BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14548_g2_i1 len=459 path=[2019:0-458]

Length=459
                                                                      Score     E

ref|NP_001237556.1|  catalase-1/2                                       183   5e-52   
ref|NP_001235974.1|  catalase-3                                         183   7e-52   
gb|KEH36313.1|  catalase heme-binding enzyme                            181   1e-51   
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             182   1e-51   
gb|ACJ71245.1|  catalase 2                                              179   2e-51   Vigna unguiculata
gb|ACJ71244.1|  catalase 2                                              179   2e-51   Vigna unguiculata
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 182   2e-51   
gb|AIA61608.1|  catalase                                                181   2e-51   
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             179   4e-51   
gb|KEH36312.1|  catalase heme-binding enzyme                            181   4e-51   
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              181   4e-51   
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 181   5e-51   
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 180   5e-51   
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             179   6e-51   
ref|XP_002521709.1|  catalase, putative                                 180   7e-51   Ricinus communis
emb|CBI29557.3|  unnamed protein product                                171   7e-51   
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg             172   7e-51   
ref|NP_001237571.1|  catalase-4                                         180   8e-51   
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             180   9e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         180   9e-51   
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            180   1e-50   Pisum sativum [garden pea]
dbj|BAH37035.1|  catalase 1                                             180   1e-50   Pisum sativum [garden pea]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          180   1e-50   
gb|AFD29285.1|  catalase                                                180   1e-50   
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              179   1e-50   
ref|XP_010094556.1|  Catalase isozyme 1                                 179   1e-50   
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             180   1e-50   
gb|KHG25152.1|  Catalase isozyme 1                                      179   2e-50   
ref|XP_004300681.1|  PREDICTED: catalase-like                           179   2e-50   
ref|NP_001240021.1|  catalase                                           179   2e-50   
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         179   2e-50   
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               179   2e-50   Ricinus communis
tpg|DAA43177.1|  TPA: catalase2                                         178   3e-50   
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         178   3e-50   
ref|XP_007018034.1|  Catalase 2                                         178   3e-50   
gb|ABF93811.1|  Catalase-1, putative, expressed                         176   3e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      178   3e-50   
gb|ACJ11733.1|  catalase                                                178   4e-50   Gossypium hirsutum [American cotton]
gb|AAX88799.1|  catalase                                                178   5e-50   Euphorbia characias
gb|AAC84138.1|  catalase                                                170   5e-50   Cichorium intybus [radicchio]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          178   5e-50   Vigna radiata var. radiata [golden gram]
ref|XP_010530333.1|  PREDICTED: catalase-2                              178   5e-50   
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               178   5e-50   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ADZ45555.1|  catalase                                                177   5e-50   
gb|ADZ45556.1|  catalase                                                177   6e-50   
tpg|DAA43178.1|  TPA: catalase2                                         178   6e-50   
ref|XP_011100522.1|  PREDICTED: catalase isozyme 1                      177   7e-50   
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      177   7e-50   
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      177   8e-50   
gb|AAR84577.1|  catalase 1b                                             176   8e-50   Lotus japonicus
gb|ACB11496.1|  catalase                                                177   8e-50   Pinus sylvestris [Scotch pine]
gb|AGE15298.2|  catalase 1                                              177   9e-50   
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      176   9e-50   
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             177   9e-50   
gb|AGC65520.1|  catalase                                                177   1e-49   
gb|ABK24453.1|  unknown                                                 177   1e-49   Picea sitchensis
gb|AET97564.1|  catalase                                                177   1e-49   
gb|ADC95629.1|  catalase                                                177   1e-49   Bruguiera gymnorhiza [Burma mangrove]
emb|CDP01803.1|  unnamed protein product                                177   1e-49   
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      177   1e-49   
gb|ACL35349.1|  catalase                                                177   1e-49   Picea glauca
ref|NP_001289779.1|  catalase isozyme 1                                 177   1e-49   
gb|AAR84578.1|  catalase 1a                                             177   1e-49   Lotus japonicus
emb|CDX72514.1|  BnaC07g45360D                                          176   1e-49   
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      176   2e-49   
gb|AGV54297.1|  peroxisomal catalase                                    176   2e-49   
gb|ACA50528.1|  putative catalase 2                                     176   2e-49   Brassica napus [oilseed rape]
ref|NP_001031791.1|  catalase 2                                         176   2e-49   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19523.1|  AT4G35090                                              176   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106100.1|  PREDICTED: catalase-2                              176   2e-49   
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             176   2e-49   
emb|CAD42908.1|  catalase                                               176   2e-49   Prunus persica
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      176   2e-49   
gb|AAK96854.1|  catalase                                                176   2e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69111.1|  BnaC01g03420D                                          176   2e-49   
ref|NP_195235.1|  catalase 2                                            176   2e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CAA64220.1|  catalase                                               176   2e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AAD17935.1|  catalase                                                176   2e-49   Brassica juncea [Indian mustard]
ref|XP_009103333.1|  PREDICTED: catalase-1                              176   2e-49   
emb|CDY01363.1|  BnaA07g11360D                                          176   2e-49   
gb|ACV92695.1|  catalase                                                176   2e-49   Brassica oleracea
emb|CDY40645.1|  BnaA03g53180D                                          176   2e-49   
emb|CDY31877.1|  BnaC07g15270D                                          176   2e-49   
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             176   2e-49   
gb|AFN81243.1|  catalase 1                                              176   2e-49   
ref|XP_010437527.1|  PREDICTED: catalase-2                              176   2e-49   
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             176   2e-49   
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         176   2e-49   
gb|AAF71742.1|AF248491_1  catalase                                      176   2e-49   Raphanus sativus
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             176   2e-49   
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             176   2e-49   
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             176   2e-49   
dbj|BAJ33995.1|  unnamed protein product                                176   2e-49   
gb|KFK30147.1|  catalase                                                176   2e-49   
gb|AAD17933.1|  catalase                                                176   2e-49   Brassica juncea [Indian mustard]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         176   2e-49   
gb|AAC19397.1|  leaf catalase                                           176   2e-49   Mesembryanthemum crystallinum
ref|XP_009138342.1|  PREDICTED: catalase-2                              176   2e-49   
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           176   3e-49   
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           176   3e-49   
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      176   3e-49   
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      176   3e-49   
gb|ADU56199.1|  catalase                                                176   3e-49   
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    175   5e-49   
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      175   5e-49   
ref|NP_001048861.1|  Os03g0131200                                       175   5e-49   Oryza sativa Japonica Group [Japonica rice]
gb|ACL27272.1|  catalase                                                175   5e-49   Nicotiana benthamiana
gb|EPS69543.1|  catalase                                                175   5e-49   
dbj|BAA34205.1|  catalase                                               175   5e-49   Oryza sativa Japonica Group [Japonica rice]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          175   5e-49   Soldanella alpina
gb|ADU56189.1|  catalase 1                                              166   6e-49   
dbj|BAA34714.1|  catalase                                               175   7e-49   Oryza sativa [red rice]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      174   8e-49   
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                174   8e-49   
ref|XP_007046520.1|  Catalase 2                                         174   8e-49   
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                174   8e-49   
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      174   9e-49   
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 174   9e-49   
gb|AAB71764.1|  catalase 1                                              174   9e-49   Nicotiana tabacum [American tobacco]
emb|CCP37650.1|  catalase-1                                             174   9e-49   
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      174   1e-48   
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       174   1e-48   
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               174   1e-48   Gossypium hirsutum [American cotton]
gb|AAF19965.1|AF207906_1  catalase 1                                    174   1e-48   Zantedeschia aethiopica [arum-lily]
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             174   1e-48   
emb|CDP07288.1|  unnamed protein product                                174   2e-48   
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 174   2e-48   
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               174   2e-48   Gossypium hirsutum [American cotton]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         174   2e-48   
gb|KHG12976.1|  Catalase isozyme 2                                      174   2e-48   
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             174   2e-48   
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               174   2e-48   Cucurbita pepo
gb|AAD17936.1|  catalase                                                174   2e-48   Brassica juncea [Indian mustard]
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      173   3e-48   
gb|AAK67359.2|AF390210_1  catalase                                      173   3e-48   Suaeda salsa
gb|AIP93616.1|  CAT1                                                    173   3e-48   
gb|ABY21704.1|  catalase-1 precursor                                    173   4e-48   Panax ginseng [Chinese ginseng]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 173   4e-48   
gb|AFU48609.1|  catalase 1                                              173   4e-48   
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      172   4e-48   
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      172   4e-48   
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              172   4e-48   
ref|XP_002301920.1|  catalase family protein                            172   5e-48   Populus trichocarpa [western balsam poplar]
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 172   5e-48   
emb|CAI43948.1|  catalase                                               172   5e-48   Populus deltoides
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              173   5e-48   
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              172   5e-48   
emb|CAA45564.1|  catalase                                               172   5e-48   Arabidopsis thaliana [mouse-ear cress]
prf||1906388A  catalase                                                 172   6e-48
gb|ABM47415.1|  catalase                                                172   7e-48   Prunus avium [gean]
ref|XP_002306976.2|  catalase family protein                            172   7e-48   Populus trichocarpa [western balsam poplar]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 172   8e-48   
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      172   8e-48   
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     170   8e-48   
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      172   8e-48   
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    172   9e-48   
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             172   9e-48   
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      172   1e-47   
gb|AAC39465.1|  catalase 3                                              161   1e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     171   1e-47   
ref|XP_001784759.1|  predicted protein                                  171   1e-47   
gb|AIS20825.1|  CAT                                                     171   1e-47   
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      171   1e-47   
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      171   1e-47   
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 171   2e-47   
ref|XP_001752315.1|  predicted protein                                  171   2e-47   
gb|AAC17731.1|  catalase 1                                              171   2e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AAB07026.1|  catalase 1                                              171   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564121.1|  catalase 1                                            171   2e-47   Arabidopsis thaliana [mouse-ear cress]
prf||2104177A  catalase                                                 171   2e-47
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 171   2e-47   
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          171   2e-47   Helianthus annuus
dbj|BAJ90861.1|  predicted protein                                      171   2e-47   
gb|AAM97542.1|  catalase 3                                              171   2e-47   Capsicum annuum
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 170   2e-47   
gb|AFU90823.1|  catalase                                                170   2e-47   
ref|NP_001234186.1|  catalase isozyme 2                                 171   3e-47   
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      171   3e-47   
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 174   3e-47   
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 169   3e-47   
gb|AAO17721.1|  catalase                                                170   3e-47   Hypericum perforatum
ref|NP_001268098.1|  catalase                                           170   4e-47   
gb|AFU90822.1|  catalase                                                170   4e-47   
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 170   4e-47   
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               170   4e-47   Zea mays [maize]
gb|AII23739.1|  catalase                                                170   4e-47   
prf||1803522A  catalase                                                 170   4e-47
gb|AAY59707.1|  catalase                                                170   4e-47   Oryza sativa Indica Group [Indian rice]
dbj|BAA34204.1|  catalase                                               170   4e-47   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058635.1|  Os06g0727200                                       170   4e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010692546.1|  PREDICTED: catalase                                170   4e-47   
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    170   4e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      170   4e-47   
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          170   4e-47   Sorghum bicolor [broomcorn]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              170   5e-47   
gb|AHB72694.1|  catalase                                                170   5e-47   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             170   5e-47   
gb|AAB86582.2|  catalase                                                169   6e-47   Raphanus sativus
gb|AIU99480.1|  catalase                                                169   6e-47   
gb|AIU99481.1|  catalase                                                169   6e-47   
emb|CDP07287.1|  unnamed protein product                                169   7e-47   
gb|AIU99487.1|  catalase                                                169   7e-47   
gb|AIU99479.1|  catalase                                                169   7e-47   
gb|AIU99488.1|  catalase                                                169   7e-47   
gb|AAF61734.1|AF243519_1  catalase 4                                    169   7e-47   Helianthus annuus
ref|NP_001241808.1|  catalase isozyme B                                 169   7e-47   
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               169   7e-47   Zea mays [maize]
emb|CAA42720.1|  catalase-1                                             169   7e-47   Zea mays [maize]
ref|XP_003558892.1|  PREDICTED: catalase-1                              169   8e-47   
ref|NP_001105415.1|  catalase isozyme 1                                 169   8e-47   Zea mays [maize]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             169   8e-47   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 170   8e-47   
ref|NP_001105310.1|  catalase isozyme 2                                 169   9e-47   Zea mays [maize]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             169   9e-47   
gb|AAF61733.1|AF243518_1  catalase 3                                    169   1e-46   Helianthus annuus
emb|CAD42909.1|  catalase                                               169   1e-46   Prunus persica
gb|AIM43584.1|  catalase                                                169   1e-46   
emb|CAE82295.1|  catalase                                               169   1e-46   Homogyne alpina
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 169   1e-46   
gb|ACH63223.1|  catalase                                                169   1e-46   Rheum australe [Himalayan rhubarb]
gb|AIZ77475.1|  catalase                                                169   1e-46   
gb|AIU99486.1|  catalase                                                169   1e-46   
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              169   1e-46   
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       167   1e-46   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         168   2e-46   
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         168   2e-46   
gb|AAG43363.1|AF151368_1  catalase                                      168   2e-46   Hevea brasiliensis [Para rubber tree]
ref|XP_010477308.1|  PREDICTED: catalase-1                              168   2e-46   
ref|XP_010061175.1|  PREDICTED: catalase-like                           168   2e-46   
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       168   2e-46   Triticum aestivum [Canadian hard winter wheat]
gb|AAF61732.1|AF243517_1  catalase 2                                    168   3e-46   Helianthus annuus
emb|CAG23920.1|  catalase                                               167   3e-46   Festuca arundinacea [tall fescue]
gb|AHA50082.1|  catalase                                                167   3e-46   
gb|ACL81498.1|  catalase                                                167   4e-46   Ginkgo biloba [ginkgo]
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          167   4e-46   
dbj|BAA05494.1|  catalase                                               167   5e-46   Oryza sativa Japonica Group [Japonica rice]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     168   6e-46   
gb|AGI65617.1|  catalase                                                166   7e-46   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      166   8e-46   
emb|CDY52649.1|  BnaAnng11640D                                          166   9e-46   
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          166   1e-45   Ipomoea batatas [batate]
emb|CDY29518.1|  BnaA06g14520D                                          166   1e-45   
ref|XP_009149540.1|  PREDICTED: catalase-1                              166   1e-45   
emb|CDY31490.1|  BnaC05g15990D                                          166   1e-45   
gb|AIX10947.1|  putative catalase                                       166   1e-45   
gb|AIU99485.1|  catalase                                                166   1e-45   
gb|AIU99482.1|  catalase                                                166   1e-45   
emb|CDX76313.1|  BnaA08g10870D                                          166   1e-45   
emb|CDY17510.1|  BnaC03g65530D                                          166   1e-45   
ref|XP_002510677.1|  catalase, putative                                 169   2e-45   Ricinus communis
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         166   2e-45   
dbj|BAC79443.1|  catalase                                               166   2e-45   Acacia ampliceps
gb|AIU99483.1|  catalase                                                165   2e-45   
gb|AHF21552.1|  catalase                                                165   3e-45   
gb|ABK24543.1|  unknown                                                 165   3e-45   Picea sitchensis
gb|ACJ22771.1|  catalase 1                                              165   3e-45   Jatropha curcas
gb|ADB03784.1|  catalase                                                165   3e-45   Ipomoea batatas [batate]
gb|AIU99484.1|  catalase                                                165   4e-45   
gb|AAB62892.1|  catalase-1                                              165   4e-45   Nicotiana glutinosa
gb|KFM23952.1|  Catalase isozyme 2                                      164   5e-45   
gb|ABK41476.1|  catalase                                                164   5e-45   Haematococcus lacustris
gb|AAB70006.1|  catalase                                                164   7e-45   Chlamydomonas reinhardtii
ref|XP_001696763.1|  catalase/peroxidase                                164   7e-45   Chlamydomonas reinhardtii
ref|XP_002950455.1|  catalase                                           164   7e-45   
emb|CAA73663.1|  catalase                                               164   8e-45   Chlamydomonas reinhardtii
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         164   9e-45   Triticum aestivum [Canadian hard winter wheat]
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               163   1e-44   Hordeum vulgare [barley]
gb|ABK24449.1|  unknown                                                 163   1e-44   Picea sitchensis
gb|EMS61345.1|  Catalase isozyme 1                                      164   3e-44   
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               162   4e-44   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               162   4e-44   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 162   5e-44   Manihot esculenta [manioc]
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             160   5e-44   
gb|AAP80622.1|AF475100_1  catalase isozyme                              156   7e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      162   7e-44   
ref|NP_973873.1|  catalase 3                                            160   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001779509.1|  predicted protein                                  161   1e-43   
emb|CDY29519.1|  BnaA06g14510D                                          161   1e-43   
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    161   1e-43   
ref|XP_009149539.1|  PREDICTED: catalase-3                              161   1e-43   
gb|AEB22071.1|  catalase 2                                              152   1e-43   
gb|AAM97541.1|  catalase 2                                              160   1e-43   
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             160   1e-43   
gb|AAD30291.2|AF139538_1  catalase 2                                    160   2e-43   
gb|AAD30292.1|AF139539_1  catalase 3                                    160   2e-43   
gb|AAC19398.1|  root catalase                                           160   2e-43   
dbj|BAH56915.1|  AT1G20620                                              160   2e-43   
gb|AAM65021.1|  unknown                                                 160   2e-43   
ref|NP_564120.1|  catalase 3                                            160   2e-43   
ref|XP_009110221.1|  PREDICTED: catalase-3                              160   2e-43   
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 160   2e-43   
gb|AAC49807.1|  catalase 3                                              160   2e-43   
ref|NP_001031073.1|  catalase 3                                         160   2e-43   
emb|CDY33636.1|  BnaC08g19360D                                          160   2e-43   
ref|XP_005645077.1|  catalase                                           160   2e-43   
emb|CDY31878.1|  BnaC07g15280D                                          160   2e-43   
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         160   2e-43   
gb|AHF27433.1|  catalase                                                160   3e-43   
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     160   3e-43   
gb|ADN94253.1|  catalase                                                159   3e-43   
dbj|BAJ88747.1|  predicted protein                                      160   3e-43   
emb|CDY01364.1|  BnaA07g11370D                                          160   4e-43   
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      159   5e-43   
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         159   5e-43   
gb|AHF27430.1|  catalase                                                159   6e-43   
dbj|BAF91369.1|  catalase                                               159   6e-43   
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 159   7e-43   
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      159   7e-43   
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    158   8e-43   
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      158   8e-43   
gb|AAF79625.1|AC027665_26  F5M15.5                                      162   8e-43   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               158   8e-43   
ref|XP_002890395.1|  F5M15.5                                            162   1e-42   
ref|NP_001234827.1|  catalase isozyme 1                                 158   1e-42   
ref|NP_001274863.1|  catalase isozyme 1                                 158   1e-42   
gb|AFR53082.1|  CAT                                                     158   1e-42   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               158   1e-42   
gb|AAZ29552.1|  catalase-C                                              158   1e-42   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              157   1e-42   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             157   1e-42   
gb|ABV55108.1|  catalase 2                                              157   2e-42   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      157   2e-42   
ref|XP_009362858.1|  PREDICTED: catalase-4-like                         149   2e-42   
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               157   2e-42   
ref|XP_010692544.1|  PREDICTED: catalase-like                           157   2e-42   
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               157   2e-42   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          157   2e-42   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          157   2e-42
gb|ABC01913.1|  catalase isozyme 1-like protein                         157   3e-42   
gb|ACJ76836.3|  catalase                                                157   3e-42   
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             157   3e-42   
gb|ADM96039.1|  catalase                                                156   4e-42   
gb|AAR97905.1|  catalase                                                156   5e-42   
gb|AAC48918.1|  salicylic acid binding catalase                         156   6e-42   
emb|CAA85470.1|  catalase                                               156   6e-42   
gb|ADQ28492.1|  catalase                                                156   7e-42   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    155   1e-41   
ref|XP_010498496.1|  PREDICTED: catalase-3                              155   1e-41   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 155   1e-41   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      154   2e-41   
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      154   3e-41   
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      154   3e-41   
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               154   3e-41   
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      154   3e-41   
gb|ABB72796.1|  catalase isozyme 1-like protein                         154   4e-41   
gb|ABB88582.1|  catalase                                                154   5e-41   
gb|KHG21219.1|  Catalase isozyme 1                                      151   1e-40   
gb|ADU56198.1|  catalase                                                152   2e-40   
emb|CDY31488.1|  BnaC05g15970D                                          150   8e-40   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        150   8e-40   
gb|ABB51561.1|  truncated catalase 2                                    149   8e-40   
ref|NP_001105416.1|  catalase isozyme 3                                 150   1e-39   
gb|AAG61140.2|AF332973_1  catalase 2                                    149   2e-39   
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          149   2e-39   
gb|EMT05040.1|  Catalase-1                                              149   2e-39   
gb|AHZ13843.1|  catalase                                                147   7e-39   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               147   7e-39   
gb|AFW66787.1|  catalase3                                               147   8e-39   
gb|AGT16310.1|  catalase                                                147   9e-39   
gb|AFW66788.1|  catalase3                                               147   9e-39   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      147   1e-38   
gb|AFW66785.1|  catalase3 isoform 1                                     148   1e-38   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      147   1e-38   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      147   2e-38   
emb|CAA43814.1|  catalase                                               146   2e-38   
gb|ABN71233.2|  catalase                                                146   2e-38   
ref|NP_001045673.1|  Os02g0115700                                       146   2e-38   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           146   2e-38
gb|AAR14052.2|  catalase                                                146   3e-38   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    145   6e-38   
gb|AEQ30070.1|  catalase                                                145   7e-38   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               145   8e-38   
emb|CAH61266.1|  catalase                                               145   8e-38   
gb|ADY02963.1|  catalase                                                144   9e-38   
dbj|BAJ92414.1|  predicted protein                                      144   9e-38   
gb|KDD77132.1|  catalase                                                144   2e-37   
gb|AGT16054.1|  catalase                                                140   3e-36   
gb|AGT16203.1|  catalase                                                140   3e-36   
gb|AGT16188.1|  catalase                                                140   3e-36   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          139   8e-36   
ref|XP_005708279.1|  catalase                                           139   1e-35   
gb|EMS51034.1|  Catalase isozyme 2                                      139   1e-35   
gb|AGT15888.1|  catalase                                                138   1e-35   
gb|EMT06167.1|  Catalase isozyme 2                                      138   6e-35   
gb|KHG11966.1|  Catalase isozyme 2                                      134   8e-35   
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                135   2e-34   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   135   3e-34   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 135   3e-34   
ref|XP_005536240.1|  catalase                                           132   3e-33   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          124   1e-30   
ref|XP_005644653.1|  catalase-domain-containing protein                 123   6e-30   
ref|XP_005642928.1|  catalase                                           122   8e-30   
ref|XP_005647994.1|  catalase-domain-containing protein                 115   2e-27   
ref|WP_030085542.1|  catalase                                           105   1e-25   
ref|WP_030064609.1|  catalase                                           105   1e-25   
emb|CEI86636.1|  Putative Catalase                                      109   4e-25   
emb|CEG67568.1|  Putative Catalase                                      109   5e-25   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          108   1e-24   
ref|WP_026009813.1|  hypothetical protein                               102   1e-24   
gb|KFK81701.1|  catalase family protein                                 104   2e-24   
gb|AEX91749.1|  catalase 1                                              107   2e-24   
ref|WP_007933642.1|  catalase                                           101   2e-24   
ref|XP_005712277.1|  unnamed protein product                            107   3e-24   
gb|EPB86922.1|  catalase-A                                              107   3e-24   
gb|EPB92634.1|  catalase                                                107   3e-24   
emb|CDS08738.1|  Putative Catalase                                      107   3e-24   
emb|CDH60495.1|  catalase                                               107   3e-24   
gb|EIE85094.1|  catalase                                                107   3e-24   
ref|WP_029420398.1|  catalase                                           107   3e-24   
gb|AHG98056.1|  catalase                                                105   3e-24   
gb|ADR01107.1|  catalase 3                                              105   5e-24   
dbj|BAH20307.1|  AT1G20620                                              105   6e-24   
ref|XP_004337981.1|  catalase                                           105   7e-24   
ref|XP_011022275.1|  PREDICTED: catalase-like                           105   8e-24   
gb|AHF27432.1|  catalase                                                105   9e-24   
gb|AHF27429.1|  catalase                                                105   1e-23   
gb|ADI58890.1|  catalase                                                101   1e-23   
ref|WP_035511089.1|  MULTISPECIES: catalase                             105   1e-23   
ref|WP_030978395.1|  catalase                                         99.8    1e-23   
ref|WP_003470096.1|  catalase                                           105   1e-23   
ref|WP_030360132.1|  MULTISPECIES: catalase                             105   2e-23   
ref|WP_031086753.1|  catalase                                           101   2e-23   
ref|WP_018932076.1|  catalase                                           104   2e-23   
ref|WP_013390447.1|  catalase                                           104   2e-23   
ref|WP_015846975.1|  catalase                                           104   2e-23   
ref|WP_019393152.1|  catalase                                           104   2e-23   
ref|WP_039073350.1|  catalase                                           104   2e-23   
ref|WP_010788026.1|  Catalase                                           104   2e-23   
dbj|GAF39996.1|  catalase                                               100   3e-23   
ref|WP_020929221.1|  catalase                                           104   3e-23   
ref|WP_018395773.1|  catalase                                           104   3e-23   
ref|WP_034285200.1|  catalase                                           104   3e-23   
ref|WP_031127238.1|  catalase                                           104   3e-23   
ref|WP_015612335.1|  Catalase                                           104   3e-23   
ref|WP_032753795.1|  catalase                                           103   4e-23   
ref|WP_020618147.1|  catalase                                           103   4e-23   
ref|WP_018523799.1|  MULTISPECIES: catalase                             103   4e-23   
gb|AIM05077.1|  catalase                                                100   4e-23   
ref|WP_028609851.1|  catalase                                           103   4e-23   
gb|EJY78794.1|  Catalase                                                103   4e-23   
ref|WP_006679508.1|  catalase                                           103   4e-23   
ref|WP_028783654.1|  catalase                                           103   5e-23   
ref|WP_037880627.1|  catalase                                           103   5e-23   
ref|WP_030632612.1|  MULTISPECIES: catalase                             103   5e-23   
gb|AAG23863.1|  catalase                                              98.6    5e-23   
ref|WP_028443088.1|  catalase                                           103   5e-23   
ref|WP_018100527.1|  MULTISPECIES: catalase                             103   5e-23   
ref|WP_019121620.1|  catalase                                           103   5e-23   
ref|WP_010064265.1|  MULTISPECIES: catalase                             103   5e-23   
ref|WP_039631655.1|  catalase                                           103   5e-23   
ref|WP_033370129.1|  catalase                                           103   6e-23   
ref|WP_033300332.1|  catalase                                           103   6e-23   
gb|AJC55211.1|  putative catalase                                       103   6e-23   
ref|WP_015737807.1|  catalase                                           103   6e-23   
ref|WP_009590324.1|  catalase                                           103   6e-23   
ref|WP_007915547.1|  catalase                                           103   6e-23   
ref|WP_019890359.1|  catalase                                           103   6e-23   
ref|WP_036662024.1|  catalase                                           103   6e-23   
ref|WP_037840407.1|  catalase                                           103   7e-23   
ref|WP_010052614.1|  catalase                                           103   7e-23   
ref|WP_015077590.1|  vegetative catalase                                103   7e-23   
ref|WP_030778128.1|  catalase                                           103   7e-23   
ref|WP_018554643.1|  catalase                                           103   7e-23   
ref|WP_035723747.1|  catalase                                           103   7e-23   
ref|WP_036835295.1|  catalase                                           103   7e-23   
ref|WP_030024662.1|  catalase                                           103   7e-23   
ref|WP_026238137.1|  catalase                                           103   8e-23   
ref|WP_015595454.1|  catalase                                           103   8e-23   
ref|WP_028418212.1|  catalase                                           103   8e-23   
ref|WP_027638416.1|  catalase                                           103   8e-23   
ref|WP_024758732.1|  catalase                                           103   8e-23   
ref|WP_026169533.1|  catalase                                           103   8e-23   
ref|WP_029395313.1|  catalase                                           103   8e-23   
ref|WP_019913466.1|  catalase                                           103   9e-23   
ref|WP_026241961.1|  catalase                                           103   9e-23   
ref|WP_029326408.1|  catalase                                           103   9e-23   
ref|WP_030564868.1|  catalase                                           103   9e-23   
ref|WP_030585243.1|  catalase                                           103   9e-23   
gb|ESU50391.1|  putative catalase                                       102   9e-23   
gb|EPZ43494.1|  hypothetical protein N007_12360                         100   1e-22   
ref|WP_037692003.1|  catalase                                           102   1e-22   
ref|WP_006128571.1|  MULTISPECIES: catalase                             102   1e-22   
ref|WP_032767960.1|  catalase                                           102   1e-22   
ref|WP_030562485.1|  catalase                                           102   1e-22   
gb|EHM25602.1|  putative catalase                                       102   1e-22   
ref|WP_037773140.1|  catalase                                           102   1e-22   
ref|WP_026291121.1|  catalase                                           102   1e-22   
ref|WP_003965363.1|  catalase                                           102   1e-22   
ref|WP_030671953.1|  catalase                                           102   1e-22   
ref|WP_032775332.1|  catalase                                           102   1e-22   
ref|WP_030703835.1|  catalase                                           102   1e-22   
ref|WP_028396461.1|  catalase                                           102   1e-22   
ref|WP_025688646.1|  catalase                                           101   1e-22   
ref|XP_008078504.1|  Heme-dependent catalase-like protein               103   1e-22   
ref|WP_024714768.1|  catalase                                           102   1e-22   
ref|WP_032793670.1|  catalase                                           102   1e-22   
ref|WP_030083983.1|  MULTISPECIES: catalase                             102   1e-22   
ref|WP_037958717.1|  catalase                                           102   1e-22   
ref|WP_035314486.1|  catalase                                           102   1e-22   
gb|AIQ33869.1|  catalase                                                102   1e-22   



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYKNRPSSA+NSPF+TTNSGAP+WNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   183 bits (464),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYKNRPSSA+NSPF+TTNSGAP+WNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|KEH36313.1| catalase heme-binding enzyme [Medicago truncatula]
Length=430

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSAYNSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYKNRPS+A+NSPF+TTNSGAP+WNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKNRPSTAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|ACJ71245.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>gb|ACJ71244.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYN+PF+TTNSGAPVWNNNS+LT+GSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKQRPSSAYNTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYKNRPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDIT+LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLTCADFL  90



>ref|XP_006382987.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382988.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382989.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60784.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60785.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60786.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=434

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVT+DI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFL  90



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSAYNSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYKNRPSSA+NSPF TTNSGAPVWNNNSSLTVG+RGP+LLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYKNRPSSA+NSPF TTNSGAPVWNNNSSLTVG+RGP+LLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>ref|XP_006382990.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382991.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60787.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60788.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=455

 Score =   179 bits (455),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVT+DI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFL  90



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNSPFFTTNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSAYNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTH+I+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHNISHLTCADFL  90



>emb|CBI29557.3| unnamed protein product [Vitis vinifera]
 emb|CBI37654.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   171 bits (433),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNSP+FTTN+GAPV+NN+SSLTVGSRGP+LLEDYHLVEKL+NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFL  90



>ref|XP_006306503.1| hypothetical protein CARUB_v10012491mg [Capsella rubella]
 gb|EOA39401.1| hypothetical protein CARUB_v10012491mg [Capsella rubella]
Length=201

 Score =   172 bits (437),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EK++NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDIT LT ADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFL  90



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSPF+TTNSGAP+WNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   180 bits (456),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVT+DI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFL  90



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   180 bits (456),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>sp|P25890.1|CATA_PEA RecName: Full=Catalase [Pisum sativum]
 emb|CAA42736.1| catalase [Pisum sativum]
Length=494

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>dbj|BAH37035.1| catalase 1 [Pisum sativum]
Length=494

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+N PFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSAHNCPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|AFD29285.1| catalase [Vicia faba]
Length=494

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVT+DI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFL  90



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNSPFFTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFFTTNSGAPVWNNNSSLTVGQRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVT+DI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFL  90



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_004300681.1| PREDICTED: catalase-like [Fragaria vesca subsp. vesca]
Length=492

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAY+SPF+TTNSGAPVWNNNSSLT+G+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKLRPSSAFNSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA++SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAHSSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY+NRPSS +N+PF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYRNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+N+P++TTNSGAPVWNN+SSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA NSPFFTTNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSANNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|ABF93811.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
Length=382

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS++N P ++TNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY++RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+H+TCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHVTCADFL  90



>gb|AAX88799.1| catalase [Euphorbia characias]
Length=493

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNS FFTTNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSAYNSGFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFF+VTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFQVTHDISHLTCADFL  90



>gb|AAC84138.1| catalase [Cichorium intybus]
Length=182

 Score =   170 bits (430),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNSPF+TTN+G PV+NN +SLTVG+RGPILLEDYHL+EKL+NF RERIP
Sbjct  1    MDPYKQRPSSAYNSPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ER+VHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFL  90



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS++NSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSSHNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA NSPF+TTNSGAPVWNNNSS+TVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+N+P++TTNSGAPVWNN+SSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>ref|XP_011100522.1| PREDICTED: catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF TTNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HL+CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFL  90



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA NSPF TTNSGAPVWNNNSS+TVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA NSPF TTNSGAPVWNNNSS+TVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>gb|AAR84577.1| catalase 1b [Lotus japonicus]
 gb|AAR84579.1| catalase 1b [Lotus japonicus]
Length=449

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNN+S+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNSPF+TTN+GAPVWNNNSSLT+GSRGPILLEDYHLVEK++ FDRER+P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNAGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF+TTN+GAPVWNNNSSLTVGSRGP+LLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HL+CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFL  90



>ref|XP_010242895.1| PREDICTED: catalase isozyme 1-like isoform X2 [Nelumbo nucifera]
Length=433

 Score =   176 bits (446),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF++TNSGAPVWNNNSSLTVG+RGPI+LEDYHLVEK++NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY++RPSSA++SPFFTTNSGAPVWNNNSSL+VG+RGPILLEDYHL+EK++NFDRERIP
Sbjct  1    MDPYRHRPSSAHDSPFFTTNSGAPVWNNNSSLSVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF+TTN+GAPVWNNNSSLTVGSRGP+LLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HL+CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFL  90



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSAYNSPF+TTNSGAPVWNNNSSLT+GSRGPILLEDYHLVEK++ FDRER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCAD L
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLL  90



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSP++TTNSGAP+WNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNSPF+T NSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTANSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNS FFTTNSGAPVWNNNSSLTVGSRGP+LLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSAYNSTFFTTNSGAPVWNNNSSLTVGSRGPVLLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFL  90



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY++RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HL+CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFL  90



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSAYNSPF+TTNSGAPVWNNNSSLT+GSRGPILLEDYHLVEK++ FDRER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCAD L
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLL  90



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPS+A++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSTAFDSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNN+S+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF++TNSGAPVWNNNSSLTVG+RGPI+LEDYHLVEK++NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSPF+TTNSGAPV+NNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSPF+TTNSGAPV+NNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA++SPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFL  90



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY++RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HL CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLXCADFL  90



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLT G+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLT G+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLT G+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA++SPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFL  90



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSP+FTTNSGAPV+NNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPYFTTNSGAPVYNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPS A+NSPF TTNSGAPVWNNN SLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPS A+NSPF TTNSGAPVWNNN SLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFE THDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFETTHDISNLTCADFL  90



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA++SPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEK++NFDRERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFL  90



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NS FFTTNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSAHNSSFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGAS+KGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASSKGFFEVTHDISHLTCADFL  90



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY+ RPSSA +SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EK++NFDRERIP
Sbjct  1    MDPYRFRPSSANDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYH++EKL+ FDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHVIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS++N P ++TNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGPILLEDYHLVEKL+NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNSPF+TTNSGAPVWNNN SLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNHSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLT ADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTSADFL  90



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS++N P ++TNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK R SSA+N+PF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRSSSAFNTPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|ADU56189.1| catalase 1 [Jatropha curcas]
Length=152

 Score =   166 bits (420),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+ PSSA+N+PF+TTN+GAPVWNNNSS+TVG RGPILLEDYH++EKL+NFDRERIP
Sbjct  1    MDPYKHCPSSAHNTPFWTTNAGAPVWNNNSSMTVGQRGPILLEDYHMLEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARG SAKGFFEVTH+I++LTCADFL
Sbjct  61   ERVVHARGMSAKGFFEVTHEISNLTCADFL  90



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS++N P ++TNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKGRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   174 bits (442),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL+NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   174 bits (442),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   174 bits (442),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF+TTNSGAPV+NNNSSL+VG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYNNNSSLSVGARGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   174 bits (442),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY++RPSS YN+PF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS YNSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKYRPSSNYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHLVEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL+NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL+NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF TTNSGAPVWNNNSSLTVG+RGP+LLEDYHLVEKL+NFDRERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFL  90



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY++RPSS YN+PF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDIT+L+CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFL  90



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RG  LLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGQYLLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY+ RPSSA+NSPF+TTNSGAPVWNNN+SLTVG+RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYRQRPSSAFNSPFWTTNSGAPVWNNNNSLTVGARGPILLEDYHLLEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>ref|XP_002963086.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
 gb|EFJ36549.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
Length=484

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNS  FTTN+GAPVWNNN+SLTVGSRGPILLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSPF+TT+SGAPVW+NNSSLTVG+RGP+LLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTSSGAPVWDNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYH++EKL+ FDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVT+D++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTNDVSHLTCADFL  90



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFL  90



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS++N P ++TNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFL  90



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNS  FTTN+GAPVWNNN+SLTVGSRGPILLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY++RPSSA+N+PF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYRHRPSSAFNAPFWTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDIT+L+CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFL  90



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTN GAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNFGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_008812256.1| PREDICTED: catalase isozyme B [Phoenix dactylifera]
Length=478

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS +N+PF+TTNSGAPVWNNNSSLTVGSRGP+ LEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPVFLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA NSP+FT NSGAPVWNNN+SLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSANNSPYFTANSGAPVWNNNNSLTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSP FTTNSGAPVWN+NSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSAHNSPHFTTNSGAPVWNDNSSMTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFE THDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFETTHDISHLTCADFL  90



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY++RPSSA+NS ++TTNSGAPVWNNNSSLTVG+RGPILLEDY LVEK++NFDRERIP
Sbjct  1    MDPYQHRPSSAFNSSYWTTNSGAPVWNNNSSLTVGTRGPILLEDYQLVEKIANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+++P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFL  90



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = -1

Query  267  DPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPE  88
            DPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGPILLEDYHLVEKL+NFDRER+PE
Sbjct  1    DPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVPE  60

Query  87   RVVHARGASAKGFFEVTHDITHLTCADFL  1
            RVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   RVVHARGASAKGFFEVTHDITHLTCADFL  89



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY++RPSS +N+PF+TTNSGAPVWNNNSSLTVGSRGPILLEDYH++EKL+ FDRERIP
Sbjct  1    MDPYRHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHVIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA NSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYH++EKL+ FDRERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFT NSGAPVWNNNS +TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+ +P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFL  90



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA NSPF TTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+ +P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFL  90



>ref|XP_009108682.1| PREDICTED: catalase-2-like isoform X1 [Brassica rapa]
Length=514

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFT NSGAPVWNNNS +TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFT NSGAPVWNNNS +TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RG ILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>prf||1906388A catalase
Length=492

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RG ILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+++PF+TTNSGAPVWNN+SSLTVGSRGP+LLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKHRPSSAFDTPFWTTNSGAPVWNNDSSLTVGSRGPVLLEDYHLVEKLATFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFL  90



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSP++TTNSGA VWNNNSSLTVGSRGPILLEDYHLVEK++NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++L+CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFL  90



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA NSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYH++EKL+ FDRERIP
Sbjct  1    MDPYKFRPSSANNSPFWTTNSGAPVWNNNSSLTVGNRGPILLEDYHVIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+NSP++TTNSGA VWNNNSSLTVGSRGPILLEDYHLVEK++NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++L+CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFL  90



>gb|KCW68093.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=399

 Score =   170 bits (430),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAY+S F+TTN GAPVWNN+SSLTVG+RGPILLEDYHL+EKL+NF+RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S++N+PFFTTNSGAPVWNNNSS+T+G RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD+++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFL  90



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDP+K RPSSA+N+ F+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFL  90



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S++N+PFFTTNSGAPVWNNNSS+T+G RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD+++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFL  90



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA NSPF TTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EK++NFDRERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|AAC39465.1| catalase 3 [Arabidopsis thaliana]
Length=115

 Score =   161 bits (408),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYN+PF+TTN GAPV NN SSLT+G RGP+LLEDYHL+EK++NF RERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARG SAKGFFEVTHDI++LTCADF+
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFV  90



>gb|KCW70315.1| hypothetical protein EUGRSUZ_F03557 [Eucalyptus grandis]
Length=479

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDP+K RPSSA+N+ F+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFL  90



>ref|XP_001784759.1| predicted protein [Physcomitrella patens]
 gb|EDQ50419.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS YN+PF+TTN G+PVWNNN+SLTVG RGP+LLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKYRPSSQYNTPFWTTNQGSPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF+TTNSGAPV NNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVSNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HL+CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFL  90



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NS F TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL+NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSTFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS YNSPF+TTNSGAPVWNNN+S+TVGSRGPILLEDYHLVEK++ FDRERIP
Sbjct  1    MDPYKFRPSSNYNSPFWTTNSGAPVWNNNASITVGSRGPILLEDYHLVEKIAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSRLTCADFL  90



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAY+S F+TTN GAPVWNN+SSLTVG+RGPILLEDYHL+EKL+NF+RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLIEKLANFERERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_001752315.1| predicted protein [Physcomitrella patens]
 gb|EDQ83048.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS Y++PF+TTN GAPVWNNN+SLTVG RGP+LLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKYRPSSQYDTPFWTTNQGAPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|AAC17731.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDIT LT ADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFL  90



>gb|AAB07026.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDIT LT ADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFL  90



>ref|NP_564121.1| catalase 1 [Arabidopsis thaliana]
 sp|Q96528.3|CATA1_ARATH RecName: Full=Catalase-1 [Arabidopsis thaliana]
 gb|AAM97090.1| expressed protein [Arabidopsis thaliana]
 gb|AAQ56816.1| At1g20630 [Arabidopsis thaliana]
 dbj|BAE99222.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29998.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDIT LT ADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFL  90



>prf||2104177A catalase
Length=492

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK R SSAYN+PF+TTNSGAPV+NNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDIT LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFL  90



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSASNSSFWTTNSGAPVWNNNSALTVGHRGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK R SSAYN+PF+TTNSGAPV+NNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDIT LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFL  90



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS++NSP ++TNSGAPVWNN++SLTVGSRGPILLEDYHLVEK+++FDRERIP
Sbjct  1    MDPYKHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA NSP++TTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAANSPYWTTNSGAPVYNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDIT LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITRLTCADFL  90



>ref|XP_008348922.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=445

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF+TTN+GAPV NNNSSLTVG RGP+LLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HL+CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFL  90



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = -1

Query  267  DPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPE  88
            DPYK RPSSA+ +P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  87   RVVHARGASAKGFFEVTHDITHLTCADFL  1
            RVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFL  89



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL+NFDRERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFL  90



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAY+S F+TTN GAPVWNN+SSLTVG+RGPILLEDYHL+EKL+NF+RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
 ref|XP_004157075.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=973

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPY++RPSS YN+PF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDIT+L+CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFL  90


 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/85 (92%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = -1

Query  255  NRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVH  76
            NRPSSA+++PF+TTNSGAPVWNNNS+LT+GSRGPILLEDYHLVEKL+NFDRERIPERVVH
Sbjct  487  NRPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIPERVVH  546

Query  75   ARGASAKGFFEVTHDITHLTCADFL  1
            ARGASAKGFFEVTHDITHLTCADFL
Sbjct  547  ARGASAKGFFEVTHDITHLTCADFL  571



>ref|XP_008382478.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=453

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF+TTN+GAPV NNNSSLTVG RGP+LLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HL+CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFL  90



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSPF+TTNSGAPV++N+ SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYSNDHSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HL+CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFL  90



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNSP+FTTN+GAPV+NN+SSLTVGSRGP+LLEDYHLVEKL+NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFL  90



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = -1

Query  267  DPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPE  88
            DPYK RPSSA+ +P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  87   RVVHARGASAKGFFEVTHDITHLTCADFL  1
            RVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFL  89



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNSP+FTTN+GAPV+NN+SSLTVGSRGP+LLEDYHLVEKL+NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFL  90



>sp|P12365.3|CATA2_MAIZE RecName: Full=Catalase isozyme 2 [Zea mays]
 emb|CAA38588.1| catalase [Zea mays]
Length=491

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 88/90 (98%), Gaps = 1/90 (1%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+N+P++TTNSGAPVWNN+SSLTVG+RGPILLEDYH  EKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFL  89



>gb|AII23739.1| catalase [Zostera marina]
Length=477

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDP K RPSS +NSP++TTNSGAPVWNNNSSLTVGSRGPILLEDYHL+EK++ FDRERIP
Sbjct  1    MDPTKFRPSSDFNSPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKIAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>prf||1803522A catalase
Length=491

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 88/90 (98%), Gaps = 1/90 (1%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+N+P++TTNSGAPVWNN+SSLTVG+RGPILLEDYH  EKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFL  89



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA N+P+ TTNSGAPVWNNNSSLTV  RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADF+
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFM  90



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_010061173.1| PREDICTED: catalase isozyme 2-like isoform X1 [Eucalyptus grandis]
Length=496

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAY+S F+TTN GAPVWNN+SSLTVG+RGPILLEDYHL+EKL+NF+RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 86/86 (100%), Gaps = 0/86 (0%)
 Frame = -1

Query  258  KNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVV  79
            ++RPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIPERVV
Sbjct  6    QHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  65

Query  78   HARGASAKGFFEVTHDITHLTCADFL  1
            HARGASAKGFFEVTHD++HLTCADFL
Sbjct  66   HARGASAKGFFEVTHDVSHLTCADFL  91



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA N+P+ TTNSGAPVWNNNSSLTV  RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADF+
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFM  90



>ref|XP_002961779.1| hypothetical protein SELMODRAFT_140901 [Selaginella moellendorffii]
 ref|XP_002964850.1| hypothetical protein SELMODRAFT_167253 [Selaginella moellendorffii]
 gb|EFJ33688.1| hypothetical protein SELMODRAFT_167253 [Selaginella moellendorffii]
 gb|EFJ37039.1| hypothetical protein SELMODRAFT_140901 [Selaginella moellendorffii]
Length=492

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+ PSSA+NS FFTTNSG PVWNNNSSLTVGSRGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHTPSSAFNSSFFTTNSGTPVWNNNSSLTVGSRGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKG+FEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGYFEVTHDISNLTCADFL  90



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 1/90 (1%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+S+YNSPFFT NSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFT-NSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  59

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  60   ERVVHARGASAKGFFEVTHDISNLTCADFL  89



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDP K RPSSA+NSPF+TTNSGA VWNNNSSLTVG+RGP+LLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPCKYRPSSAFNSPFWTTNSGASVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>gb|AAF61734.1|AF243519_1 catalase 4 [Helianthus annuus]
Length=492

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAY++PF+TTN+GAPV+NN +SLTVG+RGPILLEDYHL+EKL+NF RERIP
Sbjct  1    MDPYKQRPSSAYDTPFWTTNAGAPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ER+VHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFL  90



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>sp|P18122.1|CATA1_MAIZE RecName: Full=Catalase isozyme 1 [Zea mays]
Length=492

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS++N P ++TNSGAPVWNN++SLTVG RGPILLEDYHLVEK++NFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPMWSTNSGAPVWNNDNSLTVGPRGPILLEDYHLVEKIANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>ref|NP_001105415.1| catalase isozyme 1 [Zea mays]
 emb|CAA31056.1| unnamed protein product [Zea mays]
Length=492

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = -1

Query  252  RPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVHA  73
            RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIPERVVHA
Sbjct  5    RPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVVHA  64

Query  72   RGASAKGFFEVTHDITHLTCADFL  1
            RGASAKGFFEVT+DI+HLTCADFL
Sbjct  65   RGASAKGFFEVTNDISHLTCADFL  88



>ref|XP_004966515.1| PREDICTED: catalase isozyme 1-like [Setaria italica]
Length=547

 Score =   170 bits (430),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -1

Query  276  PLMDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRER  97
            P MDPY++RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRER
Sbjct  54   PAMDPYRHRPSSGNNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRER  113

Query  96   IPERVVHARGASAKGFFEVTHDITHLTCADFL  1
            IPERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  114  IPERVVHARGASAKGFFEVTHDVSHLTCADFL  145



>ref|NP_001105310.1| catalase isozyme 2 [Zea mays]
 gb|AAA33440.1| catalase [Zea mays]
Length=491

 Score =   169 bits (428),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 87/90 (97%), Gaps = 1/90 (1%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA+N P++TTNSGAPVWNN+SSLTVG+RGPILLEDYH  EKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNPPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFL  89



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   169 bits (428),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA++SP++TTN+GAPVWNN+SSLTVG RGP+LLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFL  90



>gb|AAF61733.1|AF243518_1 catalase 3 [Helianthus annuus]
Length=492

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYN+PF+TTN+G PV+NN +SLTVG+RGPILLEDYHL+EKL+NF RERIP
Sbjct  1    MDPYKQRPSSAYNAPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ER+VHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFL  90



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA++SP++TTN+GAPVWNN+SSLTVG RGP+LLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFL  90



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>emb|CAE82295.1| catalase [Homogyne alpina]
Length=492

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RP+SAYNSPF TTN+G PV+NN +SLTVG+RGPILLEDYHL+EKL+NF RERIP
Sbjct  1    MDPYKQRPASAYNSPFLTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ER+VHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFL  90



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSA++SP++TTN+GAPVWNN+SSLTVG RGP+LLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFL  90



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA++SP++TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEK+ NFDRERIP
Sbjct  1    MDPYKFRPSSAHDSPYWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKIVNFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAK FFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKVFFEVTHDVSHLTCADFL  90



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS++N+P ++TNSGAPVWNN++SLTVGSRGPILLEDYHLVEK+++FDRERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>gb|AIU99486.1| catalase [Saccharum spontaneum]
Length=492

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = -1

Query  252  RPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVHA  73
            RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIPERVVHA
Sbjct  26   RPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVVHA  85

Query  72   RGASAKGFFEVTHDITHLTCADFL  1
            RGASAKGFFEVT+DI+HLTCADFL
Sbjct  86   RGASAKGFFEVTNDISHLTCADFL  109



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = -1

Query  255  NRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVH  76
             RPSSA+++PF+TTNSGAPVWNNNS+LT+GSRGPILLEDYHLVEKL+NFDRERIPERVVH
Sbjct  5    QRPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIPERVVH  64

Query  75   ARGASAKGFFEVTHDITHLTCADFL  1
            ARGASAKGFFEVTHDITHLTCADFL
Sbjct  65   ARGASAKGFFEVTHDITHLTCADFL  89



>ref|XP_010459749.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK  PSSA++SPFFTTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKVVPSSAHDSPFFTTNSGAPVFNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFL  90



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+N P ++TNSGAPVW+N+ SLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAHNGPHWSTNSGAPVWSNDHSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYKN PS+AYN  F+TTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKNLPSNAYNCSFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTH+++ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHNVSQLTCADFL  90



>ref|XP_010477308.1| PREDICTED: catalase-1 [Camelina sativa]
Length=492

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK  PSSA++SPFFTTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKVIPSSAHDSPFFTTNSGAPVFNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFL  90



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA++S F+TTNSGAPVWNNN+SLTVG+RGP+LLEDYHL+EK++NFDRERIP
Sbjct  1    MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFL  90



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS++N+P ++TNSGAPVWNN++SLTVGSRGPILLEDYHLVEK+++FDRERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGA+AKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFL  90



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYN+PF+TTN GAPV+NN+SSLTVG+RGPILLEDYH VEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAYNAPFWTTNYGAPVYNNDSSLTVGTRGPILLEDYHFVEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISALTCADFL  90



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS++N P ++TNSGAPVWNN++SLTVGSRGPILLEDYHLVEK+++FDRERIP
Sbjct  1    MDPYKYRPSSSFNGPQWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+NSP++TTNSGAP WNNNSSLTVG+RGPILLEDY LVE ++NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPAWNNNSSLTVGTRGPILLEDYQLVEIIANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISKLTCADFL  90



>gb|ACL81498.1| catalase [Ginkgo biloba]
Length=492

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSSAYNSP+ TTN GAPVWNN SSLT+G+RGP+LLEDYHL+EKLS F RERIP
Sbjct  1    MDPYKHRPSSAYNSPYCTTNQGAPVWNNTSSLTLGNRGPVLLEDYHLIEKLSVFTRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSAYNSPF TTN+GAPVWN++SSLTVGSRGPILLEDYHL+EKL++F RER P
Sbjct  1    MDPYKYRPSSAYNSPFMTTNAGAPVWNDDSSLTVGSRGPILLEDYHLIEKLAHFTRERTP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ER+VHARGASAKGFFEVTHDI+HLTCAD L
Sbjct  61   ERIVHARGASAKGFFEVTHDISHLTCADLL  90



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+R SS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRASSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA++S F+TTNSGAPVWNNN+SLTVG+RGP+LLEDYHL+EK++NFDRERIP
Sbjct  93   MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIP  152

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+ LTCADFL
Sbjct  153  ERVVHARGASAKGFFEVTHDISQLTCADFL  182



>gb|AGI65617.1| catalase, partial [Fragaria x ananassa]
Length=467

 Score =   166 bits (421),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = -1

Query  249  PSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVHAR  70
            PSSAY+SPF+TTNSGAPVWNNNSSLT+G+RGPILLEDYHLVEKL+NFDRERIPERVVHAR
Sbjct  1    PSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIPERVVHAR  60

Query  69   GASAKGFFEVTHDITHLTCADFL  1
            GASAKGFFEVTHDI+HLTCADFL
Sbjct  61   GASAKGFFEVTHDISHLTCADFL  83



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   166 bits (421),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  N+ F++TNSGAPVWNNN++LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGANAGFWSTNSGAPVWNNNNALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI+HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFL  90



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   166 bits (419),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -1

Query  252  RPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVHA  73
            RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIPERVVHA
Sbjct  44   RPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVHA  103

Query  72   RGASAKGFFEVTHDITHLTCADFL  1
            RGASAKGFFEVTHDI++LTCADFL
Sbjct  104  RGASAKGFFEVTHDISNLTCADFL  127



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDP K RPSS++N+PF TTNSGAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDITHLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFL  90



>emb|CDY29518.1| BnaA06g14520D [Brassica napus]
Length=492

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDP + RPSSA++SPF+TTNSGAPVWNNN+SLTVG RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPERVRPSSAHDSPFWTTNSGAPVWNNNASLTVGPRGPILLEDYHLIEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++L+CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFL  90



>ref|XP_009149540.1| PREDICTED: catalase-1 [Brassica rapa]
 ref|XP_009149541.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDP + RPSSA++SPF+TTNSGAPVWNNN+SLTVG RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPERVRPSSAHDSPFWTTNSGAPVWNNNASLTVGPRGPILLEDYHLIEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++L+CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFL  90



>emb|CDY31490.1| BnaC05g15990D [Brassica napus]
Length=492

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDP + RPSSA++SPF+TTNSGAPVWNNN+SLTVG RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPERVRPSSAHDSPFWTTNSGAPVWNNNASLTVGPRGPILLEDYHLIEKLANFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++L+CADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFL  90



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSSA+N+PF+TTN+G PVWNN+S+LTVG+RGPILLEDYHLVEKL+N+ RERIP
Sbjct  1    MDPYKFRPSSAFNTPFWTTNAGGPVWNNDSALTVGTRGPILLEDYHLVEKLANWTRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHDI++LTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFL  90



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EK + FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKPAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>gb|AIU99482.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK+RPSS  NS F+TTNSGA VWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGASVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFL  90



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -1

Query  252  RPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVHA  73
            RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIPERVVHA
Sbjct  4    RPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVHA  63

Query  72   RGASAKGFFEVTHDITHLTCADFL  1
            RGASAKGFFEVTHDI++LTCADFL
Sbjct  64   RGASAKGFFEVTHDISNLTCADFL  87



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -1

Query  252  RPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVHA  73
            RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIPERVVHA
Sbjct  4    RPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVHA  63

Query  72   RGASAKGFFEVTHDITHLTCADFL  1
            RGASAKGFFEVTHDI++LTCADFL
Sbjct  64   RGASAKGFFEVTHDISNLTCADFL  87



>ref|XP_002510677.1| catalase, putative [Ricinus communis]
 gb|EEF52864.1| catalase, putative [Ricinus communis]
Length=974

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -1

Query  294  NSSLQLPLMDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLS  115
            + SL   L     NRPSS +N+PF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHL+EKL+
Sbjct  475  DKSLGQKLASRLNNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKLA  534

Query  114  NFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFL  1
            NFDRERIPERVVHARGASAKGFFEVTHD++HLTCADFL
Sbjct  535  NFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFL  572


 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = -1

Query  270  MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  91
            MDPYK RPSS+ ++PF+TTN+GAPV NNNSS+TVG RGPILLEDYH++EKL+NF RERIP
Sbjct  1    MDPYKFRPSSSNDTPFWTTNAGAPVSNNNSSMTVGPRGPILLEDYHMIEKLANFTRERIP  60

Query  90   ERVVHARGASAKGFFEVTHDITHLTCADFL  1
            ERVVHARG SAKGFFEVTHD+T LTCADFL
Sbjct  61   ERVVHARGMSAKGFFEVTHDVTDLTCADFL  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519083570308