BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14548_g1_i1 len=985 path=[1:0-984]

Length=985
                                                                      Score     E

emb|CCP37650.1|  catalase-1                                             401   2e-133   
gb|ACL27272.1|  catalase                                                400   2e-133   Nicotiana benthamiana
gb|AFU48609.1|  catalase 1                                              400   2e-133   
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      400   2e-133   
gb|AAB62892.1|  catalase-1                                              400   3e-133   Nicotiana glutinosa
gb|AAB71764.1|  catalase 1                                              400   4e-133   Nicotiana tabacum [American tobacco]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               398   2e-132   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      398   2e-132   
gb|AAR14052.2|  catalase                                                396   7e-132   Solanum tuberosum [potatoes]
gb|AAM97541.1|  catalase 2                                              395   2e-131   Capsicum annuum
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      395   5e-131   
emb|CDP01803.1|  unnamed protein product                                390   3e-129   
ref|NP_001234186.1|  catalase isozyme 2                                 388   2e-128   
emb|CAI43948.1|  catalase                                               387   3e-128   Populus deltoides
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 387   4e-128   
ref|XP_002301920.1|  catalase family protein                            387   4e-128   Populus trichocarpa [western balsam poplar]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      386   1e-127   
gb|KHG12976.1|  Catalase isozyme 2                                      384   5e-127   
ref|XP_007046520.1|  Catalase 2                                         384   5e-127   
gb|ACJ11733.1|  catalase                                                384   6e-127   Gossypium hirsutum [American cotton]
emb|CDY40645.1|  BnaA03g53180D                                          384   7e-127   
ref|XP_009138342.1|  PREDICTED: catalase-2                              384   9e-127   
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         384   9e-127   
gb|ACV92695.1|  catalase                                                383   1e-126   Brassica oleracea
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               383   2e-126   Gossypium hirsutum [American cotton]
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      383   2e-126   
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               383   2e-126   Gossypium hirsutum [American cotton]
ref|XP_007018034.1|  Catalase 2                                         383   2e-126   
gb|KHG25152.1|  Catalase isozyme 1                                      383   2e-126   
ref|XP_009106100.1|  PREDICTED: catalase-2                              383   2e-126   
gb|AAB86582.2|  catalase                                                382   2e-126   Raphanus sativus
gb|AFU90823.1|  catalase                                                381   2e-126   
emb|CDX72514.1|  BnaC07g45360D                                          382   2e-126   
gb|AAF71742.1|AF248491_1  catalase                                      382   3e-126   Raphanus sativus
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         382   3e-126   
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             382   3e-126   
ref|XP_010437527.1|  PREDICTED: catalase-2                              382   3e-126   
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      382   3e-126   
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      382   3e-126   
gb|AFU90822.1|  catalase                                                382   3e-126   
ref|XP_010094556.1|  Catalase isozyme 1                                 382   4e-126   
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      383   4e-126   
emb|CDP01802.1|  unnamed protein product                                381   5e-126   
emb|CDP07287.1|  unnamed protein product                                382   6e-126   
gb|AIA61608.1|  catalase                                                382   7e-126   
ref|XP_011022275.1|  PREDICTED: catalase-like                           381   8e-126   
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      381   8e-126   
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             381   9e-126   Populus trichocarpa [western balsam poplar]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             381   1e-125   
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      381   1e-125   
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             381   1e-125   
dbj|BAJ33995.1|  unnamed protein product                                381   1e-125   
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      380   1e-125   
ref|XP_010530333.1|  PREDICTED: catalase-2                              380   1e-125   
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              380   2e-125   
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      380   3e-125   
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              380   3e-125   
emb|CDX76313.1|  BnaA08g10870D                                          379   3e-125   
gb|ADU56199.1|  catalase                                                380   4e-125   
gb|AAD17936.1|  catalase                                                380   4e-125   Brassica juncea [Indian mustard]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             379   4e-125   
ref|NP_001289779.1|  catalase isozyme 1                                 379   4e-125   
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 379   5e-125   
gb|AAB88173.1|  catalase                                                372   7e-125   Glycine max [soybeans]
gb|AET97564.1|  catalase                                                379   7e-125   
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         379   7e-125   
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             379   8e-125   
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             379   9e-125   
emb|CAD42908.1|  catalase                                               379   9e-125   Prunus persica
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       379   1e-124   
gb|AAD17935.1|  catalase                                                378   1e-124   Brassica juncea [Indian mustard]
gb|AIS20825.1|  CAT                                                     378   1e-124   
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      378   2e-124   
emb|CDY17510.1|  BnaC03g65530D                                          377   2e-124   
emb|CAA64220.1|  catalase                                               378   2e-124   Arabidopsis thaliana [mouse-ear cress]
emb|CAA45564.1|  catalase                                               378   2e-124   Arabidopsis thaliana [mouse-ear cress]
prf||1906388A  catalase                                                 377   2e-124
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      377   3e-124   
gb|AAK96854.1|  catalase                                                377   3e-124   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195235.1|  catalase 2                                            377   3e-124   Arabidopsis thaliana [mouse-ear cress]
gb|AHF27428.1|  catalase                                                372   4e-124   
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          377   4e-124   Soldanella alpina
prf||2104177A  catalase                                                 376   1e-123
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          376   1e-123   Helianthus annuus
emb|CDX69111.1|  BnaC01g03420D                                          375   1e-123   
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      375   2e-123   
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 375   2e-123   
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         375   2e-123   
gb|AAR84578.1|  catalase 1a                                             375   2e-123   Lotus japonicus
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      375   2e-123   
ref|XP_002521709.1|  catalase, putative                                 375   3e-123   Ricinus communis
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      375   3e-123   
gb|KFK30147.1|  catalase                                                374   6e-123   
emb|CAC04509.1|  catalase                                               365   6e-123   Digitalis lanata [Grecian foxglove]
gb|AAO17721.1|  catalase                                                374   8e-123   Hypericum perforatum
ref|XP_002306976.2|  catalase family protein                            374   9e-123   Populus trichocarpa [western balsam poplar]
ref|NP_001240021.1|  catalase                                           373   1e-122   
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 373   1e-122   
gb|AAD17933.1|  catalase                                                373   2e-122   Brassica juncea [Indian mustard]
gb|AAK67359.2|AF390210_1  catalase                                      372   2e-122   Suaeda salsa
ref|NP_001237571.1|  catalase-4                                         372   2e-122   
gb|AAC19397.1|  leaf catalase                                           372   3e-122   Mesembryanthemum crystallinum
gb|AFN81243.1|  catalase 1                                              372   3e-122   
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         372   3e-122   
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               372   4e-122   Cucurbita pepo
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              372   5e-122   
gb|AIP93616.1|  CAT1                                                    372   6e-122   
ref|XP_010692546.1|  PREDICTED: catalase                                371   6e-122   
emb|CAB56850.1|  catalase                                               369   6e-122   Prunus persica
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 371   6e-122   
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                371   6e-122   
gb|AGV54297.1|  peroxisomal catalase                                    370   1e-121   
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      370   1e-121   
gb|ADC95629.1|  catalase                                                370   2e-121   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             370   2e-121   
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    370   2e-121   
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      370   2e-121   
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               369   3e-121   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011100522.1|  PREDICTED: catalase isozyme 1                      369   6e-121   
ref|XP_003558892.1|  PREDICTED: catalase-1                              369   8e-121   
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 369   9e-121   
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          368   9e-121   
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 368   2e-120   
ref|NP_001268098.1|  catalase                                           367   2e-120   
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       364   2e-120   
gb|ACA50528.1|  putative catalase 2                                     367   2e-120   Brassica napus [oilseed rape]
ref|NP_001237556.1|  catalase-1/2                                       367   3e-120   
dbj|BAA34205.1|  catalase                                               367   4e-120   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 367   4e-120   
gb|AAM97542.1|  catalase 3                                              367   4e-120   Capsicum annuum
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             367   4e-120   
ref|NP_001048861.1|  Os03g0131200                                       367   5e-120   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           367   5e-120   
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             367   5e-120   
gb|AHB72694.1|  catalase                                                366   5e-120   
emb|CAD42909.1|  catalase                                               366   6e-120   Prunus persica
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      366   7e-120   
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              366   7e-120   
ref|NP_564121.1|  catalase 1                                            366   7e-120   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001235974.1|  catalase-3                                         366   9e-120   
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              366   1e-119   
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         365   1e-119   
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           365   1e-119   
gb|AGE15298.2|  catalase 1                                              365   2e-119   
gb|AHA50082.1|  catalase                                                364   3e-119   
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 363   6e-119   
ref|XP_004300681.1|  PREDICTED: catalase-like                           363   8e-119   
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       363   9e-119   Triticum aestivum [Canadian hard winter wheat]
gb|ACN36234.1|  unknown                                                 358   1e-118   Zea mays [maize]
dbj|BAJ90861.1|  predicted protein                                      363   1e-118   
gb|AAC17731.1|  catalase 1                                              363   2e-118   Arabidopsis thaliana [mouse-ear cress]
gb|EMT05040.1|  Catalase-1                                              363   2e-118   
ref|XP_010061175.1|  PREDICTED: catalase-like                           362   2e-118   
gb|ABK24453.1|  unknown                                                 362   2e-118   Picea sitchensis
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             362   3e-118   
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          362   3e-118   Vigna radiata var. radiata [golden gram]
gb|ACB11496.1|  catalase                                                362   3e-118   Pinus sylvestris [Scotch pine]
gb|AAF19965.1|AF207906_1  catalase 1                                    362   4e-118   Zantedeschia aethiopica [arum-lily]
dbj|BAJ88747.1|  predicted protein                                      363   5e-118   
gb|ABQ44283.1|  catalase                                                356   5e-118   Saccharum officinarum [noble cane]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 361   5e-118   
gb|AIZ77475.1|  catalase                                                361   6e-118   
gb|ADZ45555.1|  catalase                                                361   6e-118   
gb|AGC65520.1|  catalase                                                361   8e-118   
gb|AIX10947.1|  putative catalase                                       360   9e-118   
gb|ADZ45556.1|  catalase                                                360   2e-117   
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 360   2e-117   
gb|ABM47415.1|  catalase                                                360   2e-117   Prunus avium [gean]
gb|AAY59707.1|  catalase                                                360   2e-117   Oryza sativa Indica Group [Indian rice]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    360   2e-117   Oryza sativa Indica Group [Indian rice]
gb|EPS69543.1|  catalase                                                359   3e-117   
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     362   3e-117   
gb|KEH36312.1|  catalase heme-binding enzyme                            359   3e-117   
gb|ACL35349.1|  catalase                                                359   3e-117   Picea glauca
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 373   3e-117   
dbj|BAA34204.1|  catalase                                               359   5e-117   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA05494.1|  catalase                                               358   5e-117   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058635.1|  Os06g0727200                                       358   7e-117   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ87148.1|  predicted protein                                      352   8e-117   
emb|CDP07288.1|  unnamed protein product                                358   8e-117   
tpg|DAA43177.1|  TPA: catalase2                                         357   2e-116   
gb|AAF61732.1|AF243517_1  catalase 2                                    357   2e-116   Helianthus annuus
gb|AFW69584.1|  catalase1                                               352   2e-116   
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         357   4e-116   
emb|CAG23920.1|  catalase                                               356   4e-116   Festuca arundinacea [tall fescue]
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               356   5e-116   Zea mays [maize]
gb|ACH63223.1|  catalase                                                356   6e-116   Rheum australe [Himalayan rhubarb]
prf||1803522A  catalase                                                 355   9e-116
gb|AIU99480.1|  catalase                                                355   1e-115   
gb|AIU99481.1|  catalase                                                355   1e-115   
ref|NP_001105310.1|  catalase isozyme 2                                 355   1e-115   Zea mays [maize]
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             355   1e-115   
gb|AIU99479.1|  catalase                                                355   2e-115   
gb|KHG21219.1|  Catalase isozyme 1                                      352   2e-115   
ref|XP_010105996.1|  Catalase isozyme 1                                 350   2e-115   
gb|AAC17729.1|  catalase 1                                              351   2e-115   Hordeum vulgare [barley]
gb|AIM43584.1|  catalase                                                354   3e-115   
gb|AIU99485.1|  catalase                                                354   3e-115   
gb|AIU99484.1|  catalase                                                354   3e-115   
tpg|DAA43178.1|  TPA: catalase2                                         355   4e-115   
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               354   4e-115   Ricinus communis
gb|ABY21704.1|  catalase-1 precursor                                    353   5e-115   Panax ginseng [Chinese ginseng]
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    353   6e-115   
emb|CAA42720.1|  catalase-1                                             353   7e-115   Zea mays [maize]
ref|NP_001241808.1|  catalase isozyme B                                 353   7e-115   
emb|CDY31877.1|  BnaC07g15270D                                          353   9e-115   
ref|XP_009103333.1|  PREDICTED: catalase-1                              353   9e-115   
gb|AAB07026.1|  catalase 1                                              353   1e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 353   1e-114   
gb|AAG43363.1|AF151368_1  catalase                                      353   1e-114   Hevea brasiliensis [Para rubber tree]
emb|CDY01363.1|  BnaA07g11360D                                          353   1e-114   
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          352   1e-114   Sorghum bicolor [broomcorn]
gb|AAD37788.1|AF149283_1  catalase 1                                    350   1e-114   Phaseolus vulgaris [French bean]
gb|AIU99482.1|  catalase                                                352   1e-114   
gb|AIU99488.1|  catalase                                                352   2e-114   
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          352   2e-114   
gb|AAF79625.1|AC027665_26  F5M15.5                                      366   2e-114   Arabidopsis thaliana [mouse-ear cress]
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               352   3e-114   Hordeum vulgare [barley]
gb|ABR15776.1|  catalase                                                345   3e-114   Litchi chinensis [litchi]
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 353   3e-114   
gb|AIU99486.1|  catalase                                                352   3e-114   
gb|AIU99487.1|  catalase                                                351   6e-114   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         351   7e-114   
gb|ADN94253.1|  catalase                                                350   1e-113   
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                350   1e-113   
ref|XP_010477308.1|  PREDICTED: catalase-1                              350   2e-113   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      350   2e-113   
ref|XP_002890395.1|  F5M15.5                                            363   3e-113   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         349   3e-113   
ref|NP_001105415.1|  catalase isozyme 1                                 349   3e-113   Zea mays [maize]
gb|AIU99483.1|  catalase                                                349   3e-113   
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                348   4e-113   
gb|ABY19573.1|  catalase                                                340   5e-113   Manihot esculenta [manioc]
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             348   8e-113   
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     348   9e-113   
gb|AAX84671.1|  catalase CAT2                                           340   9e-113   Manihot esculenta [manioc]
gb|ACJ22771.1|  catalase 1                                              348   1e-112   Jatropha curcas
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      347   2e-112   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         347   2e-112   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             348   2e-112   
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              346   4e-112   
dbj|BAH19523.1|  AT4G35090                                              345   8e-112   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031791.1|  catalase 2                                         345   8e-112   Arabidopsis thaliana [mouse-ear cress]
emb|CDY29518.1|  BnaA06g14520D                                          345   9e-112   
emb|CDY31490.1|  BnaC05g15990D                                          345   9e-112   
ref|XP_009149540.1|  PREDICTED: catalase-1                              345   1e-111   
gb|AAA57551.1|  catalase                                                341   2e-111   Nicotiana sylvestris
gb|ACJ76836.3|  catalase                                                345   2e-111   Dimocarpus longan [longan]
gb|AEQ30070.1|  catalase                                                344   2e-111   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             344   2e-111   
emb|CDY52649.1|  BnaAnng11640D                                          342   4e-111   
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    343   9e-111   Nicotiana tabacum [American tobacco]
dbj|BAH37035.1|  catalase 1                                             343   9e-111   Pisum sativum [garden pea]
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      342   1e-110   
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 342   1e-110   
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      342   1e-110   
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             342   2e-110   
dbj|BAC79443.1|  catalase                                               342   2e-110   Acacia ampliceps
gb|AAD50974.1|AF170272_1  catalase CAT1                                 342   2e-110   Manihot esculenta [manioc]
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         342   2e-110   
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               341   5e-110   Zea mays [maize]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          341   5e-110   Avicennia marina
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               341   5e-110   Ricinus communis
gb|AFD29285.1|  catalase                                                341   6e-110   
dbj|BAF91369.1|  catalase                                               340   7e-110   Capsicum annuum
ref|XP_002510677.1|  catalase, putative                                 353   8e-110   Ricinus communis
ref|NP_001031072.3|  catalase 3                                         336   1e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498496.1|  PREDICTED: catalase-3                              339   2e-109   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    339   3e-109   Capsicum annuum
ref|XP_009110221.1|  PREDICTED: catalase-3                              339   3e-109   
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               338   5e-109   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
dbj|BAH20307.1|  AT1G20620                                              337   5e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         338   6e-109   
emb|CDY29519.1|  BnaA06g14510D                                          338   6e-109   
emb|CDY31488.1|  BnaC05g15970D                                          338   6e-109   
ref|XP_009149539.1|  PREDICTED: catalase-3                              339   8e-109   
emb|CDY33636.1|  BnaC08g19360D                                          337   1e-108   
gb|AAF61734.1|AF243519_1  catalase 4                                    337   1e-108   Helianthus annuus
gb|AAC48918.1|  salicylic acid binding catalase                         337   1e-108   Nicotiana tabacum [American tobacco]
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          337   1e-108   
ref|NP_564120.1|  catalase 3                                            337   2e-108   
emb|CAE82295.1|  catalase                                               337   2e-108   
emb|CDY01364.1|  BnaA07g11370D                                          339   2e-108   
gb|AAM65021.1|  unknown                                                 337   2e-108   
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            337   2e-108   
emb|CDY31878.1|  BnaC07g15280D                                          337   2e-108   
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    336   3e-108   
gb|AHF21552.1|  catalase                                                336   4e-108   
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             335   7e-108   
gb|AAD30292.1|AF139539_1  catalase 3                                    335   1e-107   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             335   1e-107   
gb|AGI65617.1|  catalase                                                333   2e-107   
gb|AAD30291.2|AF139538_1  catalase 2                                    334   3e-107   
gb|AAF61733.1|AF243518_1  catalase 3                                    333   4e-107   
gb|AFR53082.1|  CAT                                                     333   5e-107   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      332   1e-106   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          332   1e-106
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      332   1e-106   
gb|ABV55108.1|  catalase 2                                              332   1e-106   
gb|AHF27430.1|  catalase                                                332   2e-106   
gb|AHF27433.1|  catalase                                                331   2e-106   
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      331   2e-106   
gb|AAC49807.1|  catalase 3                                              331   2e-106   
gb|ADU56198.1|  catalase                                                331   3e-106   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      330   5e-106   
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               330   1e-105   
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      329   1e-105   
ref|NP_001234827.1|  catalase isozyme 1                                 328   3e-105   
gb|ADK25939.1|  catalase                                                319   3e-105   
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          328   3e-105   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 328   4e-105   
gb|ADB03784.1|  catalase                                                328   4e-105   
emb|CAA85470.1|  catalase                                               328   4e-105   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               328   5e-105   
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 328   5e-105   
gb|AAR97905.1|  catalase                                                328   5e-105   
gb|ADM96039.1|  catalase                                                328   5e-105   
gb|AAL00886.1|  catalase                                                321   5e-105   
gb|AII23739.1|  catalase                                                327   5e-105   
gb|ACJ73906.1|  CAT2                                                    322   7e-105   
gb|ACJ73905.1|  CAT1                                                    316   9e-105   
gb|ABC01913.1|  catalase isozyme 1-like protein                         327   1e-104   
gb|AAG61140.2|AF332973_1  catalase 2                                    327   1e-104   
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      326   3e-104   
ref|NP_001274863.1|  catalase isozyme 1                                 326   3e-104   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               325   5e-104   
ref|XP_001752315.1|  predicted protein                                  325   6e-104   
gb|AHF27429.1|  catalase                                                323   2e-103   
gb|AHF27432.1|  catalase                                                323   2e-103   
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               322   7e-103   
ref|XP_010692544.1|  PREDICTED: catalase-like                           321   2e-102   
gb|EMS61345.1|  Catalase isozyme 1                                      324   5e-102   
ref|XP_001784759.1|  predicted protein                                  320   7e-102   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     320   7e-102   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      318   3e-101   
ref|NP_001031073.1|  catalase 3                                         317   6e-101   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   319   3e-100   
gb|ABB72796.1|  catalase isozyme 1-like protein                         315   6e-100   
gb|ADQ28492.1|  catalase                                                315   7e-100   
gb|AAC17730.1|  catalase 2                                              311   9e-100   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          313   2e-99    
gb|ACL81498.1|  catalase                                                313   5e-99    
gb|ADY02963.1|  catalase                                                313   5e-99    
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 312   6e-99    
gb|AGT16203.1|  catalase                                                312   8e-99    
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               311   1e-98    
gb|AAZ29552.1|  catalase-C                                              311   2e-98    
gb|EMS51034.1|  Catalase isozyme 2                                      310   5e-98    
emb|CAH61266.1|  catalase                                               310   6e-98    
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      310   7e-98    
ref|NP_001045673.1|  Os02g0115700                                       309   1e-97    
dbj|BAJ92414.1|  predicted protein                                      308   2e-97    
gb|ABN71233.2|  catalase                                                308   2e-97    
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          309   2e-97    
ref|XP_005645077.1|  catalase                                           308   2e-97    
gb|ABK41476.1|  catalase                                                307   6e-97    
gb|AAC19398.1|  root catalase                                           307   6e-97    
gb|EMT06167.1|  Catalase isozyme 2                                      311   2e-96    
gb|AGT16188.1|  catalase                                                306   2e-96    
gb|AGT16310.1|  catalase                                                306   2e-96    
gb|ABK24449.1|  unknown                                                 306   2e-96    
gb|AGT16054.1|  catalase                                                306   2e-96    
gb|AGT15888.1|  catalase                                                305   3e-96    
gb|AHZ13843.1|  catalase                                                305   6e-96    
gb|AAX88799.1|  catalase                                                304   7e-96    
dbj|BAH56915.1|  AT1G20620                                              304   9e-96    
ref|XP_002950455.1|  catalase                                           303   4e-95    
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    303   4e-95    
gb|EMS35721.1|  Catalase isozyme 1                                      295   5e-95    
ref|XP_001696763.1|  catalase/peroxidase                                302   6e-95    
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      301   2e-94    
gb|ABR16304.1|  unknown                                                 299   6e-94    
emb|CAA43814.1|  catalase                                               299   6e-94    
gb|ABK24543.1|  unknown                                                 298   1e-93    
gb|AAB70006.1|  catalase                                                298   1e-93    
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           298   2e-93 
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          297   4e-93    
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              296   9e-93    
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               296   9e-93    
gb|AFW66787.1|  catalase3                                               296   9e-93    
ref|XP_001779509.1|  predicted protein                                  295   5e-92    
emb|CAA73663.1|  catalase                                               294   5e-92    
dbj|BAA34714.1|  catalase                                               294   8e-92    
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             291   5e-91    
gb|AFW66785.1|  catalase3 isoform 1                                     296   1e-90    
gb|AAR84577.1|  catalase 1b                                             288   4e-90    
gb|AEY70510.1|  catalase                                                283   4e-90    
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              289   1e-89    
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      285   2e-88    
gb|AFY26882.1|  catalase                                                274   2e-88    
gb|KFM23952.1|  Catalase isozyme 2                                      280   3e-86    
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)            277   2e-85 
gb|AFW66789.1|  catalase3                                               270   6e-85    
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        274   4e-84    
ref|NP_001105416.1|  catalase isozyme 3                                 274   4e-84    
gb|ABB88582.1|  catalase                                                270   9e-83    
ref|XP_005708279.1|  catalase                                           270   1e-82    
gb|AFW66788.1|  catalase3                                               270   2e-82    
gb|ACV30589.1|  catalase                                                258   3e-82    
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      257   2e-77    
gb|KDD77132.1|  catalase                                                254   1e-76    
gb|AFH53187.1|  catalase                                                246   2e-76    
gb|AFH53190.1|  catalase                                                245   3e-76    
gb|AFH53189.1|  catalase                                                245   3e-76    
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      249   5e-75    
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             247   2e-74    
gb|AFR42410.1|  catalase                                                234   4e-73    
dbj|BAH20283.1|  AT1G20620                                              233   7e-73    
gb|ACU23083.1|  unknown                                                 235   2e-72    
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 241   5e-72    
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 241   8e-72    
ref|XP_005536240.1|  catalase                                           242   1e-71    
gb|AFR42412.1|  catalase                                                228   5e-71    
gb|KEH36313.1|  catalase heme-binding enzyme                            235   1e-69    
gb|AGS17821.1|  catalase 2                                              230   1e-68    
gb|AAP57673.1|  catalase                                                226   2e-68    
gb|AID50071.1|  catalase                                                221   2e-68    
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             227   8e-67    
dbj|BAD07937.1|  catalase catA-like protein                             217   2e-66    
emb|CAA10286.1|  catalase                                               213   3e-65    
gb|AFA36510.1|  catalase                                                216   1e-64    
gb|AAO16182.1|  catalase-1                                              211   2e-64    
gb|ABB51561.1|  truncated catalase 2                                    219   6e-64    
ref|NP_973873.1|  catalase 3                                            216   1e-62    
gb|ABY68160.1|  catalase                                                206   2e-62    
gb|ABY68162.1|  catalase                                                205   4e-62    
gb|ABY68158.1|  catalase                                                204   6e-62    
gb|ABY68159.1|  catalase                                                204   6e-62    
gb|AFI48101.1|  catalase isozyme B                                      204   8e-62    
gb|ABS89000.1|  catalase                                                206   9e-62    
gb|AFI48054.1|  catalase isozyme B                                      203   2e-61    
gb|AFI48111.1|  catalase isozyme B                                      202   3e-61    
gb|ABY68161.1|  catalase                                                202   3e-61    
emb|CBI29556.3|  unnamed protein product                                201   8e-61    
gb|AFI48068.1|  catalase isozyme B                                      201   2e-60    
gb|AFI48130.1|  catalase isozyme B                                      201   2e-60    
gb|AFI48131.1|  catalase isozyme B                                      201   2e-60    
gb|ABY68164.1|  catalase                                                201   2e-60    
gb|AEA86295.1|  putative catalase                                       202   3e-60    
gb|AFI48098.1|  catalase isozyme B                                      200   4e-60    
dbj|BAD94702.1|  catalase                                               197   3e-59    
gb|AFK46618.1|  unknown                                                 195   3e-58    
gb|ACJ71245.1|  catalase 2                                              203   4e-58    
gb|ACJ71244.1|  catalase 2                                              202   1e-57    
gb|AAZ03546.1|  Catalase                                                195   3e-57    
ref|XP_005712277.1|  unnamed protein product                            203   6e-57    
gb|ADR01107.1|  catalase 3                                              198   2e-56    
emb|CDP22058.1|  unnamed protein product                                191   3e-56    
gb|AAY22485.1|  catalase                                                189   9e-55    
gb|AAT68776.1|  catalase                                                190   2e-54    
gb|ABY68163.1|  catalase                                                184   5e-54    
gb|AFV96158.1|  catalase                                                183   8e-53    
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                     185   5e-52    
gb|ACY30463.1|  catalase                                                185   9e-52    
gb|ABN79860.2|  catalase                                                181   4e-51    
emb|CAC16850.1|  catalase                                               177   7e-51    
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     184   1e-50    
gb|AAR25790.1|  catalase                                                175   1e-50    
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             184   2e-50    
emb|CAC17121.1|  catalase                                               175   3e-50    
ref|XP_005642928.1|  catalase                                           184   4e-50    
ref|XP_005644653.1|  catalase-domain-containing protein                 182   9e-49    
ref|XP_004366029.1|  catalase isozyme 2                                 181   2e-48    
gb|EFW40633.2|  catalase isozyme 2                                      181   2e-48    
gb|AAG23803.1|  catalase                                                167   8e-47    
ref|XP_005647994.1|  catalase-domain-containing protein                 175   2e-46    
ref|WP_035160169.1|  catalase                                           171   6e-45    
gb|AII80275.1|  catalase                                                166   6e-45    
ref|WP_032122311.1|  catalase                                           169   1e-44    
gb|AFC35182.1|  catalase dismutase                                      163   6e-44    
gb|KGS11078.1|  catalase                                                162   8e-44    
gb|AAU43642.1|  catalase                                                158   1e-43    
gb|EGH29791.1|  catalase                                                160   2e-43    
ref|WP_029198005.1|  catalase                                           166   2e-43    
ref|WP_032664185.1|  catalase                                           166   3e-43    
ref|WP_032632526.1|  catalase                                           166   3e-43    
gb|AIM05078.1|  catalase                                                161   6e-43    
ref|WP_001069151.1|  catalase                                           165   6e-43    
ref|WP_031421259.1|  catalase                                           165   8e-43    
ref|WP_004887231.1|  catalase                                           165   9e-43    
ref|XP_002963084.1|  hypothetical protein SELMODRAFT_404656             156   1e-42    
ref|WP_038401366.1|  catalase                                           164   1e-42    
ref|WP_032632922.1|  catalase                                           164   1e-42    
ref|WP_031412803.1|  catalase                                           164   2e-42    
ref|WP_015881004.1|  catalase                                           164   2e-42    
gb|AIS15880.1|  catalase                                                164   2e-42    
gb|AIG28769.1|  catalase                                                164   2e-42    
ref|WP_003342200.1|  catalase                                           164   2e-42    
gb|AHB35639.1|  catalase                                                156   2e-42    
gb|AHG41775.1|  catalase                                                164   2e-42    
ref|WP_026590478.1|  catalase                                           163   3e-42    
gb|KGA00789.1|  catalase                                                163   3e-42    
ref|WP_022586116.1|  catalase                                           163   4e-42    
ref|WP_002194469.1|  catalase                                           163   4e-42    
ref|WP_032610664.1|  catalase                                           163   4e-42    
ref|WP_032622880.1|  catalase                                           163   4e-42    
gb|EGH10006.1|  catalase                                                162   5e-42    
ref|WP_029437825.1|  catalase                                           162   6e-42    
ref|WP_001069185.1|  catalase                                           162   6e-42    
ref|WP_001069200.1|  catalase                                           162   6e-42    



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   401 bits (1030),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 199/204 (98%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +CTGKREKCVI KENNFKQPG+RYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWI
Sbjct  409  PSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   400 bits (1029),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 199/204 (98%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +CTGKREKCVI KENNFKQPG+RYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWI
Sbjct  409  PSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   400 bits (1029),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 199/204 (98%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSY
Sbjct  288  VTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSY  347

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP 
Sbjct  348  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPI  407

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +CTGKREKCVI KENNFKQPG+RYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWI
Sbjct  408  PSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWI  467

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  468  SYWSQADKSLGQKLASRLNVRPSI  491



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   400 bits (1029),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +CTGKREKCVI KENNF QPGERYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWI
Sbjct  409  PSTMCTGKREKCVIQKENNFNQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   400 bits (1028),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 199/204 (98%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +CTGKREKCVI KENNFKQPGERYRSF+PDRQERFI RWV+ALSDPRIT+EIRSIWI
Sbjct  409  PSTMCTGKREKCVILKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   400 bits (1028),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 199/204 (98%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +CTGKREKCVI KENNFKQPG+RYRSF+PDRQERFI RWV+ALSDPRITYEIR+IWI
Sbjct  409  PSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNF NENEQLAFCPSIVVPG+YYSDDK+LQTRIFSY
Sbjct  282  VTKTWPEDILPLQPVGRLVLNKNIDNFSNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSY  341

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP 
Sbjct  342  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPI  401

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +CTGKREKCVI KENNFKQPGERYRSF+PDRQERFI RWV+ LSDPRITYEIRSIWI
Sbjct  402  PSTMCTGKREKCVIQKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRITYEIRSIWI  461

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  462  SYWSQADKSLGQKLASRLNVRPSI  485



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   398 bits (1023),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +CTGKREKCVI KENNFKQ G+RYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWI
Sbjct  409  PSTMCTGKREKCVIQKENNFKQAGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   396 bits (1018),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSY
Sbjct  272  VTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSY  331

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYD VRHAE YP 
Sbjct  332  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPI  391

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ VC+GKREKC+I KENNFKQPGERYR+F+PDRQERFI RWV+ALSDPRITYEIRSIWI
Sbjct  392  PSTVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWI  451

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  452  SYWSQADKSLGQKLASRLNVRPSI  475



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   395 bits (1016),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+ PLQP+GRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSY
Sbjct  281  VTKTWPEDIFPLQPLGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSY  340

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE YP 
Sbjct  341  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAENYPI  400

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  VC+GKREKC+I KENNF+QPGERYRSFS DRQERFI RWV+ALSDPRITYEIRSIWI
Sbjct  401  PTTVCSGKREKCIIQKENNFQQPGERYRSFSADRQERFIRRWVEALSDPRITYEIRSIWI  460

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  461  SYWSQADKSLGQKLASRLNVRPSI  484



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   395 bits (1014),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYD VRHAE YP 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ VC+GKREKC+I KENNFKQPGERYR+F+PDRQERFI RWV+ALSDPRITYEIRSIWI
Sbjct  409  PSTVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            +YWSQADKSLGQK+ASRLN+RP++
Sbjct  469  TYWSQADKSLGQKLASRLNVRPSI  492



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   390 bits (1002),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLN+NIDNFFNENEQLAFCP+IVVPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNRNIDNFFNENEQLAFCPAIVVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE+DYFPSRYDPVRHAE +P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVDYFPSRYDPVRHAEMHPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+AV TG+REK +I KENNFKQPGERYRSF+PDRQERFICRWVDALSDPR+TYEIRSIWI
Sbjct  409  PSAVLTGRREKTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVTYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNIRPSI  492



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   388 bits (997),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNF   NEQLAFCPSIVVPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFLYMNEQLAFCPSIVVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYD VRHAE YP 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ VC+GKREKC+I KENNFKQPGERYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWI
Sbjct  409  PSTVCSGKREKCIIQKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            +YWSQADKSLGQK+ASRLN+RP++
Sbjct  469  TYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   387 bits (995),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWI
Sbjct  409  PPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   387 bits (995),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKREKC+I KENNFKQPGERYRS++PDRQERF+CRWVDALSDPR+T+EIRSIWI
Sbjct  409  PPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   387 bits (994),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWI
Sbjct  409  PPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   386 bits (991),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAERYP 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+ TG+REKC+I KENNFKQPGERYRSF+PDRQERFI RWVDALSDPR+TYEIRSIWI
Sbjct  409  PPAILTGRREKCIIPKENNFKQPGERYRSFAPDRQERFIQRWVDALSDPRVTYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   384 bits (987),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+ PLQPVGR+VLNKNIDNFF ENEQLAFCPS++VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ V +GKREKC+IGKENNFKQPGERYRSFS DRQERFI RW+DALSDPR+T+EIRSIWI
Sbjct  409  PSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQKIASRLN+RP++
Sbjct  469  SYWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   384 bits (987),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+ PLQPVGRLVLNKNIDNFF ENEQLAFCPSI+VPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPSIIVPGLYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAE+YP 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAEKYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+C+GKREKC+I KENNF+QPGERYRSF+PDRQERFI RWVDALSDPR+TYEIRSIWI
Sbjct  409  PTAICSGKREKCIIDKENNFQQPGERYRSFAPDRQERFIYRWVDALSDPRVTYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWS+ADKSLGQK+ASRL++RP++
Sbjct  469  SYWSKADKSLGQKLASRLSVRPSI  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   384 bits (987),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVCTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWV+ALSDPR+T+EIRSIWI
Sbjct  409  PPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   384 bits (986),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  282  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  341

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  342  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  401

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWI
Sbjct  402  PPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWI  461

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RPN+
Sbjct  462  SYWSQADKSLGQKLASRLNVRPNI  485



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   384 bits (985),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RPN+
Sbjct  469  SYWSQADKSLGQKLASRLNVRPNI  492



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   384 bits (985),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+YP 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPA  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+G RE+CVI KENNFK+PGERYRSF P+RQERFICRW+DALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGTRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   383 bits (984),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   383 bits (984),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+ PLQP+GR+VLNKNIDNFF ENEQLAFCPS++VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIFPLQPMGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ V +GKREKC+IGKENNFKQPGERYRSFS DRQERFI RW+DALSDPR+T+EIRSIWI
Sbjct  409  PSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQKIASRLN+RP++
Sbjct  469  SYWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+YP 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TGKR+KC++ KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWI
Sbjct  409  PLRVLTGKRDKCIVEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQKIASRLN+RP M
Sbjct  469  SYWSQADKSLGQKIASRLNIRPTM  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVCTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWVDALSDPR+T+EIRSIWI
Sbjct  409  PPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKS+GQK+AS LN+RP++
Sbjct  469  SYWSQADKSVGQKLASLLNVRPSI  492



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAER+P 
Sbjct  349  ADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+G+REKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWI
Sbjct  409  PPAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            +YWSQA KSLGQK+ASRLN++PN+
Sbjct  469  TYWSQACKSLGQKLASRLNVKPNI  492



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVCTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWV+A SDPR+T+EIRSIWI
Sbjct  409  PPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEAFSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPE+L+PLQPVGR+VLNKNIDNF  ENEQLAFCP+I+VPGIYYSDDKLLQTR+FSY
Sbjct  289  VTKTWPEELLPLQPVGRMVLNKNIDNFLAENEQLAFCPAIIVPGIYYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP N+PKCS HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RPN+
Sbjct  469  SYWSQADKSLGQKLASRLNVRPNI  492



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  288  VTKTWPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  347

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  348  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  407

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWI
Sbjct  408  PPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWI  467

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  468  SYWSQADKSLGQKLASRLNVRPSI  491



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   381 bits (978),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  247  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  306

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P 
Sbjct  307  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPI  366

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWI
Sbjct  367  PPAVCSGKRERCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWI  426

Query  392  SYWSQADKSLGQKIASRLNM  333
            SYWSQADKSLGQK+ASRLN+
Sbjct  427  SYWSQADKSLGQKLASRLNV  446



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  277  VTKTWPEDLLPLQPVGRMVLNKNIDNFFTENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  336

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MN MHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  337  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNVMHRDEEVNYFPSRYDPVRHAEKYPT  396

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWI
Sbjct  397  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWI  456

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  457  SYWSQADKSLGQKLASRLNVRPSI  480



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   382 bits (982),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   382 bits (982),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYD VRHAE+YP 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPA  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+CVI KENNFK+PGERYRSF P+RQERFICRW+DALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   382 bits (982),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYS+DKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDPVRHAE +PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  +C G+REKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIR IWI
Sbjct  409  PPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQA KSLGQK+ASRLN+RPN+
Sbjct  469  SYWSQACKSLGQKLASRLNVRPNI  492



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   382 bits (982),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYD VRHAE+YP 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPA  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+CVI KENNFK+PGERYRSF P+RQERFICRW+DALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   382 bits (982),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP +VVPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPGVVVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKC+ HNNH+DG MNF+HRDEE++YFPSRYDPVRHAER+P 
Sbjct  349  SDTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  +CTGKREKCVI KENNFKQPGERYRSF PDRQERFI RW DALSDPR+T+EIRSIWI
Sbjct  409  PPRICTGKREKCVIEKENNFKQPGERYRSFDPDRQERFIKRWFDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+A+RLN++P+M
Sbjct  469  SYWSQADKSLGQKLATRLNVKPSM  492



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   382 bits (982),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYS+DKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDPVRHAE +PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  +C G+REKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIR IWI
Sbjct  409  PPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQA KSLGQK+ASRLN+RPN+
Sbjct  469  SYWSQACKSLGQKLASRLNVRPNI  492



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   382 bits (981),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  288  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  347

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P 
Sbjct  348  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPI  407

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWI
Sbjct  408  PPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWI  467

Query  392  SYWSQADKSLGQKIASRLNM  333
            SYWSQADKSLGQK+ASRLN+
Sbjct  468  SYWSQADKSLGQKLASRLNV  487



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   382 bits (981),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHR+EE++YFPSRYDPVRHAERYP 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHREEEVNYFPSRYDPVRHAERYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+A+CTG+RE+ VI KENNFKQPGERYRSFSPDRQERFI RWV+ALSDPR+T+EIRSIWI
Sbjct  409  PSAICTGRRERTVIDKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   383 bits (983),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYS+DKLLQTRIFSY
Sbjct  309  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSY  368

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDPVRHAE +PT
Sbjct  369  ADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPT  428

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  +C G+REKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIR IWI
Sbjct  429  PPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWI  488

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQA KSLGQK+ASRLN+RPN+
Sbjct  489  SYWSQACKSLGQKLASRLNVRPNI  512



>emb|CDP01802.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   381 bits (978),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 197/211 (93%), Gaps = 7/211 (3%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLN+NIDNFFNENEQLAFCP+IVVPGI+YSDDKLLQTRIFSY
Sbjct  259  VTKTWPEDILPLQPVGRLVLNRNIDNFFNENEQLAFCPAIVVPGIHYSDDKLLQTRIFSY  318

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEE-------IDYFPSRYDPVR  594
            +DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE       +DYFPSRYDPVR
Sbjct  319  ADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEHCTFCPCVDYFPSRYDPVR  378

Query  593  HAERYPTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITY  414
            HAE +P P+AV TG+REK +I KENNFKQPGERYRSF+PDRQERFICRWVDALSDPR+TY
Sbjct  379  HAEMHPIPSAVLTGRREKTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVTY  438

Query  413  EIRSIWISYWSQADKSLGQKIASRLNMRPNM  321
            EIRSIWISYWSQADKSLGQK+ASRLN+RP++
Sbjct  439  EIRSIWISYWSQADKSLGQKLASRLNIRPSI  469



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   382 bits (980),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            V+KTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VSKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERHPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V +GKR+KCVI KENNFKQPGERYRS++PDRQERFICRWVDALSD R+T+EIRSIWI
Sbjct  409  PPPVLSGKRDKCVIQKENNFKQPGERYRSWAPDRQERFICRWVDALSDARVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQKIA+RLN+RP M
Sbjct  469  SYWSQADKSLGQKIATRLNVRPTM  492



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   382 bits (980),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKCS HNNH++G MNFMHRDEE++YFPSRYDP RHAERYP 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPH  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVCTGKRE+CVI KENNFKQPGERYRS++PDRQERFI RWV+ALSDPR+T+EIRSIWI
Sbjct  409  PPAVCTGKRERCVIDKENNFKQPGERYRSWAPDRQERFIRRWVNALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+S+GQK+AS LNMRP++
Sbjct  469  SYWSQADRSVGQKLASHLNMRPSI  492



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   381 bits (978),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  273  VTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  332

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP 
Sbjct  333  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPN  392

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWI
Sbjct  393  PSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWI  452

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+AS LNMRP +
Sbjct  453  SYWSQADKSLGQKLASHLNMRPGI  476



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   381 bits (979),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAETFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +CTGKREKCVI KENNFKQPGERYRS++PDRQERF+ RWVDALSDPR+TYEIRSIWI
Sbjct  409  PSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+S GQK+ASRLN+RP++
Sbjct  469  SYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   381 bits (979),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPN  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWI
Sbjct  409  PSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+AS LNMRP++
Sbjct  469  SYWSQADKSLGQKLASHLNMRPSI  492



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   381 bits (978),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  287  VTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  346

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP 
Sbjct  347  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPN  406

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWI
Sbjct  407  PSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWI  466

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+AS LNMRP++
Sbjct  467  SYWSQADKSLGQKLASHLNMRPSI  490



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   381 bits (978),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAER+P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+AVC+G+REKC+I KENNFKQPGERYRS++PDRQERF+CRWVDALS+PR+T+E+RSIWI
Sbjct  409  PSAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSEPRVTHEVRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+AS LN+RP++
Sbjct  469  SYWSQADKSLGQKLASHLNVRPSI  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   381 bits (978),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   381 bits (978),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE++P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQHPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TGKR+KC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWI
Sbjct  409  PPRVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADK+LGQKIASRLN+RP M
Sbjct  469  SYWSQADKTLGQKIASRLNVRPTM  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAERYP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  +C+G+RE+C+I KENNFKQPGERYRSF+PDRQERFI RW++ALSDPRIT+EIRSIWI
Sbjct  409  PPVICSGRRERCIIEKENNFKQPGERYRSFTPDRQERFIRRWIEALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADQSLGQKLASRLNVRPSI  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   380 bits (977),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPN  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWI
Sbjct  409  PSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+AS LNMRP +
Sbjct  469  SYWSQADKSLGQKLASHLNMRPGI  492



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   380 bits (976),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDPVR+AER+P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRNAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  + +GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWI
Sbjct  409  PPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   380 bits (977),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  308  VTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  367

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP 
Sbjct  368  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPN  427

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWI
Sbjct  428  PSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWI  487

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+AS LNMRP +
Sbjct  488  SYWSQADKSLGQKLASHLNMRPGI  511



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   379 bits (974),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  274  VTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  333

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  334  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  393

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWI
Sbjct  394  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWI  453

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADK+LGQK+ASRLN+RP++
Sbjct  454  SYWSQADKTLGQKLASRLNVRPSI  477



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   380 bits (975),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLN+NIDNFF ENEQLAFCPSIVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPSIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQRYRLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+YP 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+A+ +G  EKCVI KENNFKQPGERYRSFS DR+ERFI RWV+A+SDPR+TYEIRSIWI
Sbjct  409  PSAILSGNCEKCVIPKENNFKQPGERYRSFSSDRKERFIRRWVEAMSDPRVTYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW QADKSLGQKIAS LNMRP M
Sbjct  469  SYWYQADKSLGQKIASHLNMRPTM  492



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   380 bits (975),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+C+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWI
Sbjct  409  PPAICSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+A+RLN+RP++
Sbjct  469  SYWSQADKSLGQKLANRLNVRPSI  492



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   379 bits (974),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIQRWIEALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   379 bits (974),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            V+KTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VSKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKC+ HNNH++G MNF+HR+EE++YFPSRYDPVRHAERYP 
Sbjct  349  SDTQRHRLGPNYLLLPANAPKCAHHNNHHEGFMNFLHREEEVNYFPSRYDPVRHAERYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  +CTGKREKCVI KENNFKQPGERYRS++PDRQERFI RW+DALSDPR+T+EIRSIWI
Sbjct  409  PPQICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFIKRWIDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN++P+M
Sbjct  469  SYWSQADKSLGQKLASRLNVKPSM  492



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   379 bits (974),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+P 
Sbjct  349  ADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  + TG+REKCVI KENNFKQPGERYRS++PDRQERFICRWV+ALSDPR+TYEIR+IWI
Sbjct  409  PFRILTGRREKCVIHKENNFKQPGERYRSWAPDRQERFICRWVEALSDPRVTYEIRTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D+SLGQKIA+RLN++P+M
Sbjct  469  SYWSQCDRSLGQKIATRLNVKPSM  492



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   372 bits (956),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIFSY
Sbjct  105  VTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSY  164

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYDPVRHAE +P 
Sbjct  165  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPI  224

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+C+G+REKC I KENNFKQPGERYRS++PDRQ+RF  RWVDALSDPR+T+EIRS+WI
Sbjct  225  PPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWI  284

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQKIASRL+MRPN+
Sbjct  285  SYWSQADRSLGQKIASRLSMRPNI  308



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   379 bits (973),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQHPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+A+  GKREKC+I KENNFKQPGERYRS++PDRQERFI RW+DALSDPR+T+EIRSIWI
Sbjct  409  PSAIFNGKREKCIIEKENNFKQPGERYRSWAPDRQERFIRRWIDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   379 bits (973),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+VPLQPVGRLVLNKNID+FF ENEQLAFCP I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDIVPLQPVGRLVLNKNIDSFFAENEQLAFCPGIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAERYP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPV  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ VC+G+RE+C+I KENNFKQPGERYRSF+PDR+ERFI RW++ALSDPRIT+EIRSIWI
Sbjct  409  PSVVCSGRRERCIIEKENNFKQPGERYRSFTPDRKERFIRRWIEALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQK+ASR+N+RPN+
Sbjct  469  SYWSQADQSLGQKLASRMNVRPNI  492



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   379 bits (972),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+CVI KENNFK+PGERYRSF P+RQERFI RW++ALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   379 bits (972),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDPVRHAER+P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  + +GKREKC+I KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRS+WI
Sbjct  409  PPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   379 bits (972),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDPVRHAER+P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  + +GKREKC+I KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRS+WI
Sbjct  409  PPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAERYP 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPH  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVCTGKRE+CVI KENNFK+PGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWI
Sbjct  409  PPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            +YWSQAD+S+GQK+AS LN+RP++
Sbjct  469  TYWSQADRSVGQKLASHLNVRPSI  492



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   378 bits (971),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADK+LGQK+ASRLN+RP++
Sbjct  469  SYWSQADKTLGQKLASRLNVRPSI  492



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   378 bits (971),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDP RHAE +P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +CTGKREKCVI KENNFKQPGERYRS++PDRQERF+ RWVDALSDPR+TYEIRSIWI
Sbjct  409  PSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+S GQK+ASRLN+RP++
Sbjct  469  SYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   378 bits (971),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAERYP 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAERYPH  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVCTGKRE+CVI KENNFK+PGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWI
Sbjct  409  PPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+S+GQK+AS LN+RP++
Sbjct  469  SYWSQADRSVGQKLASHLNVRPSI  492



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  274  VTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  333

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  334  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  393

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWI
Sbjct  394  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWI  453

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADK+LGQK+AS LN+RP++
Sbjct  454  SYWSQADKTLGQKLASHLNVRPSI  477



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   378 bits (970),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+CVI KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   378 bits (970),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>prf||1906388A catalase
Length=492

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   377 bits (969),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR++LNKNIDNFF+ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRMILNKNIDNFFSENEQLAFCPAIVVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE +P 
Sbjct  349  ADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAETFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ V TG+REKCVI KENNFKQPGERYRS++PDRQ RFICRWV+ALSDPR+TYEIRSIWI
Sbjct  409  PSCVLTGRREKCVIHKENNFKQPGERYRSWAPDRQGRFICRWVEALSDPRVTYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D+SLGQKIA+RLN++P+M
Sbjct  469  SYWSQCDRSLGQKIATRLNVKPSM  492



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   377 bits (968),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   377 bits (968),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   372 bits (954),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY
Sbjct  141  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSY  200

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAERYP 
Sbjct  201  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPH  260

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNFK+PGERYRS++PDRQERF+ RWVDALSD R+T+EIRSIWI
Sbjct  261  PPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWI  320

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQK+AS LN+RP++
Sbjct  321  SYWSQADRSLGQKLASHLNVRPSI  344



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   377 bits (968),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+++VPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLMPVGRLVLNKNIDNFFAENEQLAFCPALIVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+P 
Sbjct  349  ADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TGKR++C+I KENNFKQPGERYR+F+PDRQERF+CRWVDALSDPR+T+EIRSIWI
Sbjct  409  PPPVLTGKRDRCMIEKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW+QADKSLGQK+ASRLN+RP M
Sbjct  469  SYWTQADKSLGQKLASRLNVRPTM  492



>prf||2104177A catalase
Length=492

 Score =   376 bits (965),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+ PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDP RHAE+YP 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P    +GKR+KCVI KENNFKQPGERYRSFSPDRQERFI R V  LSDPR+T+E+RSIW+
Sbjct  409  PPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWV  468

Query  392  SYWSQADKSLGQKIASRLNMRPN  324
            SYWSQADKSLGQKIASRLN++PN
Sbjct  469  SYWSQADKSLGQKIASRLNVKPN  491



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   376 bits (965),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+ PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDP RHAE+YP 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P    +GKR+KCVI KENNFKQPGERYRSFSPDRQERFI R V  LSDPR+T+E+RSIW+
Sbjct  409  PPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWV  468

Query  392  SYWSQADKSLGQKIASRLNMRPN  324
            SYWSQADKSLGQKIASRLN++PN
Sbjct  469  SYWSQADKSLGQKIASRLNVKPN  491



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   375 bits (963),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  277  VTKTWPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  336

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSRY+PVRHAE+YPT
Sbjct  337  ADTQRHRLGPNYLQLPVNAPKCGHHNNHHEGFMNFMHRDEEVNYFPSRYNPVRHAEKYPT  396

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC GKRE+CVI KENNFK+PGERYR F P+RQERFI RW++ALSDPRIT+EIRSIWI
Sbjct  397  PPAVCAGKRERCVIEKENNFKEPGERYRYFPPERQERFIRRWIEALSDPRITHEIRSIWI  456

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+AS LN+RPN+
Sbjct  457  SYWSQADKSLGQKLASHLNVRPNI  480



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+ PLQPVGR+VLNKNIDNFF ENEQLAFCP++VVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIFPLQPVGRMVLNKNIDNFFGENEQLAFCPALVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER+P 
Sbjct  349  SDTQRHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TGKREKC+I KENNFKQPGERYRSFSPDRQERFI RWV+ALSDP++T+EIRSIWI
Sbjct  409  PTRVLTGKREKCMISKENNFKQPGERYRSFSPDRQERFIRRWVEALSDPKVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ DKSL QK+A+RL+++P+M
Sbjct  469  SYWSQCDKSLSQKLATRLSVKPSM  492



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+ PLQPVGR+VLNKNIDNFFNENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIFPLQPVGRMVLNKNIDNFFNENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+P 
Sbjct  349  SDTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P++V TG+REK +I KENNFKQPGERYRS++PDRQERF+ RWVDALSDPR+T+EIR IWI
Sbjct  409  PSSVVTGRREKSIINKENNFKQPGERYRSWAPDRQERFVHRWVDALSDPRVTHEIRDIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ DKSLGQKIA+RLN++P M
Sbjct  469  SYWSQCDKSLGQKIATRLNVKPTM  492



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLN+NIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNRNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YP 
Sbjct  349  SDTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG+REK VI KENNFKQPGERYRSF+PDR++RFI RWV+ALSDPR+TYEIRSIWI
Sbjct  409  PPPVLTGRREKTVIPKENNFKQPGERYRSFTPDRKDRFIRRWVEALSDPRVTYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQKIAS LNMRP M
Sbjct  469  SYWSQADKSLGQKIASHLNMRPTM  492



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPGI YSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGISYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAERYP 
Sbjct  349  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+CTG RE+C I KENNFKQPGERYRSF+PDRQ+RF+ RWVDALSDPR+T+EIRS WI
Sbjct  409  PPAICTGSRERCAIEKENNFKQPGERYRSFAPDRQDRFVRRWVDALSDPRVTHEIRSTWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQKIAS LN+RP++
Sbjct  469  SYWSQADRSLGQKIASHLNLRPSI  492



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDP RHAE +P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +CTGKREKCVI KENNFKQPGERYRS++PDRQERF+ RWVD LS+PR+T+EIRSIWI
Sbjct  409  PSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+S GQK+ASRLN+RP++
Sbjct  469  SYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   375 bits (962),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCPSIVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPSIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNH++G MN MHRDEE++YFPSRYDP RHAE++P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNIMHRDEEVNYFPSRYDPARHAEQHPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  + +GKREKC+I KENNFKQPGERYRSF+PDR+ERFI RWV+AL+D RITYEIRSIWI
Sbjct  409  PPRILSGKREKCIILKENNFKQPGERYRSFTPDRKERFIRRWVEALTDTRITYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+AS LNMRP M
Sbjct  469  SYWSQADKSLGQKLASHLNMRPTM  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   375 bits (962),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDP RHAE +P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +CTGKREKCVI KENNFKQPGERYRS++PDRQERF+ RWVD LS+PR+T+EIRSIWI
Sbjct  409  PSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+S GQK+ASRLN+RP++
Sbjct  469  SYWSQADRSFGQKLASRLNVRPSI  492



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   374 bits (960),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YP 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDTVRHAEKYPA  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+CVI KENNFK+PGERYRSF P+RQERFI RW++ALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   365 bits (938),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  62   VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  121

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAER+P 
Sbjct  122  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERFPH  181

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P     GKR++  I KENNFKQPGE+YRSF PDRQERFI RWVDALSDPR+T+EIRSIW+
Sbjct  182  PPVALNGKRDRICIEKENNFKQPGEKYRSFPPDRQERFIKRWVDALSDPRLTHEIRSIWV  241

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW+QADKSLGQK+ASRLN+RP M
Sbjct  242  SYWTQADKSLGQKLASRLNIRPTM  265



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   374 bits (959),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPK + HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKSAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V  G+REKC+I KENNFKQPGERYRSFSPDRQERF+ RW+ +LSDPR+T+EIR+IW+
Sbjct  409  PPVVLNGRREKCMIAKENNFKQPGERYRSFSPDRQERFLNRWISSLSDPRVTHEIRAIWV  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            +YW QADKSLGQK+ASRLN+RPNM
Sbjct  469  TYWYQADKSLGQKLASRLNVRPNM  492



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   374 bits (959),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAER+P 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+AVC+G+REKC+I KENNFKQPGERYRS++PDRQERF+ RWVDALS+PR+T+E+RSIWI
Sbjct  409  PSAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVRRWVDALSEPRVTHEVRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+AS LN+RP++
Sbjct  469  SYWSQADKSLGQKLASHLNVRPSV  492



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   373 bits (958),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYDPVRHAE +P 
Sbjct  349  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+C+G+REKC I KENNFKQPGERYRS++PDRQ+RF  RWVDALSDPR+T+EIRS+WI
Sbjct  409  PPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQKIASRL+MRPN+
Sbjct  469  SYWSQADRSLGQKIASRLSMRPNI  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   373 bits (958),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+YP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMHRDEEVNYFPSRFDPCRHAEQYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  + TGKR++C+I KENNFKQPGERYRS+SPDRQERFICRW++ALSDPR+T+EI +IWI
Sbjct  409  PPRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIHTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLG+KIASRLN+RP M
Sbjct  469  SYWSQADKSLGEKIASRLNVRPTM  492



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   373 bits (957),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 197/208 (95%), Gaps = 4/208 (2%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPD----RQERFICRWVDALSDPRITYEIR  405
            P AVC+GKRE+CVI KENNFK+PGERYRSF+P+    RQERFI RW++ALSDPRIT+EIR
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPESFDFRQERFIRRWIEALSDPRITHEIR  468

Query  404  SIWISYWSQADKSLGQKIASRLNMRPNM  321
            SIWISYWSQADK+LGQK+ASRLN+RP++
Sbjct  469  SIWISYWSQADKTLGQKLASRLNVRPSI  496



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCPSIVVPG++YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPSIVVPGVHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKCS HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAERYP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ V  G REK  I KENNFKQPGERYRS  P RQERFICR VDALSDPR+T+EIRSIWI
Sbjct  409  PSNVLNGCREKQCIPKENNFKQPGERYRSMDPARQERFICRVVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLG K+ASRLN+RP M
Sbjct  469  SYWSQADKSLGMKVASRLNVRPTM  492



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYDPVRHAER+P 
Sbjct  349  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+C+G+REKC I KENNFKQPGERYRS++PDRQ+RF  RWVDALSDPR+T+EIRS+WI
Sbjct  409  PPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVTHEIRSVWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQKIAS L+ RPN+
Sbjct  469  SYWSQADRSLGQKIASHLSTRPNI  492



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRD+E+DYFPSRYDPVRHAERYP 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHYDGQMNFMHRDDEVDYFPSRYDPVRHAERYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V  G R++ +I KENNFKQPGERYRS+ P RQERFICRWVDALSDPRIT+EIR+IWI
Sbjct  409  PPNVLNGNRDRQIIQKENNFKQPGERYRSWDPARQERFICRWVDALSDPRITHEIRNIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKS+G K+ASRLN+RP M
Sbjct  469  SYWSQADKSVGMKLASRLNVRPTM  492



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW++AL DPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALFDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
             YWSQADK+ GQK+ASRLN+RP++
Sbjct  469  FYWSQADKTFGQKLASRLNVRPSI  492



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQ+AFCP++VVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQVAFCPALVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC  HNNH+DG MNFMHRDEE++YFPSR+DPVRHAER+P+
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCVHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHAERFPS  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+C+G+REKC+I KENNFKQPGERYRS++PDRQERF+ RWV+ALSD R T+EIRSIWI
Sbjct  409  PPAICSGRREKCIIEKENNFKQPGERYRSWAPDRQERFLKRWVEALSDKRCTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP+ 
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSF  492



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   372 bits (955),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAERYP 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPH  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNFK+PGERYRS++PDRQERF+ RWVDALSD R+T+EIRSIWI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQK+AS LN+RP++
Sbjct  469  SYWSQADRSLGQKLASHLNVRPSI  492



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   372 bits (954),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 196/208 (94%), Gaps = 4/208 (2%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPD----RQERFICRWVDALSDPRITYEIR  405
            P AVC+GKRE+CVI KENNFK+PG RYRSF+PD    RQERFI RW++ALSDPRIT+EIR
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGGRYRSFTPDSFDFRQERFIRRWIEALSDPRITHEIR  468

Query  404  SIWISYWSQADKSLGQKIASRLNMRPNM  321
            SIWISYWSQADK+LGQK+ASRLN+RP++
Sbjct  469  SIWISYWSQADKTLGQKLASRLNVRPSI  496



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   372 bits (954),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKCS HNNHYDG MNFMHR EE+DYFPSRYDPVRHAE++P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRGEEVDYFPSRYDPVRHAEKFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +CTG+RE+ +I KENNFKQPGERYRS  P RQERFICR VDALSDPRIT+EIRSIWI
Sbjct  409  PSNICTGRRERQIIPKENNFKQPGERYRSMDPARQERFICRVVDALSDPRITHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW+QADKSLG K+ASRLN++  M
Sbjct  469  SYWTQADKSLGMKVASRLNVKATM  492



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   371 bits (953),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PL PVGR+VLNKNIDNFF ENEQLAFCP+IVVPG+ YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLLPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGVSYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKCS HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER+P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERHPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ V  GKRE+ +I KENNFKQPGERYRS  P RQERFICR VDALSDPRIT+EIRSIW+
Sbjct  409  PSNVINGKRERQIIAKENNFKQPGERYRSMDPARQERFICRVVDALSDPRITHEIRSIWV  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLG K+ASRLN+RP M
Sbjct  469  SYWSQADKSLGMKVASRLNVRPTM  492



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   369 bits (947),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            +TKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPGIYYSDDK+LQTRIF+Y
Sbjct  220  LTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKMLQTRIFAY  279

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP 
Sbjct  280  SDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPI  339

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ + +GKREKCVI KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRS+WI
Sbjct  340  PSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWI  399

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  400  SYWSQADKSLGQKLASRLNVRPSI  423



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   371 bits (953),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFM+RDEE++YFPSR+DP RHAE+YP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMYRDEEVNYFPSRFDPCRHAEQYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  + TGKR++C+I KENNFKQPGERYRS+SPDRQERFICRW++ALSDPR+T+EIR IWI
Sbjct  409  PPRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIRIIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLG+KIASRLN+RP M
Sbjct  469  SYWSQADKSLGEKIASRLNVRPTM  492



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   371 bits (953),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP +VVPG++YSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGLVVPGVHYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SD+QR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAE++P 
Sbjct  349  SDSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKHPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V +GKR++C I KENNFKQPGERYR+FSPDRQERFI RWVDALSDPR+T+EIRSIWI
Sbjct  409  PPVVLSGKRDRCCIEKENNFKQPGERYRTFSPDRQERFIRRWVDALSDPRLTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP M
Sbjct  469  SYWSQADKSLGQKLASRLNVRPTM  492



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   370 bits (951),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYD VRHAE +P 
Sbjct  349  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+C+G+REKC I KENNFKQ GER+RS++PDRQ+RFI RWVDALSDPR+T+EIRS+WI
Sbjct  409  PPAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQKIAS LNMRPN+
Sbjct  469  SYWSQADRSLGQKIASHLNMRPNI  492



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   370 bits (951),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+P 
Sbjct  349  ADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ + TG+REKCVI KENNFKQPGERYRS+ P+RQERFI RWV+ALSDPR+T+EI+SIWI
Sbjct  409  PSRILTGRREKCVIHKENNFKQPGERYRSWDPNRQERFIRRWVEALSDPRVTHEIQSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ DKSLGQKIA+RLN++P M
Sbjct  469  SYWSQCDKSLGQKIATRLNVKPCM  492



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE++Y PSR+DPVRHAER+P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYLPSRFDPVRHAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVCTG+REKC+I KENNFKQPGERYRS++PDRQERF  RWV+ALSDPR+T+EI SIWI
Sbjct  409  PPAVCTGRREKCIIEKENNFKQPGERYRSWAPDRQERFTHRWVEALSDPRVTHEICSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW+Q DK LGQK+A+RLN+RP++
Sbjct  469  SYWTQCDKFLGQKLATRLNVRPSI  492



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   370 bits (950),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYD VRHAE +P 
Sbjct  349  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+C+G+REKC I KENNFKQ GER+RS++PDRQ+RFI RWVDALSDPR+T+EIRS+WI
Sbjct  409  PPAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQKIAS LNMRPN+
Sbjct  469  SYWSQADRSLGQKIASHLNMRPNI  492



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 191/204 (94%), Gaps = 2/204 (1%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PL PVGRLVLN+NIDNFF ENEQLAFCPSIVVPG++YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLMPVGRLVLNRNIDNFFAENEQLAFCPSIVVPGVFYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAERYP 
Sbjct  349  SDTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+ TGKREK +I KENNFKQPGERYRS++PDRQERFICRWVDALSD   T+EIRS+WI
Sbjct  409  PTAMLTGKREKTIIEKENNFKQPGERYRSWTPDRQERFICRWVDALSD--XTHEIRSVWI  466

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  SYWSQADKSLGQKLASRLNVRPSI  490



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            V+K WPED+VPLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPGI+YSDDKLLQTR+FSY
Sbjct  289  VSKIWPEDIVPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPL  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TGKREKCVIGKENNFKQPGERYRSF P RQERF+ RWV+ALSD R+T+EIR IWI
Sbjct  409  PPRVLTGKREKCVIGKENNFKQPGERYRSFDPARQERFVHRWVEALSDTRVTHEIRGIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            +YWSQ DKSLGQK+A+RLNMRP+M
Sbjct  469  TYWSQCDKSLGQKLATRLNMRPSM  492



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   369 bits (948),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+IVVPG+Y SDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFWPAIVVPGVYCSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SD QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+YP 
Sbjct  349  SDAQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TGKR+KC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIW 
Sbjct  409  PPCVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWF  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADK+LGQKIASRLN+RP M
Sbjct  469  SYWSQADKTLGQKIASRLNVRPTM  492



>ref|XP_011100522.1| PREDICTED: catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   369 bits (947),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RH+E YP 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPTRHSEMYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V +GKREK  I KENNFKQPGERYRS++PDRQERFI RWV+ALSDPR+T+EIRSIWI
Sbjct  409  PPVVLSGKREKRCIEKENNFKQPGERYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP M
Sbjct  469  SYWSQADKSLGQKLASRLNVRPTM  492



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   369 bits (946),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLN+NIDNFF+ENEQLAFCP I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRLVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDG+MNFMHRDEE+DYFPSR+DP +HA RYP 
Sbjct  349  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGTMNFMHRDEEVDYFPSRFDPAKHAPRYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P++ C G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI+SIW+
Sbjct  409  PSSTCNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKSIWL  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQK+ASRL+ +P+M
Sbjct  469  SYWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   369 bits (946),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            +TKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPG+YYSDDK+LQTRIF+Y
Sbjct  289  LTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGVYYSDDKMLQTRIFAY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSRYDPVRHAERYP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +  GKREKCVI KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWI
Sbjct  409  PSNILYGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   368 bits (945),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PL  VGR+VLN+NIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLLLVGRMVLNRNIDNFFTENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDG MNF HRDEE+DYFPSR+DPVRHAE++P 
Sbjct  349  SDTQRHRLGPNYLMLPANAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAEKFPM  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  +C+GKREKC+I KENNFKQPGERYRSF+ DRQERFI RWVDALSDPR+T+EI SIWI
Sbjct  409  PPQICSGKREKCMIEKENNFKQPGERYRSFAIDRQERFIKRWVDALSDPRVTHEILSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ DKSLGQK+A+ LN++PNM
Sbjct  469  SYWSQCDKSLGQKLATHLNLKPNM  492



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENE LAF P++VVPGIYY++DK+LQ RIF+Y
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEMLAFNPALVVPGIYYTNDKMLQGRIFAY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKC+ HNNH+DGSMNFMHRDEE+DYFPSR+DPVRHAE +P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +C GKREK VI KENNFKQPGERYRSF+PDRQERFI RWV+ LSDPR+TYEIRSIWI
Sbjct  409  PSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRP  327
            SYWSQAD+SLGQK+ASRLN++P
Sbjct  469  SYWSQADRSLGQKLASRLNVKP  490



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   367 bits (943),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENE LAF P++VVPGIYY++DK+LQ RIF+Y
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEMLAFNPALVVPGIYYTNDKMLQGRIFAY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKC+ HNNH+DGSMNFMHRDEE+DYFPSR+DPVRHAE +P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +C GKREK VI KENNFKQPGERYRSF+PDRQERFI RWV+ LSDPR+TYEIRSIWI
Sbjct  409  PSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRP  327
            SYWSQAD+SLGQK+ASRLN++P
Sbjct  469  SYWSQADRSLGQKLASRLNVKP  490



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   364 bits (935),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  202  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  261

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQRYRLGPNYLQLP NAPKC+ HNNH+DG MNFM RDEEI+YFPSR DP RHAERYP 
Sbjct  262  ADTQRYRLGPNYLQLPVNAPKCAYHNNHHDGFMNFMDRDEEINYFPSRIDPTRHAERYPQ  321

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+AV TGKRE+CVI KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIR+IWI
Sbjct  322  PSAVYTGKRERCVIEKENNFKQPGERYRSWPSDRQERFVGRWVDALSDPRVTHEIRNIWI  381

Query  392  SYWSQADKSLGQKIASRLNMRPN  324
            SYWSQADKSLG K+AS  N++ N
Sbjct  382  SYWSQADKSLGHKLASHFNLKIN  404



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   367 bits (943),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSIWI
Sbjct  409  PPAVCSGKRERCIIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRP  327
            SYW+QADKSLGQK+ASRLN+RP
Sbjct  469  SYWTQADKSLGQKLASRLNVRP  490



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   367 bits (942),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+ P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKVPV  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  +  GKREKC+I KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIRSIWI
Sbjct  409  PPRILGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQKIAS LN++P++
Sbjct  469  SYWSQADRSLGQKIASHLNLKPSI  492



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   367 bits (942),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+VPLQPVGR+VLN+NIDNFF+ENEQLAFCP I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIVPLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDP +HA RYP 
Sbjct  349  SDTQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+A  TG+REK VI KENNFKQPGERYRS+ P RQ+RFI RW+DALSDPR+T+EIRSIW+
Sbjct  409  PSATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWL  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQK+ASRL+ +P+M
Sbjct  469  SYWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   367 bits (941),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DP  HAERYP 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRIDPAHHAERYPQ  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AV TGKRE+CVI KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIR+IWI
Sbjct  409  PPAVYTGKRERCVIEKENNFKQPGERYRSWPADRQERFVGRWVDALSDPRVTHEIRNIWI  468

Query  392  SYWSQADKSLGQKIASRLNMR  330
            SYWSQADKSLGQK+ASRLN++
Sbjct  469  SYWSQADKSLGQKLASRLNVK  489



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   367 bits (941),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFVENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+YP 
Sbjct  349  ADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V  GKR++C+I KENNFKQPGERYRS++PDRQERFICRWVDALS+PR+T+EIR+IW+
Sbjct  409  PPRVLNGKRDRCIIQKENNFKQPGERYRSWAPDRQERFICRWVDALSEPRVTHEIRTIWL  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN++P M
Sbjct  469  SYWSQADKSLGQKLASRLNVKPTM  492



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   367 bits (941),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            +TKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPGIYYSDDK+LQTRIF+Y
Sbjct  289  LTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKMLQTRIFAY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ + +GKREKCVI KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWI
Sbjct  409  PSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ SRLN+RP++
Sbjct  469  SYWSQADKSLGQKLLSRLNVRPSI  492



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   367 bits (941),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+VPLQPVGR+VLN+NIDNFF+ENEQLAFCP I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIVPLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDP +HA RYP 
Sbjct  349  SDTQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+A  TG+REK VI KENNFKQPGERYRS+ P RQ+RFI RW+DALSDPR+T+EIRSIW+
Sbjct  409  PSATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWL  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQK+ASRL+ +P+M
Sbjct  469  SYWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   367 bits (941),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAERYP 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V +GKR K  I KENNFKQPG+RYRS++PDRQERFI RWV+ALSDPR+T+EIRSIW+
Sbjct  409  PPVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWV  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP M
Sbjct  469  SYWSQADKSLGQKLASRLNVRPAM  492



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   367 bits (943),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 197/230 (86%), Gaps = 26/230 (11%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  572  PAAVCTGKREK--------------------------CVIGKENNFKQPGERYRSFSPDR  471
            P AVC+GKRE+                          C+I KENNFK+PGERYRSF+P+R
Sbjct  409  PPAVCSGKRERVSNQIKPIFFSVSVSYGSESLKFVLQCIIEKENNFKEPGERYRSFAPER  468

Query  470  QERFICRWVDALSDPRITYEIRSIWISYWSQADKSLGQKIASRLNMRPNM  321
            QERFI RW++ALSDPRIT+EIRSIWISYWSQADKSLGQK+ASRLN+RP++
Sbjct  469  QERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  518



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   366 bits (940),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PL PVGR+VLNKNIDNFF ENEQLAFCP+IVVPG+ YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLLPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGVSYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKCS HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER+P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERHPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ V  GKRE+ +I KENNFKQPGERYRS  P RQERFICR VDAL DPRIT+EIRSIW+
Sbjct  409  PSNVINGKRERQIIAKENNFKQPGERYRSMDPARQERFICRVVDALFDPRITHEIRSIWV  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW QADKSLG K+ASRLN+RP M
Sbjct  469  SYWFQADKSLGMKVASRLNVRPTM  492



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   366 bits (940),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            +TKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPGIYYSDDK+LQTRIF+Y
Sbjct  289  LTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKVLQTRIFAY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ + +GKREKCVI KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWI
Sbjct  409  PSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ SRLN+RP++
Sbjct  469  SYWSQADKSLGQKLLSRLNVRPSI  492



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   366 bits (940),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTR+FSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++Y PSR DP RHAE+YP 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYLPSRLDPCRHAEQYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TGKREK +I KENNFKQPGE YRS++PDRQERF+CRWVDALSDPR T+EIRSIWI
Sbjct  409  PPRVLTGKREKVIIEKENNFKQPGEHYRSWAPDRQERFLCRWVDALSDPRATHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP M
Sbjct  469  SYWSQADKSLGQKLASRLNIRPTM  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   366 bits (940),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY
Sbjct  290  VTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSY  349

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSR+DPVRHAER+PT
Sbjct  350  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPT  409

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A  +GKRE+C+  KENNFKQPGERYR+++PDRQ+RF  RW++ALSDPR+T+E+RSIWI
Sbjct  410  PPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWI  469

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQKIAS LNMRP++
Sbjct  470  SYWSQADRSLGQKIASHLNMRPSI  493



>ref|NP_564121.1| catalase 1 [Arabidopsis thaliana]
 sp|Q96528.3|CATA1_ARATH RecName: Full=Catalase-1 [Arabidopsis thaliana]
 gb|AAM97090.1| expressed protein [Arabidopsis thaliana]
 gb|AAQ56816.1| At1g20630 [Arabidopsis thaliana]
 dbj|BAE99222.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29998.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   366 bits (939),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++VVPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT
Sbjct  349  ADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
               VC+G REKC IGKENNFKQPGERYRS+  DRQERF+ R+V+ALS+PR+T+EIRSIWI
Sbjct  409  TPIVCSGNREKCFIGKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+A+RLN+RPN 
Sbjct  469  SYWSQADKSLGQKLATRLNVRPNF  492



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   366 bits (939),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPAN+PKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER P 
Sbjct  349  ADTQRHRLGPNYLQLPANSPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERVPV  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P     GKREKC+I KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIRSIWI
Sbjct  409  PPRTLGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQKIAS LN++P++
Sbjct  469  SYWSQADRSLGQKIASHLNLKPSI  492



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   366 bits (939),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSR+DPVRHAER+PT
Sbjct  349  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A  +GKRE+C+  KENNFKQPGERYR+++PDRQ+RF  RW++ALSDPR+T+E+RSIWI
Sbjct  409  PPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQKIAS LNMRP++
Sbjct  469  SYWSQADRSLGQKIASHLNMRPSI  492



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   365 bits (938),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLN+NIDNFF+ENEQLAFCP I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDP +HA RYP 
Sbjct  349  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+   TG+REK VI KENNFKQPGERYRS+ P RQERFI RW+DALSDPR+T+EIRSIW+
Sbjct  409  PSVNLTGRREKTVIPKENNFKQPGERYRSWDPARQERFIKRWIDALSDPRLTHEIRSIWL  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQK+ASRL+ +P+M
Sbjct  469  SYWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   365 bits (938),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAERYP 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V +GKR K  I KENNFKQPG+RYRS++PDRQERFI RWV+ALSDPR+T+EIRSIW+
Sbjct  409  PPVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWV  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+AS LN+RP M
Sbjct  469  SYWSQADKSLGQKLASHLNVRPTM  492



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   365 bits (936),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  929  TKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  750
            TKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYA  349

Query  749  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  570
            DTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRY P RHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYQPARHAETFPIP  409

Query  569  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  390
            +++ TGKR+KCVI KENNFKQPGERYRS++PDRQERF+ RWVD LS+ R+TYEIRSIWIS
Sbjct  410  SSIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSESRVTYEIRSIWIS  469

Query  389  YWSQADKSLGQKIASRLNMRPNM  321
            YWSQAD+S GQK+A+RLN+RP++
Sbjct  470  YWSQADRSFGQKLATRLNVRPSI  492



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   364 bits (935),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPL  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  + TG+R++C++ KENNFKQPGERYRSFS DRQERFI R VDALSDPR+T+EIRSIWI
Sbjct  409  PPPMLTGRRDRCMVQKENNFKQPGERYRSFSTDRQERFISRLVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW+QA KSLGQK+ASRLN++P++
Sbjct  469  SYWTQACKSLGQKLASRLNVKPSI  492



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   363 bits (933),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTR+FSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR DP RHAE+YP 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLDPCRHAEQYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TGKREK +I KENNFKQPGE YRS++P RQERF+CRWVDALSD R T+EIRSIWI
Sbjct  409  PPRVLTGKREKVIIEKENNFKQPGEHYRSWAPGRQERFVCRWVDALSDLRATHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN+RP M
Sbjct  469  SYWSQADKSLGQKLASRLNIRPTM  492



>ref|XP_004300681.1| PREDICTED: catalase-like [Fragaria vesca subsp. vesca]
Length=492

 Score =   363 bits (933),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+++VPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPALIVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPK + HNNH++G MNFMHRDEE++YFPSR+DPVRHAE +P 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKSAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAESHPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+AV TG+REK +I KENNFKQ GERYRSF+PDRQER+I RWVDALSDPR T+EIRSIWI
Sbjct  409  PSAVYTGRREKSIIEKENNFKQAGERYRSFAPDRQERYIRRWVDALSDPRCTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+AS LN+RPN 
Sbjct  469  SYWSQADKSLGQKLASHLNVRPNF  492



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   363 bits (932),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+VPLQPVGRLVLN+NIDNFF+ENEQLAFCP I+VPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDVVPLQPVGRLVLNRNIDNFFSENEQLAFCPGIIVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RYP 
Sbjct  349  SDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+    G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+
Sbjct  409  PSRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWL  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRL+ +P+M
Sbjct  469  SYWSQADKSLGQKLASRLSSKPSM  492



>gb|ACN36234.1| unknown [Zea mays]
Length=340

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSY
Sbjct  137  VTKTWPEDAFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSY  196

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP 
Sbjct  197  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPI  256

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+
Sbjct  257  PTAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWL  316

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            S WSQAD+SLGQK+ASRL+ +P+M
Sbjct  317  SNWSQADRSLGQKLASRLSAKPSM  340



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   363 bits (932),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+VPLQPVGRLVLN+NIDNFF ENEQLAFCP I+VPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RYP 
Sbjct  349  SDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            PA    G+REK  I KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+
Sbjct  409  PARALNGRREKACIDKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWL  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRL+ +P+M
Sbjct  469  SYWSQADKSLGQKLASRLSAKPSM  492



>gb|AAC17731.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++VVPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT
Sbjct  349  ADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
               VC+G REKC I KENNFKQPGERYRS+  DRQERF+ R+V+ALS+PR+T+EIRSIWI
Sbjct  409  TPIVCSGNREKCFIRKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+A+RLN+RPN 
Sbjct  469  SYWSQADKSLGQKLATRLNVRPNF  492



>gb|EMT05040.1| Catalase-1 [Aegilops tauschii]
Length=526

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+VPLQPVGRLVLN+NIDNFF ENEQLAFCP I+VPG+YYSDDKLLQTRIFSY
Sbjct  323  VTKTWPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSY  382

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RYP 
Sbjct  383  SDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPI  442

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+    G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+
Sbjct  443  PSRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWL  502

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRL+ +P+M
Sbjct  503  SYWSQADKSLGQKLASRLSSKPSM  526



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   362 bits (930),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED+VPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQ+RIFSY
Sbjct  289  VTKIWPEDIVPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+D VRHAE++P 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V  GKR++C+I KENNFKQPGERYRS++PDRQERFI RWV+ALSDPR+T EIRSIWI
Sbjct  409  PPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW+QADKSLGQKIAS LN+RP+M
Sbjct  469  SYWTQADKSLGQKIASCLNVRPSM  492



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+ PLQPVGR+VLNKNIDNFF ENEQLAF P++VVPGIYY++DKLLQTRIFSY
Sbjct  289  VTKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFSPALVVPGIYYTEDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+P 
Sbjct  349  SDTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+   +G REKCVI KENNFKQPGERYRSF PDRQERF+ RWV ALSDPR+T+EI SIWI
Sbjct  409  PSHTHSGMREKCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ+DKSLGQKIA+RLNM+ NM
Sbjct  469  SYWSQSDKSLGQKIAARLNMKANM  492



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   362 bits (929),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKIWPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQ+PANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAER P 
Sbjct  349  ADSQRHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPV  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  +  GKREKC+I KENNFKQPGERYRS++ DRQERF+ RWVDALS+PR+T+EIRSIWI
Sbjct  409  PPRILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQKIAS LN++P++
Sbjct  469  SYWSQADRSLGQKIASHLNLKPSI  492



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   362 bits (928),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYL LPANAPK + HNNH++G MNF+HRDEE++YFPSRYDPVRHAE++P 
Sbjct  349  ADSQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AV +G+REK  I KENNFKQ GER+RS++PDRQ+RFI RWVDALSDPR+T+EIRS+WI
Sbjct  409  PPAVFSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQKIAS LNMRPN+
Sbjct  469  SYWSQADRSLGQKIASHLNMRPNI  492



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   362 bits (928),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+ PLQPVGR+VLNKNIDNFF ENEQLAF P ++VPG+YY++DKLLQTRIFSY
Sbjct  289  VTKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFGPGLIVPGVYYTEDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+P 
Sbjct  349  SDTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+   TGKREKCVI KENNFKQPGERYRSF+P+RQERF+ RWV ALSDPR+T+EI SIWI
Sbjct  409  PSHTHTGKREKCVIEKENNFKQPGERYRSFAPERQERFVKRWVAALSDPRVTHEICSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ DKSLGQKIA+RLNM+ NM
Sbjct  469  SYWSQCDKSLGQKIAARLNMKANM  492



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   362 bits (928),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++P 
Sbjct  349  ADTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  +  G REKC I KENNFKQPGE+YRS++PDRQERFI RW+DALSDPR+T+EIR+IWI
Sbjct  409  PPRILNGGREKCCIQKENNFKQPGEKYRSWAPDRQERFIKRWIDALSDPRVTHEIRTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            +YWSQ DK LGQK+ASRLN++P +
Sbjct  469  TYWSQCDKFLGQKLASRLNIKPTL  492



>dbj|BAJ88747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   363 bits (931),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+VPLQPVGRLVLN+NIDNFF ENEQLAFCP I+VPG+YYSDDKLLQTRIFSY
Sbjct  330  VTKTWPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSY  389

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RYP 
Sbjct  390  SDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPI  449

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            PA    G+REK  I KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+
Sbjct  450  PARALNGRREKACIDKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWL  509

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRL+ +P+M
Sbjct  510  SYWSQADKSLGQKLASRLSAKPSM  533



>gb|ABQ44283.1| catalase [Saccharum hybrid cultivar NCo 376]
Length=339

 Score =   356 bits (913),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+ PLQPVGR+VLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSY
Sbjct  136  VTKTWPEDVFPLQPVGRMVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSY  195

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDP ++A RYP 
Sbjct  196  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKNAPRYPI  255

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P    TG+R+K VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIRSIW+
Sbjct  256  PTVHITGRRDKTVIAKENNFKQPGERYRAMDPARQERFIKRWVDALSDPRLTHEIRSIWL  315

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            S WSQAD+SLGQK+ASRL+ +P+M
Sbjct  316  SNWSQADRSLGQKLASRLSAKPSM  339



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   361 bits (927),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQ VGR+VLNKNIDNFF ENEQLAFCP+IVVPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQAVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LPANAPKC+ HNNH+DG MNF+HRDEE++YFPSRYDPVRHAER P 
Sbjct  349  ADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERCPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ + TG+REKCVI KENNFKQPGERYRS+ PDRQ RFI RWV+ALSDPR+T+EI+SIWI
Sbjct  409  PSRILTGRREKCVIQKENNFKQPGERYRSWDPDRQGRFIRRWVEALSDPRVTHEIQSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ DKSLG+KIA+RLN++P+M
Sbjct  469  SYWSQCDKSLGRKIATRLNVKPSM  492



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   361 bits (927),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+VPLQPVGRLVLN+NIDNFF+ENEQLAFCP I+VPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDVVPLQPVGRLVLNRNIDNFFSENEQLAFCPGIIVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RYP 
Sbjct  349  SDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+    G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+
Sbjct  409  PSRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWL  468

Query  392  SYWSQADKSLGQKIASRLNMRP  327
            SYWSQADKSLGQK+ASRL+ +P
Sbjct  469  SYWSQADKSLGQKLASRLSSKP  490



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   361 bits (927),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYL LPANAPK + HNNH++G MNF+HRDEE++YFPSRYDPVRHAE++P 
Sbjct  349  ADSQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+C+G+REK  I KENNFKQ GER+RS++PDRQ+RF  RWVDALSDPR+T+EIRS+WI
Sbjct  409  PPAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQKIAS L+MRPN+
Sbjct  469  SYWSQADRSLGQKIASHLSMRPNI  492



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   361 bits (926),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  929  TKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  750
            TKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPG+YYS+DK+LQTR+F+YS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAFVVPGVYYSNDKMLQTRLFAYS  349

Query  749  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  570
            DTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRY P RHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYQPARHAETFPIP  409

Query  569  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  390
            + + TGKR+KCVI KENNFKQPGERYRS++PDRQERF+ RWVD LS+PR+TYEIRSIWIS
Sbjct  410  SNIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTYEIRSIWIS  469

Query  389  YWSQADKSLGQKIASRLNMRPNM  321
            YWSQAD+S GQK+A+RLN+RP++
Sbjct  470  YWSQADRSFGQKLATRLNVRPSI  492



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   360 bits (925),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFFNENEQLAF P+ VVPGIYYS+DKLLQ RIF+Y
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFNPAHVVPGIYYSEDKLLQGRIFAY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDT R+RLGPNYLQLP NAPKC+ HNNHYDG MN MHRDEEIDYFPSRYDPVRHAER+P 
Sbjct  349  SDTHRHRLGPNYLQLPVNAPKCAHHNNHYDGYMNIMHRDEEIDYFPSRYDPVRHAERHPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG+RE+ VI KENNFKQP ERYRS++PDRQERF+ RWVDALSDPR+T+EIRSIWI
Sbjct  409  PTRVLTGRRERRVIEKENNFKQPVERYRSWAPDRQERFVRRWVDALSDPRLTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQKIA RLN+RP M
Sbjct  469  SYWSQADKSLGQKIAFRLNVRPTM  492



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   360 bits (924),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D QR+RLGPNYL LPANAPK + HNNH++G MNF+HRDEE++YFPSRYDPVRHAE++P 
Sbjct  349  ADPQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+C+G+REK  I KENNFKQ GER+RS++PDRQ+RF  RWVDALSDPR+T+EIRS+WI
Sbjct  409  PPAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQKIAS L+MRPN+
Sbjct  469  SYWSQADRSLGQKIASHLSMRPNI  492



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   360 bits (924),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DG+MNFMHRDEE++YFPSR+D  RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGTMNFMHRDEEVNYFPSRFDAARHAEKVPV  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKCVI KENNFKQ GERYRSF P RQ+RFI RWVDALSDPRIT+E+R IWI
Sbjct  409  PPRVLTGCREKCVINKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRITHELRGIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   360 bits (923),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            +TKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPGIYYSDDKLLQTRIF+Y
Sbjct  289  LTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAFVVPGIYYSDDKLLQTRIFAY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNY+QLP NAPKC  HNNH DG MNFMHRDEE++YFPSRYDPVRHAER+P 
Sbjct  349  SDTQRHRLGPNYMQLPVNAPKCPHHNNHQDGFMNFMHRDEEVNYFPSRYDPVRHAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ + TGKRE+ VI KENNFKQPGERYRS++PDRQERFI R VDALSDPR+++EIRSIWI
Sbjct  409  PSNILTGKRERRVIEKENNFKQPGERYRSWAPDRQERFIRRCVDALSDPRVSHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQKIA+RLN+RP++
Sbjct  469  SYWSQADKSLGQKIATRLNVRPSI  492



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   360 bits (923),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKCVI KENNFKQ GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R IWI
Sbjct  409  PPRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   360 bits (923),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKCVI KENNFKQ GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R IWI
Sbjct  409  PPRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   359 bits (922),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDVLPLQPVGRLVLNRNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPK + HNNH++G MNFMHRDEE++YFPSRYDPVRHA++ P 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKNAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHADKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+   +G+REK  I KENNFKQPGERYRS+ PDRQERFI RWVDALSDPR+T EIRSIWI
Sbjct  409  PSVPFSGRREKVSIEKENNFKQPGERYRSWDPDRQERFIRRWVDALSDPRLTQEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW+QADKSLGQK+ASRLN+RP M
Sbjct  469  SYWTQADKSLGQKLASRLNVRPTM  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   362 bits (930),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED+VPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQ+RIFSY
Sbjct  381  VTKIWPEDIVPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSY  440

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+D VRHAE++P 
Sbjct  441  ADTQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPI  500

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V  GKR++C+I KENNFKQPGERYRS++PDRQERFI RWV+ALSDPR+T EIRSIWI
Sbjct  501  PPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWI  560

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW+QADKSLGQKIAS LN+RP+M
Sbjct  561  SYWTQADKSLGQKIASCLNVRPSM  584



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   359 bits (922),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSR+DPVRHAE+ P 
Sbjct  349  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A  +  REKC I K+NNFKQPGERYRS++PDRQ+RF+ RWVDALSDPR+T+EIRSIWI
Sbjct  409  PTANFSACREKCNIPKQNNFKQPGERYRSWAPDRQDRFLRRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQKIAS LNMRP++
Sbjct  469  SYWSQADRSLGQKIASHLNMRPSI  492



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   359 bits (922),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+ PLQPVGR+VLNKNIDNFF ENEQLAF P++VVPGIYY++DKLLQTRIFSY
Sbjct  289  VTKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFSPALVVPGIYYTEDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+P 
Sbjct  349  SDTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+   +G REKCVI KENNFKQPGERYRSF PDRQERF+ RWV ALSDPR+T+EI SIWI
Sbjct  409  PSHTHSGMREKCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
             YWSQ+DKSLGQKIA+RLNM+ NM
Sbjct  469  FYWSQSDKSLGQKIAARLNMKANM  492



>ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
 ref|XP_004157075.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=973

 Score =   373 bits (957),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAERYP 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPH  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVCTGKRE+CVI KENNFK+PGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWI
Sbjct  409  PPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLN  336
            +YWSQAD+S+GQK+AS LN
Sbjct  469  TYWSQADRSVGQKLASHLN  487


 Score =   364 bits (934),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  770  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  829

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQRYRLGPNYLQLP NAPKC+ HNNH+DG MNFM RDEEI+YFPSR DP RHAERYP 
Sbjct  830  ADTQRYRLGPNYLQLPVNAPKCAYHNNHHDGFMNFMDRDEEINYFPSRIDPTRHAERYPQ  889

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+AV TGKRE+CVI KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIR+IWI
Sbjct  890  PSAVYTGKRERCVIEKENNFKQPGERYRSWPSDRQERFVGRWVDALSDPRVTHEIRNIWI  949

Query  392  SYWSQADKSLGQKIASRLNMRPN  324
            SYWSQADKSLG K+AS  N++ N
Sbjct  950  SYWSQADKSLGHKLASHFNLKIN  972



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   359 bits (921),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKCVI KENNF+Q GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R IWI
Sbjct  409  PPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   358 bits (920),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKCVI KENNF+Q GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R IWI
Sbjct  409  PPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   358 bits (920),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKCVI KENNF+Q GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R IWI
Sbjct  409  PPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   352 bits (902),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP++ VPGI+YSDDKLLQTRIFSY
Sbjct  99   VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSY  158

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNF+HRDEE++YFPSR+DP RHAE+YP 
Sbjct  159  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPM  218

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V +G REKC+I KENNFKQ GERYRSF P RQ+RF+ RWVDAL+D R+T+EI+SIW+
Sbjct  219  PPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWV  278

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRL ++PNM
Sbjct  279  SYWSQCDASLGQKLASRLKIKPNM  302



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   358 bits (919),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            V+K WPED++PLQPVGRLVLNKNIDN+F E EQLAF P+ VVPGIYY++DKLLQTRIF+Y
Sbjct  289  VSKIWPEDILPLQPVGRLVLNKNIDNYFAETEQLAFNPAFVVPGIYYTEDKLLQTRIFAY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
             DTQR+RLGPNY+QLP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSR+DPVRHA R+P 
Sbjct  349  GDTQRHRLGPNYMQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRFDPVRHAARHPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ V  GKR++CVI KENNFKQ GERYRS++PDRQERFICRWVD LSD R+T+EIRSIWI
Sbjct  409  PSTVLRGKRDRCVIPKENNFKQAGERYRSWAPDRQERFICRWVDILSDARVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+A+RLN+RP M
Sbjct  469  SYWSQADKSLGQKMATRLNVRPTM  492



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   357 bits (917),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSY
Sbjct  290  VTKTWPEDAFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSY  349

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP 
Sbjct  350  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPI  409

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+
Sbjct  410  PTAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWL  469

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            S WSQAD+SLGQK+ASRL+ +P+M
Sbjct  470  SNWSQADRSLGQKLASRLSAKPSM  493



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE+ YFPSRYDPVRHAE+ P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVIYFPSRYDPVRHAEQSPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  + +GKR KCVI KENNFKQPGER+RS+ PDRQERFI R V ALSDPR+T+E+ +IW+
Sbjct  409  PPVMLSGKRNKCVIEKENNFKQPGERFRSWDPDRQERFIRRIVGALSDPRVTHEVCTIWV  468

Query  392  SYWSQADKSLGQKIASRLNMRPN  324
            SYWSQADKSLGQKIASRLN++P+
Sbjct  469  SYWSQADKSLGQKIASRLNVKPS  491



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKN+DNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  150  VTKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSY  209

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P 
Sbjct  210  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  269

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDAL+DPR+T+E R+IWI
Sbjct  270  PPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWI  329

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D +LGQK+ASRLN++P+M
Sbjct  330  SYWSQCDAALGQKLASRLNLKPSM  353



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   357 bits (915),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDVIPLQPVGRMVLNRNIDNFFTENEQLAFCPGVIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYD  ++A RYP 
Sbjct  349  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDAAKNAPRYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+   TG+REK +I KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EIRSIW+
Sbjct  409  PSVPLTGRREKTMIKKENNFKQPGERYRSMDPARQERFIKRWIDALSDPRLTHEIRSIWL  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D+SLGQK+ASRL+ +P+M
Sbjct  469  SYWSQTDRSLGQKLASRLSAKPSM  492



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   356 bits (914),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED+VPLQPVGRLVLN+NIDNFF ENEQLAFCP I+VPG+YYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP   A RYP 
Sbjct  349  SDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPATDAPRYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+    G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+
Sbjct  409  PSRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWL  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQK+A RL+++P+M
Sbjct  469  SYWSQADRSLGQKLAGRLSVKPSM  492



>sp|P12365.3|CATA2_MAIZE RecName: Full=Catalase isozyme 2 [Zea mays]
 emb|CAA38588.1| catalase [Zea mays]
Length=491

 Score =   356 bits (914),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSY
Sbjct  288  VTKTWPEDTFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSY  347

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP 
Sbjct  348  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPI  407

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+
Sbjct  408  PTAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWL  467

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            S WSQAD+SLGQK+ASRL+ +P+M
Sbjct  468  SNWSQADRSLGQKLASRLSAKPSM  491



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   356 bits (913),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VT+TWPED++PL PVGR+VLNKNIDNFF ENEQLAFCP IVVPGIYYSDDKLLQTRIFSY
Sbjct  289  VTRTWPEDILPLIPVGRMVLNKNIDNFFAENEQLAFCPGIVVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+YP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPARHAEKYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V  G+REK +I KENNF++PG RYRSF P RQERFICRW+ ALSDPR+T EIRSIWI
Sbjct  409  PQNVLNGRREKQIIAKENNFEEPGVRYRSFDPARQERFICRWIGALSDPRVTPEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLG K+A+RLN++P M
Sbjct  469  SYWSQADKSLGMKLANRLNVKPTM  492



>prf||1803522A catalase
Length=491

 Score =   355 bits (912),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSY
Sbjct  288  VTKTWPEDRFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSY  347

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP 
Sbjct  348  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPI  407

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+
Sbjct  408  PTAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWL  467

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            S WSQAD+SLGQK+ASRL+ +P+M
Sbjct  468  SNWSQADRSLGQKLASRLSAKPSM  491



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   355 bits (912),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWI
Sbjct  409  PTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWI
Sbjct  409  PTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>ref|NP_001105310.1| catalase isozyme 2 [Zea mays]
 gb|AAA33440.1| catalase [Zea mays]
Length=491

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSY
Sbjct  288  VTKTWPEDRFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSY  347

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP 
Sbjct  348  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPI  407

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+
Sbjct  408  PTAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWL  467

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            S WSQAD+SLGQK+ASRL+ +P+M
Sbjct  468  SNWSQADRSLGQKLASRLSAKPSM  491



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP+IVVPG++YSDDKLLQ+RIFSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQSRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHR+EE++YFPSR +PVRHAE+YPT
Sbjct  349  ADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHREEEVNYFPSRLNPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
               VC+G REKC+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSIWI
Sbjct  409  SPIVCSGNREKCIIKKENNFQQPGERYRSWDSDRQERFVKRFVEALAEPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+A+RLN++PN 
Sbjct  469  SYWSQADKSLGQKLATRLNVKPNF  492



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   355 bits (911),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+A CP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIALCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWI
Sbjct  409  PSRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>gb|KHG21219.1| Catalase isozyme 1 [Gossypium arboreum]
Length=432

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 186/204 (91%), Gaps = 6/204 (3%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVV GIYYSDDKLLQTR+FSY
Sbjct  235  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVRGIYYSDDKLLQTRVFSY  294

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDE+I+YFPSRYDP  HAER+P 
Sbjct  295  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEQINYFPSRYDPSHHAERFPI  354

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+CTGKREK      NNFKQPGERYRS++PDRQERFI  WVDALSDPR+T+EI SIWI
Sbjct  355  PPALCTGKREK------NNFKQPGERYRSWAPDRQERFINSWVDALSDPRVTHEICSIWI  408

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            +YWSQADKSLGQK+A RLN+RP++
Sbjct  409  TYWSQADKSLGQKLACRLNVRPSI  432



>ref|XP_010105996.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXC51646.1| Catalase isozyme 1 [Morus notabilis]
Length=359

 Score =   350 bits (898),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP IVVPG+YYSDDKLLQTRIFSY
Sbjct  161  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSY  220

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHR+EE++YFPSRYDPVRHAERYP 
Sbjct  221  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHREEEVNYFPSRYDPVRHAERYPI  280

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+A+CTG+RE+ VI KENNFKQPGERYRSFSPDRQERFI RWV+ALSDPR+T+EIRSIWI
Sbjct  281  PSAICTGRRERTVIDKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWI  340

Query  392  SYWSQA  375
            SYWSQ 
Sbjct  341  SYWSQV  346



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP++ VPGI+YSDDKLLQTRIFSY
Sbjct  195  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSY  254

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNF+HRDEE++YFPSR+DP RHAE+YP 
Sbjct  255  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPM  314

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V +G REKC+I KENNFKQ GERYRSF P RQ+RF+ RWVDAL+D R+T+EI+SIW+
Sbjct  315  PPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWV  374

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRL ++PNM
Sbjct  375  SYWSQCDASLGQKLASRLKIKPNM  398



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   354 bits (909),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWI
Sbjct  409  PTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   354 bits (909),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWI
Sbjct  409  PTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   354 bits (909),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWI
Sbjct  409  PTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   355 bits (912),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSY
Sbjct  290  VTKTWPEDAFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSY  349

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP 
Sbjct  350  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPI  409

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+
Sbjct  410  PTAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWL  469

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            S WSQAD+SLGQK+ASRL+ +P++
Sbjct  470  SNWSQADRSLGQKLASRLSAKPSI  493



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   354 bits (908),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP IVVPG+ YS+DKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVSYSEDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR DP R+AE +P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRCDPARNAESFPV  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+A+C+GKREKCVI KENNFKQPGERYRS++PDRQERF+ R V  LSDPRIT+E+R+IWI
Sbjct  409  PSAICSGKREKCVIEKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW Q DKSLGQK+A+RLN++P++
Sbjct  469  SYWIQCDKSLGQKLATRLNVKPSI  492



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   353 bits (907),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQ+RIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPK + HNNH++G MNFMHRDEE++YFPSR+D VRH+E++P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKSAHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHSEKHPL  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG+  + +I KENNFKQPGERYRSF PDRQERFI R VDALSDPR+T+EIRSIWI
Sbjct  409  PPPVLTGRCTRAMIEKENNFKQPGERYRSFPPDRQERFIRRVVDALSDPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLG+KIASRLN+RP++
Sbjct  469  SYWSQADKSLGEKIASRLNVRPSI  492



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   353 bits (907),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++P+QPVGRLVLNKNIDNFFNENEQ+AFCP++VVPGI+YSDDKLLQ+RIFSY
Sbjct  289  VTKIWPEDVLPMQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQSRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHR+EE++YFPSR+DPVR+A++YPT
Sbjct  349  ADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRNEEVNYFPSRFDPVRNAQKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
               VC+G REKC+IGKENNFKQPGERYRS+   RQERF+ R+V+AL++PR+T+EIRSIWI
Sbjct  409  TPIVCSGNREKCIIGKENNFKQPGERYRSWDSARQERFVKRFVEALAEPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+ASRLN RP+ 
Sbjct  469  SYWSQADKSLGQKLASRLNARPSF  492



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   353 bits (906),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKN+DNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDAL+DPR+T+E R+IWI
Sbjct  409  PPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D +LGQK+ASRLN++P+M
Sbjct  469  SYWSQCDAALGQKLASRLNLKPSM  492



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   353 bits (906),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKN+DNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDAL+DPR+T+E R+IWI
Sbjct  409  PPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D +LGQK+ASRLN++P+M
Sbjct  469  SYWSQCDAALGQKLASRLNLKPSM  492



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   353 bits (906),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP+IVVPG++YSDDKLLQTRIFSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHA++YPT
Sbjct  349  ADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLNPVRHADKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
                C+G REKC+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSIWI
Sbjct  409  TPVFCSGNREKCMIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRP  327
            SYW+QADKSLGQK+ASRLN+RP
Sbjct  469  SYWTQADKSLGQKLASRLNVRP  490



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   353 bits (905),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP+IVVPG++YSDDKLLQTRIFSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHA++YPT
Sbjct  349  ADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLNPVRHADKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
                C+G REKC+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSIWI
Sbjct  409  TPVFCSGNREKCMIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRP  327
            SYW+QADKSLGQK+ASRLN+RP
Sbjct  469  SYWTQADKSLGQKLASRLNVRP  490



>gb|AAB07026.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++VVP I+YSDD +LQTRIFSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPFIHYSDDNVLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT
Sbjct  349  ADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
               VC+G REKC I KENNFKQPGERYRS+  DRQERF+ R+V+AL +PR+T+EIRSIWI
Sbjct  409  TPIVCSGNREKCFIRKENNFKQPGERYRSWDSDRQERFVKRFVEALWEPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+A+RLN+RPN 
Sbjct  469  SYWSQADKSLGQKLATRLNVRPNF  492



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            +TK WPED++PLQPVGRLVLNKN+DNFF ENEQLAF P+ VVPGIYYS+DKLLQ RIF+Y
Sbjct  289  MTKEWPEDILPLQPVGRLVLNKNVDNFFAENEQLAFNPAFVVPGIYYSNDKLLQARIFAY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDT RYRLGPNYLQLP NAPKC+ HNNH+DG MN MHRDEEI+YFPS++DPVRHAERYP 
Sbjct  349  SDTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNIMHRDEEINYFPSKFDPVRHAERYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ + TGKREK +I KENNFKQPGERYRS++PDRQERFI RW+ AL++PR+T+E RSIWI
Sbjct  409  PSQIVTGKREKVIIEKENNFKQPGERYRSWAPDRQERFINRWIKALTEPRVTHEHRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW+QADKSLGQK+ASRL+ RP+M
Sbjct  469  SYWTQADKSLGQKLASRLSARPSM  492



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP IVVPGI YS+DKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGISYSEDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLG NYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRH+ER+P 
Sbjct  349  SDTQRHRLGSNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRCDPVRHSERFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +C+G+R+KCVI KENNF+QPGERYRS++PDRQERF+ R V  LSDPRIT+E+RSIWI
Sbjct  409  PSTICSGRRDKCVIEKENNFEQPGERYRSWAPDRQERFLNRMVGCLSDPRITHELRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW+Q D+SLGQK+A RLN+RP++
Sbjct  469  SYWTQCDRSLGQKLAFRLNVRPSI  492



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP+IVVPG++YSDDKLLQTRIFSY
Sbjct  289  VTKIWPEDVLPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHA++YPT
Sbjct  349  ADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLNPVRHADKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
                C+G REKC+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSIWI
Sbjct  409  TPVFCSGNREKCMIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRP  327
            SYW+QADKSLGQK+ASRLN+RP
Sbjct  469  SYWTQADKSLGQKLASRLNVRP  490



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPTRHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ V TG REKC+I KENNFKQ GER+RSF P RQ+RFI RWVDALSDPR+T+E  +IWI
Sbjct  409  PSRVLTGCREKCIIEKENNFKQAGERFRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            +YWSQ D SLGQK+ASRLN++PNM
Sbjct  469  NYWSQCDASLGQKLASRLNLKPNM  492



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VT+  PED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY
Sbjct  230  VTRICPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSY  289

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQ+PANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAER P 
Sbjct  290  ADSQRHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPV  349

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  +  GKREKC+I KENNFKQPGERYRS++ DRQERF+ RWVDALS+PR+T+EIRSIWI
Sbjct  350  PPRILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWI  409

Query  392  SYWSQADKSLGQKIASRLN  336
            SYWSQAD+SLGQKIAS LN
Sbjct  410  SYWSQADRSLGQKIASHLN  428



>gb|AIU99482.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP +APKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVDAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWI
Sbjct  409  PTRVQTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWV ALSDPR+T+E  +IWI
Sbjct  409  PTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVGALSDPRVTHEHHTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   352 bits (903),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED+ PLQPVGR+VLN+NIDNFFNENEQLAF P IVVPGIYYSDDK LQ R F+Y
Sbjct  289  VTKEWPEDMFPLQPVGRMVLNRNIDNFFNENEQLAFNPGIVVPGIYYSDDKFLQARTFAY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
             DTQR+RLGPNYL LP NAPKC+ HNNHYDG MNF HRDEE+DYFPSR+DPVRHAER P 
Sbjct  349  GDTQRHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAERCPL  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  + +GKRE+CVI KENNFKQPG+RYRSF+PDRQERF+ R VDALSD R+T+EIRSIWI
Sbjct  409  PPQLVSGKRERCVIEKENNFKQPGDRYRSFAPDRQERFVKRIVDALSDTRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ DKSLGQKIA+RLN++P+M
Sbjct  469  SYWSQCDKSLGQKIATRLNIKPHM  492



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   366 bits (940),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932   VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
             VTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++VVPGI+YSDDKLLQTRIFSY
Sbjct  810   VTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQTRIFSY  869

Query  752   SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
             +D+QR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT
Sbjct  870   ADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPT  929

Query  572   PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
                VC+G REKC IGKENNFKQPGERYRS+  DRQERF+ R+V+ALS+PR+T+EIRSIWI
Sbjct  930   TPIVCSGNREKCFIGKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWI  989

Query  392   SYWSQADKSLGQKIASRLNMRPNM  321
             SYWSQADKSLGQK+A+RLN+RPN 
Sbjct  990   SYWSQADKSLGQKLATRLNVRPNF  1013


 Score =   337 bits (863),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLN+ IDNFFNE EQLAF P +VVPGIYYSDDKLLQ RIF+Y
Sbjct  328  VTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAY  387

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
             DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEEI+Y+PS++DPVR AE+ PT
Sbjct  388  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPT  447

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P    TG R KCVI KENNFKQ G+RYRS++PDRQ+RF+ RWV+ LS+PR+T+EIR IWI
Sbjct  448  PTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWI  507

Query  392  SYWSQADKSLGQKIASRLNMRPN  324
            SYWSQAD+SLGQK+ASRLN+RP+
Sbjct  508  SYWSQADRSLGQKLASRLNVRPS  530



>sp|P55307.1|CATA1_HORVU RecName: Full=Catalase isozyme 1 [Hordeum vulgare]
 gb|AAA96947.1| catalase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ84783.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08157.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   352 bits (903),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP++ VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNF+HRDEE++YFPSR+DP RHAE+YP 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPM  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V +G REKC+I KENNFKQ GERYRSF P RQ+RF+ RWVDAL+D R+T+EI+SIW+
Sbjct  409  PPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWV  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRL ++PNM
Sbjct  469  SYWSQCDASLGQKLASRLKIKPNM  492



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   345 bits (884),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLN+NIDNFFNENEQLAF P +VVPGIYYSDDK+LQ RIF+Y
Sbjct  88   VTKWWPEDIIPLQPVGRLVLNRNIDNFFNENEQLAFNPGLVVPGIYYSDDKMLQCRIFAY  147

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
             DTQR+RLGPNYL LP NAPKC  HNNHYDG MNFMHRDEE+DYFPS++  V +AE++P 
Sbjct  148  GDTQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPI  207

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  +C+GKREK  I KENNFK PG+RYRS++PDRQERFI R VD LSDPR+T+EIRSIW+
Sbjct  208  PGRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWV  267

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQKIASRLN+RPN+
Sbjct  268  SYWSQADKSLGQKIASRLNVRPNI  291



>ref|XP_004966515.1| PREDICTED: catalase isozyme 1-like [Setaria italica]
Length=547

 Score =   353 bits (907),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  344  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSY  403

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P 
Sbjct  404  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  463

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI R VDALSDPR+T+E RSIWI
Sbjct  464  PPRVLTGCREKCIIHKENNFKQAGERYRSFDPARQDRFIQRVVDALSDPRVTHEHRSIWI  523

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  524  SYWSQCDASLGQKLASRLNLKPNM  547



>gb|AIU99486.1| catalase [Saccharum spontaneum]
Length=492

 Score =   352 bits (902),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG  EKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWI
Sbjct  409  PTRVLTGCGEKCIIQKENNFKQAGERYRSFDPARQDRFIRRWVDALSDPRVTHEHHTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   351 bits (900),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHA + P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAGKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IW+
Sbjct  409  PTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWM  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRLN++PNM
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_010459749.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   351 bits (900),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++ VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALAVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QRYRLGPNYLQLP NAPK + HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT
Sbjct  349  ADSQRYRLGPNYLQLPVNAPKSAHHNNHHDGIMNFMHRDEEVNYFPSRMDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
                C+G REK +IGKENNFKQPGERYRS+  DRQERF+ R+++ALS+PR+T+EIRSIW+
Sbjct  409  TPITCSGNREKSIIGKENNFKQPGERYRSWDSDRQERFVKRFLEALSEPRVTHEIRSIWV  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW+QADKSLGQK+A+ LN++ N+
Sbjct  469  SYWTQADKSLGQKLATCLNVKANI  492



>gb|ADN94253.1| catalase [Puccinellia chinampoensis]
Length=492

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAITVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DPVRHAE+YP 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHAEKYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+   TG REKC+I KENNFKQ GER+RSF P  Q+RFI  WVDAL+D R+T+EI+ IWI
Sbjct  409  PSRTLTGCREKCIIEKENNFKQAGERFRSFDPAGQDRFIQWWVDALTDTRVTHEIQGIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRL M+PNM
Sbjct  469  SYWSQCDASLGQKLASRLKMKPNM  492



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+++VPG++YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPALIVPGVHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPK   HNNH++G MNFMHRDEE++YFPSRYDP RHAER+P 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKNGHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERHPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V +GKR++  I KENNFK+PG R+RS++ DRQERFI RWVDALSDPR+T+EIR IWI
Sbjct  409  PPVVLSGKRDRICIEKENNFKEPGVRFRSWATDRQERFIRRWVDALSDPRLTHEIRGIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW+QADKSLGQK+ASRLN+RP M
Sbjct  469  SYWTQADKSLGQKLASRLNVRPTM  492



>ref|XP_010477308.1| PREDICTED: catalase-1 [Camelina sativa]
Length=492

 Score =   350 bits (897),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++ VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALAVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QRYRLGPNYLQLP NAPK + HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT
Sbjct  349  ADSQRYRLGPNYLQLPVNAPKSAHHNNHHDGIMNFMHRDEEVNYFPSRMDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
                C+G REK +IGKENNF+QPGERYRS+  DRQERF+ R+++ALS+PR+T+EIRSIW+
Sbjct  409  TPITCSGNREKSIIGKENNFQQPGERYRSWDSDRQERFVKRFLEALSEPRVTHEIRSIWV  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW+QADKSLGQK+A+ LN++ N+
Sbjct  469  SYWTQADKSLGQKLATCLNVKANI  492



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   350 bits (897),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR++LNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMILNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH++G MNF+HRDEE++YFPSR+DP RHA++YP 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRFDPTRHAQKYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSD R+T+EI+ IWI
Sbjct  409  PTRVLTGCREKCIIEKENNFKQAGERYRSFDPARQDRFIQRWVDALSDARVTHEIQGIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ SRL  +PNM
Sbjct  469  SYWSQCDTSLGQKLGSRLKAKPNM  492



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score =   363 bits (931),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFFNE EQ+AFCP++VVPGI+YSDDKLLQTRIFSY
Sbjct  778  VTKIWPEDILPLQPVGRLVLNKNIDNFFNEYEQIAFCPALVVPGIHYSDDKLLQTRIFSY  837

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT
Sbjct  838  ADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPT  897

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
               VCTG REKC IGKENNF+QPGERYRS+  DRQERF+ R+V+ALS+PR+T+EIRSIWI
Sbjct  898  TPIVCTGNREKCFIGKENNFQQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWI  957

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQK+A+RLN+RPN 
Sbjct  958  SYWSQADKSLGQKLATRLNVRPNF  981


 Score =   334 bits (856),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLN+ IDNFFNE EQLAF P +VVPGIYYSDDKLLQ RIF+Y
Sbjct  296  VTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAY  355

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
             DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEEI+Y+PS++DPVR AE+ P 
Sbjct  356  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKAPI  415

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P    TG R KCVI KENNFKQ G+RYRS++PDRQ+RF+ RWV+ LS+PR+T+EIR IWI
Sbjct  416  PTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWI  475

Query  392  SYWSQADKSLGQKIASRLNMRPN  324
            SYWSQAD+SLGQK+ASRLN+RP+
Sbjct  476  SYWSQADRSLGQKLASRLNVRPS  498



>ref|XP_010498497.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   349 bits (896),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++ VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALAVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QRYRLGPNYLQLP NAPK + HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT
Sbjct  349  ADSQRYRLGPNYLQLPVNAPKSAHHNNHHDGIMNFMHRDEEVNYFPSRMDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
                C+G REK +IGKENNFKQPG+RYRS+  DRQERF+ R+++ALS+PR+T+EIRSIW+
Sbjct  409  TPITCSGNREKSIIGKENNFKQPGDRYRSWDSDRQERFVKRFLEALSEPRVTHEIRSIWV  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW+QADKSLGQK+A+ LN++ N+
Sbjct  469  SYWTQADKSLGQKLATCLNVKANI  492



>ref|NP_001105415.1| catalase isozyme 1 [Zea mays]
 emb|CAA31056.1| unnamed protein product [Zea mays]
Length=492

 Score =   349 bits (895),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKN+DNFF ENEQ+AFCP+I VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAISVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDAL+DPR+T+E R+IWI
Sbjct  409  PPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D +LGQK+ SRLN++P+M
Sbjct  469  SYWSQCDAALGQKLPSRLNLKPSM  492



>gb|AIU99483.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   349 bits (895),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP +APKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVDAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V TG REKC+I KENNFKQ GERYRSF P  Q+RFI RWVDALSDPR+T+E  +IWI
Sbjct  409  PTRVLTGCREKCIIQKENNFKQAGERYRSFDPAGQDRFIQRWVDALSDPRVTHEHHTIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQ++ASRLN++PNM
Sbjct  469  SYWSQCDASLGQELASRLNLKPNM  492



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   348 bits (893),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFF ENE LAF P IVVPGIYYS+DK+LQ RIF+Y
Sbjct  274  VTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAY  333

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
             DTQR+RLGPNYL LP NAPKC   NNHYDG MNFMHRDEE+DYFPSRYDP RHAERYP 
Sbjct  334  GDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPI  393

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ V TG+REK  I KENNFKQPGERYRS++PDRQERF+ RW+ AL DPR+T+E+RSIW+
Sbjct  394  PSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWV  453

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQK+ASRLN+RP++
Sbjct  454  SYWSQADRSLGQKLASRLNVRPSI  477



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   340 bits (873),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            +TK WPED+ PLQ +GRLVLN+NIDN+F ENE LAF P  VVPGI+YS+DKL Q R F+Y
Sbjct  58   MTKIWPEDMFPLQQLGRLVLNRNIDNWFAENEMLAFDPGHVVPGIHYSNDKLFQLRTFAY  117

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNY  LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER P 
Sbjct  118  ADTQRHRLGPNYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPL  177

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+ +G+REKCVI KENNFKQPG+RYRS++PDRQERF+CR V+ALSDPRIT+EIRSIW+
Sbjct  178  PHAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWV  237

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ DKSLGQK+ASRLN+RPN 
Sbjct  238  SYWSQCDKSLGQKLASRLNVRPNF  261



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   348 bits (893),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFF ENE LAF P IVVPGIYYS+DK+LQ RIF+Y
Sbjct  290  VTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAY  349

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
             DTQR+RLGPNYL LP NAPKC   NNHYDG MNFMHRDEE+DYFPSRYDP RHAERYP 
Sbjct  350  GDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPI  409

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ V TG+REK  I KENNFKQPGERYRS++PDRQERF+ RW+ AL DPR+T+E+RSIW+
Sbjct  410  PSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWV  469

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+SLGQK+ASRLN+RP++
Sbjct  470  SYWSQADRSLGQKLASRLNVRPSI  493



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   348 bits (894),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PL PVGRLVLN+N+DNFF ENE LAF PS++VPGIY+S+DK+LQTRIF+Y
Sbjct  310  VTKIWPEDILPLMPVGRLVLNRNVDNFFAENEMLAFSPSMIVPGIYFSNDKMLQTRIFAY  369

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+R+GPNYLQLP NAPKC  HNNH+DG+MNFMHRDEE++YFPSRYDP RHAE++P 
Sbjct  370  ADTQRHRIGPNYLQLPVNAPKCPHHNNHHDGAMNFMHRDEEVNYFPSRYDPCRHAEKFPI  429

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V +G+R K VI KENNFKQPG+RYRS++PDRQERFI RW+DALSDPR+T EIRSIW+
Sbjct  430  PPVVLSGQRVKTVIEKENNFKQPGDRYRSWAPDRQERFIRRWIDALSDPRLTAEIRSIWV  489

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW+QADKSLGQK+ASRLN+RP M
Sbjct  490  SYWTQADKSLGQKLASRLNVRPAM  513



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   340 bits (872),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            +TK WPED+ PLQ +GRLVLN+NIDN+F ENE LAF P  VVPGI+YS+DKL Q R F+Y
Sbjct  67   MTKIWPEDMFPLQQLGRLVLNRNIDNWFAENEMLAFDPGHVVPGIHYSNDKLFQLRTFAY  126

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNY  LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER P 
Sbjct  127  ADTQRHRLGPNYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPL  186

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+ +G+REKCVI KENNFKQPG+RYRS++PDRQERF+CR V+ALSDPRIT+EIRSIW+
Sbjct  187  PHAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWV  246

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ DKSLGQK+ASRLN+RPN 
Sbjct  247  SYWSQCDKSLGQKLASRLNVRPNF  270



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            +TK WPED+ PLQP+GRLVLN+NIDN+F ENE LAF P+ VVPGI+YS+DKL Q R F+Y
Sbjct  289  MTKIWPEDIFPLQPIGRLVLNRNIDNWFAENEMLAFNPAHVVPGIHYSNDKLFQLRTFAY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDTQR+RLGPNY+QLP NAPKC  HNNHYDG MNFMHRDEEIDYF SRYDPVRHAERYP 
Sbjct  349  SDTQRHRLGPNYMQLPVNAPKCPHHNNHYDGFMNFMHRDEEIDYFQSRYDPVRHAERYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P A+ +G+REKCVI KENNFKQPGERYRS++PDRQERF+CR V+ALSDPRIT+EIR IW+
Sbjct  409  PNAIISGRREKCVIPKENNFKQPGERYRSWTPDRQERFLCRLVNALSDPRITHEIRGIWV  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D+SLGQK+ASRLN+RPN+
Sbjct  469  SYWSQCDQSLGQKLASRLNVRPNI  492



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            +TK WPED++PLQPVGRLVLN+N+DNFF ENEQLAF P+ VVPGIY+S+DKLLQ RIF+Y
Sbjct  289  MTKIWPEDILPLQPVGRLVLNQNVDNFFAENEQLAFNPAFVVPGIYFSNDKLLQARIFAY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            SDT RYRLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEEI+YFPS++DPVRHAERYP 
Sbjct  349  SDTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEINYFPSKFDPVRHAERYPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ + TGKRE+ +I KENNFKQ GERYRS++PDRQERFI RW+ ALS+PR+T+E RSIWI
Sbjct  409  PSQIVTGKRERVIIEKENNFKQAGERYRSWAPDRQERFINRWIKALSEPRVTHEHRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYW+QADKS+GQK+AS L+ RP+M
Sbjct  469  SYWTQADKSIGQKLASSLSARPSM  492



>sp|P55313.1|CATA2_WHEAT RecName: Full=Catalase [Triticum aestivum]
 emb|CAA64077.1| catalase [Triticum aestivum]
Length=492

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP++ VPGI+YSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNF+HRDEE++YFPSR DP RHAE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRVDPTRHAEKDPM  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  V +G REKC+I KENNFKQ GERYRSF P RQ+RF+ RWVDAL+D R+T+EI+SIW+
Sbjct  409  PPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWV  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQ D SLGQK+ASRL ++PNM
Sbjct  469  SYWSQCDASLGQKLASRLKIKPNM  492



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY
Sbjct  289  VTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPN  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWI
Sbjct  409  PSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWI  468

Query  392  SYWSQA  375
            SYWSQ 
Sbjct  469  SYWSQV  474



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   346 bits (887),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+CVI KENNFK+PG RYRSF+PDRQERFI RW++ALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGGRYRSFTPDRQERFIRRWIEALSDPRITHEIRSIWI  468

Query  392  SYWSQA  375
            SYWSQ 
Sbjct  469  SYWSQV  474



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   345 bits (884),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWI  468

Query  392  SYWSQA  375
            SYWSQ 
Sbjct  469  SYWSQV  474



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   345 bits (884),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY
Sbjct  289  VTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPT  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P AVC+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWI  468

Query  392  SYWSQA  375
            SYWSQ 
Sbjct  469  SYWSQV  474



>emb|CDY29518.1| BnaA06g14520D [Brassica napus]
Length=492

 Score =   345 bits (886),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCP+IVVPG +YSDDKLLQ+RIFSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPAIVVPGFHYSDDKLLQSRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHAE+YP 
Sbjct  349  ADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRLNPVRHAEKYPQ  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
                C G REKC+I KENNFKQPGERYRS+  DRQERF+ R+VDAL++PR+T+EIRSIWI
Sbjct  409  NPIACAGNREKCMIEKENNFKQPGERYRSWDADRQERFVKRFVDALAEPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            S W++AD+SLGQK+A+RLN+ PN 
Sbjct  469  SNWTKADESLGQKLATRLNVSPNF  492



>emb|CDY31490.1| BnaC05g15990D [Brassica napus]
Length=492

 Score =   345 bits (886),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCP+IVVPG +YSDDKLLQ+RIFSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPAIVVPGFHYSDDKLLQSRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHAE+YP 
Sbjct  349  ADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRLNPVRHAEKYPQ  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
                C G REKC+I KENNFKQPGERYRS+  DRQERF+ R+VDAL++PR+T+EIRSIWI
Sbjct  409  NPIACAGNREKCMIEKENNFKQPGERYRSWDADRQERFVKRFVDALAEPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            S W++AD+SLGQK+A+RLN+ PN 
Sbjct  469  SNWTKADESLGQKLATRLNVSPNF  492



>ref|XP_009149540.1| PREDICTED: catalase-1 [Brassica rapa]
 ref|XP_009149541.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   345 bits (885),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCP+IVVPG +YSDDKLLQ+RIFSY
Sbjct  289  VTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPAIVVPGFHYSDDKLLQSRIFSY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHAE+YP 
Sbjct  349  ADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRLNPVRHAEKYPQ  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
                C G REKC+I KENNFKQPGERYRS+  DRQERF+ R+VDAL++PR+T+EIRSIWI
Sbjct  409  NPIACAGNREKCMIEKENNFKQPGERYRSWDADRQERFVKRFVDALAEPRVTHEIRSIWI  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            S W++AD+SLGQK+A+RLN+ PN 
Sbjct  469  SNWTKADESLGQKLATRLNVSPNF  492



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score =   341 bits (874),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPED++PL PVGRLVLN+NIDNFF ENEQLAF P  +VPG+YYS+DKLLQTRIF+Y
Sbjct  180  VTKTWPEDILPLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAY  239

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+R+GPNY+QLP NAPKC+ HNNH DG+MNFMHRDEE+DY PSR+DP RHAE+YP 
Sbjct  240  ADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPI  299

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ V TG+RE CVI KENNFKQ GERYRS+ PDRQ+R++ +WV+ LSDPR+TYEIRSIWI
Sbjct  300  PSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWI  359

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SY SQADKS GQK+ASRL ++P M
Sbjct  360  SYLSQADKSCGQKVASRLTLKPTM  383



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQPVGRLVLN+NIDNFFNENEQLAF P +VVPGIYYSDDK+LQ RIF+Y
Sbjct  289  VTKWWPEDIIPLQPVGRLVLNRNIDNFFNENEQLAFNPGLVVPGIYYSDDKMLQCRIFAY  348

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
             DTQR+RLGPNYL LP NAPKC  HNNHYDG MNFMHRDEE+DYFPS++  V +AE++P 
Sbjct  349  GDTQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPI  408

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+ +C+GKREK  I KENNFK PG+RYRS++PDRQERFI R VD LSDPR+T+E+RSIW+
Sbjct  409  PSRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFELRSIWV  468

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQKIASRLN+RPN+
Sbjct  469  SYWSQADKSLGQKIASRLNVRPNI  492



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTK WPED++PLQP GRLVLN+NIDNFFNENEQLAF P +VVPGIYYSDDK+LQ RIF+Y
Sbjct  284  VTKWWPEDIIPLQPAGRLVLNRNIDNFFNENEQLAFNPGLVVPGIYYSDDKMLQCRIFAY  343

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
             DTQR+RLGPNYL LP NAPKC  HNNHYDG MNFMHRDEE+DYFPS++  V +AE++P 
Sbjct  344  GDTQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPI  403

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P  +C+GKREK  I KENNFK PG+RYRS++PDRQERFI R VD LSDPR+T+EIRSIW+
Sbjct  404  PGRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWV  463

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQADKSLGQKIASRLN+RPN+
Sbjct  464  SYWSQADKSLGQKIASRLNVRPNI  487



>ref|XP_002963086.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
 gb|EFJ36549.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
Length=484

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  932  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  753
            VTKTWPEDL PLQPVGRLVLNKNIDNFF ENEQLAFCP++VVPG+YY+DDKLLQTRIFSY
Sbjct  281  VTKTWPEDLFPLQPVGRLVLNKNIDNFFAENEQLAFCPALVVPGVYYTDDKLLQTRIFSY  340

Query  752  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  573
            +DTQR+RLGPNYL LPANAPKC+ HNNH++G MNF HRDEE++YFPSR+DP RHAER P 
Sbjct  341  ADTQRHRLGPNYLLLPANAPKCAHHNNHHEGFMNFTHRDEEVNYFPSRFDPCRHAERVPI  400

Query  572  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  393
            P+    G+REK +I KENNF QPG R+RS+  DRQERFI R VDALSDPR+T+EIRSIW+
Sbjct  401  PSHPLGGRREKVMIEKENNFAQPGARFRSWPADRQERFIARVVDALSDPRVTHEIRSIWL  460

Query  392  SYWSQADKSLGQKIASRLNMRPNM  321
            SYWSQAD+ LGQKIA++LN++ NM
Sbjct  461  SYWSQADRMLGQKIATKLNVKANM  484



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2169515985086