSHHPESLHMFSFLFDDIGIPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+NKAGK HYVKFHWKPTCGVKSLLEDEAIKVGG+NHSHAT+DLYDSIAAGNYPEWKLF
Sbjct  212  LVNKAGKVHYVKFHWKPTCGVKSLLEDEAIKVGGSNHSHATKDLYDSIAAGNYPEWKLF  270



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   365 bits (938),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+NK GK HYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LVNKVGKVHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   365 bits (937),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+G+PQDYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGVPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLE+EAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEEEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   365 bits (937),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR++DFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK HYVKFHWKPTCGVK+LLE+EAI+VGG+NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKVHYVKFHWKPTCGVKNLLEEEAIRVGGSNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   365 bits (937),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+G+PQDYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGVPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLE+EAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEEEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   365 bits (937),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  90   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  149

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FL DDIG+PQDYRHMEGSGVNTYT
Sbjct  150  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLLDDIGVPQDYRHMEGSGVNTYT  209

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK++YVKFHWKPTCGVKSLLEDEAIKVGG+NHSHATQDLYDSI AGNYPEWKLF
Sbjct  210  LINKAGKAYYVKFHWKPTCGVKSLLEDEAIKVGGSNHSHATQDLYDSIKAGNYPEWKLF  268



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   365 bits (937),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+G+PQDYRHMEG+GVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGVPQDYRHMEGAGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK++YVKFHWKPTCGVK LLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKANYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   365 bits (937),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+NKAGK+ YVKFHWKPTCGVKSLLEDEAI+VGG+NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LVNKAGKAVYVKFHWKPTCGVKSLLEDEAIRVGGSNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   365 bits (936),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+G+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDLGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWKPTCGVK LLE+EAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAQYVKFHWKPTCGVKCLLEEEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>gb|KCW70315.1| hypothetical protein EUGRSUZ_F03557 [Eucalyptus grandis]
Length=479

 Score =   364 bits (935),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR++DFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK HYVKFHWKPTCGVK+LLE+EAI+VGG+NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKVHYVKFHWKPTCGVKNLLEEEAIRVGGSNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   365 bits (936),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FL DDIG+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLLDDIGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK++YVKFHWKPTCGVKSLLEDEAIKVGG+NHSHATQDLYDSI AGNYPEWKLF
Sbjct  212  LINKAGKAYYVKFHWKPTCGVKSLLEDEAIKVGGSNHSHATQDLYDSIKAGNYPEWKLF  270



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   364 bits (934),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  91   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  150

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+G+PQDYRHMEGSGVNTY 
Sbjct  151  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGVPQDYRHMEGSGVNTYM  210

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLEDEA+KVGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  211  LINKAGKAHYVKFHWKPTCGVKCLLEDEAVKVGGTNHSHATQDLYDSIAAGNYPEWKLF  269



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   363 bits (932),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  75   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  134

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDDIGIPQDYRHM+GSGV+T+T
Sbjct  135  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGIPQDYRHMDGSGVHTFT  194

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+AGKS YVKFHWKPTCGVKSLLE+EAI+VGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  195  LINRAGKSTYVKFHWKPTCGVKSLLEEEAIRVGGANHSHATQDLYDSIAAGNYPEWKLF  253



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   364 bits (934),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFS VIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSIVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKP+PKSHIQENWR+LDFFSHHPESLHMFTFL DDIG+PQDYRHMEGSGVNTY+
Sbjct  152  PDMVHALKPSPKSHIQENWRILDFFSHHPESLHMFTFLLDDIGVPQDYRHMEGSGVNTYS  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE+EAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   364 bits (934),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+G+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDLGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWKPTCGVK LLEDEAIKVGGANHSHAT+DLYDSI+AGNYPEWKLF
Sbjct  212  LINKAGKAQYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATKDLYDSISAGNYPEWKLF  270



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   364 bits (934),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHM+GSGV+T+T
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMDGSGVHTFT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+AGKS YVKFHWKPTCGVKSLLE+EAI+VGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINRAGKSTYVKFHWKPTCGVKSLLEEEAIRVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   365 bits (936),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FL DDIG+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLLDDIGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK++YVKFHWKPTCGVKSLLEDEAIKVGG+NHSHATQDLYDSI AGNYPEWKLF
Sbjct  212  LINKAGKAYYVKFHWKPTCGVKSLLEDEAIKVGGSNHSHATQDLYDSIKAGNYPEWKLF  270



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   363 bits (933),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MFTFLFDDIGIPQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMFTFLFDDIGIPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   363 bits (933),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+G+PQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGVPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLED+AIKVGGANHSHAT+DLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEDDAIKVGGANHSHATKDLYDSIAAGNYPEWKLF  270



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   363 bits (931),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  84   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  143

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHM+GSGV+T+T
Sbjct  144  PDMVHSLKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMDGSGVHTFT  203

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGKS YVKFHW+PTCGVKSLLE+EAI+VGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  204  LINKAGKSTYVKFHWRPTCGVKSLLEEEAIRVGGANHSHATQDLYDSIAAGNYPEWKLF  262



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   363 bits (932),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGIPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LL+DEA+KVGG NHSHATQDLYDSIAAGNYP+WKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLDDEAVKVGGTNHSHATQDLYDSIAAGNYPKWKLF  270



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   363 bits (932),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNP+SHIQENWR+LDFFSHHPESLHMFTFLFDD+G+PQDYRHM+GSGVNTY+
Sbjct  152  PDMVHALKPNPRSHIQENWRILDFFSHHPESLHMFTFLFDDLGVPQDYRHMDGSGVNTYS  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHW+PTCGVK LLEDEAIKVGGANHSHATQDLYDSIAAGN+PEWKLF
Sbjct  212  LINKAGKAHYVKFHWRPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIAAGNFPEWKLF  270



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   363 bits (932),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+G+PQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGVPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLE+EAIKVGGANHSHAT+DLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEEEAIKVGGANHSHATKDLYDSIAAGNYPEWKLF  270



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQE+WR+LDFFSHHPESL+MFTFL DDIGIPQDYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQESWRILDFFSHHPESLNMFTFLLDDIGIPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLED+AI+VGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEDDAIRVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHE GSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHELGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDDIG+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDIGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK++YVKFHWKPTCGVKSLLEDEAIKVGG+NHSHATQDLYDSI AGNYPEWKLF
Sbjct  212  LINKAGKAYYVKFHWKPTCGVKSLLEDEAIKVGGSNHSHATQDLYDSIRAGNYPEWKLF  270



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFL DD+G+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLLDDLGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+K GK+HYVKFHWKPTCGVK LLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LISKXGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDDIGIPQDYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGIPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWK TCGVKSLLE++AI+VGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKARYVKFHWKATCGVKSLLEEDAIRVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDG+KF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGIKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQE WR+LDFFSHHPESLHMFTFLFDDIG+PQDYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQEFWRILDFFSHHPESLHMFTFLFDDIGVPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK+HYVKFHWKPTCGVKSLLEDEA++VGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LIDKAGKAHYVKFHWKPTCGVKSLLEDEAVRVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   363 bits (932),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHE GSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  111  APGVQTPVIVRFSTVIHELGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  170

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDDIG+PQDYRHMEGSGVNTYT
Sbjct  171  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDIGVPQDYRHMEGSGVNTYT  230

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK++YVKFHWKPTCGVKSLLEDEAIKVGG+NHSHATQDLYDSI AGNYPEWKLF
Sbjct  231  LINKAGKAYYVKFHWKPTCGVKSLLEDEAIKVGGSNHSHATQDLYDSIRAGNYPEWKLF  289



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR++DFFSHHPESLHMFTFLFDD+G+PQDYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRIMDFFSHHPESLHMFTFLFDDLGVPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK GK+HYVKFHWKPTCGVK LLE+EAIKVGG+NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKDGKAHYVKFHWKPTCGVKCLLEEEAIKVGGSNHSHATQDLYDSIAAGNYPEWKLF  270



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   362 bits (930),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYV  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   362 bits (929),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGV+TP+I+RFSTVIHE GSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  76   APGVKTPVIVRFSTVIHELGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  135

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDDIG+PQDYRHMEGSGVNTYT
Sbjct  136  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDIGVPQDYRHMEGSGVNTYT  195

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK++YVKFHWKPTCGVKSLLEDEAIKVGG+NHSHATQDLYDSI AGNYPEWKLF
Sbjct  196  LINKAGKAYYVKFHWKPTCGVKSLLEDEAIKVGGSNHSHATQDLYDSIRAGNYPEWKLF  254



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   362 bits (930),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  91   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  150

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MFTFLFDDIGIPQDYRHMEGSGVNTY 
Sbjct  151  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMFTFLFDDIGIPQDYRHMEGSGVNTYM  210

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK+GK+HYVKFHWKPTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  211  LINKSGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  269



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   362 bits (930),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MFTFLFDDIGIPQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMFTFLFDDIGIPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK+GK+HYVKFHWKPTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKSGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   362 bits (930),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MFTFLFDDIGIPQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMFTFLFDDIGIPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK+GK+HYVKFHWKPTCGVKSLLE++A++VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKSGKAHYVKFHWKPTCGVKSLLEEDAVRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   362 bits (930),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MFTFLFDDIGIPQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMFTFLFDDIGIPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK+GK+HYVKFHWKPTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKSGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   362 bits (930),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   362 bits (930),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHW+PTCGVKSLLE++AI+VGG+NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWRPTCGVKSLLEEDAIRVGGSNHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   362 bits (930),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDD+G+PQDYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDLGVPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLE+EAI+VGG+NHSHATQDLYDSI AGNYPEWKL+
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEEEAIRVGGSNHSHATQDLYDSIGAGNYPEWKLY  270



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   362 bits (930),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MFTFLFDDIGIPQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMFTFLFDDIGIPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK+GK+HYVKFHWKPTCGVKSLLE++A++VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKSGKAHYVKFHWKPTCGVKSLLEEDAVRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   362 bits (928),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  76   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  135

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQE+WR++DFFSHHPESLHMF+FLFDD+G+PQDYRHMEGSGVNTY 
Sbjct  136  PDMVHALKPNPKSHIQESWRIVDFFSHHPESLHMFSFLFDDVGVPQDYRHMEGSGVNTYM  195

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKL+
Sbjct  196  LINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLY  254



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   362 bits (929),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+G+PQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGVPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLE+EAIKVGGANHSHAT+DLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEEEAIKVGGANHSHATKDLYDSIAAGNYPEWKLF  270



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   362 bits (929),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+G+PQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGVPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLEDEA+KVGG NHSHATQDLYDSIAAG YPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEDEAVKVGGTNHSHATQDLYDSIAAGTYPEWKLF  270



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   362 bits (929),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+G+PQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGVPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLEDEA+KVGG NHSHATQDLYDSIAAG YPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEDEAVKVGGTNHSHATQDLYDSIAAGTYPEWKLF  270



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   362 bits (929),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   362 bits (929),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            +PGVQTP+I+RFSTVIHERGSPET+RDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   SPGVQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQENWR++DFFSHHPESLHMFTFLFDDIGIP +YRHMEGSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHIQENWRIMDFFSHHPESLHMFTFLFDDIGIPANYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK++YVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIA+GNYPEWKLF
Sbjct  212  LINKAGKTYYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIASGNYPEWKLF  270



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   362 bits (929),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   362 bits (929),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQE+WR++DFFSHHPESLHMFTFL DDIG+PQDYRHM+GSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHIQEDWRIMDFFSHHPESLHMFTFLLDDIGVPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK++YVKFHWKPTCGVKSLLE+EAIK+GGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAYYVKFHWKPTCGVKSLLEEEAIKIGGANHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   363 bits (931),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDG+KF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGIKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQE WR+LDFFSHHPESLHMFTFLFDDIGIPQDYRHM+GSG+NTYT
Sbjct  152  PDMVHALKPNPKSHIQETWRILDFFSHHPESLHMFTFLFDDIGIPQDYRHMDGSGINTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK++YV FHWKPTCGVKSLLEDEAI+VGG+NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAYYVNFHWKPTCGVKSLLEDEAIRVGGSNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+G+PQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGVPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK++YVKFHWKPTCGVK LLEDEA+KVGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAYYVKFHWKPTCGVKCLLEDEAVKVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            +PGVQTP+I+RFSTVIHERGSPET+RDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   SPGVQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQENWR++DFFSHHPESLHMFTFLFDDIGIP +YRHMEGSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHIQENWRIMDFFSHHPESLHMFTFLFDDIGIPANYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+NKAGK++YVKFHWKPTCGVKSLLEDEAIK+GGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LVNKAGKAYYVKFHWKPTCGVKSLLEDEAIKIGGANHSHATQDLYDSIAAGNYPEWKLF  270



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   361 bits (927),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   361 bits (927),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHW+PTCGVKSLLE+EAI+VGG+NHSHATQDLYDSI AGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWRPTCGVKSLLEEEAIRVGGSNHSHATQDLYDSIMAGNYPEWKLF  270



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   362 bits (928),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHW+PTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWRPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   362 bits (928),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDG+KF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGIKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+G+PQDYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGVPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHW+PTCGVK+LLEDEAIKVGG+NHSHATQDLYDSIAAGNYPEWKL+
Sbjct  212  LINKAGKAHYVKFHWRPTCGVKNLLEDEAIKVGGSNHSHATQDLYDSIAAGNYPEWKLY  270



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   362 bits (928),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   GPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIG+PQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGVPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWKPTCGVKSLLE+EAI+VGG+NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAVYVKFHWKPTCGVKSLLEEEAIRVGGSNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQE WR+LDFFSHHPESLHMFTFLFDD+G+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQEPWRILDFFSHHPESLHMFTFLFDDLGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWKPTCGVK LLEDEAIKVGGANHSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINKAGKAQYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATKDLYDSIAAGNYPEWKLY  270



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MFTFLFDDIGIPQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMFTFLFDDIGIPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK+GK+HYVKFHWKPTCGVKSLLE++A++VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKSGKAHYVKFHWKPTCGVKSLLEEDAVRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR++DFFSHHPESLHMF+FLFDD+G+P+DYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMFSFLFDDVGVPRDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKL+
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLY  270



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFP FF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPXFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFL DD+G+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLLDDLGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK+HYVKFHWKPTCGVK LLEDEAIKVGGANHSHAT+DLYDSIAAGNYPEWKLF
Sbjct  212  LISKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATKDLYDSIAAGNYPEWKLF  270



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHER SPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERASPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+G+PQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGVPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLE+EAI+VGG+NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEEEAIRVGGSNHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPET+RDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDD+G+P DYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDVGVPTDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+K+GK HYVKFHWKPTCGVK LLE+EA+K+GGANHSHATQDLYDSIAAGNYPEWKL+
Sbjct  212  LISKSGKVHYVKFHWKPTCGVKCLLEEEAVKIGGANHSHATQDLYDSIAAGNYPEWKLY  270



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   361 bits (926),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQE WR+LDFFSHHPESLHMFTFLFDD+G+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQEPWRILDFFSHHPESLHMFTFLFDDLGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWKPTCGVK LLEDEAIKVGGANHSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINKAGKAQYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATKDLYDSIAAGNYPEWKLY  270



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   361 bits (926),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  85   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  144

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSH PESLHMFTFLFDDIGIPQDYRHM+GSGV+T+T
Sbjct  145  PDMVHALKPNPKSHIQENWRVLDFFSHVPESLHMFTFLFDDIGIPQDYRHMDGSGVHTFT  204

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGKS YVKFHWKPTCGVKSLLEDEA +VGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  205  LINKAGKSTYVKFHWKPTCGVKSLLEDEAARVGGANHSHATQDLYDSIAAGNYPEWKLF  263



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   361 bits (926),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVK YTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKSYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MFTFLFDDIGIPQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMFTFLFDDIGIPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHW+PTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWRPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSH PESLHMFTFLFDDIGIPQDYRHM+GSGV+T+T
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHVPESLHMFTFLFDDIGIPQDYRHMDGSGVHTFT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGKS YVKFHWKPTCGVKSLLEDEA +VGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKSTYVKFHWKPTCGVKSLLEDEAARVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDD+G+PQDYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDVGVPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK +YVKFHWKPTCGVK+LLE+EAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKVNYVKFHWKPTCGVKNLLEEEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   360 bits (925),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSH PESLHMFTFLFDDIGIPQDYRHM+GSGV+T+T
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHVPESLHMFTFLFDDIGIPQDYRHMDGSGVHTFT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGKS YVKFHWKPTCGVKSLLEDEA +VGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKSTYVKFHWKPTCGVKSLLEDEAARVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   360 bits (925),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  91   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  150

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSH PESLHMFTFLFDDIGIPQDYRHM+GSGV+T+T
Sbjct  151  PDMVHALKPNPKSHIQENWRVLDFFSHVPESLHMFTFLFDDIGIPQDYRHMDGSGVHTFT  210

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGKS YVKFHWKPTCGVKSLLEDEA +VGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  211  LINKAGKSTYVKFHWKPTCGVKSLLEDEAARVGGANHSHATQDLYDSIAAGNYPEWKLF  269



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   360 bits (925),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR++DFFSHHPESLHMF+FLFDD+G+P+DYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMFSFLFDDVGVPRDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLEDEAIKVGGANHSHATQDLYDSIA+GNYPEWKL+
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIASGNYPEWKLY  270



>prf||2104177A catalase
Length=492

 Score =   360 bits (925),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+R STVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRLSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQE+WR++DFFSHHPESLHMFTFL DDIG+PQDYRHM+GSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHIQEDWRIMDFFSHHPESLHMFTFLLDDIGVPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK++YVKFHWKPTCGVKSLLE+EAIK+GGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAYYVKFHWKPTCGVKSLLEEEAIKIGGANHSHATQDLYDSIAAGNYPEWKLF  270



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   360 bits (925),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+GIPQDYRHMEG GVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDVGIPQDYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK+ YVKFHWKP+CGVKSLLE+EAIKVGG+NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LIDKAGKASYVKFHWKPSCGVKSLLEEEAIKVGGSNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   360 bits (924),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+G+PQDYRHM+GSGV+TYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDVGVPQDYRHMDGSGVHTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHW+PTCGVK LL+DEAI+VGG+NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAQYVKFHWRPTCGVKCLLDDEAIRVGGSNHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AGI65617.1| catalase, partial [Fragaria x ananassa]
Length=467

 Score =   359 bits (922),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  85   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  144

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+GIPQDYRHMEGSGVNTYT
Sbjct  145  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDLGIPQDYRHMEGSGVNTYT  204

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+K GK++YVKFHWKPTCGVK LL++EAIKVGG+NHSHATQDLYDSIAAGNYPEWKL+
Sbjct  205  LISKTGKAYYVKFHWKPTCGVKCLLDEEAIKVGGSNHSHATQDLYDSIAAGNYPEWKLY  263



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   360 bits (924),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHW+PTCGVKSLLE++AI++GG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWRPTCGVKSLLEEDAIRIGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   360 bits (924),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE++AI VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEDAILVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   360 bits (924),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHW+PTCGVKSLLE++AI++GG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWRPTCGVKSLLEEDAIRIGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   360 bits (924),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQE WR+LDFFSHHPESLHMFTFLFDD+G+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQEPWRILDFFSHHPESLHMFTFLFDDLGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK  YVKFHWKPTCGVK LLEDEAIKVGGANHSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINKAGKVQYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATKDLYDSIAAGNYPEWKLY  270



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   360 bits (923),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_004300681.1| PREDICTED: catalase-like [Fragaria vesca subsp. vesca]
Length=492

 Score =   360 bits (923),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+GIPQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDLGIPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+K GK++YVKFHWKPTCGVK LL++EAIKVGG+NHSHATQDLYDSIAAGNYPEWKL+
Sbjct  212  LISKTGKAYYVKFHWKPTCGVKCLLDEEAIKVGGSNHSHATQDLYDSIAAGNYPEWKLY  270



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   360 bits (923),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+GIPQDYRHM+GSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDVGIPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LL+DEA+ VGGANHSHAT+DLYDSI AGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLDDEAVLVGGANHSHATKDLYDSIQAGNYPEWKLF  270



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  112  APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  171

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR++DFFSHHPESLHMF+FLFDD+G+P+DYRHMEGSGVNTY 
Sbjct  172  PDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMFSFLFDDVGVPRDYRHMEGSGVNTYM  231

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LLEDEAIKVGGANHSHATQDLYDSIA+GNYPEWKL+
Sbjct  232  LINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIASGNYPEWKLY  290



>ref|XP_010242895.1| PREDICTED: catalase isozyme 1-like isoform X2 [Nelumbo nucifera]
Length=433

 Score =   357 bits (917),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHMEGSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGIPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK GK+HYVKFHWKPTCGVK LL+DEA+ VGGANHSHAT+DLYDSI AGNYPEWKLF
Sbjct  212  LINKTGKAHYVKFHWKPTCGVKCLLDDEAVMVGGANHSHATKDLYDSIQAGNYPEWKLF  270



>prf||1906388A catalase
Length=492

 Score =   359 bits (921),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD+VHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTY 
Sbjct  152  PDIVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE++AI++GG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEDAIRLGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_009108682.1| PREDICTED: catalase-2-like isoform X1 [Brassica rapa]
Length=514

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MFTFLFDDIGIPQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMFTFLFDDIGIPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK+GK+HYVKFHWKPTCGVKSLLE++A++VGG NHSHATQDLYDSIAAGN PEWKLF
Sbjct  212  LINKSGKAHYVKFHWKPTCGVKSLLEEDAVRVGGTNHSHATQDLYDSIAAGNSPEWKLF  270



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   358 bits (919),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MFTFLFDDIGIPQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMFTFLFDDIGIPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK+GK+HYVKFHWKPTCGVKSLLE++A++VGG NHSHATQDLYDSIAAGN PEWKLF
Sbjct  212  LINKSGKAHYVKFHWKPTCGVKSLLEEDAVRVGGTNHSHATQDLYDSIAAGNSPEWKLF  270



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   358 bits (920),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSH PESLHMFTFLFDDIGIPQDYRHM+GSGV+T+T
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHVPESLHMFTFLFDDIGIPQDYRHMDGSGVHTFT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGKS YVKFHWKPTCGVKSLLE+EA ++GGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKSTYVKFHWKPTCGVKSLLEEEAARIGGANHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   358 bits (920),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MFTFLFDDIGIPQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMFTFLFDDIGIPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK+GK+HYVKFHWKPTCGVKSLLE++A++VGG NHSHATQDLYDSIAAGN PEWKLF
Sbjct  212  LINKSGKAHYVKFHWKPTCGVKSLLEEDAVRVGGTNHSHATQDLYDSIAAGNSPEWKLF  270



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   358 bits (920),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFP FF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPXFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFL DD+G+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLLDDLGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK+HYVKFHWKPTCGVK LLEDEAIKVGGANHS AT+DLYDSIAAGNYPEWKLF
Sbjct  212  LISKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSXATKDLYDSIAAGNYPEWKLF  270



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   358 bits (920),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHMEGSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGIPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK GK+HYVKFHWKPTCGVK LL+DEA+ VGGANHSHAT+DLYDSI AGNYPEWKLF
Sbjct  212  LINKTGKAHYVKFHWKPTCGVKCLLDDEAVMVGGANHSHATKDLYDSIQAGNYPEWKLF  270



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   358 bits (920),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENW VLDFFSHHPESL+MFTFLFDDIG+PQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWGVLDFFSHHPESLNMFTFLFDDIGVPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK+GK+HYVKFHWKPTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKSGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   358 bits (920),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSH PESLHMFTFLFDDIGIPQDYRHM+GSGV+T+T
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHVPESLHMFTFLFDDIGIPQDYRHMDGSGVHTFT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGKS YVKFHWKPTCGVKSLLE+EA ++GGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKSTYVKFHWKPTCGVKSLLEEEAARIGGANHSHATQDLYDSIAAGNYPEWKLF  270



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   358 bits (920),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHM+GSGV+T+T
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMDGSGVHTFT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWK  7
            LIN+AGKS YVKFHWKPTCGVKSLLE++AI+VGGANHSHATQDLYDSIAAGNYPEWK
Sbjct  212  LINRAGKSTYVKFHWKPTCGVKSLLEEKAIRVGGANHSHATQDLYDSIAAGNYPEWK  268



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   358 bits (920),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSH PESLHMFTFLFDDIGIPQDYRHM+GSGV+T+T
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHVPESLHMFTFLFDDIGIPQDYRHMDGSGVHTFT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGKS YVKFHWKPTCGVKSLLE+EA ++GGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKSTYVKFHWKPTCGVKSLLEEEAARIGGANHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   358 bits (919),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHE GSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHEHGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFL DD+G+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLSDDLGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+K GK+HYVKFHWKPTCGVK LLEDEAIKVGGANHSHAT+DLYDSIAAGNYPEWKLF
Sbjct  212  LISKTGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATKDLYDSIAAGNYPEWKLF  270



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   358 bits (919),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSH PESLHMFTFLFDDIGIPQDYRHM+GSGV+T+T
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHVPESLHMFTFLFDDIGIPQDYRHMDGSGVHTFT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGKS Y KFHWKPTCGV+SLLEDEA +VGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKSTYAKFHWKPTCGVQSLLEDEAARVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   358 bits (918),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+RFSTVIHERGSPE++RDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   GPGVQTPVIVRFSTVIHERGSPESIRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+G+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDLGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK +YVKFHWKPTCGVK L+E+EAIKVGGANHSHATQDLYDSIAAG YPEWKLF
Sbjct  212  LINKAGKVNYVKFHWKPTCGVKCLIEEEAIKVGGANHSHATQDLYDSIAAGTYPEWKLF  270



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   357 bits (916),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIH RGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHARGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD+VHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTY 
Sbjct  152  PDIVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE++AI++GG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEDAIRLGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   357 bits (916),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFA+KFYTREGN+D+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSH+QENWR+LDFFSHHPESLHMFTFLFDDIGIP DYRHM+GSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHVQENWRILDFFSHHPESLHMFTFLFDDIGIPADYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+N+AGKSHYVKFHWKPTCGVKSLL+DEA+ VGG NHSHATQDLYDSIAAGN+PEWKLF
Sbjct  212  LVNRAGKSHYVKFHWKPTCGVKSLLDDEAVTVGGTNHSHATQDLYDSIAAGNFPEWKLF  270



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFA+KFYTREGN+D+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDDIGIP DYRHM+GSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGIPADYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+N+AGKSHYVKFHWKPTCGVKSLL+DEA+ VGG NHSHATQDLYDSIAAGN+PEWKL+
Sbjct  212  LVNRAGKSHYVKFHWKPTCGVKSLLDDEAVTVGGTNHSHATQDLYDSIAAGNFPEWKLY  270



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFA+KFYTREGN+D+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSH+QENWR+LDF SHHPESLHMFTFLFDDIGIP DYRHM+GSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHVQENWRILDFLSHHPESLHMFTFLFDDIGIPADYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+N+AGKSHYVKFHWKPTCGVKSLL+DEA+ VGG NHSHATQDLYDSIAAGN+PEWKLF
Sbjct  212  LVNRAGKSHYVKFHWKPTCGVKSLLDDEAVTVGGTNHSHATQDLYDSIAAGNFPEWKLF  270



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   356 bits (913),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPET+RDPRGFAVKFYTREGN+D+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNWDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIP DYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPADYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+N+AGKSHYVKFHW+PTCGVKSLLEDEA+ VGG NHSHAT+DLYD+IAAGN+PEWKL+
Sbjct  212  LVNRAGKSHYVKFHWRPTCGVKSLLEDEAVTVGGTNHSHATKDLYDAIAAGNFPEWKLY  270



>gb|AAR84577.1| catalase 1b [Lotus japonicus]
 gb|AAR84579.1| catalase 1b [Lotus japonicus]
Length=449

 Score =   354 bits (909),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSH PESLHMFTFLFDD+G+PQDYRHM+G GVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHFPESLHMFTFLFDDVGVPQDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK  YVKFHWKPTCGVK LLE+EAIKVGG+NHSHATQDLY+SIAAGNYPEWKLF
Sbjct  212  LINKAGKVVYVKFHWKPTCGVKCLLEEEAIKVGGSNHSHATQDLYESIAAGNYPEWKLF  270



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   355 bits (912),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFFIRDGMKF
Sbjct  92   APGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNIPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRV+DFFS HPESL+MFTFLFDDIGIPQDYRHMEGSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRVMDFFSPHPESLNMFTFLFDDIGIPQDYRHMEGSGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK+GK+HYVKFHWKPTCGVKSLLE++A++VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKSGKAHYVKFHWKPTCGVKSLLEEDAVRVGGTNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   355 bits (911),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHM+G GVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGIPQDYRHMDGFGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWKPTCGVK LL++EAIKVGGANHSHAT+DLYDSI+AGNYPEWKLF
Sbjct  212  LINKAGKAQYVKFHWKPTCGVKCLLDEEAIKVGGANHSHATKDLYDSISAGNYPEWKLF  270



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   355 bits (911),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHM+G GVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGIPQDYRHMDGFGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWKPTCGVK LL++EAIKVGG+NHSHAT+DLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAQYVKFHWKPTCGVKCLLDEEAIKVGGSNHSHATKDLYDSIAAGNYPEWKLF  270



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   355 bits (911),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR++DFFSHHPESLHMF+FLFDD+G+PQDYRHMEG GVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMFSFLFDDVGVPQDYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+N++GK+HYVKFHWKPTCGVKSLLE+EAI+VGG+NHSHAT+DLYDSIAAGNYPEW+L+
Sbjct  212  LLNESGKAHYVKFHWKPTCGVKSLLEEEAIRVGGSNHSHATKDLYDSIAAGNYPEWQLY  270



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   355 bits (911),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   GPGVQTPVIARFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHMEG+GVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGIPQDYRHMEGAGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVK LL++EAI+VGG+NHSHAT+DLYDSIAAGNYPEW LF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKCLLDEEAIRVGGSNHSHATKDLYDSIAAGNYPEWNLF  270



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   355 bits (910),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFA+KFYTREGN+D+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDDIGIP DYRHM+GSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGIPADYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+N+AGKSHYVKFHWKPTCGVKSLL+DEA+ VGG NHSHAT+DLYDSIAAGNYPEWK +
Sbjct  212  LVNRAGKSHYVKFHWKPTCGVKSLLDDEAVTVGGTNHSHATKDLYDSIAAGNYPEWKFY  270



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   354 bits (909),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSH PESLHMFTFLFDD+G+PQDYRHM+G GVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHFPESLHMFTFLFDDVGVPQDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK  YVKFHWKPTCGVK LLE+EAIKVGG+NHSHATQDLY+SIAAGNYPEWKLF
Sbjct  212  LINKAGKVVYVKFHWKPTCGVKCLLEEEAIKVGGSNHSHATQDLYESIAAGNYPEWKLF  270



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   354 bits (908),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQE+WR+LDFFSHHPESLHMFTFL DD+G+PQDYRHM+GSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHIQEDWRILDFFSHHPESLHMFTFLQDDVGVPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK GK+HYVKFHW+PTCGVK LLEDEAIKVGG NHSHAT+DLYDSIA GNYPEWKLF
Sbjct  212  LINKTGKTHYVKFHWRPTCGVKCLLEDEAIKVGGMNHSHATKDLYDSIADGNYPEWKLF  270



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   353 bits (907),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPR FA+KFYTREGN+D+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRVFAIKFYTREGNWDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSH+QENWR+LDFFSHHPESLHMFTFLFDDIGIP DYRHM+GSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHVQENWRILDFFSHHPESLHMFTFLFDDIGIPADYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+N+AGKSHYVKFHWKPTCGVKSLL+DEA+ VGG NHSHATQDLYDSIAAGN+PEWKLF
Sbjct  212  LVNRAGKSHYVKFHWKPTCGVKSLLDDEAVTVGGTNHSHATQDLYDSIAAGNFPEWKLF  270



>gb|AAC17731.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   353 bits (905),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   GPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHMEG+GVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGIPQDYRHMEGAGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCG+K L ++EAI+VGGANHSHAT+DLYDSIAAGNYP+W LF
Sbjct  212  LINKAGKAHYVKFHWKPTCGIKCLSDEEAIRVGGANHSHATKDLYDSIAAGNYPQWNLF  270



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   352 bits (904),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+GIPQDYRHM+GSGVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDLGIPQDYRHMDGSGVNTYN  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK GK HYVKFHW+PTCGVK LL++EAI+VGG+NHSHATQDLYDSI AG+YPEWKL+
Sbjct  212  LINKEGKVHYVKFHWRPTCGVKCLLDEEAIRVGGSNHSHATQDLYDSIEAGSYPEWKLY  270



>ref|NP_564121.1| catalase 1 [Arabidopsis thaliana]
 sp|Q96528.3|CATA1_ARATH RecName: Full=Catalase-1 [Arabidopsis thaliana]
 gb|AAM97090.1| expressed protein [Arabidopsis thaliana]
 gb|AAQ56816.1| At1g20630 [Arabidopsis thaliana]
 dbj|BAE99222.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29998.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   352 bits (904),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   GPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHMEG+GVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGIPQDYRHMEGAGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCG+K L ++EAI+VGGANHSHAT+DLYDSIAAGNYP+W LF
Sbjct  212  LINKAGKAHYVKFHWKPTCGIKCLSDEEAIRVGGANHSHATKDLYDSIAAGNYPQWNLF  270



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   355 bits (911),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  184  APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  243

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR++DFFSHHPESLHMF+FLFDD+G+PQDYRHMEG GVNTYT
Sbjct  244  PDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMFSFLFDDVGVPQDYRHMEGFGVNTYT  303

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+N++GK+HYVKFHWKPTCGVKSLLE+EAI+VGG+NHSHAT+DLYDSIAAGNYPEW+L+
Sbjct  304  LLNESGKAHYVKFHWKPTCGVKSLLEEEAIRVGGSNHSHATKDLYDSIAAGNYPEWQLY  362



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   352 bits (904),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   GPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHM+G GVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGIPQDYRHMDGFGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKP+CGVK LL++EAIKVGG+NHSHAT+DLYDSIAAGNYPEW LF
Sbjct  212  LINKAGKAHYVKFHWKPSCGVKCLLDEEAIKVGGSNHSHATKDLYDSIAAGNYPEWHLF  270



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   352 bits (904),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   GPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHM+G GVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGIPQDYRHMDGFGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKP+CGVK LL++EAIKVGG+NHSHAT+DLYDSIAAGNYPEW LF
Sbjct  212  LINKAGKAHYVKFHWKPSCGVKCLLDEEAIKVGGSNHSHATKDLYDSIAAGNYPEWHLF  270



>gb|KEH36313.1| catalase heme-binding enzyme [Medicago truncatula]
Length=430

 Score =   350 bits (898),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+ DGM F
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVHDGMNF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSH PESLHMF+FLFDD+G+PQDYRHM+G GVNTY+
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHFPESLHMFSFLFDDVGVPQDYRHMDGFGVNTYS  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWKPTCGVK LLE+EAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAVYVKFHWKPTCGVKCLLEEEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   352 bits (903),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDG+KF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGIKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR++DFFSHHPESLHMFTFLFDD+G+P DYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMFTFLFDDVGVPADYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+ GK+HYVKFHW+PTCGVK LLEDEA+ VGG NHSHAT+DLYDSIAAGNYPEWKLF
Sbjct  212  LINREGKTHYVKFHWRPTCGVKCLLEDEAVIVGGNNHSHATKDLYDSIAAGNYPEWKLF  270



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   352 bits (903),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+ DGMKF
Sbjct  93   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVHDGMKF  152

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSH PESLHMF+FLFDD+G+PQDYRHM+G GVNTYT
Sbjct  153  PDMVHALKPNPKSHIQENWRILDFFSHFPESLHMFSFLFDDVGVPQDYRHMDGFGVNTYT  212

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWKPTCGVKSLLE+EAIKVGGANHSHATQDLY+SIAAGNYPEWKL+
Sbjct  213  LINKAGKALYVKFHWKPTCGVKSLLEEEAIKVGGANHSHATQDLYESIAAGNYPEWKLY  271



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   352 bits (902),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDG+KF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGIKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+G+P DYRHM+GSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDVGVPADYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK GK+HYVKFHW+PTCGVK LLEDEA+ VGG NHSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINKEGKAHYVKFHWRPTCGVKCLLEDEAVIVGGNNHSHATKDLYDSIAAGNYPEWKLY  270



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   352 bits (902),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+ DGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVHDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSH PESLHMF+FLFDD+G+PQDYRHM+G GVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHFPESLHMFSFLFDDVGVPQDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWKPTCGVKSLLE+EAIKVGGANHSHATQDLY+SIAAGNYPEWKL+
Sbjct  212  LINKAGKALYVKFHWKPTCGVKSLLEEEAIKVGGANHSHATQDLYESIAAGNYPEWKLY  270



>gb|AEG89525.1| catalase [Brassica oleracea var. botrytis]
Length=340

 Score =   346 bits (887),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  29   GPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  88

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSH PESLHMF+FLFDD+GIPQDYRHM+G GVNTY 
Sbjct  89   PDMVHALKPNPKSHIQENWRILDFFSHRPESLHMFSFLFDDLGIPQDYRHMDGFGVNTYM  148

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+H VKFHWKP+CGVK LL++EAIKVGG+NHSHAT+DLYDSIA+GNYPEW LF
Sbjct  149  LINKAGKAHNVKFHWKPSCGVKCLLDEEAIKVGGSNHSHATKDLYDSIASGNYPEWNLF  207



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   351 bits (900),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   GPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHMEG+ VNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGIPQDYRHMEGASVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCG+K L ++EA++VGG+NHSHAT+DLYDSIAAGNYPEW LF
Sbjct  212  LINKAGKAHYVKFHWKPTCGIKCLSDEEAVRVGGSNHSHATKDLYDSIAAGNYPEWNLF  270



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   351 bits (900),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   GPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHM+G GVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGIPQDYRHMDGFGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKP+CGVK LL++EAIKVGG+NHSHAT+DLYDSIA+GNYPEW LF
Sbjct  212  LINKAGKAHYVKFHWKPSCGVKCLLDEEAIKVGGSNHSHATKDLYDSIASGNYPEWNLF  270



>gb|AEQ94083.1| putative catalase [Elaeis guineensis]
Length=300

 Score =   344 bits (882),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDG+KF
Sbjct  20   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGIKF  79

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSH+QENWR+LDFFSHHPESLHMF+FLFDD+GIP DYRHM+G GVNTY+
Sbjct  80   PDMVHALKPNPKSHMQENWRILDFFSHHPESLHMFSFLFDDVGIPSDYRHMDGFGVNTYS  139

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+K GK+HYVKFHWKPTCGVK LL+DEA+ VGG+NHSHAT+DLYDSIAAGNYPEWK F
Sbjct  140  LISKDGKAHYVKFHWKPTCGVKCLLDDEAVTVGGSNHSHATKDLYDSIAAGNYPEWKPF  198



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   350 bits (899),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFA+KFYTREGN+D+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWRVLDFFSHHPESLHMFTFLFDDIG+P DYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKTHIQENWRVLDFFSHHPESLHMFTFLFDDIGVPADYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+N+AGK+HYVKFHWKPTCGVKSLLEDEA+ VGG NHSHAT+DL DSIAAGNYPEW  +
Sbjct  212  LVNRAGKAHYVKFHWKPTCGVKSLLEDEAVTVGGTNHSHATKDLTDSIAAGNYPEWTFY  270



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   350 bits (899),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
               VH LKPNPKSHIQENWR+LDFFSHHPESL+MF+FLFDDIGIPQDYRHM+GSGVNTYT
Sbjct  152  TRHVHPLKPNPKSHIQENWRILDFFSHHPESLNMFSFLFDDIGIPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHW+PTCGVKSLLE++AI+VGG+NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWRPTCGVKSLLEEDAIRVGGSNHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AAB07026.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   350 bits (899),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+R STVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   GPGVQTPVIVRLSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHMEG+GVNTY 
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGIPQDYRHMEGAGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCG+K L ++EAI+VGGANHSHAT+DLYDSIAAGNYP+W LF
Sbjct  212  LINKAGKAHYVKFHWKPTCGIKCLSDEEAIRVGGANHSHATKDLYDSIAAGNYPQWNLF  270



>dbj|BAJ88747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   352 bits (902),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFA+KFYTREGN+D+VGNNFPVFFIRDGMKF
Sbjct  133  APGVQTPVIVRFSTVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKF  192

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWRVLDFFSHHPESLHMFTFLFDDIG+P DYRHM+GSGVNTYT
Sbjct  193  PDMVHALKPNPKTHIQENWRVLDFFSHHPESLHMFTFLFDDIGVPADYRHMDGSGVNTYT  252

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+N+AGK+HYVKFHWKPTCGVKSLLEDEA+ VGG NHSHAT+DL DSIAAGNYPEW  +
Sbjct  253  LVNRAGKAHYVKFHWKPTCGVKSLLEDEAVTVGGTNHSHATKDLTDSIAAGNYPEWTFY  311



>ref|XP_010477308.1| PREDICTED: catalase-1 [Camelina sativa]
Length=492

 Score =   350 bits (899),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   GPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHMEG+GVNTY 
Sbjct  152  PDMVHALKPNPKTHIQENWRILDFFSHHPESLHMFSFLFDDLGIPQDYRHMEGAGVNTYL  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK+HYVKFHWKPTCGVK LL++EAIKVGG+NHSHAT+DL+DSIAAGN+P+W LF
Sbjct  212  LISKAGKAHYVKFHWKPTCGVKCLLDEEAIKVGGSNHSHATKDLHDSIAAGNFPQWNLF  270



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   350 bits (897),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+ DGM F
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVHDGMNF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSH PESLHMF+FLFDD+G+PQDYRHM+G GVNTY+
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHFPESLHMFSFLFDDVGVPQDYRHMDGFGVNTYS  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWKPTCGVK LLE+EAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAVYVKFHWKPTCGVKCLLEEEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   350 bits (897),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDG+KF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGIKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR++DFFSHHPESLHMFTFLFDD+G+P DYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMFTFLFDDVGVPADYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK GK+ YVKFHW+PTCGVK LLEDEA+ VGG NHSHAT+DLYDSIAAGNYPEWKLF
Sbjct  212  LINKEGKARYVKFHWRPTCGVKCLLEDEAVIVGGNNHSHATKDLYDSIAAGNYPEWKLF  270



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   349 bits (896),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDG+KF
Sbjct  92   APGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGLKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHM+G GVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGIPQDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWK TCG K LL+DEAI+VGG+NHSHATQDLYDSIAAGNYPEWKL+
Sbjct  212  LINKAGKAVYVKFHWKTTCGEKCLLDDEAIRVGGSNHSHATQDLYDSIAAGNYPEWKLY  270



>ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
 ref|XP_004157075.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=973

 Score =   362 bits (930),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESL+MFTFLFDDIGIPQDYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHW+PTCGVKSLLE++AI+VGG+NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWRPTCGVKSLLEEDAIRVGGSNHSHATQDLYDSIAAGNYPEWKLF  270


 Score =   353 bits (905),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APG QTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  573  APGTQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  632

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+GIPQDYRHM+GSGVNTYT
Sbjct  633  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDLGIPQDYRHMDGSGVNTYT  692

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK GK HYVKFHW+PTCGVK+LL++ AI+VGG+NHSHATQDLYDSIAAGNYPEW+L+
Sbjct  693  LINKEGKVHYVKFHWRPTCGVKTLLDEVAIRVGGSNHSHATQDLYDSIAAGNYPEWELY  751



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD+VHA KPNPKSH+QENWR+ DF SH PESLHM TFL DD+GIPQDYRHMEGSGVNTYT
Sbjct  152  PDVVHAFKPNPKSHLQENWRIFDFLSHVPESLHMLTFLLDDLGIPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK HYVKFHWKPTCGVK LLE+EAIKVGG+NHSHATQDLYDSI+AGNYPEWKL+
Sbjct  212  LINKAGKVHYVKFHWKPTCGVKCLLENEAIKVGGSNHSHATQDLYDSISAGNYPEWKLY  270



>ref|XP_010459749.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   GPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHMEG+GVNTY 
Sbjct  152  PDMVHALKPNPKTHIQENWRILDFFSHHPESLHMFSFLFDDLGIPQDYRHMEGAGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+K GK+HYVKFHWKP+CGVK LL++EAIKVGG+NHSHAT+DLYDSIAAGN+P+W LF
Sbjct  212  LISKDGKAHYVKFHWKPSCGVKCLLDEEAIKVGGSNHSHATKDLYDSIAAGNFPQWNLF  270



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFA+KFYTREGN+D+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSHHPESLHMFTFLFDDIG+P DYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKTHIQENWRILDFFSHHPESLHMFTFLFDDIGVPADYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+N+AGK+HYVKFHWKPTCGVKSLLE+EA+ VGG NHSHAT+DL DSIAAGNYPEW  +
Sbjct  212  LVNRAGKAHYVKFHWKPTCGVKSLLEEEAVTVGGTNHSHATKDLTDSIAAGNYPEWTFY  270



>ref|XP_010498497.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   GPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHMEG+GVNTY 
Sbjct  152  PDMVHALKPNPKTHIQENWRILDFFSHHPESLHMFSFLFDDLGIPQDYRHMEGAGVNTYM  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+K GK+HYVKFHWKP+CGVK LL++EAIKVGG+NHSHAT+DLYDSIAAGN+P+W LF
Sbjct  212  LISKDGKAHYVKFHWKPSCGVKCLLDEEAIKVGGSNHSHATKDLYDSIAAGNFPQWNLF  270



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFA+KFYTREGN+D+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSHHPESLHMFTFLFDDIG+P DYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKTHIQENWRILDFFSHHPESLHMFTFLFDDIGVPADYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+N+AGK+HYVKFHWKPTCGVKSLLE+EA+ VGG NHSHAT+DL DSIAAGNYPEW  +
Sbjct  212  LVNRAGKAHYVKFHWKPTCGVKSLLEEEAVTVGGTNHSHATKDLTDSIAAGNYPEWTFY  270



>ref|XP_008812256.1| PREDICTED: catalase isozyme B [Phoenix dactylifera]
Length=478

 Score =   348 bits (893),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTPII+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDG+KF
Sbjct  92   APGVQTPIIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGIKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSH+QENWR+LDFFSHHPESLHMF+FLFDD+GIP DYRHM+G GVNTY+
Sbjct  152  PDMVHALKPNPKSHLQENWRILDFFSHHPESLHMFSFLFDDVGIPSDYRHMDGFGVNTYS  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK GK+HYVKFHWKPTCGVK LL+DEA+ VGG+NHSHAT+DLY+SIAAGNYPEWKLF
Sbjct  212  LINKDGKTHYVKFHWKPTCGVKCLLDDEAVTVGGSNHSHATKDLYNSIAAGNYPEWKLF  270



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFA+KFYTREGN+D+ GNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAIKFYTREGNWDLAGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWRVLDFFSHHPESLHMFTFLFDDIGIP DYRHM+GSGVNTYT
Sbjct  152  PDMVHALKPNPKTHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPADYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+N+AGK+HYVKFHWKPTCGVKSLLEDEA+ VGG NHSHAT+DL D+IAAGNYPEW  +
Sbjct  212  LVNRAGKTHYVKFHWKPTCGVKSLLEDEAVTVGGTNHSHATKDLTDAIAAGNYPEWTFY  270



>emb|CAC37634.1| catalase 1 [Pinus pinea]
Length=296

 Score =   342 bits (876),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            A GVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  23   AAGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  82

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQE+WR+LDFFSHHPESLHMFTFLFDD+GIP +YRHM+GSGV+T+T
Sbjct  83   PDMVHALKPNPKSHIQEDWRILDFFSHHPESLHMFTFLFDDLGIPLNYRHMDGSGVHTFT  142

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+NKAG+  YVKFHW+PTCGVK LL+DEA+ VGG NHSHAT+DLYDSIAAGNYPEWKLF
Sbjct  143  LVNKAGRQTYVKFHWRPTCGVKCLLDDEAVVVGGTNHSHATKDLYDSIAAGNYPEWKLF  201



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   348 bits (893),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPK+HIQENWR+LDFFSHHPESLHMFTFLFDD+GIP DYRHM+G GVNTYT
Sbjct  152  PDMVHSLKPNPKTHIQENWRILDFFSHHPESLHMFTFLFDDVGIPMDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+  VKFHW+P+CGVKSLL+DEA+ VGG NHSHAT+DLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKATLVKFHWRPSCGVKSLLDDEAVIVGGTNHSHATKDLYDSIAAGNYPEWKLF  270



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   348 bits (893),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDG+KF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGIKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIP DYRHM+G GVNTY+
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGIPSDYRHMDGFGVNTYS  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+K GK+HYVKFHWKPTCGVK LL+DEA+ VGG+NHSHAT+DLYDSIAAGNYPEWKLF
Sbjct  212  LISKDGKAHYVKFHWKPTCGVKCLLDDEAVTVGGSNHSHATKDLYDSIAAGNYPEWKLF  270



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   348 bits (892),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDG+KF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGIKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH+LKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDD+G+P DYRHM+GSGVNTYT
Sbjct  152  PDMVHSLKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDVGVPADYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
             INK GK+HYVKFHW+PTCGVK LLEDEA+ VGG NHSHAT+DLY SIAAGNYPEWKL+
Sbjct  212  FINKEGKAHYVKFHWRPTCGVKCLLEDEAVIVGGNNHSHATKDLYGSIAAGNYPEWKLY  270



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   348 bits (892),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDG+KF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGIKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSHHPESLHMFTFLFDDIGIP DYRHM+GSGV+TYT
Sbjct  152  PDMVHALKPNPKTHIQENWRILDFFSHHPESLHMFTFLFDDIGIPTDYRHMDGSGVHTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L++K GK+HYVKFHWKPTCGVKSLL+DEA+ VGGANHSHAT+DL D+IAAGNYPEWKL+
Sbjct  212  LVSKEGKAHYVKFHWKPTCGVKSLLDDEAVVVGGANHSHATKDLTDAIAAGNYPEWKLY  270



>gb|ACJ71242.1| catalase 1 [Vigna unguiculata]
Length=236

 Score =   338 bits (868),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDG+KF
Sbjct  34   APGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGLKF  93

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFS+ PESLHMF+FLFDD+GIPQDYRHM+G GVNTYT
Sbjct  94   PDMVHALKPNPKSHIQENWRILDFFSYVPESLHMFSFLFDDVGIPQDYRHMDGFGVNTYT  153

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+K GK+HYVKFHWK TCG K LL++EAI+VGG+NHSHATQDLYDSIAAGNYP WKL+
Sbjct  154  LISKTGKAHYVKFHWKATCGEKCLLDEEAIRVGGSNHSHATQDLYDSIAAGNYPGWKLY  212



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   347 bits (891),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDG+KF
Sbjct  92   APGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGLKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHM+G GVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGIPQDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWK T G KSLL+DEAI+VGG+NHSHATQDLYDSIAAGNYPEWKL+
Sbjct  212  LINKAGKALYVKFHWKTTSGEKSLLDDEAIRVGGSNHSHATQDLYDSIAAGNYPEWKLY  270



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   347 bits (891),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDDIG+P +YRHM+GSGV+T+T
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGVPLNYRHMDGSGVHTFT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI++ GK+ YVKFHW+PTCGVKSLLE+EA+ VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LISREGKATYVKFHWRPTCGVKSLLEEEAVIVGGNNHSHATQDLYDSIAAGNYPEWKLF  270



>gb|EMT05040.1| Catalase-1 [Aegilops tauschii]
Length=526

 Score =   348 bits (892),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFA+KFYTREGN+D+VGNNFPVFFIRDGMKF
Sbjct  126  APGVQTPVIVRFSTVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKF  185

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSHHPESLHMFTFLFDDIG+P DYRHM+GSGVNTYT
Sbjct  186  PDMVHALKPNPKTHIQENWRILDFFSHHPESLHMFTFLFDDIGVPADYRHMDGSGVNTYT  245

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+N+AGK+HYVKFHWKPTCGVKSLLE+EA+ VGG NHSHAT+DL DSI AGNYPEW  +
Sbjct  246  LVNRAGKAHYVKFHWKPTCGVKSLLEEEAVTVGGTNHSHATKDLTDSIGAGNYPEWTFY  304



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   345 bits (884),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDG+KF
Sbjct  33   APGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGLKF  92

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHM+G GVNTYT
Sbjct  93   PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGIPQDYRHMDGFGVNTYT  152

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK HYVKFHWK TCG K LL++EA++VGG NHSHATQDL+DSIAAGNYPEWKL+
Sbjct  153  LISKAGKPHYVKFHWKATCGEKCLLDEEAVRVGGFNHSHATQDLHDSIAAGNYPEWKLY  211



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   346 bits (888),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDG+KF
Sbjct  92   APGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGLKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHM+G GVNTYT
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGIPQDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK HYVKFHWK TCG K LL++EA++VGG+NHSHATQDL+DSIAAGNYPEWKL+
Sbjct  212  LISKAGKPHYVKFHWKATCGEKCLLDEEAVRVGGSNHSHATQDLHDSIAAGNYPEWKLY  270



>gb|AFC01205.1| catalase, partial [Ammopiptanthus mongolicus]
Length=264

 Score =   338 bits (867),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGM+F
Sbjct  14   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMQF  73

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD++HA KPNPKSHIQE WR+LDF SH PESL+ FTF FDD+GIPQDYRHMEGSGV+T+T
Sbjct  74   PDVIHAFKPNPKSHIQEYWRILDFLSHAPESLNTFTFFFDDLGIPQDYRHMEGSGVHTFT  133

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK  YVKFHWKPTCGVK LLE+EAIKVGG+NHSHATQDLYDSIAAGNYPEWKL+
Sbjct  134  LINKAGKVLYVKFHWKPTCGVKCLLEEEAIKVGGSNHSHATQDLYDSIAAGNYPEWKLY  192



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            +PGVQTP+I+RFSTV +ERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   SPGVQTPVIVRFSTVTNERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH LK NPKS+IQE+WR LDFFSHHPESLHMFTFLFDD+G+PQDYRHM+GSGVNTYT
Sbjct  152  PDMVHCLKSNPKSNIQESWRSLDFFSHHPESLHMFTFLFDDLGVPQDYRHMDGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK+HYVKFHWKP CGVK LLE+EAIKVGGANHSHAT+DLYDSIAAGNYPEWKLF
Sbjct  212  LISKAGKAHYVKFHWKPICGVKCLLEEEAIKVGGANHSHATKDLYDSIAAGNYPEWKLF  270



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPET+RDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD+VHA KPNPKSHIQE+WR+ DF SH PESLHM TFLFDD+GIPQDYRHMEGSGVNTYT
Sbjct  152  PDVVHAFKPNPKSHIQESWRIFDFLSHVPESLHMLTFLFDDLGIPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN AGK H VKFHWKPTCGVK LLE+EAIKVGG+NHSHATQDLYDSIAAGNYPEWKL+
Sbjct  212  LINNAGKVHCVKFHWKPTCGVKCLLEEEAIKVGGSNHSHATQDLYDSIAAGNYPEWKLY  270



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            +PGVQTP+I+RFSTV +ERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   SPGVQTPVIVRFSTVTNERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVH LK NPKS+IQE+WR LDFFSHHPESLHMFTFLFDD+G+PQDYRHMEGSGVNTYT
Sbjct  152  PDMVHCLKSNPKSNIQESWRSLDFFSHHPESLHMFTFLFDDLGVPQDYRHMEGSGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK+HYVKFHWKPTC VK LLE+EAIKVGGANHSHAT+DLYD+IAAGNYPEWKLF
Sbjct  212  LISKAGKAHYVKFHWKPTCEVKCLLEEEAIKVGGANHSHATKDLYDAIAAGNYPEWKLF  270



>gb|AGQ21569.2| catalase, partial [Lathyrus sativus]
Length=271

 Score =   338 bits (867),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGN+D+VGNNFPVFF+ DGM F
Sbjct  6    APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNYDLVGNNFPVFFVHDGMNF  65

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNP++HIQENWR+LDFFSH PESLHMF+FLFDD+G+PQDYRHM+G GVNTYT
Sbjct  66   PDMVHALKPNPQTHIQENWRILDFFSHFPESLHMFSFLFDDVGVPQDYRHMDGFGVNTYT  125

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGKS YVKFHW PTCGVK LL+ EA++VGG+NHSHAT+DLYDSIAAGNYPEWKL+
Sbjct  126  LINKAGKSVYVKFHWIPTCGVKCLLDAEAVQVGGSNHSHATKDLYDSIAAGNYPEWKLY  184



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   344 bits (883),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQE+WR+LDFFSHHPESLHMF+FLFDD+G+P +YRHM+GSGV+T+T
Sbjct  152  PDMVHALKPNPKSHIQEDWRILDFFSHHPESLHMFSFLFDDVGVPLNYRHMDGSGVHTFT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+NKAG+  YVKFHW+PTCGVK LLEDEA+ VGG NHSHAT+DLYDSIAAGNYPEWKLF
Sbjct  212  LVNKAGRQTYVKFHWRPTCGVKCLLEDEAVVVGGTNHSHATKDLYDSIAAGNYPEWKLF  270



>dbj|BAH37035.1| catalase 1 [Pisum sativum]
Length=494

 Score =   344 bits (883),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGN+D+VGNNFPVFF+ DGM F
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNYDLVGNNFPVFFVHDGMNF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNP++HIQENWR+LDFFSH PESLHMF+FLFDD+G+PQDYRHM+G GVNTYT
Sbjct  152  PDMVHALKPNPQTHIQENWRILDFFSHFPESLHMFSFLFDDVGVPQDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGKS YVKFHWKPTCGVK LLE+EAI+VGG+NHSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINKAGKSVYVKFHWKPTCGVKCLLEEEAIQVGGSNHSHATKDLYDSIAAGNYPEWKLY  270



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score =   344 bits (882),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNP++HIQENWR++DFFSHHPESLHMFTFL DDIGIP +YRHMEG GV+T+T
Sbjct  152  PDMVHALKPNPRTHIQENWRIMDFFSHHPESLHMFTFLLDDIGIPLNYRHMEGFGVHTFT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+N+AGK  YVKFHWKPTCGVKSLLE++A+ VGG+NHSHATQDL DSIAAGNYPEWKLF
Sbjct  212  LVNRAGKCSYVKFHWKPTCGVKSLLEEQAVIVGGSNHSHATQDLQDSIAAGNYPEWKLF  270



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   343 bits (881),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSH PESLHMFTFLFDD+G+PQDYRHM+G GVNTYT
Sbjct  152  PDMVHALKPNPKNHIQENWRILDFFSHFPESLHMFTFLFDDLGVPQDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWK T G+K LLE+EAIKVGGANHSHATQDL+DSIAAGNYPEWKLF
Sbjct  212  LINKAGKAVYVKFHWKTTSGIKCLLEEEAIKVGGANHSHATQDLHDSIAAGNYPEWKLF  270



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   343 bits (880),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSH PESLHMFTFLFDD+G+PQDYRHM+G GVNTYT
Sbjct  152  PDMVHALKPNPKNHIQENWRILDFFSHFPESLHMFTFLFDDLGVPQDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWK T G+K LLE+EAIKVGGANHSHATQDL+DSIAAGNYPEWKLF
Sbjct  212  LINKAGKAVYVKFHWKTTSGIKCLLEEEAIKVGGANHSHATQDLHDSIAAGNYPEWKLF  270



>gb|AFD29285.1| catalase [Vicia faba]
Length=494

 Score =   343 bits (879),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGN+D+VGNNFPVFF+ DGM F
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNYDLVGNNFPVFFVHDGMNF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNP++HIQENWR+LDFFSH PESLHMF+FLFDD+G+PQDYRHM+G GVNTYT
Sbjct  152  PDMVHALKPNPQTHIQENWRILDFFSHFPESLHMFSFLFDDVGVPQDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+NKAGKS YVKFHWKPTCGVK LLE+EAI+VGG+NHSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LLNKAGKSVYVKFHWKPTCGVKCLLEEEAIQVGGSNHSHATKDLYDSIAAGNYPEWKLY  270



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   343 bits (879),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSH PESLHMF+FLFDD+G+PQDYRHM+G GVNTYT
Sbjct  152  PDMVHALKPNPKNHIQENWRILDFFSHFPESLHMFSFLFDDLGVPQDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWK T GVK LLE+EAIKVGGANHSHATQDL+DSIAAGNYPEWKLF
Sbjct  212  LINKAGKAVYVKFHWKTTSGVKCLLEEEAIKVGGANHSHATQDLHDSIAAGNYPEWKLF  270



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   343 bits (879),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSH PESLHMF+FLFDD+G+PQDYRHM+G GVNTYT
Sbjct  152  PDMVHALKPNPKNHIQENWRILDFFSHFPESLHMFSFLFDDLGVPQDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWK T GVK LLE+EAIKVGGANHSHATQDL+DSIAAGNYPEWKLF
Sbjct  212  LINKAGKAVYVKFHWKTTSGVKCLLEEEAIKVGGANHSHATQDLHDSIAAGNYPEWKLF  270



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   343 bits (879),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSH PESLHMF+FLFDD+G+PQDYRHM+G GVNTYT
Sbjct  152  PDMVHALKPNPKNHIQENWRILDFFSHFPESLHMFSFLFDDLGVPQDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKFHWK T GVK LLE+EAIKVGGANHSHATQDL+DSIAAGNYPEWKLF
Sbjct  212  LINKAGKAVYVKFHWKTTSGVKCLLEEEAIKVGGANHSHATQDLHDSIAAGNYPEWKLF  270



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   342 bits (877),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPET+RDPRGFAVKFYTREGNFD+VGNNFPVFF+RD MKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDAMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD++HA KPNPKSHIQE WRVLDF SHHPESL  F FLFDD+G+PQDYRHMEG GV++YT
Sbjct  152  PDVIHAFKPNPKSHIQEYWRVLDFLSHHPESLLTFAFLFDDVGVPQDYRHMEGFGVHSYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK HYVKFHWKPTCGVK LLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LISKAGKVHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   342 bits (876),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPET+RDPRGFAVKFYTREGNFD+VGNNFPVFF+RD MKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDAMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD++HA KPNPKSHIQE WRVLDF SHHPESL  F FLFDD+G+PQDYRHMEG GV++YT
Sbjct  152  PDVIHAFKPNPKSHIQEYWRVLDFLSHHPESLLTFAFLFDDVGVPQDYRHMEGFGVHSYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK HYVKFHWKPTCGVK LLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LISKAGKVHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  270



>gb|ACJ71243.1| catalase 2 [Vigna unguiculata]
Length=221

 Score =   332 bits (851),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFF+R GMKF
Sbjct  26   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFFVRGGMKF  85

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSH PESLHMF+FL DD+G+PQDYRHM+G GVNTY+
Sbjct  86   PDMVHALKPNPKNHIQENWRILDFFSHFPESLHMFSFLIDDLGVPQDYRHMDGFGVNTYS  145

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+NKAGK+ YV+FHWK   GVK LLE+EAIKVGGANH+HATQDL+DSIAAGNYPEWKLF
Sbjct  146  LVNKAGKAVYVQFHWKTVSGVKCLLEEEAIKVGGANHTHATQDLHDSIAAGNYPEWKLF  204



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   341 bits (875),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 170/179 (95%), Gaps = 7/179 (4%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFA       GNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFA-------GNFDLVGNNFPVFFIRDGMKF  144

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MFTFLFDDIGIPQDYRHMEGSGVNTY 
Sbjct  145  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMFTFLFDDIGIPQDYRHMEGSGVNTYM  204

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINK+GK+HYVKFHWKPTCGVKSLLE++AI+VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  205  LINKSGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLF  263



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   341 bits (875),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPET RDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   APGVQTPLIVRFSTVIHERGSPETPRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQE+WR+LDFFSHHPESLHMF+FLFDD+G+P +YRHM+GSGV+T+T
Sbjct  152  PDMVHALKPNPKSHIQEDWRILDFFSHHPESLHMFSFLFDDVGVPLNYRHMDGSGVHTFT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+NKAG+  YVKFHW+PTCGVK LLEDEA+ VGG NHSHAT+DLYDSIAAGNYPEWKLF
Sbjct  212  LVNKAGRQTYVKFHWRPTCGVKCLLEDEAVVVGGTNHSHATKDLYDSIAAGNYPEWKLF  270



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   341 bits (875),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            A GVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  92   AAGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQE+WR+LDFFSHHPESLHMFTFLFDD+GIP +YRHM+GSGV+T+T
Sbjct  152  PDMVHALKPNPKSHIQEDWRILDFFSHHPESLHMFTFLFDDLGIPLNYRHMDGSGVHTFT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+NKAG+  YVKFHW+PTCGVK LL+DEA+ VGG NHSHAT+DLYDSIAAGNYPEWKLF
Sbjct  212  LVNKAGRQTYVKFHWRPTCGVKCLLDDEAVVVGGTNHSHATKDLYDSIAAGNYPEWKLF  270



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   340 bits (873),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTPII+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPIIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+G+P +YRHM+GSGV+T+T
Sbjct  152  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGVPLNYRHMDGSGVHTFT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+N+ GK+ YVKFHW+PT GVK LLEDEA+ VGG NHSH TQDLYDSIAAGNYPEWKLF
Sbjct  212  LLNREGKATYVKFHWRPTSGVKCLLEDEAVTVGGNNHSHGTQDLYDSIAAGNYPEWKLF  270



>gb|ACJ71245.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSH PESLHMF+FLFDD G+PQDYRHM+G GVNTY+
Sbjct  152  PDMVHALKPNPKNHIQENWRILDFFSHFPESLHMFSFLFDDWGVPQDYRHMDGFGVNTYS  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+NKAGK+ YVKFHWK   GVK LLE+EAIKVGGANHSHATQDL+DSIAAGNYPEWKLF
Sbjct  212  LVNKAGKAVYVKFHWKTVSGVKCLLEEEAIKVGGANHSHATQDLHDSIAAGNYPEWKLF  270



>gb|ACJ71244.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSH PESLHMF+FLFDD G+PQDYRHM+G GVNTY+
Sbjct  152  PDMVHALKPNPKNHIQENWRILDFFSHFPESLHMFSFLFDDWGVPQDYRHMDGFGVNTYS  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+NKAGK+ YVKFHWK   GVK LLE+EAIKVGGANHSHATQDL+DSIAAGNYPEWKLF
Sbjct  212  LVNKAGKAVYVKFHWKTVSGVKCLLEEEAIKVGGANHSHATQDLHDSIAAGNYPEWKLF  270



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   353 bits (906),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  613  GPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  672

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHMEG+GVNTY 
Sbjct  673  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGIPQDYRHMEGAGVNTYM  732

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCG+K L ++EAI+VGGANHSHAT+DLYDSIAAGNYP+W LF
Sbjct  733  LINKAGKAHYVKFHWKPTCGIKCLSDEEAIRVGGANHSHATKDLYDSIAAGNYPQWNLF  791


 Score =   300 bits (767),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HER SPET+RD RGFAVKFYTREGNFD+VGNN PVFFIRDG++F
Sbjct  131  APGVQTPVIVRFSTVVHERASPETMRDIRGFAVKFYTREGNFDLVGNNTPVFFIRDGIQF  190

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD+VHALKPNPK++IQE WR+LD+ SH PESL  + ++FDD+GIPQDYRHMEG GV+TYT
Sbjct  191  PDVVHALKPNPKTNIQEYWRILDYMSHLPESLLTWCWMFDDVGIPQDYRHMEGFGVHTYT  250

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI K+GK  +VKFHWKPTCG+K+L ++EA  VGGANHSHAT+DL+D+IA+GNYPEWKLF
Sbjct  251  LIAKSGKVLFVKFHWKPTCGIKNLTDEEAKVVGGANHSHATKDLHDAIASGNYPEWKLF  309



>sp|P25890.1|CATA_PEA RecName: Full=Catalase [Pisum sativum]
 emb|CAA42736.1| catalase [Pisum sativum]
Length=494

 Score =   339 bits (870),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGN+D+VGNNFPVFF+ DGM F
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNYDLVGNNFPVFFVHDGMNF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNP++HIQENWR+LDFF + PESLHMF+FLFDD+G+PQDYRHM+G GVNTYT
Sbjct  152  PDMVHALKPNPQTHIQENWRILDFFYNFPESLHMFSFLFDDVGVPQDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGKS YVKFHWKPTCGVK LLE+EAI+VGG+NHSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINKAGKSVYVKFHWKPTCGVKCLLEEEAIQVGGSNHSHATKDLYDSIAAGNYPEWKLY  270



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   339 bits (870),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSH PESLHMF+FLFDD+G+PQDYRHM+G GVNTYT
Sbjct  152  PDMVHALKPNPKNHIQENWRILDFFSHFPESLHMFSFLFDDLGVPQDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK+ YVKFHWK   GVK LLE+EAIKVGGANHSHATQDL+DSIAAGNYPEWKLF
Sbjct  212  LISKAGKAVYVKFHWKTVSGVKCLLEEEAIKVGGANHSHATQDLHDSIAAGNYPEWKLF  270



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   339 bits (870),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RD MKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDAMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD + A KPNPKSHIQENWR+LDFFSH PESLH F F +DD+GIPQDYRHMEGS V+ YT
Sbjct  152  PDAIRAFKPNPKSHIQENWRILDFFSHLPESLHTFAFFYDDLGIPQDYRHMEGSSVHAYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK HYVKFHWKPTCGVK LLEDEAIKVGGANHSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LISKAGKVHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATKDLYDSIAAGNYPEWKLY  270



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RD MKF
Sbjct  23   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDAMKF  82

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD + A KPNPKSHIQE WR+LDFFSH PESLH F F +DD+G+PQDYRHMEGS V+ YT
Sbjct  83   PDAIRAFKPNPKSHIQETWRILDFFSHLPESLHTFAFFYDDLGVPQDYRHMEGSSVHAYT  142

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK HYVKFHWKPTCGVK LLEDEAIKVGGANHSHAT+DLYDSIAAGNYPEWKL+
Sbjct  143  LISKAGKVHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATKDLYDSIAAGNYPEWKLY  201



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   338 bits (866),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPET+RDPRGFAVKFYTREGNFDMVGNNFPVFFIRD MKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDAMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD++HA KPNPKSHIQE WRV+DF S+HPESL  F FLFDD+G+PQDYRHMEG GV+T+T
Sbjct  152  PDVIHAFKPNPKSHIQEYWRVVDFLSYHPESLSTFAFLFDDVGVPQDYRHMEGFGVHTFT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK++YVKFHWKPTCGVK LLEDEAI+VGG NHSHATQDLYDSI AGNYPEWKLF
Sbjct  212  LINKAGKANYVKFHWKPTCGVKCLLEDEAIRVGGTNHSHATQDLYDSIKAGNYPEWKLF  270



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   338 bits (866),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PGVQTP+I+RFSTVIHERGSPET+RDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   GPGVQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD++HA KPNPKSHIQE WRVLDF S+ PESLH F FLFDD+G+PQDYRHMEGS VNTYT
Sbjct  152  PDVIHAFKPNPKSHIQEYWRVLDFCSYLPESLHTFMFLFDDVGVPQDYRHMEGSSVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK HYVKFHWKPT GVK LLE+EAI+VGGANHSHATQDLYDSIAAGNYPEWKL+
Sbjct  212  LINKAGKVHYVKFHWKPTLGVKCLLEEEAIRVGGANHSHATQDLYDSIAAGNYPEWKLY  270



>gb|AIR77003.1| catalase, partial [Lilium longiflorum]
Length=292

 Score =   331 bits (848),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTPIILRFSTVIHERGSPET+RDPRGFAVKFYTREGN+D++GNNFPVFFIRDG+KF
Sbjct  46   APGVQTPIILRFSTVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKF  105

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD++HA KPNPKSHIQE WRV DF SHHPESLH F FLFDD+G+P DYRHMEG GVNTYT
Sbjct  106  PDVIHAFKPNPKSHIQEYWRVFDFLSHHPESLHTFFFLFDDVGVPSDYRHMEGFGVNTYT  165

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
             INKAGKS YVKFHWKPTCGV  LLEDEA+ +GG NHSHATQDLY+SIAAGN+PEWKLF
Sbjct  166  FINKAGKSRYVKFHWKPTCGVTCLLEDEAVVIGGKNHSHATQDLYESIAAGNFPEWKLF  224



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   338 bits (866),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGN+D+VGNNFPVFF+RD MKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNYDLVGNNFPVFFVRDAMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD +HALKPNPKSHIQE+WR+LDFFSH PESL  F + +DD+GIPQDYRHMEG G++ YT
Sbjct  152  PDSIHALKPNPKSHIQESWRILDFFSHLPESLSTFAWFYDDVGIPQDYRHMEGFGIHAYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCGVKSLLE+EAI+VGG+NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  LINKAGKAHYVKFHWKPTCGVKSLLEEEAIRVGGSNHSHATQDLYDSIAAGNYPEWKLF  270



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   337 bits (865),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPET+RDPRGFAVKFYTREGNFDMVGNNFPVFFIRD MKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDAMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD++HA KPNPKSHIQE WRV+DF S+HPESL  F FLFDD+GIPQDYRHMEG GV+T+T
Sbjct  152  PDVIHAFKPNPKSHIQEYWRVVDFLSYHPESLSTFAFLFDDVGIPQDYRHMEGFGVHTFT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+NKAGK++YVKFHWKPTCGVK LLEDEAI+VGG NHSHATQDLYDSI AGNYPEWKLF
Sbjct  212  LLNKAGKANYVKFHWKPTCGVKCLLEDEAIRVGGTNHSHATQDLYDSIKAGNYPEWKLF  270



>emb|CDY29518.1| BnaA06g14520D [Brassica napus]
Length=492

 Score =   337 bits (864),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  531  GVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPD  352
            GVQTP+I RFSTVIHERGSPETLRDPRGFAVKFYTREGN D+VGNNFPVFF+RDGMKFPD
Sbjct  94   GVQTPVIARFSTVIHERGSPETLRDPRGFAVKFYTREGNLDLVGNNFPVFFVRDGMKFPD  153

Query  351  MVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLI  172
            MVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHM+G GVNTY LI
Sbjct  154  MVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGIPQDYRHMDGFGVNTYVLI  213

Query  171  NKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            NKAGK+HYVKFHWKPTC VK L ++EAI+VGG NHSHAT+DLYDSIAAG++PEW +F
Sbjct  214  NKAGKAHYVKFHWKPTCPVKCLSDEEAIRVGGTNHSHATKDLYDSIAAGSFPEWHMF  270



>ref|XP_008348922.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=445

 Score =   335 bits (859),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPET+RDPRGFAVKFYTREGN+D+VGNNFPVFF+RD MKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNWDLVGNNFPVFFVRDAMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD++HA KPNPKSHIQE WRVLDF SHHPESL  F FLFDD+G+PQDYRHMEG GV+ YT
Sbjct  152  PDVIHAFKPNPKSHIQEYWRVLDFLSHHPESLLTFAFLFDDVGVPQDYRHMEGFGVHAYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK HYVKFHWKPTCGVK LLEDEAIKVGGANHSHAT+DLYDSI AGNYPEWKLF
Sbjct  212  LISKAGKVHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATKDLYDSIEAGNYPEWKLF  270



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score =   350 bits (897),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
             PG QTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKF
Sbjct  581  GPGAQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKF  640

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHMEG+GVNTY 
Sbjct  641  PDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDLGIPQDYRHMEGAGVNTYM  700

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+HYVKFHWKPTCG+K L ++EAI+VGG+NHSHAT+DLYDSIAAGNYP+W LF
Sbjct  701  LINKAGKAHYVKFHWKPTCGIKCLSDEEAIRVGGSNHSHATKDLYDSIAAGNYPQWNLF  759


 Score =   297 bits (761),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HER SPET+RD RGFAVKFYTREGNFD+VGNN PVFFIRDG++F
Sbjct  99   APGVQTPVIVRFSTVVHERASPETMRDIRGFAVKFYTREGNFDLVGNNTPVFFIRDGIQF  158

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD+VHALKPNPK++IQE WR+LD+ SH PESL  + ++FDD+GIPQDYRHMEG GV+TYT
Sbjct  159  PDVVHALKPNPKTNIQEYWRILDYMSHLPESLLTWCWMFDDVGIPQDYRHMEGFGVHTYT  218

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+ K+GK  +VKFHWKPTCG+K+L ++EA  VGGANHSHAT+DL+D+I++GNYPEWKLF
Sbjct  219  LVAKSGKVLFVKFHWKPTCGIKNLTDEEAKVVGGANHSHATKDLHDAISSGNYPEWKLF  277



>ref|XP_008382478.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=453

 Score =   335 bits (859),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPET+RDPRGFAVKFYTREGN+D+VGNNFPVFF+RD MKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNWDLVGNNFPVFFVRDAMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD++HA KPNPKSHIQE WRVLDF SHHPESL  F FLFDD+G+PQDYRHMEG GV+ YT
Sbjct  152  PDVIHAFKPNPKSHIQEYWRVLDFLSHHPESLLTFAFLFDDVGVPQDYRHMEGFGVHAYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK HYVKFHWKPTCGVK LLEDEAIKVGGANHSHAT+DLYDSI AGNYPEWKLF
Sbjct  212  LISKAGKVHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATKDLYDSIEAGNYPEWKLF  270



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   336 bits (862),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQ P+I+RFSTV+HERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFFIRDGMKF
Sbjct  92   APGVQAPVIVRFSTVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHA KPNPK+++QENWR++DFFSHHPESLHMFTFLFDD+GIP +YRHMEG GVNTYT
Sbjct  152  PDMVHAFKPNPKTNLQENWRIVDFFSHHPESLHMFTFLFDDVGIPLNYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+ GKSH VKFHWKPTCGVK LL+DEA+ VGG  HSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINRDGKSHLVKFHWKPTCGVKCLLDDEAVTVGGTCHSHATKDLYDSIAAGNYPEWKLY  270



>ref|XP_009149540.1| PREDICTED: catalase-1 [Brassica rapa]
 ref|XP_009149541.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   336 bits (862),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  531  GVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPD  352
            GVQTP+I RFSTVIHERGSPETLRDPRGFAVKFYTREGN D+VGNNFPVFF+RDGMKFPD
Sbjct  94   GVQTPVIARFSTVIHERGSPETLRDPRGFAVKFYTREGNLDLVGNNFPVFFVRDGMKFPD  153

Query  351  MVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLI  172
            MVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHM+G GVNTY LI
Sbjct  154  MVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGIPQDYRHMDGFGVNTYVLI  213

Query  171  NKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            NKAG++HYVKFHWKPTC VK L ++EAI+VGG NHSHAT+DLYDSIAAG++PEW +F
Sbjct  214  NKAGRAHYVKFHWKPTCPVKCLSDEEAIRVGGTNHSHATKDLYDSIAAGSFPEWHMF  270



>emb|CAP74531.1| putative Td650 protein [Triticum turgidum subsp. durum]
Length=264

 Score =   328 bits (841),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFFIRDGMKF
Sbjct  23   APGVQTPVIVRFSTVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKF  82

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHA KP+PK+++QENWR++DFFSHHPESLHMFTFLFDD+GIP +YRHM+G GVNTYT
Sbjct  83   PDMVHAFKPSPKTNMQENWRIVDFFSHHPESLHMFTFLFDDVGIPLNYRHMDGFGVNTYT  142

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI++ GK+H VKFHWKPTCGVK LL+DEA+ VGG  H+HAT+DL D+IAAGNYPEWKLF
Sbjct  143  LISRDGKAHLVKFHWKPTCGVKCLLDDEAVTVGGTCHTHATKDLTDAIAAGNYPEWKLF  201



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RD MKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDAMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD + A KPNPKSHIQE WR+LDFFSH PESLH F F +DD+G+PQDYRHMEGS V+ YT
Sbjct  152  PDAIRAFKPNPKSHIQETWRILDFFSHLPESLHTFAFFYDDLGVPQDYRHMEGSSVHAYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK HYVKFHWKPTCGVK LLEDEAIKVGGANHSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LISKAGKVHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATKDLYDSIAAGNYPEWKLY  270



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHA KPNPK+++QENWR++DFFSHHPESLHMFTFLFDD+GIP +YRHMEG GVNTYT
Sbjct  152  PDMVHAFKPNPKTNLQENWRIVDFFSHHPESLHMFTFLFDDVGIPLNYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+ GK H VKFHWKPTCGVK LL+DEA+ VGG  HSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINRDGKPHLVKFHWKPTCGVKCLLDDEAVTVGGTCHSHATKDLYDSIAAGNYPEWKLY  270



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RD MKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDAMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD + A KPNPKSHIQE WR+LDFFSH PESLH F F +DD+G+PQDYRHMEGS V+ YT
Sbjct  152  PDAIRAFKPNPKSHIQETWRILDFFSHLPESLHTFAFFYDDLGVPQDYRHMEGSSVHAYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK HYVKFHWKPTCGVK LLEDEAIKVGGANHSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LISKAGKVHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATKDLYDSIAAGNYPEWKLY  270



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RD MKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDAMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD + A KPNPKSHIQE WR+LDFFSH PESLH F F +DD+G+PQDYRHMEGS V+ YT
Sbjct  152  PDAIRAFKPNPKSHIQETWRILDFFSHLPESLHTFAFFYDDLGVPQDYRHMEGSSVHAYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LI+KAGK HYVKFHWKPTCGVK LLEDEAIKVGGANHSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LISKAGKVHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATKDLYDSIAAGNYPEWKLY  270



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHA KPNPK+++QENWR++DFFSHHPESLHMFTFLFDD+GIP +YRHMEG GVNTYT
Sbjct  152  PDMVHAFKPNPKTNLQENWRIVDFFSHHPESLHMFTFLFDDVGIPLNYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+ GK H VKFHWKPTCGVK LL+DEA+ VGG  HSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINRDGKPHLVKFHWKPTCGVKCLLDDEAVTVGGTCHSHATKDLYDSIAAGNYPEWKLY  270



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHA KPNPK+++QENWR++DFFSHHPESLHMFTFLFDD+GIP +YRHMEG GVNTYT
Sbjct  152  PDMVHAFKPNPKTNLQENWRIVDFFSHHPESLHMFTFLFDDVGIPLNYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+ GK H VKFHWKPTCGVK LL+DEA+ VGG  HSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINRDGKPHLVKFHWKPTCGVKCLLDDEAVTVGGTCHSHATKDLYDSIAAGNYPEWKLY  270



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHA KPNPK+++QENWR++DFFSHHPESLHMFTFLFDD+GIP +YRHMEG GVNTYT
Sbjct  152  PDMVHAFKPNPKTNLQENWRIVDFFSHHPESLHMFTFLFDDVGIPLNYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+ GK H VKFHWKPTCGVK LL+DEA+ VGG  HSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINRDGKPHLVKFHWKPTCGVKCLLDDEAVTVGGTCHSHATKDLYDSIAAGNYPEWKLY  270



>emb|CDY31490.1| BnaC05g15990D [Brassica napus]
Length=492

 Score =   335 bits (859),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  531  GVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPD  352
            GVQTP+I RFSTVIHERGSPETLRDPRGFAVKFYTREGN D+VGNNFPVFF+RDGMKFPD
Sbjct  94   GVQTPVIARFSTVIHERGSPETLRDPRGFAVKFYTREGNLDLVGNNFPVFFVRDGMKFPD  153

Query  351  MVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLI  172
            MVHALKPNPKSHIQENWR+LDFFSHHPESLHMF+FLFDD+GIPQDYRHM+G GVNTY LI
Sbjct  154  MVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGIPQDYRHMDGFGVNTYVLI  213

Query  171  NKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            NKAGK+H+VKFHWKPTC VK L ++EAI+VGG NHSHAT+DLYDSIAAG++PEW +F
Sbjct  214  NKAGKAHFVKFHWKPTCPVKCLSDEEAIRVGGTNHSHATKDLYDSIAAGSFPEWHMF  270



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   335 bits (858),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFFIRDG+KF
Sbjct  92   APGVQTPVIVRFSTVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFFIRDGLKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHA KPNPK+++QENWR++DFFSHHPESLHMFTFLFDD+GIP +YRHMEG GVNTYT
Sbjct  152  PDMVHAFKPNPKTNLQENWRIVDFFSHHPESLHMFTFLFDDVGIPLNYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+ GK H VKFHWKPTCGVK LL+DEA+ VGG  HSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINRDGKPHLVKFHWKPTCGVKCLLDDEAVTVGGTRHSHATKDLYDSIAAGNYPEWKLY  270



>ref|XP_002510677.1| catalase, putative [Ricinus communis]
 gb|EEF52864.1| catalase, putative [Ricinus communis]
Length=974

 Score =   347 bits (891),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  574  APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKF  633

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD+VHA KPNPKSH+QENWR+ DF SH PESLHM TFL DD+GIPQDYRHMEGSGVNTYT
Sbjct  634  PDVVHAFKPNPKSHLQENWRIFDFLSHVPESLHMLTFLLDDLGIPQDYRHMEGSGVNTYT  693

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK HYVKFHWKPTCGVK LLE+EAIKVGG+NHSH+TQDLYDSI+AGNYPEWKL+
Sbjct  694  LINKAGKVHYVKFHWKPTCGVKCLLENEAIKVGGSNHSHSTQDLYDSISAGNYPEWKLY  752


 Score =   329 bits (844),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFA KFYTREGNFD+VGNNFPVFFIRDG+KF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFATKFYTREGNFDIVGNNFPVFFIRDGIKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD+VHA KPNPKSHIQE WR+ DF SHHPESL  F + FDD+GIPQDYRHMEG GV+TY 
Sbjct  152  PDVVHAFKPNPKSHIQEYWRIFDFCSHHPESLSTFAWFFDDVGIPQDYRHMEGFGVHTYC  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK  YVKFHWKPTCGVK L++DEAIKVGGANHSHATQDLYDSIAAGN+PEWKL 
Sbjct  212  LINKAGKVTYVKFHWKPTCGVKCLMDDEAIKVGGANHSHATQDLYDSIAAGNFPEWKLM  270



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   334 bits (856),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHA KPNPK+++QENWR++DFFSHHPESLHMFTFLFDD+GIP +YRHMEG GVNTYT
Sbjct  152  PDMVHAFKPNPKTNLQENWRIVDFFSHHPESLHMFTFLFDDVGIPLNYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+ GK H VKFHWKPTCGVK LL++EA+ VGG  HSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINRDGKPHLVKFHWKPTCGVKCLLDNEAVTVGGTCHSHATKDLYDSIAAGNYPEWKLY  270



>gb|AIU99486.1| catalase [Saccharum spontaneum]
Length=492

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHA KPNPK+++QENWR++DFFSHHPESLHMFTFLFDD+GIP +YRHMEG GVNTYT
Sbjct  152  PDMVHAFKPNPKTNLQENWRIVDFFSHHPESLHMFTFLFDDVGIPLNYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+ GK H VKFHWKPTCGVK LL+DEA+ VGG  HSH T+DLYDSIAAGNYPEWKL+
Sbjct  212  LINRDGKPHLVKFHWKPTCGVKCLLDDEAVTVGGTCHSHVTKDLYDSIAAGNYPEWKLY  270



>gb|AIU99482.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HERGSPETLRDPRGFAVKFYTREGNFD+VGNN PV FIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVLFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHA KPNPK+++QENWR++DFFSHHPESLHMFTFLFDD+GIP +YRHMEG GVNTYT
Sbjct  152  PDMVHAFKPNPKTNLQENWRIVDFFSHHPESLHMFTFLFDDVGIPLNYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+ GK H VKFHWKPTCGVK LL+DEA+ VGG  HSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINRDGKPHLVKFHWKPTCGVKCLLDDEAVTVGGTCHSHATKDLYDSIAAGNYPEWKLY  270



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HERGSPETLRDPRGFAVKFYTREGNFD+VGNN PV FIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVLFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHA KPNPK+++QENWR++DFFSHHPESLHMFTFLFDD+GIP +YRHMEG GVNTYT
Sbjct  152  PDMVHAFKPNPKTNLQENWRIVDFFSHHPESLHMFTFLFDDVGIPLNYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+ GK H VKFHWKPTCGVK LL+DEA+ VGG  HSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINRDGKPHLVKFHWKPTCGVKCLLDDEAVTVGGTCHSHATKDLYDSIAAGNYPEWKLY  270



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HERGSPETLRDPRGFAVK YTREGNFD+VGNN PVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVVHERGSPETLRDPRGFAVKLYTREGNFDLVGNNMPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHA KPNPK+++QENWR++DFFSHHPESLHMFTFLFDD+GIP +YRHMEG GVNTYT
Sbjct  152  PDMVHAFKPNPKTNLQENWRIVDFFSHHPESLHMFTFLFDDVGIPLNYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+ GK H VKFHWKPTCGVK LL+DEA+ VGG  HSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINRDGKPHLVKFHWKPTCGVKCLLDDEAVTVGGTCHSHATKDLYDSIAAGNYPEWKLY  270



>ref|XP_009398521.1| PREDICTED: catalase isozyme A [Musa acuminata subsp. malaccensis]
Length=492

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTPIILRFSTVIHERGSPET+RDPRGFAVKFYTREGN+D++GNNFPVFFIRDG+KF
Sbjct  92   APGVQTPIILRFSTVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD++HA KPNPKSH+QE WRV DF SHHPESLH F FLFDD+G+P DYRHMEG GVNTYT
Sbjct  152  PDVIHAFKPNPKSHVQEYWRVFDFLSHHPESLHTFFFLFDDVGVPSDYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
             +NK GK +YVKFHWKPTCGVK LLEDEAI VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  FVNKEGKVNYVKFHWKPTCGVKCLLEDEAIVVGGKNHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AIU99483.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHA KPNPK+++QENWR++DFFSHHPESLHMFTFLFDD+G+P +YRHMEG GVNTYT
Sbjct  152  PDMVHAFKPNPKTNLQENWRIVDFFSHHPESLHMFTFLFDDVGVPLNYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+ GK H  KFHWKPTCGVK LL+DEA+ VGG  HSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINRDGKPHLAKFHWKPTCGVKCLLDDEAVTVGGTCHSHATKDLYDSIAAGNYPEWKLY  270



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   333 bits (854),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFF+RDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNPK+HIQENWR+LDFFSH PESLHMF+FLFDD+G+PQDYRHM+G GVNTYT
Sbjct  152  PDMVHALKPNPKNHIQENWRILDFFSHFPESLHMFSFLFDDLGVPQDYRHMDGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK+ YVKF  K   GVK LLE+EAIKVGGANHSHATQDL+DSIAAGNYPEWKLF
Sbjct  212  LINKAGKTMYVKFTGKNVSGVKRLLEEEAIKVGGANHSHATQDLHDSIAAGNYPEWKLF  270



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   333 bits (854),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRD +KF
Sbjct  92   APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDAIKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD+VHA KPNPKSHIQE+WR+LDF +H PESL  FT+ +DD+GIPQDYRHMEG GV TYT
Sbjct  152  PDVVHAFKPNPKSHIQESWRILDFCAHIPESLSTFTWFYDDVGIPQDYRHMEGFGVQTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK HYVKFHWKPTCGVKSL++DEAI+VGG NHSHAT+DLYDSIA+GNYPEWKL+
Sbjct  212  LINKAGKVHYVKFHWKPTCGVKSLMDDEAIRVGGTNHSHATKDLYDSIASGNYPEWKLY  270



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   333 bits (853),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRD +KF
Sbjct  87   APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDAIKF  146

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD+VHA KPNPKSH+QE+WR+LDF SH PESL  FT+ +DD+GIPQDYRHMEG GV TYT
Sbjct  147  PDVVHAFKPNPKSHVQESWRILDFCSHIPESLSTFTWFYDDVGIPQDYRHMEGFGVQTYT  206

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LINKAGK HYVKFHWKPTCGVKSL++DEAI+VGG NHSHAT+DLYDSIA+GNYPEWKL+
Sbjct  207  LINKAGKVHYVKFHWKPTCGVKSLMDDEAIRVGGTNHSHATKDLYDSIASGNYPEWKLY  265



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   333 bits (854),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPET+RDPRGFA KFYTREGNFD+VGNNFPVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETIRDPRGFATKFYTREGNFDIVGNNFPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD++HA KPNPKSHIQE WRVLDF SHHPESL+ F +LFDD+GIPQDYRHMEG GVNT++
Sbjct  152  PDVIHAFKPNPKSHIQEYWRVLDFCSHHPESLNTFGWLFDDVGIPQDYRHMEGFGVNTFS  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKL  4
             IN+ GK HYVKFHWKPTCGVKSLLEDEA++VGG NHSHATQDLY+SIAAGNYPEWKL
Sbjct  212  FINRDGKVHYVKFHWKPTCGVKSLLEDEAVRVGGLNHSHATQDLYESIAAGNYPEWKL  269



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   333 bits (854),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGN+D+VGNNFPVFFIRDG+KF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLVGNNFPVFFIRDGIKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHALKPNP++HIQ+NWR+LDFFSHHPESLHMF+FLFDD+GIP DYRHM+GSGV+TYT
Sbjct  152  PDMVHALKPNPRTHIQDNWRILDFFSHHPESLHMFSFLFDDVGIPADYRHMDGSGVHTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            L+++AG   YVKFHW+PTCGV+SL++DEA+ VGGANHSHAT+DL D+IAAGN+PEW L+
Sbjct  212  LVSRAGTVTYVKFHWRPTCGVRSLMDDEAVAVGGANHSHATKDLTDAIAAGNFPEWTLY  270



>ref|XP_009392261.1| PREDICTED: catalase isozyme A-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   333 bits (853),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPET+RDPRGFAVKFYTREGN+D++GNNFPVFFIRDG+KF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PD++HA KPNPKSHIQE WRV DF SHHPESLH F FLFDD+G+P DYRHMEG GVNTYT
Sbjct  152  PDVIHAFKPNPKSHIQEYWRVFDFLSHHPESLHTFFFLFDDVGVPSDYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
             INK GK +YVKFHWKPTCGVK LLEDEAI VGG NHSHATQDLYDSIAAGNYPEWKLF
Sbjct  212  FINKEGKVNYVKFHWKPTCGVKCLLEDEAIVVGGKNHSHATQDLYDSIAAGNYPEWKLF  270



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   333 bits (853),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HERGSPETLR PRGFAVKFYTREGNFD+VGNN PVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVVHERGSPETLRGPRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHA KPNPK+++QENWR++DFFSHHPESLHMFTFLFDD+GIP +YRHMEG GVNTYT
Sbjct  152  PDMVHAFKPNPKTNLQENWRIVDFFSHHPESLHMFTFLFDDVGIPLNYRHMEGFGVNTYT  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+ GK H VKFHWKPTCGVK LL+DEA+ VGG  HSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINRDGKPHLVKFHWKPTCGVKCLLDDEAVTVGGTCHSHATKDLYDSIAAGNYPEWKLY  270



>sp|P18122.1|CATA1_MAIZE RecName: Full=Catalase isozyme 1 [Zea mays]
Length=492

 Score =   333 bits (853),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHA KPNPK+++QENWR++DFFSHHPESLHMFTFLFDD+GIP +YRHMEG GVNTY+
Sbjct  152  PDMVHAFKPNPKTNLQENWRIVDFFSHHPESLHMFTFLFDDVGIPLNYRHMEGFGVNTYS  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+ GK H VKFHWKPTCGVK LL++EA+ VGG  HSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINRDGKPHLVKFHWKPTCGVKCLLDNEAVTVGGTCHSHATKDLYDSIAAGNYPEWKLY  270



>ref|XP_001784759.1| predicted protein [Physcomitrella patens]
 gb|EDQ50419.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   332 bits (852),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTVIHERGSPE +RDPRGFAVKFYTREGNFDMVGNN PVFFIRDG+KF
Sbjct  92   APGVQTPVIVRFSTVIHERGSPEAIRDPRGFAVKFYTREGNFDMVGNNIPVFFIRDGIKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDM+HALKPNPKSHIQE WR++DFFSH PES +MFTFLFDDIGIP DYRHMEG GV+T+ 
Sbjct  152  PDMIHALKPNPKSHIQEAWRIMDFFSHVPESCNMFTFLFDDIGIPADYRHMEGFGVHTFK  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKL  4
            LINKAGK  YVKFHWKPTCGVK+LL+DEA+ VGGANHSHATQDLYDSIAAGN+PEWKL
Sbjct  212  LINKAGKETYVKFHWKPTCGVKNLLDDEAVLVGGANHSHATQDLYDSIAAGNFPEWKL  269



>ref|NP_001105415.1| catalase isozyme 1 [Zea mays]
 emb|CAA31056.1| unnamed protein product [Zea mays]
Length=492

 Score =   332 bits (852),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  537  APGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKF  358
            APGVQTP+I+RFSTV+HERGSPETLRDPRGFAVKFYTREGNFD+VGNN PVFFIRDGMKF
Sbjct  92   APGVQTPVIVRFSTVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKF  151

Query  357  PDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYT  178
            PDMVHA KPNPK+++QENWR++DFFSHHPESLHMFTFLFDD+GIP +YRHMEG GVNTY+
Sbjct  152  PDMVHAFKPNPKTNLQENWRIVDFFSHHPESLHMFTFLFDDVGIPLNYRHMEGFGVNTYS  211

Query  177  LINKAGKSHYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLF  1
            LIN+ GK H VKFHWKPTCGVK LL++EA+ VGG  HSHAT+DLYDSIAAGNYPEWKL+
Sbjct  212  LINRDGKPHLVKFHWKPTCGVKCLLDNEAVTVGGTCHSHATKDLYDSIAAGNYPEWKLY  270



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520026522120