BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14513_g1_i1 len=210 path=[1:0-209]

Length=210
                                                                      Score     E

ref|XP_004291065.1|  PREDICTED: transcription factor MYB44-like         101   5e-24   
gb|AGN52031.1|  MYB-related transcription factor                      97.4    2e-22   
emb|CDP01282.1|  unnamed protein product                              97.1    2e-22   
emb|CDP02540.1|  unnamed protein product                              97.1    3e-22   
gb|EYU25477.1|  hypothetical protein MIMGU_mgv1a010338mg              96.7    4e-22   
ref|NP_001235142.1|  MYB transcription factor MYB112                  95.5    7e-22   
ref|XP_011074411.1|  PREDICTED: transcription factor MYB44-like       95.9    7e-22   
ref|XP_007156759.1|  hypothetical protein PHAVU_002G015100g           95.5    7e-22   
ref|XP_010059753.1|  PREDICTED: transcription factor MYB44-like       95.5    8e-22   
gb|KDP41681.1|  hypothetical protein JCGZ_16088                       95.1    1e-21   
gb|AGN52056.1|  MYB-related transcription factor                      94.7    1e-21   
ref|NP_001238087.1|  MYB transcription factor MYB50                   95.1    1e-21   
gb|AIK01747.1|  MYB                                                   94.7    1e-21   
ref|XP_001753593.1|  predicted protein                                91.3    1e-21   
gb|AEO27498.1|  MYB2                                                  94.7    2e-21   
ref|XP_007227715.1|  hypothetical protein PRUPE_ppa008979mg           94.4    2e-21   
ref|XP_011099313.1|  PREDICTED: transcription factor MYB44-like       94.7    2e-21   
ref|XP_011029247.1|  PREDICTED: transcription factor MYB44-like       94.4    2e-21   
ref|XP_006374871.1|  hypothetical protein POPTR_0014s02260g           94.4    2e-21   
ref|XP_004151866.1|  PREDICTED: transcription factor MYB44-like       94.4    2e-21   
ref|XP_008462845.1|  PREDICTED: transcription factor MYB44-like       94.4    2e-21   
gb|KDO84060.1|  hypothetical protein CISIN_1g022144mg                 94.4    2e-21   
ref|XP_002302428.2|  hypothetical protein POPTR_0002s12410g           94.4    2e-21   Populus trichocarpa [western balsam poplar]
gb|ACJ85153.1|  unknown                                               92.8    2e-21   Medicago truncatula
ref|XP_006434697.1|  hypothetical protein CICLE_v10001979mg           94.0    2e-21   
ref|NP_001275798.1|  putative R2R3-MYB transcription factor           94.0    2e-21   
ref|XP_002285015.1|  PREDICTED: transcription factor MYB44-like       94.0    3e-21   Vitis vinifera
emb|CBI19466.3|  unnamed protein product                              93.6    3e-21   
ref|XP_011017151.1|  PREDICTED: transcription factor MYB44-like       94.0    3e-21   
ref|XP_008220277.1|  PREDICTED: transcription factor MYB44-like       94.0    3e-21   
ref|XP_010556427.1|  PREDICTED: transcription factor MYB44-like       94.0    3e-21   
gb|AFK47194.1|  unknown                                               94.0    3e-21   
ref|XP_008440323.1|  PREDICTED: transcription factor MYB44            93.6    3e-21   
gb|ADN33728.1|  MYB transcription factor                              92.8    3e-21   
ref|XP_010691674.1|  PREDICTED: transcription factor MYB44-like       93.6    3e-21   
ref|XP_004142878.1|  PREDICTED: transcription factor MYB44-like       93.6    3e-21   
ref|XP_003611666.1|  R2R3-MYB transcription factor                    94.0    3e-21   
gb|AAG08959.1|AF122051_1  tuber-specific and sucrose-responsive e...  94.0    3e-21   Solanum tuberosum [potatoes]
ref|XP_010095320.1|  Transcription factor                             93.6    3e-21   
ref|XP_004141899.1|  PREDICTED: transcription factor MYB44-like       93.6    3e-21   
gb|AGL76985.1|  MYB transcription factor                              93.6    3e-21   
ref|XP_008444592.1|  PREDICTED: transcription factor MYB44-like       93.6    4e-21   
ref|XP_009586849.1|  PREDICTED: transcription factor MYB44-like       94.0    4e-21   
dbj|BAC53938.1|  Myb-like protein                                     94.0    4e-21   Nicotiana tabacum [American tobacco]
gb|EPS70032.1|  myb-like protein                                      91.3    4e-21   
ref|XP_002510155.1|  r2r3-myb transcription factor, putative          93.6    4e-21   Ricinus communis
ref|XP_010271172.1|  PREDICTED: transcription factor MYB44-like       93.6    4e-21   
emb|CDY43567.1|  BnaC02g16640D                                        92.4    4e-21   
ref|XP_006339846.1|  PREDICTED: transcription factor MYB44-like       94.0    4e-21   
ref|XP_009795719.1|  PREDICTED: transcription factor MYB44-like       93.6    4e-21   
ref|XP_010315996.1|  PREDICTED: transcription factor MYB44-like       94.0    4e-21   
gb|ABQ10818.1|  putative R2R3-Myb transcription factor                93.6    5e-21   Citrus sinensis [apfelsine]
ref|XP_009588514.1|  PREDICTED: transcription factor MYB44            93.6    5e-21   
ref|XP_004141275.1|  PREDICTED: transcription factor MYB44-like       92.8    5e-21   
ref|XP_007205522.1|  hypothetical protein PRUPE_ppa008450mg           93.6    5e-21   
ref|XP_004511885.1|  PREDICTED: transcription factor MYB44-like       93.6    5e-21   
gb|AFS65096.1|  sucrose responsive element-binding protein            93.6    5e-21   
ref|NP_001235731.1|  MYB transcription factor MYB178                  91.7    5e-21   
gb|ABN11121.1|  MYB transcription factor                              93.6    5e-21   Capsicum annuum
gb|EYU36318.1|  hypothetical protein MIMGU_mgv1a022221mg              93.2    5e-21   
ref|XP_010928389.1|  PREDICTED: transcription factor MYB44-like       93.6    5e-21   
ref|XP_004163238.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  92.8    5e-21   
ref|XP_010943207.1|  PREDICTED: transcription factor MYB44-like       93.6    5e-21   
ref|XP_006425988.1|  hypothetical protein CICLE_v10026107mg           93.2    6e-21   
ref|XP_003524661.1|  PREDICTED: transcription factor MYB44            92.8    6e-21   
ref|XP_004238123.1|  PREDICTED: transcription factor MYB44-like       93.2    6e-21   
ref|XP_010547530.1|  PREDICTED: transcription factor MYB44-like       93.2    6e-21   
gb|ABQ10819.1|  putative R2R3-Myb transcription factor                93.2    6e-21   Citrus sinensis [apfelsine]
ref|NP_001275856.1|  putative R2R3-Myb transcription factor           93.2    6e-21   
ref|NP_001268121.1|  sucrose responsive element binding protein       92.8    7e-21   
ref|XP_002524926.1|  r2r3-myb transcription factor, putative          93.2    7e-21   Ricinus communis
gb|AHB59606.1|  putative MYB-related protein 20                       93.2    7e-21   
ref|XP_007155887.1|  hypothetical protein PHAVU_003G240200g           92.8    7e-21   
gb|KFK28404.1|  hypothetical protein AALP_AA8G510400                  92.8    7e-21   
ref|XP_002866710.1|  AtMYB44/AtMYBr1                                  92.8    7e-21   
gb|KDP31997.1|  hypothetical protein JCGZ_12458                       92.8    8e-21   
gb|KDO79069.1|  hypothetical protein CISIN_1g021071mg                 92.4    8e-21   
ref|XP_007047395.1|  Myb domain protein 73, putative                  92.8    8e-21   
ref|XP_010679545.1|  PREDICTED: transcription factor MYB44            92.8    8e-21   
emb|CAA90809.1|  MYB-related protein                                  92.8    8e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006367421.1|  PREDICTED: transcription factor MYB44-like       92.8    9e-21   
ref|XP_010101670.1|  Transcription factor                             92.4    9e-21   
ref|XP_006279745.1|  hypothetical protein CARUB_v10027659mg           92.4    9e-21   
gb|AAM64847.1|  myb-related protein, 33.3K                            92.4    9e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009798591.1|  PREDICTED: transcription factor MYB44            92.8    9e-21   
ref|XP_006393928.1|  hypothetical protein EUTSA_v10004676mg           92.4    9e-21   
ref|XP_010484518.1|  PREDICTED: transcription factor MYB44-like       92.4    9e-21   
ref|NP_201531.1|  transcription factor MYB44                          92.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010548433.1|  PREDICTED: transcription factor MYB44 isofor...  92.4    1e-20   
ref|XP_010548432.1|  PREDICTED: transcription factor MYB44 isofor...  92.4    1e-20   
dbj|BAJ40867.1|  transcriptional factor MYB-1                         92.4    1e-20   
gb|AAK96490.1|  AT5g67300/K8K14_2                                     92.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009398678.1|  PREDICTED: transcription factor MYB44-like       92.8    1e-20   
ref|XP_010444669.1|  PREDICTED: transcription factor MYB44-like       92.4    1e-20   
ref|XP_010464243.1|  PREDICTED: transcription factor MYB44            92.4    1e-20   
ref|XP_010558924.1|  PREDICTED: transcription factor MYB44-like i...  92.4    1e-20   
ref|XP_009587267.1|  PREDICTED: transcription factor MYB44-like       92.0    1e-20   
gb|AAZ20429.1|  MYB6                                                  92.4    1e-20   Malus domestica [apple tree]
gb|ADL36765.1|  MYB domain class transcription factor                 92.0    1e-20   
ref|XP_006294656.1|  hypothetical protein CARUB_v10023692mg           92.0    1e-20   
emb|CDY01420.1|  BnaA07g11930D                                        91.7    1e-20   
emb|CDY12830.1|  BnaC07g16030D                                        91.7    1e-20   
ref|XP_008452606.1|  PREDICTED: transcription factor MYB44-like       91.7    1e-20   
ref|XP_011097391.1|  PREDICTED: transcription factor MYB44            92.4    2e-20   
ref|XP_009395856.1|  PREDICTED: transcription factor MYB44-like       92.0    2e-20   
ref|XP_010244270.1|  PREDICTED: transcription factor MYB44            92.0    2e-20   
ref|XP_006844027.1|  hypothetical protein AMTR_s00006p00225600        91.7    2e-20   
gb|AHN60125.1|  MYB transcription factor 44                           91.7    2e-20   
ref|XP_010417080.1|  PREDICTED: transcription factor MYB44-like       91.7    2e-20   
gb|ABD60288.2|  R2R3-MYB transcription factor MYB9                    91.3    2e-20   
ref|XP_009103434.1|  PREDICTED: transcription factor MYB44            91.7    2e-20   
ref|XP_002880492.1|  hypothetical protein ARALYDRAFT_481200           91.7    2e-20   
ref|XP_006404809.1|  hypothetical protein EUTSA_v10000438mg           91.7    2e-20   
ref|XP_006286095.1|  hypothetical protein CARUB_v10007638mg           91.7    2e-20   
gb|AFK46950.1|  unknown                                               91.7    2e-20   
ref|NP_001235715.1|  MYB transcription factor MYB68                   91.3    2e-20   
ref|XP_010437245.1|  PREDICTED: transcription factor MYB44-like       91.7    2e-20   
gb|AGN52088.1|  MYB-related transcription factor                      91.7    2e-20   
emb|CAN81361.1|  hypothetical protein VITISV_028904                   91.7    2e-20   Vitis vinifera
gb|ABD60281.1|  R2R3-MYB transcription factor MYB7                    91.7    2e-20   Pinus taeda
ref|NP_195443.1|  myb domain protein 73                               91.3    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432074.1|  PREDICTED: transcription factor MYB44-like       91.3    2e-20   
gb|AAM65553.1|  putative MYB family transcription factor              91.3    2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AHN19846.1|  MYB6                                                  91.3    3e-20   
gb|AHN19845.1|  MYB6                                                  91.3    3e-20   
ref|XP_008360495.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  90.1    3e-20   
ref|XP_002877726.1|  myb family transcription factor                  90.9    3e-20   
ref|XP_010070607.1|  PREDICTED: transcription factor MYB44-like       91.3    3e-20   
ref|XP_006411909.1|  hypothetical protein EUTSA_v10025742mg           91.3    3e-20   
ref|XP_007136715.1|  hypothetical protein PHAVU_009G068000g           90.9    3e-20   
gb|AFH03065.1|  R2R3-MYB transcription factor MYB13                   91.3    3e-20   
ref|NP_179910.1|  myb domain protein 70                               90.9    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446682.1|  PREDICTED: transcription factor MYB44-like       91.3    3e-20   
gb|ABR16702.1|  unknown                                               92.0    3e-20   Picea sitchensis
ref|XP_008367655.1|  PREDICTED: transcription factor MYB44-like       90.9    3e-20   
ref|XP_008351984.1|  PREDICTED: transcription factor MYB44-like       90.9    3e-20   
gb|ABQ51225.1|  R2R3-MYB transcription factor MYB9                    92.0    3e-20   Picea glauca
ref|NP_001287808.1|  transcription factor MYB44-like                  90.9    3e-20   
ref|XP_009372447.1|  PREDICTED: transcription factor MYB44-like       90.9    3e-20   
emb|CAN75196.1|  hypothetical protein VITISV_014739                   90.9    3e-20   Vitis vinifera
gb|ABR28330.1|  MYB transcription factor MYB8                         90.5    3e-20   
gb|KEH31491.1|  myb transcription factor                              90.5    4e-20   
ref|XP_011010210.1|  PREDICTED: transcription factor MYB44-like       90.9    4e-20   
ref|XP_010472329.1|  PREDICTED: transcription factor MYB44-like       90.9    4e-20   
gb|ABV02031.1|  sucrose responsive element binding factor 1           90.5    4e-20   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_010429274.1|  PREDICTED: transcription factor MYB44-like       90.5    4e-20   
ref|XP_009354151.1|  PREDICTED: transcription factor MYB44-like       90.9    4e-20   
gb|AHB59592.1|  putative R2R3 MYB protein 4                           90.5    4e-20   
ref|XP_009367649.1|  PREDICTED: transcription factor MYB44            90.5    5e-20   
ref|XP_009136534.1|  PREDICTED: transcription factor MYB44-like       90.5    5e-20   
gb|ADL36764.1|  MYB domain class transcription factor                 90.5    5e-20   
ref|XP_008391509.1|  PREDICTED: transcription factor MYB44-like       90.5    5e-20   
ref|XP_004287994.1|  PREDICTED: transcription factor MYB44-like       90.5    5e-20   
emb|CDY22442.1|  BnaC03g61550D                                        90.1    5e-20   
ref|NP_190575.1|  myb domain protein 77                               90.1    6e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CAA74604.1|  R2R3-MYB transcription factor                        90.1    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404067.1|  hypothetical protein EUTSA_v10010581mg           90.1    6e-20   
ref|XP_009109365.1|  PREDICTED: transcription factor MYB44-like       90.1    6e-20   
emb|CDY23023.1|  BnaC07g31640D                                        90.1    6e-20   
ref|XP_006293134.1|  hypothetical protein CARUB_v10019440mg           90.1    6e-20   
ref|XP_008338349.1|  PREDICTED: transcription factor MYB44-like       90.1    7e-20   
ref|XP_009360105.1|  PREDICTED: transcription factor MYB44-like       90.1    7e-20   
emb|CAA90810.1|  MYB-related protein                                  90.1    7e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008351390.1|  PREDICTED: transcription factor MYB44-like       89.7    7e-20   
ref|XP_002306488.2|  hypothetical protein POPTR_0005s18620g           90.5    7e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010531261.1|  PREDICTED: transcription factor MYB44            90.1    7e-20   
gb|AHN50422.1|  R2R3-type MYB transcription factor                    89.7    7e-20   
emb|CDY02098.1|  BnaA03g40690D                                        90.1    7e-20   
ref|XP_010426549.1|  PREDICTED: transcription factor MYB44-like       90.1    7e-20   
ref|XP_009392116.1|  PREDICTED: transcription factor MYB44-like       90.5    7e-20   
ref|XP_011088207.1|  PREDICTED: transcription factor MYB44-like       89.7    7e-20   
ref|XP_008799576.1|  PREDICTED: transcription factor MYB44-like       90.5    8e-20   
ref|NP_001183628.1|  putative MYB DNA-binding domain superfamily ...  89.7    8e-20   
emb|CDY44045.1|  BnaA08g15610D                                        89.7    8e-20   
ref|XP_010550347.1|  PREDICTED: transcription factor MYB44-like       89.7    8e-20   
ref|XP_010486483.1|  PREDICTED: myb protein-like                      90.1    1e-19   
ref|XP_002518677.1|  r2r3-myb transcription factor, putative          89.0    1e-19   Ricinus communis
gb|EYU34554.1|  hypothetical protein MIMGU_mgv1a011398mg              89.4    1e-19   
ref|XP_010470301.1|  PREDICTED: myb-related protein B-like            90.1    1e-19   
ref|XP_003575562.1|  PREDICTED: transcription factor MYB44-like       89.4    1e-19   
ref|XP_001762255.1|  predicted protein                                86.3    1e-19   
ref|XP_007042527.1|  Myb domain protein 73, putative                  89.0    1e-19   
ref|NP_001235688.1|  MYB transcription factor MYB61                   89.4    1e-19   
gb|KFK34266.1|  hypothetical protein AALP_AA5G122700                  89.4    1e-19   
emb|CDX69287.1|  BnaC01g01660D                                        89.4    1e-19   
ref|XP_011006987.1|  PREDICTED: transcription factor MYB44-like       89.4    1e-19   
ref|XP_010464561.1|  PREDICTED: myb-related protein B-like            89.7    1e-19   
ref|XP_002310702.1|  hypothetical protein POPTR_0007s10490g           89.4    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_001765018.1|  predicted protein                                86.3    2e-19   
emb|CDX72621.1|  BnaC07g46430D                                        88.6    2e-19   
ref|XP_009137661.1|  PREDICTED: transcription factor MYB44            89.0    2e-19   
emb|CDX75635.1|  BnaA01g00670D                                        89.0    2e-19   
ref|XP_009396365.1|  PREDICTED: transcription factor MYB44-like       89.4    2e-19   
gb|KDP45901.1|  hypothetical protein JCGZ_15461                       88.6    2e-19   
ref|XP_006657167.1|  PREDICTED: transcription factor MYB44-like       86.7    2e-19   
ref|NP_001046131.1|  Os02g0187700                                     88.6    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001237693.1|  MYB transcription factor MYB70                   88.6    2e-19   
ref|XP_002462029.1|  hypothetical protein SORBIDRAFT_02g013010        89.0    2e-19   Sorghum bicolor [broomcorn]
gb|EAZ22021.1|  hypothetical protein OsJ_05678                        88.6    2e-19   Oryza sativa Japonica Group [Japonica rice]
emb|CDY30608.1|  BnaAnng03830D                                        88.2    3e-19   
emb|CDY57355.1|  BnaC08g48630D                                        88.2    3e-19   
gb|AHN60131.1|  MYB transcription factor 77                           88.2    3e-19   
ref|XP_006660414.1|  PREDICTED: transcription factor MYB44-like       88.6    3e-19   
gb|KDO59816.1|  hypothetical protein CISIN_1g040502mg                 87.8    3e-19   
gb|ABL97967.1|  R2R3-MYB transcription factor                         88.2    3e-19   Brassica rapa
ref|XP_006422932.1|  hypothetical protein CICLE_v10029124mg           87.8    3e-19   
ref|XP_009115687.1|  PREDICTED: transcription factor MYB44-like       88.2    3e-19   
ref|XP_006487005.1|  PREDICTED: transcription factor MYB44-like       87.8    3e-19   
gb|KFK38309.1|  hypothetical protein AALP_AA3G097200                  88.2    4e-19   
ref|NP_001151336.1|  sucrose responsive element binding protein       88.2    4e-19   Zea mays [maize]
gb|ABC86569.1|  MYB transcription factor TaMYB1                       87.8    4e-19   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007160886.1|  hypothetical protein PHAVU_001G025200g           87.8    4e-19   
ref|XP_010515371.1|  PREDICTED: transcription factor MYB44-like       87.8    4e-19   
ref|XP_008811216.1|  PREDICTED: transcription factor MYB44-like       88.2    4e-19   
ref|XP_002961364.1|  hypothetical protein SELMODRAFT_77255            84.7    5e-19   
ref|NP_001058148.1|  Os06g0637500                                     87.8    5e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010096284.1|  Transcription factor                             87.8    5e-19   
dbj|BAD34048.1|  myb-related transcription factor-like                87.8    5e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08096.1|  hypothetical protein OsI_30362                        87.8    5e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001062562.1|  Os09g0106700                                     87.8    5e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147631.1|  LOC100281240                                     87.4    5e-19   Zea mays [maize]
emb|CDX83109.1|  BnaA01g21090D                                        85.9    6e-19   
ref|XP_009101651.1|  PREDICTED: transcription factor MYB44-like       87.4    6e-19   
ref|XP_009418521.1|  PREDICTED: transcription factor MYB44-like       87.8    6e-19   
emb|CDX89554.1|  BnaC04g35730D                                        87.4    6e-19   
ref|XP_010092183.1|  Transcription factor                             87.4    7e-19   
gb|KEH25080.1|  disease resistance protein (TIR-NBS-LRR class), p...  90.5    7e-19   
gb|ADX60118.1|  MYB-RELATED transcription factor                      87.4    7e-19   
ref|XP_009385523.1|  PREDICTED: transcription factor MYB44-like       87.4    8e-19   
ref|XP_004305954.1|  PREDICTED: transcription factor MYB44-like       86.7    9e-19   
gb|AFK48638.1|  unknown                                               86.7    9e-19   
dbj|BAK08030.1|  predicted protein                                    87.0    9e-19   
emb|CDY38933.1|  BnaA04g13540D                                        86.7    9e-19   
gb|AHB59591.1|  putative R2R3 MYB protein 3                           86.7    9e-19   
ref|XP_004246368.1|  PREDICTED: myb-related protein 315               87.4    9e-19   
ref|XP_009418325.1|  PREDICTED: transcription factor MYB44-like       87.4    1e-18   
ref|XP_010526144.1|  PREDICTED: transcriptional activator Myb-like    85.9    1e-18   
ref|XP_004951630.1|  PREDICTED: transcription factor MYB44-like       86.7    1e-18   
ref|XP_009140453.1|  PREDICTED: transcription factor MYB44            86.7    1e-18   
gb|EYU37627.1|  hypothetical protein MIMGU_mgv1a026376mg              86.7    1e-18   
emb|CDX68566.1|  BnaC01g26440D                                        86.7    1e-18   
ref|XP_002451692.1|  hypothetical protein SORBIDRAFT_04g005940        86.7    1e-18   Sorghum bicolor [broomcorn]
ref|XP_002438718.1|  hypothetical protein SORBIDRAFT_10g024950        86.7    1e-18   Sorghum bicolor [broomcorn]
ref|NP_001159044.1|  MYB transcription factor TaMYB1                  86.7    1e-18   Zea mays [maize]
ref|XP_002973727.1|  hypothetical protein SELMODRAFT_99462            84.0    1e-18   
ref|XP_006363093.1|  PREDICTED: myb-like protein AA-like              87.0    1e-18   
ref|XP_010057256.1|  PREDICTED: transcription factor MYB44-like       86.3    1e-18   
ref|XP_009394543.1|  PREDICTED: transcription factor MYB44-like       86.3    2e-18   
ref|XP_004965791.1|  PREDICTED: transcription factor MYB44-like       86.3    2e-18   
dbj|BAJ86460.1|  predicted protein                                    86.3    2e-18   
gb|AAG08960.1|AF122052_1  tuber-specific and sucrose-responsive e...  85.9    2e-18   Solanum tuberosum [potatoes]
ref|XP_003545242.1|  PREDICTED: myb-related protein 306-like          87.0    2e-18   
gb|AFV73403.1|  R2R3-MYB transcription factor                         85.9    2e-18   
ref|XP_002975777.1|  hypothetical protein SELMODRAFT_103999           83.6    2e-18   
gb|KHN20881.1|  Transcription factor MYB44                            87.0    2e-18   
ref|XP_009783755.1|  PREDICTED: myb-related protein B-like            86.7    2e-18   
ref|XP_002285389.1|  PREDICTED: transcription factor MYB44            85.9    2e-18   Vitis vinifera
ref|XP_002313145.1|  hypothetical protein POPTR_0009s09890g           85.5    2e-18   Populus trichocarpa [western balsam poplar]
ref|XP_010533876.1|  PREDICTED: myb-related protein Myb4-like         86.3    2e-18   
gb|ACF87327.1|  unknown                                               85.9    2e-18   Zea mays [maize]
ref|XP_011001142.1|  PREDICTED: transcription factor MYB44-like       85.5    2e-18   
ref|XP_009416214.1|  PREDICTED: myb-related protein 315-like          86.7    2e-18   
ref|XP_009613649.1|  PREDICTED: myb-related protein B                 86.3    2e-18   
gb|ABD60291.2|  R2R3-MYB transcription factor MYB6                    85.1    3e-18   
ref|XP_008780287.1|  PREDICTED: myb-like protein Q                    84.0    3e-18   
ref|XP_009138487.1|  PREDICTED: transcription factor MYB44-like       85.1    3e-18   
gb|KFK30351.1|  hypothetical protein AALP_AA7G250300                  85.5    3e-18   
ref|XP_008236375.1|  PREDICTED: transcription factor MYB44-like       85.1    3e-18   
ref|XP_009407576.1|  PREDICTED: myb-like protein AA                   85.9    4e-18   
ref|XP_009415461.1|  PREDICTED: transcription factor MYB44-like       85.9    4e-18   
emb|CDP07617.1|  unnamed protein product                              84.7    4e-18   
gb|ABQ51223.1|  R2R3-MYB transcription factor MYB7                    85.9    4e-18   Picea glauca
ref|XP_008373085.1|  PREDICTED: transcription factor MYB44-like       85.1    4e-18   
ref|XP_009387830.1|  PREDICTED: transcription factor MYB44-like       84.7    4e-18   
ref|XP_007199299.1|  hypothetical protein PRUPE_ppa023154mg           85.1    4e-18   
ref|XP_007134782.1|  hypothetical protein PHAVU_010G075600g           81.6    5e-18   
ref|XP_010553060.1|  PREDICTED: transcription factor MYB44            85.5    5e-18   
ref|XP_010253806.1|  PREDICTED: transcription factor MYB44-like       84.7    5e-18   
gb|ADL36760.1|  MYB domain class transcription factor                 84.7    5e-18   
gb|AIB05744.1|  MYB transcription factor                              84.7    6e-18   
ref|XP_010558349.1|  PREDICTED: myb-like protein Q                    85.9    6e-18   
ref|XP_006407701.1|  hypothetical protein EUTSA_v10021963mg           85.5    6e-18   
ref|XP_010098722.1|  Transcription factor                             84.3    6e-18   
ref|XP_010547980.1|  PREDICTED: transcription factor MYB44-like       84.7    6e-18   
gb|ABD60290.2|  R2R3-MYB transcription factor MYB7                    84.3    7e-18   
ref|XP_008239931.1|  PREDICTED: uncharacterized protein LOC103338495  85.5    7e-18   
ref|XP_006578007.1|  PREDICTED: transcription factor MYB44-like       83.6    8e-18   
ref|NP_001132112.1|  uncharacterized protein LOC100193529             84.3    8e-18   
ref|XP_007205315.1|  hypothetical protein PRUPE_ppa006851mg           85.1    8e-18   
gb|KDP44734.1|  hypothetical protein JCGZ_01234                       84.0    8e-18   
ref|XP_002527890.1|  r2r3-myb transcription factor, putative          85.1    8e-18   
ref|XP_001753678.1|  predicted protein                                81.3    8e-18   
gb|EAZ37752.1|  hypothetical protein OsJ_22090                        84.3    9e-18   
gb|KHN13094.1|  Myb-related protein B                                 85.5    9e-18   
ref|XP_010031187.1|  PREDICTED: myb-related protein A-like            84.0    1e-17   
ref|XP_002298748.1|  hypothetical protein POPTR_0001s30750g           83.6    1e-17   
ref|XP_010037759.1|  PREDICTED: myb-related protein A                 84.3    1e-17   
ref|XP_006297844.1|  hypothetical protein CARUB_v10013882mg           84.7    1e-17   
emb|CCA29104.1|  putative MYB transcription factor                    83.6    1e-17   
ref|XP_010920799.1|  PREDICTED: transcription factor MYB44-like       83.6    1e-17   
emb|CCA29118.1|  putative MYB transcription factor                    83.6    1e-17   
ref|XP_009785340.1|  PREDICTED: myb protein-like                      83.6    1e-17   
ref|XP_010105436.1|  Transcription factor                             83.2    2e-17   
gb|AHB59593.1|  putative R2R3 MYB protein 5                           84.0    2e-17   
ref|XP_010690407.1|  PREDICTED: uncharacterized protein LOC104903953  84.7    2e-17   
ref|XP_006848033.1|  hypothetical protein AMTR_s00029p00183640        84.3    2e-17   
ref|XP_010059771.1|  PREDICTED: transcription factor MYB44-like       82.8    2e-17   
ref|XP_010923173.1|  PREDICTED: myb-like protein Q                    84.0    2e-17   
ref|XP_004291141.1|  PREDICTED: transcription factor MYB98-like       82.8    2e-17   
ref|XP_008352004.1|  PREDICTED: transcription factor MYB44-like       82.8    2e-17   
ref|XP_009402306.1|  PREDICTED: myb-like protein AA                   83.6    2e-17   
ref|XP_002276375.1|  PREDICTED: uncharacterized protein LOC100256309  84.3    2e-17   
ref|XP_010932223.1|  PREDICTED: transcription factor MYB44-like       82.8    2e-17   
ref|XP_004141241.1|  PREDICTED: myb-related protein A-like            82.4    2e-17   
gb|EPS60436.1|  hypothetical protein M569_14368                       82.8    3e-17   
dbj|BAJ95362.1|  predicted protein                                    82.8    3e-17   
ref|XP_010648804.1|  PREDICTED: transcription factor MYB44-like       82.8    3e-17   
ref|XP_011030396.1|  PREDICTED: transcription factor MYB44-like       82.4    3e-17   
ref|XP_004173919.1|  PREDICTED: LOW QUALITY PROTEIN: myb-related ...  82.4    3e-17   
gb|EYU41812.1|  hypothetical protein MIMGU_mgv1a023010mg              83.6    3e-17   
ref|XP_009367403.1|  PREDICTED: transcriptional activator Myb-like    82.4    3e-17   
gb|KDO68919.1|  hypothetical protein CISIN_1g046570mg                 82.4    3e-17   
ref|XP_010937896.1|  PREDICTED: transcription factor MYB44-like       82.4    3e-17   
ref|XP_010268711.1|  PREDICTED: transcription factor MYB44-like       82.4    3e-17   
ref|XP_007223827.1|  hypothetical protein PRUPE_ppa010735mg           82.4    3e-17   
ref|XP_007008918.1|  Myb domain protein 73                            82.4    3e-17   
ref|XP_008220156.1|  PREDICTED: transcription factor MYB44-like       82.4    3e-17   
ref|XP_011000247.1|  PREDICTED: transcription factor MYB44-like       82.4    3e-17   
ref|XP_010931159.1|  PREDICTED: trichome differentiation protein ...  83.6    3e-17   
ref|XP_009412621.1|  PREDICTED: transcription factor MYB44-like       82.4    3e-17   
ref|XP_006434842.1|  hypothetical protein CICLE_v10002239mg           82.4    3e-17   
gb|AFH03055.1|  R2R3-MYB transcription factor MYB3                    82.4    3e-17   
ref|XP_002882609.1|  ATMYB1                                           83.6    3e-17   
ref|NP_001237709.1|  MYB transcription factor MYB81                   82.4    4e-17   
ref|XP_004501595.1|  PREDICTED: transcriptional activator Myb-like    82.0    4e-17   
ref|XP_008785463.1|  PREDICTED: myb-like protein Q                    83.6    4e-17   
ref|XP_006435772.1|  hypothetical protein CICLE_v10032317mg           82.4    4e-17   
gb|EYU36282.1|  hypothetical protein MIMGU_mgv1a013600mg              81.6    4e-17   
gb|AGN52077.1|  MYB-related transcription factor                      83.2    4e-17   
gb|KDP24518.1|  hypothetical protein JCGZ_25082                       83.2    4e-17   
ref|XP_008452503.1|  PREDICTED: transcriptional activator Myb-like    81.6    4e-17   
ref|NP_001235925.1|  MYB transcription factor MYB124                  81.6    5e-17   
ref|XP_010101850.1|  Transcription factor                             83.2    5e-17   
ref|XP_002272706.1|  PREDICTED: myb-related protein B                 81.6    5e-17   
ref|XP_009396271.1|  PREDICTED: transcription factor MYB44-like       82.0    5e-17   
gb|KDP38397.1|  hypothetical protein JCGZ_04322                       81.6    6e-17   
ref|XP_008448879.1|  PREDICTED: transcription factor MYB86            82.8    6e-17   
ref|XP_011094946.1|  PREDICTED: uncharacterized protein LOC105174515  83.2    6e-17   
ref|XP_008796508.1|  PREDICTED: transcription factor MYB44-like       81.6    6e-17   
ref|XP_010061776.1|  PREDICTED: transcription factor MYB44-like       81.3    6e-17   
ref|XP_004147900.1|  PREDICTED: uncharacterized protein LOC101212170  82.4    7e-17   
ref|XP_004162756.1|  PREDICTED: uncharacterized LOC101212170          82.4    7e-17   
gb|AGN52029.1|  MYB-related transcription factor                      81.3    7e-17   
ref|XP_010256737.1|  PREDICTED: uncharacterized protein LOC104597...  83.2    7e-17   
ref|XP_010262707.1|  PREDICTED: uncharacterized protein LOC104601164  83.2    7e-17   
ref|XP_008374172.1|  PREDICTED: transcriptional activator Myb-like    81.3    7e-17   
ref|XP_002312136.2|  hypothetical protein POPTR_0008s06320g           79.3    8e-17   
ref|XP_010256736.1|  PREDICTED: uncharacterized protein LOC104597...  82.8    8e-17   
ref|XP_007009127.1|  Myb domain protein 25, putative                  82.8    8e-17   
ref|XP_009345765.1|  PREDICTED: transcription factor MYB44-like       80.9    8e-17   
ref|XP_008234066.1|  PREDICTED: transcriptional activator Myb-like    80.9    9e-17   
ref|XP_010543715.1|  PREDICTED: transcription factor MYB44-like       80.5    9e-17   
ref|XP_007221111.1|  hypothetical protein PRUPE_ppa017892mg           80.9    9e-17   
ref|XP_008792655.1|  PREDICTED: transcription factor MYB44-like       80.9    1e-16   
ref|XP_004148201.1|  PREDICTED: uncharacterized protein LOC101207929  81.3    1e-16   
gb|KHG29583.1|  Transcription factor MYB44 -like protein              82.4    1e-16   
ref|XP_011030579.1|  PREDICTED: transcription factor MYB44-like       80.9    1e-16   
ref|XP_006374997.1|  hypothetical protein POPTR_0014s03440g           80.9    1e-16   
ref|NP_001141619.2|  MYB transcription factor                         82.0    1e-16   
ref|XP_010508952.1|  PREDICTED: uncharacterized protein LOC104785436  82.0    1e-16   
gb|ABQ51222.1|  R2R3-MYB transcription factor MYB6                    81.3    1e-16   
ref|XP_010517362.1|  PREDICTED: uncharacterized protein LOC104792825  82.0    1e-16   
ref|XP_010505683.1|  PREDICTED: uncharacterized protein LOC104782447  82.0    1e-16   
ref|XP_007136655.1|  hypothetical protein PHAVU_009G062700g           80.5    1e-16   
ref|XP_009123435.1|  PREDICTED: myb protein-like                      81.6    1e-16   
ref|XP_010666145.1|  PREDICTED: myb protein-like                      80.5    1e-16   
gb|AEI89704.1|  transcription factor MYB1 protein                     81.6    1e-16   
ref|XP_002276341.1|  PREDICTED: transcription factor RAX1             81.6    2e-16   
ref|XP_008789179.1|  PREDICTED: transcription factor MYB44-like       80.5    2e-16   
ref|XP_011083803.1|  PREDICTED: transcription factor MYB44-like       80.1    2e-16   
ref|XP_008233695.1|  PREDICTED: transcription factor RAX2-like        82.0    2e-16   
ref|XP_010534544.1|  PREDICTED: transcription factor MYB86-like       80.9    2e-16   
ref|XP_002528315.1|  r2r3-myb transcription factor, putative          80.1    2e-16   
ref|XP_002311241.1|  hypothetical protein POPTR_0008s07100g           80.1    2e-16   
ref|XP_009370160.1|  PREDICTED: transcriptional activator Myb-like    80.1    2e-16   
ref|XP_007017355.1|  Myb domain protein 77                            80.1    2e-16   
ref|XP_011074463.1|  PREDICTED: transcription factor MYB44-like       79.7    2e-16   
ref|XP_008378059.1|  PREDICTED: transcriptional activator Myb-like    80.1    2e-16   
ref|XP_004491024.1|  PREDICTED: transcription factor MYB44-like       79.7    2e-16   
emb|CDP06538.1|  unnamed protein product                              81.3    2e-16   
ref|XP_007141751.1|  hypothetical protein PHAVU_008G222600g           79.7    2e-16   
ref|XP_010268609.1|  PREDICTED: transcriptional activator Myb-like    79.7    3e-16   
ref|XP_004307600.1|  PREDICTED: myb protein-like                      81.3    3e-16   
gb|EYU25387.1|  hypothetical protein MIMGU_mgv1a013005mg              79.7    3e-16   
gb|KDP44844.1|  hypothetical protein JCGZ_01344                       81.6    3e-16   
gb|EMS67867.1|  Transcription factor MYB44                            79.7    3e-16   
gb|EYU43428.1|  hypothetical protein MIMGU_mgv1a012392mg              79.3    3e-16   
gb|KFK36882.1|  hypothetical protein AALP_AA4G184000                  80.5    3e-16   
ref|XP_004308944.1|  PREDICTED: myb-related protein A-like            79.3    3e-16   
emb|CBI19574.3|  unnamed protein product                              81.6    3e-16   
ref|XP_009600873.1|  PREDICTED: transcription factor MYB44-like       79.7    4e-16   
ref|NP_001044814.1|  Os01g0850400                                     80.9    4e-16   
gb|EAY76504.1|  hypothetical protein OsI_04445                        80.9    5e-16   
ref|XP_003603000.1|  Myb transcription factor                         79.0    5e-16   
ref|XP_008388098.1|  PREDICTED: transcription factor MYB44-like       80.5    5e-16   
ref|XP_011038690.1|  PREDICTED: transcriptional activator Myb-like    80.5    5e-16   
ref|XP_009780273.1|  PREDICTED: transcription factor MYB44-like       79.0    5e-16   
ref|XP_009346994.1|  PREDICTED: myb-related protein 306-like          80.1    5e-16   
ref|XP_008345508.1|  PREDICTED: transcription factor MYB59-like       80.1    6e-16   
ref|XP_009620130.1|  PREDICTED: transcription factor MYB44-like       79.0    6e-16   
ref|XP_011036027.1|  PREDICTED: transcription factor MYB76-like       80.5    6e-16   
ref|XP_002315183.2|  hypothetical protein POPTR_0010s20220g           80.1    6e-16   
ref|XP_004970585.1|  PREDICTED: myb-related protein 306-like          80.1    6e-16   
ref|XP_008370028.1|  PREDICTED: transcription factor MYB59-like       80.1    6e-16   
ref|XP_002862375.1|  predicted protein                                77.0    6e-16   
ref|XP_006294397.1|  hypothetical protein CARUB_v10023414mg           80.1    6e-16   
gb|AHB59589.1|  putative R2R3 MYB protein 1                           78.6    7e-16   
ref|XP_002510273.1|  r2r3-myb transcription factor, putative          78.6    7e-16   
gb|AAZ20427.1|  MYB2                                                  80.1    7e-16   
gb|EYU35744.1|  hypothetical protein MIMGU_mgv1a022052mg              75.9    7e-16   
gb|EYU40230.1|  hypothetical protein MIMGU_mgv1a021015mg              76.6    8e-16   
ref|XP_009400144.1|  PREDICTED: transcription factor MYB44-like       78.6    8e-16   
ref|XP_011084888.1|  PREDICTED: transcriptional activator Myb-like    78.6    8e-16   
ref|XP_002458769.1|  hypothetical protein SORBIDRAFT_03g039950        79.7    8e-16   
ref|XP_008392894.1|  PREDICTED: myb-related protein 306-like          79.7    9e-16   
ref|NP_187534.1|  myb domain protein 1                                79.7    9e-16   
ref|XP_009351142.1|  PREDICTED: myb-related protein 306-like          79.7    9e-16   
ref|XP_004238184.1|  PREDICTED: transcription factor MYB44-like       78.2    1e-15   
ref|XP_006645018.1|  PREDICTED: uncharacterized protein LOC102712209  79.7    1e-15   
ref|XP_006354921.1|  PREDICTED: transcription factor MYB44-like       78.2    1e-15   
ref|XP_009116273.1|  PREDICTED: uncharacterized protein LOC103841480  79.3    1e-15   
emb|CDY27271.1|  BnaA09g35310D                                        79.3    1e-15   
ref|NP_001288045.1|  transcription factor MYB86-like                  79.7    1e-15   
ref|XP_003604830.1|  Myb transcription factor                         76.3    1e-15   
ref|XP_006403424.1|  hypothetical protein EUTSA_v10010431mg           79.3    1e-15   
gb|AAG08961.1|AF122053_1  tuber-specific and sucrose-responsive e...  77.8    1e-15   
emb|CDX72208.1|  BnaC08g26660D                                        79.0    1e-15   
gb|KFK34814.1|  hypothetical protein AALP_AA5G196700                  79.3    1e-15   
ref|XP_010031265.1|  PREDICTED: myb-related protein B                 79.3    1e-15   
ref|XP_010232563.1|  PREDICTED: uncharacterized protein LOC100827463  79.7    1e-15   
ref|XP_003520943.1|  PREDICTED: transcription factor MYB44-like       78.6    1e-15   
ref|XP_006480929.1|  PREDICTED: myb-related protein B-like            78.6    2e-15   
gb|KEH28952.1|  myb transcription factor                              78.6    2e-15   
ref|XP_003516915.1|  PREDICTED: myb protein-like                      78.6    2e-15   
gb|AAS10070.1|  MYB transcription factor                              79.0    2e-15   
ref|NP_191132.1|  myb domain protein 109                              79.0    2e-15   
ref|XP_004963854.1|  PREDICTED: transcription factor MYB44-like       78.6    2e-15   
ref|XP_006486452.1|  PREDICTED: uncharacterized protein LOC102618168  79.3    2e-15   
ref|XP_006429252.1|  hypothetical protein CICLE_v10012003mg           78.6    2e-15   
gb|KDO69257.1|  hypothetical protein CISIN_1g012494mg                 79.3    2e-15   
gb|KDO58018.1|  hypothetical protein CISIN_1g017566mg                 78.6    2e-15   
ref|XP_006435568.1|  hypothetical protein CICLE_v10031463mg           79.3    2e-15   
ref|XP_011017241.1|  PREDICTED: transcriptional activator Myb-like    77.4    2e-15   
ref|XP_009344337.1|  PREDICTED: transcription factor MYB86-like       79.0    2e-15   
ref|XP_008805112.1|  PREDICTED: myb-related protein B-like            77.0    2e-15   
ref|XP_007026835.1|  R2r3-myb transcription factor, putative          78.6    2e-15   
emb|CDX74825.1|  BnaA05g05710D                                        78.6    3e-15   
gb|KHG04525.1|  Transcription factor MYB44 -like protein              78.6    3e-15   
ref|XP_002284237.1|  PREDICTED: transcription factor MYB44            76.6    3e-15   
gb|EPS64975.1|  hypothetical protein M569_09804                       77.0    3e-15   
ref|XP_010922579.1|  PREDICTED: transcription factor MYB44-like       76.6    4e-15   
gb|AGN52047.1|  MYB-related transcription factor                      78.2    4e-15   
ref|XP_002439611.1|  hypothetical protein SORBIDRAFT_09g016570        77.4    4e-15   
ref|XP_002881682.1|  predicted protein                                77.8    5e-15   
emb|CDX73963.1|  BnaA03g30840D                                        77.0    5e-15   
ref|XP_011076754.1|  PREDICTED: uncharacterized protein LOC105160924  78.2    5e-15   
ref|XP_009135065.1|  PREDICTED: myb protein-like                      77.0    5e-15   
ref|XP_009143276.1|  PREDICTED: myb-like protein AA                   77.4    5e-15   
gb|AGN52092.1|  MYB-related transcription factor                      77.4    5e-15   
ref|XP_002301201.1|  hypothetical protein POPTR_0002s13030g           75.9    6e-15   
ref|XP_008369404.1|  PREDICTED: transcription factor MYB23-like       75.9    6e-15   
ref|XP_004169452.1|  PREDICTED: transcriptional activator Myb-like    75.9    6e-15   
ref|XP_004152727.1|  PREDICTED: transcriptional activator Myb-like    75.9    7e-15   
ref|XP_009615291.1|  PREDICTED: transcription factor MYB122-like      77.4    7e-15   
ref|XP_008649548.1|  PREDICTED: transcription factor MYB48-like       77.0    8e-15   
gb|EPS67829.1|  hypothetical protein M569_06945                       75.1    8e-15   
ref|XP_009781248.1|  PREDICTED: transcription factor MYB122-like      77.0    8e-15   
ref|XP_007224927.1|  hypothetical protein PRUPE_ppa021680mg           73.2    9e-15   
ref|NP_181517.1|  myb domain protein 25                               76.6    9e-15   
ref|XP_008444647.1|  PREDICTED: transcription factor MYB44-like       75.5    9e-15   
emb|CDY20494.1|  BnaC04g05500D                                        76.6    9e-15   
ref|XP_005650301.1|  hypothetical protein COCSUDRAFT_12896            73.2    1e-14   
ref|XP_004964242.1|  PREDICTED: transcriptional activator Myb-like    75.1    1e-14   
gb|ADL36766.1|  MYB domain class transcription factor                 76.3    2e-14   
ref|XP_006291267.1|  hypothetical protein CARUB_v10017397mg           76.3    2e-14   
ref|XP_010504436.1|  PREDICTED: myb-related protein B-like            76.3    2e-14   
gb|EYU19967.1|  hypothetical protein MIMGU_mgv1a006317mg              76.3    2e-14   
ref|XP_004157388.1|  PREDICTED: transcription factor MYB44-like       73.9    2e-14   
ref|XP_006843647.1|  hypothetical protein AMTR_s00007p00169630        74.3    2e-14   
ref|XP_006575526.1|  PREDICTED: transcription factor MYB104-like      75.9    2e-14   
ref|XP_004140809.1|  PREDICTED: transcription factor MYB44-like       73.9    3e-14   
ref|XP_006411228.1|  hypothetical protein EUTSA_v10016794mg           75.5    3e-14   
ref|XP_010106095.1|  Transcription factor                             75.5    3e-14   
ref|XP_010239722.1|  PREDICTED: transcription factor MYB44-like       73.9    3e-14   
ref|XP_008674458.1|  PREDICTED: transcription factor MYB44-like       73.9    3e-14   
ref|XP_006595859.1|  PREDICTED: transcription factor MYB44-like       73.6    3e-14   
ref|XP_002489094.1|  hypothetical protein SORBIDRAFT_0088s002210      74.7    4e-14   
ref|XP_003616662.1|  Myb transcription factor                         73.9    4e-14   
ref|XP_010516160.1|  PREDICTED: myb-like protein A                    75.1    4e-14   
emb|CBH32525.1|  Myb-like DNA-binding domain containing protein,e...  75.5    4e-14   



>ref|XP_004291065.1| PREDICTED: transcription factor MYB44-like [Fragaria vesca subsp. 
vesca]
Length=326

 Score =   101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  55   KEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            K+AAADRIKGPWSPEEDE L+RLV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  7    KKAAADRIKGPWSPEEDEALQRLVQSYGPRNWSLISKSIPGRSGKSCRLRWC  58



>gb|AGN52031.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52141.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=317

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE+L++LVEK+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  7    ADRIKGPWSPEEDELLQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWC  54



>emb|CDP01282.1| unnamed protein product [Coffea canephora]
Length=332

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +DRIKGPWSPEEDE+L+RLVEK+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   SDRIKGPWSPEEDELLQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWC  57



>emb|CDP02540.1| unnamed protein product [Coffea canephora]
Length=365

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEED++L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  20   ADRIKGPWSPEEDDLLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  67



>gb|EYU25477.1| hypothetical protein MIMGU_mgv1a010338mg [Erythranthe guttata]
Length=315

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +DRIKGPWSPEEDE+L+RLVEK+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  7    SDRIKGPWSPEEDELLQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWC  54



>ref|NP_001235142.1| MYB transcription factor MYB112 [Glycine max]
 gb|ABH02852.1| MYB transcription factor MYB112 [Glycine max]
Length=305

 Score = 95.5 bits (236),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LVEK+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  2    DRIKGPWSPEEDEALQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWC  48



>ref|XP_011074411.1| PREDICTED: transcription factor MYB44-like [Sesamum indicum]
Length=327

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 2/55 (4%)
 Frame = +1

Query  46   EEKKEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ++KKE   DRIKGPWSPEED++L+RLVEK+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  5    DQKKET--DRIKGPWSPEEDDLLQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWC  57



>ref|XP_007156759.1| hypothetical protein PHAVU_002G015100g [Phaseolus vulgaris]
 gb|ESW28753.1| hypothetical protein PHAVU_002G015100g [Phaseolus vulgaris]
Length=300

 Score = 95.5 bits (236),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L+RLVEK+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  2    DRIKGPWSPEEDEALQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWC  48



>ref|XP_010059753.1| PREDICTED: transcription factor MYB44-like [Eucalyptus grandis]
 gb|KCW66164.1| hypothetical protein EUGRSUZ_F000021 [Eucalyptus grandis]
Length=339

 Score = 95.5 bits (236),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L+RLV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  14   ADRIKGPWSPEEDEALQRLVQSYGPRNWSLISKSIPGRSGKSCRLRWC  61



>gb|KDP41681.1| hypothetical protein JCGZ_16088 [Jatropha curcas]
 gb|AIT52202.1| MYB family protein [Jatropha curcas]
Length=313

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  43   MEEKKEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            M        DRIKGPWSPEEDE L+RLV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  1    MASAARKDVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWC  56



>gb|AGN52056.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52166.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=257

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED++L+RLVEK+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  2    DRIKGPWSPEEDDLLQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWC  48



>ref|NP_001238087.1| MYB transcription factor MYB50 [Glycine max]
 gb|ABH02824.1| MYB transcription factor MYB50 [Glycine max]
 gb|KHN12962.1| Transcription factor MYB44 [Glycine soja]
Length=297

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LVEK+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  2    DRIKGPWSPEEDEALQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWC  48



>gb|AIK01747.1| MYB [Chrysanthemum indicum var. aromaticum]
Length=315

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSP+EDEML  LVEK+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   DRIKGPWSPDEDEMLTNLVEKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>ref|XP_001753593.1| predicted protein [Physcomitrella patens]
 gb|EDQ81816.1| predicted protein, partial [Physcomitrella patens]
Length=117

 Score = 91.3 bits (225),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEED  L++LV+KYGPRNWSLIG  IPGRSGKSCRLRWC
Sbjct  13   VDRIKGPWSPEEDSALQQLVDKYGPRNWSLIGKGIPGRSGKSCRLRWC  60



>gb|AEO27498.1| MYB2 [Chrysanthemum x morifolium]
Length=315

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSP+EDEML  LVEK+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   DRIKGPWSPDEDEMLTNLVEKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>ref|XP_007227715.1| hypothetical protein PRUPE_ppa008979mg [Prunus persica]
 gb|EMJ28914.1| hypothetical protein PRUPE_ppa008979mg [Prunus persica]
Length=312

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L++LV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    ADRIKGPWSPEEDEALQKLVKNYGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_011099313.1| PREDICTED: transcription factor MYB44-like [Sesamum indicum]
Length=360

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  55   KEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            K+   DRIKGPWSPEEDE+L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  11   KKMDMDRIKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  62



>ref|XP_011029247.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=311

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L+RLV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    VDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_006374871.1| hypothetical protein POPTR_0014s02260g [Populus trichocarpa]
 gb|ERP52668.1| hypothetical protein POPTR_0014s02260g [Populus trichocarpa]
Length=311

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L+RLV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    VDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_004151866.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 ref|XP_004156766.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 gb|KGN63306.1| hypothetical protein Csa_2G427310 [Cucumis sativus]
Length=301

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEED+ L+RLV KYGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  5    TDRIKGPWSPEEDDALQRLVHKYGPRNWSLISKSIPGRSGKSCRLRWC  52



>ref|XP_008462845.1| PREDICTED: transcription factor MYB44-like [Cucumis melo]
Length=301

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L+RLV KYGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  6    DRIKGPWSPEEDDALQRLVHKYGPRNWSLISKSIPGRSGKSCRLRWC  52



>gb|KDO84060.1| hypothetical protein CISIN_1g022144mg [Citrus sinensis]
Length=302

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L+RLV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    VDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_002302428.2| hypothetical protein POPTR_0002s12410g, partial [Populus trichocarpa]
 gb|EEE81701.2| hypothetical protein POPTR_0002s12410g, partial [Populus trichocarpa]
Length=321

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L+RLV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  26   VDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWC  73



>gb|ACJ85153.1| unknown [Medicago truncatula]
Length=199

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LVEK+GPRNWS+I  SIPGRSGKSCRLRWC
Sbjct  12   DRIKGPWSPEEDEALQKLVEKHGPRNWSIISKSIPGRSGKSCRLRWC  58



>ref|XP_006434697.1| hypothetical protein CICLE_v10001979mg [Citrus clementina]
 gb|ESR47937.1| hypothetical protein CICLE_v10001979mg [Citrus clementina]
Length=302

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L+RLV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    VDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|NP_001275798.1| putative R2R3-MYB transcription factor [Citrus sinensis]
 gb|AEK32395.1| putative R2R3-MYB transcription factor [Citrus sinensis]
Length=302

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L+RLV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    VDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_002285015.1| PREDICTED: transcription factor MYB44-like [Vitis vinifera]
Length=313

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L+RLV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>emb|CBI19466.3| unnamed protein product [Vitis vinifera]
Length=261

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L+RLV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  20   DRIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  66



>ref|XP_011017151.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=305

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L+RLV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    VDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_008220277.1| PREDICTED: transcription factor MYB44-like [Prunus mume]
Length=312

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L++LV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    ADRIKGPWSPEEDEALQKLVKNYGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_010556427.1| PREDICTED: transcription factor MYB44-like [Tarenaya hassleriana]
Length=316

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L+RLV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  12   TDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWC  59



>gb|AFK47194.1| unknown [Medicago truncatula]
Length=326

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LVEK+GPRNWS+I  SIPGRSGKSCRLRWC
Sbjct  12   DRIKGPWSPEEDEALQKLVEKHGPRNWSIISKSIPGRSGKSCRLRWC  58



>ref|XP_008440323.1| PREDICTED: transcription factor MYB44 [Cucumis melo]
Length=303

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L+RLV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDDALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>gb|ADN33728.1| MYB transcription factor [Cucumis melo subsp. melo]
Length=211

 Score = 92.8 bits (229),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L+RLVE YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    VDRIKGPWSPEEDESLKRLVESYGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_010691674.1| PREDICTED: transcription factor MYB44-like [Beta vulgaris subsp. 
vulgaris]
Length=264

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +1

Query  64   AADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            AADRIKGPWSPEEDE+L++LV+K+G RNWS+I  SIPGRSGKSCRLRWC
Sbjct  13   AADRIKGPWSPEEDELLQKLVQKHGARNWSVISKSIPGRSGKSCRLRWC  61



>ref|XP_004142878.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 ref|XP_004156374.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 gb|KGN62477.1| hypothetical protein Csa_2G355030 [Cucumis sativus]
Length=290

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L+RLVE YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    VDRIKGPWSPEEDESLKRLVESYGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_003611666.1| R2R3-MYB transcription factor [Medicago truncatula]
 gb|AES94624.1| myb transcription factor [Medicago truncatula]
Length=316

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LVEK+GPRNWS+I  SIPGRSGKSCRLRWC
Sbjct  2    DRIKGPWSPEEDEALQKLVEKHGPRNWSIISKSIPGRSGKSCRLRWC  48



>gb|AAG08959.1|AF122051_1 tuber-specific and sucrose-responsive element binding factor 
[Solanum tuberosum]
Length=364

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DR+KGPWSPEEDE+L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  2    DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  48



>ref|XP_010095320.1| Transcription factor [Morus notabilis]
 gb|EXB59531.1| Transcription factor [Morus notabilis]
Length=304

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  2    DRIKGPWSPEEDEALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  48



>ref|XP_004141899.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 ref|XP_004157164.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 gb|KGN48557.1| Sucrose responsive element binding protein [Cucumis sativus]
Length=301

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L+RLV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDDALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>gb|AGL76985.1| MYB transcription factor [Cucumis melo]
Length=294

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L+RLVE YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    VDRIKGPWSPEEDESLKRLVESYGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_008444592.1| PREDICTED: transcription factor MYB44-like [Cucumis melo]
Length=296

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L+RLVE YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    VDRIKGPWSPEEDESLKRLVESYGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_009586849.1| PREDICTED: transcription factor MYB44-like [Nicotiana tomentosiformis]
Length=329

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +DRIKGPWSPEEDE+L+ LVEK+GPRNWSLI  S+PGRSGKSCRLRWC
Sbjct  10   SDRIKGPWSPEEDELLQSLVEKHGPRNWSLISKSVPGRSGKSCRLRWC  57



>dbj|BAC53938.1| Myb-like protein [Nicotiana tabacum]
Length=329

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +DRIKGPWSPEEDE+L+ LVEK+GPRNWSLI  S+PGRSGKSCRLRWC
Sbjct  10   SDRIKGPWSPEEDELLQSLVEKHGPRNWSLISKSVPGRSGKSCRLRWC  57



>gb|EPS70032.1| myb-like protein, partial [Genlisea aurea]
Length=147

 Score = 91.3 bits (225),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  43   MEEKKEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            M  +KE +++R KGPWSPEED +L RLVEK GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  4    MAARKEESSERAKGPWSPEEDGLLRRLVEKQGPRNWSLISKSIPGRSGKSCRLRWC  59



>ref|XP_002510155.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF52342.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=295

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L+RLV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  12   VDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWC  59



>ref|XP_010271172.1| PREDICTED: transcription factor MYB44-like [Nelumbo nucifera]
Length=329

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDEALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>emb|CDY43567.1| BnaC02g16640D [Brassica napus]
Length=217

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L RLV KYGPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWC  49



>ref|XP_006339846.1| PREDICTED: transcription factor MYB44-like [Solanum tuberosum]
Length=371

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DR+KGPWSPEEDE+L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_009795719.1| PREDICTED: transcription factor MYB44-like [Nicotiana sylvestris]
Length=332

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +DRIKGPWSPEEDE+L+ LVEK+GPRNWSLI  S+PGRSGKSCRLRWC
Sbjct  10   SDRIKGPWSPEEDELLQSLVEKHGPRNWSLISKSVPGRSGKSCRLRWC  57



>ref|XP_010315996.1| PREDICTED: transcription factor MYB44-like [Solanum lycopersicum]
Length=372

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DR+KGPWSPEEDE+L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  13   DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  59



>gb|ABQ10818.1| putative R2R3-Myb transcription factor [Citrus sinensis]
Length=317

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_009588514.1| PREDICTED: transcription factor MYB44 [Nicotiana tomentosiformis]
Length=361

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DR+KGPWSPEEDE+L++LV K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  13   DRVKGPWSPEEDELLQQLVHKHGPRNWSLISKSIPGRSGKSCRLRWC  59



>ref|XP_004141275.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 gb|KGN55237.1| hypothetical protein Csa_4G641690 [Cucumis sativus]
Length=263

 Score = 92.8 bits (229),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSP+EDE+L RLV  YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  5    TDRIKGPWSPDEDELLRRLVHNYGPRNWSLISKSIPGRSGKSCRLRWC  52



>ref|XP_007205522.1| hypothetical protein PRUPE_ppa008450mg [Prunus persica]
 gb|EMJ06721.1| hypothetical protein PRUPE_ppa008450mg [Prunus persica]
Length=331

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L+RLV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDDALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_004511885.1| PREDICTED: transcription factor MYB44-like [Cicer arietinum]
Length=323

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L+ LVEK+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  11   DRIKGPWSPEEDEALQNLVEKHGPRNWSLISKSIPGRSGKSCRLRWC  57



>gb|AFS65096.1| sucrose responsive element-binding protein [Elaeis guineensis]
Length=372

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  13   DRIKGPWSPEEDEALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  59



>ref|NP_001235731.1| MYB transcription factor MYB178 [Glycine max]
 gb|ABH02834.1| MYB transcription factor MYB178 [Glycine max]
Length=178

 Score = 91.7 bits (226),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LVE++GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   DRIKGPWSPEEDEALQKLVERHGPRNWSLISRSIPGRSGKSCRLRWC  56



>gb|ABN11121.1| MYB transcription factor [Capsicum annuum]
Length=345

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DR+KGPWSPEEDE+L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  2    DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  48



>gb|EYU36318.1| hypothetical protein MIMGU_mgv1a022221mg, partial [Erythranthe 
guttata]
Length=288

 Score = 93.2 bits (230),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +1

Query  64   AADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            AADRIKGPWSP+ED++L+RLVEK+GPRNWSLI  SI GRSGKSCRLRWC
Sbjct  1    AADRIKGPWSPDEDDLLQRLVEKHGPRNWSLISKSILGRSGKSCRLRWC  49



>ref|XP_010928389.1| PREDICTED: transcription factor MYB44-like [Elaeis guineensis]
Length=372

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  13   DRIKGPWSPEEDEALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  59



>ref|XP_004163238.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB44-like 
[Cucumis sativus]
Length=262

 Score = 92.8 bits (229),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSP+EDE+L RLV  YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  5    TDRIKGPWSPDEDELLRRLVHNYGPRNWSLISKSIPGRSGKSCRLRWC  52



>ref|XP_010943207.1| PREDICTED: transcription factor MYB44-like [Elaeis guineensis]
Length=370

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L+RLV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  13   DRIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  59



>ref|XP_006425988.1| hypothetical protein CICLE_v10026107mg [Citrus clementina]
 gb|ABQ10816.1| putative R2R3-Myb transcription factor [Citrus sinensis]
 gb|ESR39228.1| hypothetical protein CICLE_v10026107mg [Citrus clementina]
Length=317

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    VDRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_003524661.1| PREDICTED: transcription factor MYB44 [Glycine max]
Length=295

 Score = 92.8 bits (229),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LVE++GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   DRIKGPWSPEEDEALQKLVERHGPRNWSLISRSIPGRSGKSCRLRWC  56



>ref|XP_004238123.1| PREDICTED: transcription factor MYB44-like [Solanum lycopersicum]
Length=328

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +DRIKGPWSPEEDE+L+ LVEK+GPRNW+LI  S+PGRSGKSCRLRWC
Sbjct  10   SDRIKGPWSPEEDELLQTLVEKHGPRNWTLISKSVPGRSGKSCRLRWC  57



>ref|XP_010547530.1| PREDICTED: transcription factor MYB44-like [Tarenaya hassleriana]
Length=315

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEED+ L RLV+KYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDDQLRRLVDKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>gb|ABQ10819.1| putative R2R3-Myb transcription factor [Citrus sinensis]
Length=317

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    VDRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|NP_001275856.1| putative R2R3-Myb transcription factor [Citrus sinensis]
 gb|ABQ10817.1| putative R2R3-Myb transcription factor [Citrus sinensis]
 gb|KDO79070.1| hypothetical protein CISIN_1g021071mg [Citrus sinensis]
Length=317

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|NP_001268121.1| sucrose responsive element binding protein [Vitis vinifera]
 gb|AAY28930.1| sucrose responsive element binding protein [Vitis vinifera]
Length=312

 Score = 92.8 bits (229),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEED+ L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    ADRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_002524926.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF37423.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=339

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>gb|AHB59606.1| putative MYB-related protein 20 [Arachis hypogaea]
Length=352

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L++LVEK+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  16   DRIKGPWSPEEDDALQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWC  62



>ref|XP_007155887.1| hypothetical protein PHAVU_003G240200g [Phaseolus vulgaris]
 gb|ESW27881.1| hypothetical protein PHAVU_003G240200g [Phaseolus vulgaris]
Length=289

 Score = 92.8 bits (229),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LVE++GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   DRIKGPWSPEEDEALQKLVERHGPRNWSLISRSIPGRSGKSCRLRWC  56



>gb|KFK28404.1| hypothetical protein AALP_AA8G510400 [Arabis alpina]
Length=309

 Score = 92.8 bits (229),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L RLV KYGPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWC  49



>ref|XP_002866710.1| AtMYB44/AtMYBr1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42969.1| AtMYB44/AtMYBr1 [Arabidopsis lyrata subsp. lyrata]
Length=305

 Score = 92.8 bits (229),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L RLV KYGPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWC  49



>gb|KDP31997.1| hypothetical protein JCGZ_12458 [Jatropha curcas]
 gb|AIT52201.1| MYB family protein [Jatropha curcas]
Length=326

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>gb|KDO79069.1| hypothetical protein CISIN_1g021071mg [Citrus sinensis]
Length=278

 Score = 92.4 bits (228),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    VDRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_007047395.1| Myb domain protein 73, putative [Theobroma cacao]
 gb|EOX91552.1| Myb domain protein 73, putative [Theobroma cacao]
Length=312

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED++L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  13   DRIKGPWSPEEDDLLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  59



>ref|XP_010679545.1| PREDICTED: transcription factor MYB44 [Beta vulgaris subsp. vulgaris]
Length=313

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L RLV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  18   VDRIKGPWSPEEDEALTRLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  65



>emb|CAA90809.1| MYB-related protein [Arabidopsis thaliana]
Length=305

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L RLV KYGPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWC  49



>ref|XP_006367421.1| PREDICTED: transcription factor MYB44-like [Solanum tuberosum]
Length=320

 Score = 92.8 bits (229),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +DRIKGPWSPEEDE+L+ LVEK+GPRNW+LI  S+PGRSGKSCRLRWC
Sbjct  10   SDRIKGPWSPEEDELLQTLVEKHGPRNWTLISKSVPGRSGKSCRLRWC  57



>ref|XP_010101670.1| Transcription factor [Morus notabilis]
 gb|EXB89236.1| Transcription factor [Morus notabilis]
Length=303

 Score = 92.4 bits (228),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L RLV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDEALRRLVQNYGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_006279745.1| hypothetical protein CARUB_v10027659mg [Capsella rubella]
 gb|EOA12643.1| hypothetical protein CARUB_v10027659mg [Capsella rubella]
Length=300

 Score = 92.4 bits (228),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L RLV KYGPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWC  49



>gb|AAM64847.1| myb-related protein, 33.3K [Arabidopsis thaliana]
Length=305

 Score = 92.4 bits (228),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L RLV KYGPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWC  49



>ref|XP_009798591.1| PREDICTED: transcription factor MYB44 [Nicotiana sylvestris]
Length=357

 Score = 92.8 bits (229),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DR+KGPWSPEEDE+L++LV K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  13   DRVKGPWSPEEDELLQQLVHKHGPRNWSLISKSIPGRSGKSCRLRWC  59



>ref|XP_006393928.1| hypothetical protein EUTSA_v10004676mg [Eutrema salsugineum]
 gb|ESQ31214.1| hypothetical protein EUTSA_v10004676mg [Eutrema salsugineum]
Length=301

 Score = 92.4 bits (228),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L RLV KYGPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWC  49



>ref|XP_010484518.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=309

 Score = 92.4 bits (228),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L RLV KYGPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWC  49



>ref|NP_201531.1| transcription factor MYB44 [Arabidopsis thaliana]
 sp|Q9FDW1.1|MYB44_ARATH RecName: Full=Transcription factor MYB44; AltName: Full=Myb-related 
protein 44; Short=AtMYB44; AltName: Full=Myb-related 
protein R1; Short=AtMYBR1 [Arabidopsis thaliana]
 gb|AAG41459.1|AF326877_1 putative myb-related protein, 33.3K [Arabidopsis thaliana]
 gb|AAK00380.1|AF339698_1 putative myb-related protein, 33.3K [Arabidopsis thaliana]
 dbj|BAB09015.1| myb-related protein, 33.3K [Arabidopsis thaliana]
 gb|AAS10118.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AED98326.1| transcription factor MYB44 [Arabidopsis thaliana]
 dbj|BAP16463.1| myb-related protein, 33.3K [Cloning vector pTACAtg1]
Length=305

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L RLV KYGPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWC  49



>ref|XP_010548433.1| PREDICTED: transcription factor MYB44 isoform X2 [Tarenaya hassleriana]
 ref|XP_010548434.1| PREDICTED: transcription factor MYB44 isoform X3 [Tarenaya hassleriana]
Length=328

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +RIKGPWSPEEDE+L++LVEK+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   ERIKGPWSPEEDELLQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>ref|XP_010548432.1| PREDICTED: transcription factor MYB44 isoform X1 [Tarenaya hassleriana]
Length=328

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +RIKGPWSPEEDE+L++LVEK+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   ERIKGPWSPEEDELLQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>dbj|BAJ40867.1| transcriptional factor MYB-1 [Coptis japonica]
Length=312

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED++L +LV K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  12   DRIKGPWSPEEDDLLTKLVHKHGPRNWSLISKSIPGRSGKSCRLRWC  58



>gb|AAK96490.1| AT5g67300/K8K14_2 [Arabidopsis thaliana]
 gb|AAL31250.1| AT5g67300/K8K14_2 [Arabidopsis thaliana]
Length=305

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L RLV KYGPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWC  49



>ref|XP_009398678.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=371

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LV+++GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  14   DRIKGPWSPEEDEALQKLVQRHGPRNWSLISKSIPGRSGKSCRLRWC  60



>ref|XP_010444669.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=310

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L RLV KYGPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWC  49



>ref|XP_010464243.1| PREDICTED: transcription factor MYB44 [Camelina sativa]
Length=309

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L RLV KYGPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWC  49



>ref|XP_010558924.1| PREDICTED: transcription factor MYB44-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558931.1| PREDICTED: transcription factor MYB44-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010558937.1| PREDICTED: transcription factor MYB44-like isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010558944.1| PREDICTED: transcription factor MYB44-like isoform X4 [Tarenaya 
hassleriana]
 ref|XP_010558950.1| PREDICTED: transcription factor MYB44-like isoform X5 [Tarenaya 
hassleriana]
Length=311

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEED+ L RLV KYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDDQLRRLVVKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>ref|XP_009587267.1| PREDICTED: transcription factor MYB44-like [Nicotiana tomentosiformis]
Length=269

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 48/56 (86%), Gaps = 2/56 (4%)
 Frame = +1

Query  43   MEEKKEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ME  KE    RIKGPWSPEEDE+L+RLVE++GPRNWS+I  SIPGRSGKSCRLRWC
Sbjct  1    MEAIKETG--RIKGPWSPEEDELLQRLVEEHGPRNWSIISKSIPGRSGKSCRLRWC  54



>gb|AAZ20429.1| MYB6 [Malus domestica]
 gb|ADL36770.1| MYB domain class transcription factor [Malus domestica]
Length=312

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L+RLV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDDSLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>gb|ADL36765.1| MYB domain class transcription factor [Malus domestica]
Length=317

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  58   EAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            E   DRIKGPWSPEEDE L+ LV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  5    EKVVDRIKGPWSPEEDEALQNLVKIYGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_006294656.1| hypothetical protein CARUB_v10023692mg [Capsella rubella]
 gb|EOA27554.1| hypothetical protein CARUB_v10023692mg [Capsella rubella]
Length=308

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEED++L+ LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   TDRIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  57



>emb|CDY01420.1| BnaA07g11930D [Brassica napus]
Length=263

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L +LV KYGPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDEQLRKLVVKYGPRNWTVISKSIPGRSGKSCRLRWC  49



>emb|CDY12830.1| BnaC07g16030D [Brassica napus]
Length=253

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L +LV KYGPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDEQLRKLVVKYGPRNWTVISKSIPGRSGKSCRLRWC  49



>ref|XP_008452606.1| PREDICTED: transcription factor MYB44-like [Cucumis melo]
Length=269

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  61   AAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            A  DRIKGPWSP+EDE+L RLV  YGPRNWSLI  SI GRSGKSCRLRWC
Sbjct  2    ATTDRIKGPWSPDEDELLRRLVHNYGPRNWSLISKSISGRSGKSCRLRWC  51



>ref|XP_011097391.1| PREDICTED: transcription factor MYB44 [Sesamum indicum]
Length=385

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEED++L++LV K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  14   VDRIKGPWSPEEDDLLQQLVHKHGPRNWSLISKSIPGRSGKSCRLRWC  61



>ref|XP_009395856.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=364

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSP EDE L+RLV+++GPRNWS+I  SIPGRSGKSCRLRWC
Sbjct  16   ADRIKGPWSPAEDEALQRLVQRHGPRNWSIISKSIPGRSGKSCRLRWC  63



>ref|XP_010244270.1| PREDICTED: transcription factor MYB44 [Nelumbo nucifera]
Length=330

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  43   MEEKKEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            M        DRIKGPWSPEED+ L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  1    MSSSSRKDQDRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>ref|XP_006844027.1| hypothetical protein AMTR_s00006p00225600 [Amborella trichopoda]
 gb|ERN05702.1| hypothetical protein AMTR_s00006p00225600 [Amborella trichopoda]
Length=303

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L +LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  2    DRIKGPWSPEEDEQLRKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  48



>gb|AHN60125.1| MYB transcription factor 44 [Brassica napus]
Length=300

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L +LV KYGPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDEQLRKLVVKYGPRNWTVISKSIPGRSGKSCRLRWC  49



>ref|XP_010417080.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=304

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED++L+ LVEK+GPRNWSLI  S+PGRSGKSCRLRWC
Sbjct  10   DRIKGPWSPEEDDLLQTLVEKHGPRNWSLITKSVPGRSGKSCRLRWC  56



>gb|ABD60288.2| R2R3-MYB transcription factor MYB9 [Picea glauca]
Length=260

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  61   AAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            A A+RIKGPWSPEED  L RLVEKYGPRNWS I   IPGRSGKSCRLRWC
Sbjct  1    AVAERIKGPWSPEEDATLHRLVEKYGPRNWSQISRGIPGRSGKSCRLRWC  50



>ref|XP_009103434.1| PREDICTED: transcription factor MYB44 [Brassica rapa]
Length=296

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L +LV KYGPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    ADRIKGPWSPEEDEQLRKLVVKYGPRNWTVISKSIPGRSGKSCRLRWC  49



>ref|XP_002880492.1| hypothetical protein ARALYDRAFT_481200 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56751.1| hypothetical protein ARALYDRAFT_481200 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED++L+ LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   DRIKGPWSPEEDDLLQTLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>ref|XP_006404809.1| hypothetical protein EUTSA_v10000438mg [Eutrema salsugineum]
 gb|ESQ46262.1| hypothetical protein EUTSA_v10000438mg [Eutrema salsugineum]
Length=296

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEED++L+ LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    TDRIKGPWSPEEDDLLQTLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>ref|XP_006286095.1| hypothetical protein CARUB_v10007638mg [Capsella rubella]
 gb|EOA18993.1| hypothetical protein CARUB_v10007638mg [Capsella rubella]
Length=319

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +RIKGPWSPEED++L+RLV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  11   ERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  57



>gb|AFK46950.1| unknown [Medicago truncatula]
Length=316

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LVEK GPRNWS+I  SIPGRSGKSCRLRWC
Sbjct  2    DRIKGPWSPEEDEALQKLVEKRGPRNWSIISKSIPGRSGKSCRLRWC  48



>ref|NP_001235715.1| MYB transcription factor MYB68 [Glycine max]
 gb|ABH02831.1| MYB transcription factor MYB68 [Glycine max]
Length=259

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L RLV+ YGPRNWS+I  SIPGRSGKSCRLRWC
Sbjct  2    DRIKGPWSPEEDEALRRLVQTYGPRNWSVISKSIPGRSGKSCRLRWC  48



>ref|XP_010437245.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=312

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +RIKGPWSPEED++L+RLV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  11   ERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  57



>gb|AGN52088.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52198.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=305

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED++L++LV+++GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  7    DRIKGPWSPEEDDLLQQLVQRHGPRNWSLISKSIPGRSGKSCRLRWC  53



>emb|CAN81361.1| hypothetical protein VITISV_028904 [Vitis vinifera]
Length=309

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  73   RIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            RIKGPWSPEEDE L+RLV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  6    RIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  51



>gb|ABD60281.1| R2R3-MYB transcription factor MYB7 [Pinus taeda]
Length=374

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED  L+RLV+KYGPRNW+LI   IPGRSGKSCRLRWC
Sbjct  13   DRIKGPWSPEEDASLQRLVQKYGPRNWTLISKGIPGRSGKSCRLRWC  59



>ref|NP_195443.1| myb domain protein 73 [Arabidopsis thaliana]
 emb|CAB16756.1| myb-related protein [Arabidopsis thaliana]
 emb|CAB80392.1| myb-related protein [Arabidopsis thaliana]
 gb|AAL36268.1| putative myb-related protein [Arabidopsis thaliana]
 gb|AAM14206.1| putative myb-related protein [Arabidopsis thaliana]
 gb|AAS10083.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE86774.1| myb domain protein 73 [Arabidopsis thaliana]
Length=320

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  43   MEEKKEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            M        +RIKGPWSPEED++L+RLV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  1    MSNPTRKNMERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>ref|XP_010432074.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=322

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +RIKGPWSPEED++L+RLV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  11   ERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  57



>gb|AAM65553.1| putative MYB family transcription factor [Arabidopsis thaliana]
Length=309

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED++L+ LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   DRIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>gb|AHN19846.1| MYB6 [Malus hybrid cultivar]
Length=312

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>gb|AHN19845.1| MYB6 [Malus hybrid cultivar]
Length=310

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_008360495.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB44-like, 
partial [Malus domestica]
Length=199

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_002877726.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53985.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=285

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L R+VEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>ref|XP_010070607.1| PREDICTED: transcription factor MYB44-like [Eucalyptus grandis]
 gb|KCW59483.1| hypothetical protein EUGRSUZ_H02226 [Eucalyptus grandis]
Length=339

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 46/56 (82%), Gaps = 2/56 (4%)
 Frame = +1

Query  43   MEEKKEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            M  +KE   DRIKGPWSPEEDE L  LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  1    MASRKEV--DRIKGPWSPEEDEALRLLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  54



>ref|XP_006411909.1| hypothetical protein EUTSA_v10025742mg [Eutrema salsugineum]
 gb|ESQ53362.1| hypothetical protein EUTSA_v10025742mg [Eutrema salsugineum]
Length=321

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +RIKGPWSPEED++L+RLV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   ERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>ref|XP_007136715.1| hypothetical protein PHAVU_009G068000g [Phaseolus vulgaris]
 gb|ESW08709.1| hypothetical protein PHAVU_009G068000g [Phaseolus vulgaris]
Length=262

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L R V+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  8    DRIKGPWSPEEDEALRRFVQIYGPRNWSLISKSIPGRSGKSCRLRWC  54



>gb|AFH03065.1| R2R3-MYB transcription factor MYB13 [Epimedium sagittatum]
Length=350

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L +LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  11   DRIKGPWSPEEDDSLTKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  57



>ref|NP_179910.1| myb domain protein 70 [Arabidopsis thaliana]
 gb|AAB87103.1| MYB family transcription factor [Arabidopsis thaliana]
 dbj|BAC41938.1| putative MYB family transcription factor [Arabidopsis thaliana]
 gb|AAP37702.1| At2g23280 [Arabidopsis thaliana]
 gb|AAS10044.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEC07437.1| myb domain protein 70 [Arabidopsis thaliana]
Length=309

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED++L+ LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   DRIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>ref|XP_010446682.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=319

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +RIKGPWSPEED++L+RLV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  11   ERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  57



>gb|ABR16702.1| unknown [Picea sitchensis]
Length=418

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  61   AAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            A A+RIKGPWSPEED  L RLVEKYGPRNWS I   IPGRSGKSCRLRWC
Sbjct  13   AVAERIKGPWSPEEDATLHRLVEKYGPRNWSQISRGIPGRSGKSCRLRWC  62



>ref|XP_008367655.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=317

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  64   AADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
              DRIKGPWSPEEDE L+ LV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  7    VVDRIKGPWSPEEDEALQNLVKIYGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_008351984.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=317

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  64   AADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
              DRIKGPWSPEEDE L+ LV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  7    VVDRIKGPWSPEEDEALQNLVKIYGPRNWSLISKSIPGRSGKSCRLRWC  55



>gb|ABQ51225.1| R2R3-MYB transcription factor MYB9 [Picea glauca]
Length=416

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  61   AAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            A A+RIKGPWSPEED  L RLVEKYGPRNWS I   IPGRSGKSCRLRWC
Sbjct  13   AVAERIKGPWSPEEDATLHRLVEKYGPRNWSQISRGIPGRSGKSCRLRWC  62



>ref|NP_001287808.1| transcription factor MYB44-like [Malus domestica]
 gb|ADL36769.1| MYB domain class transcription factor [Malus domestica]
Length=319

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L+ LV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDEALQNLVKNYGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_009372447.1| PREDICTED: transcription factor MYB44-like [Pyrus x bretschneideri]
Length=316

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>emb|CAN75196.1| hypothetical protein VITISV_014739 [Vitis vinifera]
Length=301

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>gb|ABR28330.1| MYB transcription factor MYB8 [Medicago truncatula]
Length=269

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L +LV++YGPRNWSLI  +IPGRSGKSCRLRWC
Sbjct  2    DRIKGPWSPEEDESLTKLVDRYGPRNWSLISRAIPGRSGKSCRLRWC  48



>gb|KEH31491.1| myb transcription factor [Medicago truncatula]
Length=271

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L +LV++YGPRNWSLI  +IPGRSGKSCRLRWC
Sbjct  2    DRIKGPWSPEEDESLTKLVDRYGPRNWSLISRAIPGRSGKSCRLRWC  48



>ref|XP_011010210.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=335

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LV+++GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDEALQKLVQRHGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_010472329.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=309

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +RIKGPWSPEED++L+ LVEK+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   NRIKGPWSPEEDDLLQTLVEKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>gb|ABV02031.1| sucrose responsive element binding factor 1 [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=282

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 2/56 (4%)
 Frame = +1

Query  43   MEEKKEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ME  KE    RIKGPW+PEEDE+L+RLVE++GPRNWS+I  SIPGRSGKSCRLRWC
Sbjct  1    MEAIKETG--RIKGPWNPEEDELLQRLVEEHGPRNWSIISKSIPGRSGKSCRLRWC  54



>ref|XP_010429274.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=306

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED++L+ LVEK+GPRNWSLI  SIPGR GKSCRLRWC
Sbjct  10   DRIKGPWSPEEDDLLQTLVEKHGPRNWSLISKSIPGRPGKSCRLRWC  56



>ref|XP_009354151.1| PREDICTED: transcription factor MYB44-like [Pyrus x bretschneideri]
Length=319

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L+ LV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDEALQNLVKTYGPRNWSLISKSIPGRSGKSCRLRWC  55



>gb|AHB59592.1| putative R2R3 MYB protein 4 [Arachis hypogaea]
Length=316

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L+RLVE++GPRNW+LI   IPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDEALQRLVERHGPRNWTLISKYIPGRSGKSCRLRWC  55



>ref|XP_009367649.1| PREDICTED: transcription factor MYB44 [Pyrus x bretschneideri]
Length=323

 Score = 90.5 bits (223),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_009136534.1| PREDICTED: transcription factor MYB44-like [Brassica rapa]
Length=293

 Score = 90.5 bits (223),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L R+VEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSEEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>gb|ADL36764.1| MYB domain class transcription factor [Malus domestica]
Length=306

 Score = 90.5 bits (223),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  2    DRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  48



>ref|XP_008391509.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=313

 Score = 90.5 bits (223),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_004287994.1| PREDICTED: transcription factor MYB44-like [Fragaria vesca subsp. 
vesca]
Length=309

 Score = 90.5 bits (223),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  43   MEEKKEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            M  K+    DRIKGPWSPEED+ L+ LV+K+GPRNWSLI  +IPGRSGKSCRLRWC
Sbjct  3    MNRKEMDRMDRIKGPWSPEEDDALQSLVQKHGPRNWSLISKAIPGRSGKSCRLRWC  58



>emb|CDY22442.1| BnaC03g61550D [Brassica napus]
Length=275

 Score = 90.1 bits (222),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +RIKGPWSPEEDE+L+ LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   ERIKGPWSPEEDELLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>ref|NP_190575.1| myb domain protein 77 [Arabidopsis thaliana]
 gb|AAL11582.1|AF424588_1 AT3g50060/F3A4_140 [Arabidopsis thaliana]
 emb|CAB62114.1| R2R3-MYB transcription factor [Arabidopsis thaliana]
 gb|AAM70537.1| AT3g50060/F3A4_140 [Arabidopsis thaliana]
 gb|AAS10068.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE78622.1| myb domain protein 77 [Arabidopsis thaliana]
Length=301

 Score = 90.1 bits (222),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L R+VEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>emb|CAA74604.1| R2R3-MYB transcription factor [Arabidopsis thaliana]
Length=304

 Score = 90.1 bits (222),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L R+VEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>ref|XP_006404067.1| hypothetical protein EUTSA_v10010581mg [Eutrema salsugineum]
 gb|ESQ45520.1| hypothetical protein EUTSA_v10010581mg [Eutrema salsugineum]
Length=300

 Score = 90.1 bits (222),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L ++VEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSQEEDEQLRKMVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>ref|XP_009109365.1| PREDICTED: transcription factor MYB44-like [Brassica rapa]
Length=305

 Score = 90.1 bits (222),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +RIKGPWSPEEDE+L+ LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   ERIKGPWSPEEDELLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>emb|CDY23023.1| BnaC07g31640D [Brassica napus]
Length=290

 Score = 90.1 bits (222),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L R+VEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSEEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>ref|XP_006293134.1| hypothetical protein CARUB_v10019440mg [Capsella rubella]
 gb|EOA26032.1| hypothetical protein CARUB_v10019440mg [Capsella rubella]
Length=309

 Score = 90.1 bits (222),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L R+VEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>ref|XP_008338349.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=312

 Score = 90.1 bits (222),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L+ LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDDSLQXLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_009360105.1| PREDICTED: transcription factor MYB44-like [Pyrus x bretschneideri]
Length=315

 Score = 90.1 bits (222),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  64   AADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
              DRIKGPWSPEEDE L+ LV+ YGPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  7    VVDRIKGPWSPEEDEELQNLVKIYGPRNWSLISKSIPGRSGKSCRLRWC  55



>emb|CAA90810.1| MYB-related protein [Arabidopsis thaliana]
Length=304

 Score = 90.1 bits (222),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L R+VEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>ref|XP_008351390.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=255

 Score = 89.7 bits (221),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L++LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_002306488.2| hypothetical protein POPTR_0005s18620g [Populus trichocarpa]
 gb|EEE93484.2| hypothetical protein POPTR_0005s18620g [Populus trichocarpa]
Length=351

 Score = 90.5 bits (223),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LV+++GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDEALKKLVQRHGPRNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_010531261.1| PREDICTED: transcription factor MYB44 [Tarenaya hassleriana]
Length=326

 Score = 90.1 bits (222),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +RIKGPWSPEED++L++LV K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   ERIKGPWSPEEDDLLQKLVHKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>gb|AHN50422.1| R2R3-type MYB transcription factor [Salicornia brachiata]
Length=269

 Score = 89.7 bits (221),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +1

Query  64   AADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            AADRIKGPWSPEED++L++LV+K+G RNWS I  SIPGRSGKSCRLRWC
Sbjct  14   AADRIKGPWSPEEDDLLKKLVDKHGARNWSEISKSIPGRSGKSCRLRWC  62



>emb|CDY02098.1| BnaA03g40690D [Brassica napus]
Length=293

 Score = 90.1 bits (222),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L R+VEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSEEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>ref|XP_010426549.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=311

 Score = 90.1 bits (222),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L R+VEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>ref|XP_009392116.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=371

 Score = 90.5 bits (223),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEED+ L++LV+++GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  17   VDRIKGPWSPEEDDALQKLVQRHGPRNWSLISKSIPGRSGKSCRLRWC  64



>ref|XP_011088207.1| PREDICTED: transcription factor MYB44-like [Sesamum indicum]
Length=286

 Score = 89.7 bits (221),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE+L +LV+++G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDELLRKLVQRHGARNWSLISRSIPGRSGKSCRLRWC  55



>ref|XP_008799576.1| PREDICTED: transcription factor MYB44-like [Phoenix dactylifera]
Length=366

 Score = 90.5 bits (223),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L +LV+K+G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  13   DRIKGPWSPEEDEALHKLVQKHGARNWSLISKSIPGRSGKSCRLRWC  59



>ref|NP_001183628.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACR37800.1| unknown [Zea mays]
 tpg|DAA39569.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04986.1| MYB transcription factor, partial [Zea mays]
Length=285

 Score = 89.7 bits (221),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  58   EAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +A  DRIKGPWSPEEDE L+RLV ++G RNWSLI  S+PGRSGKSCRLRWC
Sbjct  14   KAGVDRIKGPWSPEEDEALQRLVRRHGARNWSLISRSVPGRSGKSCRLRWC  64



>emb|CDY44045.1| BnaA08g15610D [Brassica napus]
Length=285

 Score = 89.7 bits (221),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +RIKGPWSPEEDE+L+ LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   ERIKGPWSPEEDELLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>ref|XP_010550347.1| PREDICTED: transcription factor MYB44-like [Tarenaya hassleriana]
Length=305

 Score = 89.7 bits (221),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWS EEDE L RLVEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    VDRIKGPWSVEEDEQLRRLVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>ref|XP_010486483.1| PREDICTED: myb protein-like [Camelina sativa]
Length=392

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 2/59 (3%)
 Frame = +1

Query  40   FMEEKKEA--AADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            F+EE+       DR+KGPWSPEED +L  LVEK+GPRNWSL+  SIPGRSGKSCRLRWC
Sbjct  42   FVEERASGRGGKDRVKGPWSPEEDVVLSELVEKFGPRNWSLMARSIPGRSGKSCRLRWC  100



>ref|XP_002518677.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF43602.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=245

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  58   EAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            E+A DR+KGPWSPEED +L++LV+++G RNW+LI  SIPGRSGKSCRLRWC
Sbjct  4    ESAFDRVKGPWSPEEDLLLKKLVQRHGARNWTLISKSIPGRSGKSCRLRWC  54



>gb|EYU34554.1| hypothetical protein MIMGU_mgv1a011398mg [Erythranthe guttata]
Length=283

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED++L+ LV+++GPRNW+LI  SIPGRSGKSCRLRWC
Sbjct  6    DRIKGPWSPEEDDLLQSLVQRHGPRNWTLISRSIPGRSGKSCRLRWC  52



>ref|XP_010470301.1| PREDICTED: myb-related protein B-like [Camelina sativa]
Length=395

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 2/59 (3%)
 Frame = +1

Query  40   FMEEKKEAAA--DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            F+EE+       DR+KGPWSPEED +L  LVEK+GPRNWSL+  SIPGRSGKSCRLRWC
Sbjct  42   FVEERTSGRGRKDRVKGPWSPEEDVVLSELVEKFGPRNWSLMARSIPGRSGKSCRLRWC  100



>ref|XP_003575562.1| PREDICTED: transcription factor MYB44-like [Brachypodium distachyon]
Length=336

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADRIKGPWSPEEDE L+RLV ++G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  20   ADRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWC  67



>ref|XP_001762255.1| predicted protein [Physcomitrella patens]
 gb|EDQ73047.1| predicted protein [Physcomitrella patens]
Length=117

 Score = 86.3 bits (212),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED +L RLVEK+G RNWSLI   IPGRSGKSCRLRWC
Sbjct  14   DRIKGPWSPEEDVVLNRLVEKFGARNWSLIARGIPGRSGKSCRLRWC  60



>ref|XP_007042527.1| Myb domain protein 73, putative [Theobroma cacao]
 gb|EOX98358.1| Myb domain protein 73, putative [Theobroma cacao]
Length=245

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DR+KGPWSPEEDE+L +LV + GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  6    DRVKGPWSPEEDELLRKLVLRLGPRNWSLISKSIPGRSGKSCRLRWC  52



>ref|NP_001235688.1| MYB transcription factor MYB61 [Glycine max]
 gb|ABH02829.1| MYB transcription factor MYB61 [Glycine max]
Length=305

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L +LVE++GPRNWSLI  SIPGRSGKSC LRWC
Sbjct  10   DRIKGPWSPEEDEALHKLVERHGPRNWSLISRSIPGRSGKSCMLRWC  56



>gb|KFK34266.1| hypothetical protein AALP_AA5G122700 [Arabis alpina]
Length=311

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L R+V+KYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSQEEDEQLRRMVDKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>emb|CDX69287.1| BnaC01g01660D [Brassica napus]
Length=306

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +RIKGPWSPEED++L+ LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   ERIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>ref|XP_011006987.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=330

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LV+K+G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDEALQKLVQKHGARNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_010464561.1| PREDICTED: myb-related protein B-like [Camelina sativa]
Length=392

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = +1

Query  40   FMEEKKEA----AADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRW  207
            F+EE+         DR+KGPWSPEED +L  LVEK+GPRNWSL+  SIPGRSGKSCRLRW
Sbjct  40   FVEERTSGRGGKGKDRVKGPWSPEEDVVLSELVEKFGPRNWSLMARSIPGRSGKSCRLRW  99

Query  208  C  210
            C
Sbjct  100  C  100



>ref|XP_002310702.1| hypothetical protein POPTR_0007s10490g [Populus trichocarpa]
 gb|EEE91152.1| hypothetical protein POPTR_0007s10490g [Populus trichocarpa]
Length=330

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LV+K+G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDEALQKLVQKHGARNWSLISKSIPGRSGKSCRLRWC  55



>ref|XP_001765018.1| predicted protein [Physcomitrella patens]
 gb|EDQ70234.1| predicted protein [Physcomitrella patens]
Length=129

 Score = 86.3 bits (212),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED +L RLVEK+G RNWSLI   IPGRSGKSCRLRWC
Sbjct  25   DRIKGPWSPEEDVVLNRLVEKFGARNWSLIARGIPGRSGKSCRLRWC  71



>emb|CDX72621.1| BnaC07g46430D [Brassica napus]
Length=265

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +RIKGPWSPEED++L++LVEK+GP+NWSLI  SIPGRSGKSCRLRWC
Sbjct  10   ERIKGPWSPEEDDLLQKLVEKHGPKNWSLISKSIPGRSGKSCRLRWC  56



>ref|XP_009137661.1| PREDICTED: transcription factor MYB44 [Brassica rapa]
 gb|AHN60130.1| MYB transcription factor 73 [Brassica napus]
Length=328

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +RIKGPWSPEED++L+ LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   ERIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>emb|CDX75635.1| BnaA01g00670D [Brassica napus]
Length=299

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +RIKGPWSPEED++L+ LV+K+GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  10   ERIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWC  56



>ref|XP_009396365.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=375

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 2/52 (4%)
 Frame = +1

Query  55   KEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            KEAA  RIKGPWSPEED  L+RLV+++GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  11   KEAA--RIKGPWSPEEDTSLQRLVQRHGPRNWSLISRSIPGRSGKSCRLRWC  60



>gb|KDP45901.1| hypothetical protein JCGZ_15461 [Jatropha curcas]
 gb|AIT52203.1| MYB family protein [Jatropha curcas]
Length=267

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  55   KEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +++  DR+KGPWSPEED++L++ V+++G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  3    QQSIIDRVKGPWSPEEDQLLQKFVQRHGARNWSLISKSIPGRSGKSCRLRWC  54



>ref|XP_006657167.1| PREDICTED: transcription factor MYB44-like [Oryza brachyantha]
Length=155

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  58   EAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            EA  DRI+GPWSPEEDE L RLVE++G RNW+ IG  IPGRSGKSCRLRWC
Sbjct  5    EADCDRIRGPWSPEEDEALRRLVERHGARNWTAIGREIPGRSGKSCRLRWC  55



>ref|NP_001046131.1| Os02g0187700 [Oryza sativa Japonica Group]
 dbj|BAD15518.1| putative tuber-specific and sucrose-responsive element binding 
factor [Oryza sativa Japonica Group]
 dbj|BAD15427.1| putative tuber-specific and sucrose-responsive element binding 
factor [Oryza sativa Japonica Group]
 dbj|BAF08045.1| Os02g0187700 [Oryza sativa Japonica Group]
Length=301

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  58   EAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            EA  DRIKGPWSPEEDE L RLVE++G RNW+ IG  IPGRSGKSCRLRWC
Sbjct  4    EAECDRIKGPWSPEEDEALRRLVERHGARNWTAIGRGIPGRSGKSCRLRWC  54



>ref|NP_001237693.1| MYB transcription factor MYB70 [Glycine max]
 gb|ABH02833.1| MYB transcription factor MYB70 [Glycine max]
Length=268

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DR+KGPWSPEEDE L RLV+ +GPRNWS+I  S+PGRSGKSCRLRWC
Sbjct  2    DRVKGPWSPEEDEALRRLVQAHGPRNWSVISKSVPGRSGKSCRLRWC  48



>ref|XP_002462029.1| hypothetical protein SORBIDRAFT_02g013010 [Sorghum bicolor]
 gb|EER98550.1| hypothetical protein SORBIDRAFT_02g013010 [Sorghum bicolor]
Length=366

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  55   KEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             +A  DRIKGPWSPEEDE L+RLV ++G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  13   NKADVDRIKGPWSPEEDEALQRLVARHGARNWSLISRSIPGRSGKSCRLRWC  64



>gb|EAZ22021.1| hypothetical protein OsJ_05678 [Oryza sativa Japonica Group]
Length=301

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  58   EAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            EA  DRIKGPWSPEEDE L RLVE++G RNW+ IG  IPGRSGKSCRLRWC
Sbjct  4    EAECDRIKGPWSPEEDEALRRLVERHGARNWTAIGRGIPGRSGKSCRLRWC  54



>emb|CDY30608.1| BnaAnng03830D [Brassica napus]
Length=265

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L  +VEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>emb|CDY57355.1| BnaC08g48630D [Brassica napus]
Length=278

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L  +VEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>gb|AHN60131.1| MYB transcription factor 77 [Brassica napus]
Length=265

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L  +VEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>ref|XP_006660414.1| PREDICTED: transcription factor MYB44-like [Oryza brachyantha]
Length=312

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEEDE L+RLV ++G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  14   VDRIKGPWSPEEDEALQRLVARHGARNWSLISKSIPGRSGKSCRLRWC  61



>gb|KDO59816.1| hypothetical protein CISIN_1g040502mg [Citrus sinensis]
Length=252

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  55   KEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +++ ++R+KGPWSPEED++L +LV++YG RNWS+I  SIPGRSGKSCRLRWC
Sbjct  3    RDSVSERVKGPWSPEEDQLLLKLVQRYGARNWSVISKSIPGRSGKSCRLRWC  54



>gb|ABL97967.1| R2R3-MYB transcription factor [Brassica rapa]
Length=266

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L  +VEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>ref|XP_006422932.1| hypothetical protein CICLE_v10029124mg [Citrus clementina]
 gb|ESR36172.1| hypothetical protein CICLE_v10029124mg [Citrus clementina]
Length=252

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  55   KEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +++ ++R+KGPWSPEED++L +LV++YG RNWS+I  SIPGRSGKSCRLRWC
Sbjct  3    RDSVSERVKGPWSPEEDQLLLKLVQRYGARNWSVISKSIPGRSGKSCRLRWC  54



>ref|XP_009115687.1| PREDICTED: transcription factor MYB44-like [Brassica rapa]
Length=266

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L  +VEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>ref|XP_006487005.1| PREDICTED: transcription factor MYB44-like [Citrus sinensis]
Length=252

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  55   KEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +++ ++R+KGPWSPEED++L +LV++YG RNWS+I  SIPGRSGKSCRLRWC
Sbjct  3    RDSVSERVKGPWSPEEDQLLLKLVQRYGARNWSVISKSIPGRSGKSCRLRWC  54



>gb|KFK38309.1| hypothetical protein AALP_AA3G097200 [Arabis alpina]
Length=353

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +R+KGPWSPEEDE+L +LVEK+G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  39   ERVKGPWSPEEDEVLAKLVEKFGARNWSLIARSIPGRSGKSCRLRWC  85



>ref|NP_001151336.1| sucrose responsive element binding protein [Zea mays]
 gb|ACG42418.1| sucrose responsive element binding protein [Zea mays]
 tpg|DAA60650.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=345

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L+RLV ++G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  18   DRIKGPWSPEEDEALQRLVARHGARNWSLISRSIPGRSGKSCRLRWC  64



>gb|ABC86569.1| MYB transcription factor TaMYB1 [Triticum aestivum]
Length=298

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  58   EAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            EA  DRIKGPWSPEEDE L RLVE++G RNW+ IG  IPGRSGKSCRLRWC
Sbjct  4    EAKCDRIKGPWSPEEDEALRRLVERHGARNWTAIGRGIPGRSGKSCRLRWC  54



>ref|XP_007160886.1| hypothetical protein PHAVU_001G025200g [Phaseolus vulgaris]
 gb|ESW32880.1| hypothetical protein PHAVU_001G025200g [Phaseolus vulgaris]
Length=276

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DR+KGPWSPEEDE L+RLV+  GPRNW++I  SIPGRSGKSCRLRWC
Sbjct  9    DRVKGPWSPEEDEALQRLVQALGPRNWTVISKSIPGRSGKSCRLRWC  55



>ref|XP_010515371.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=304

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L  +VEKYGPRNWS I  SIPGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSQEEDEQLRMMVEKYGPRNWSAISKSIPGRSGKSCRLRWC  49



>ref|XP_008811216.1| PREDICTED: transcription factor MYB44-like [Phoenix dactylifera]
Length=372

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LV+K+G RNWSLI  +IPGRSGKSCRLRWC
Sbjct  13   DRIKGPWSPEEDESLQKLVQKHGARNWSLISKAIPGRSGKSCRLRWC  59



>ref|XP_002961364.1| hypothetical protein SELMODRAFT_77255, partial [Selaginella moellendorffii]
 ref|XP_002980911.1| hypothetical protein SELMODRAFT_113522, partial [Selaginella 
moellendorffii]
 gb|EFJ18096.1| hypothetical protein SELMODRAFT_113522, partial [Selaginella 
moellendorffii]
 gb|EFJ36624.1| hypothetical protein SELMODRAFT_77255, partial [Selaginella moellendorffii]
Length=113

 Score = 84.7 bits (208),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  43   MEEKKEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ME   + + D+++GPWSPEED  L++L++KYG RNWSLI   +PGRSGKSCRLRWC
Sbjct  1    MESAVDRSIDKVRGPWSPEEDANLQKLIQKYGARNWSLISKGVPGRSGKSCRLRWC  56



>ref|NP_001058148.1| Os06g0637500 [Oryza sativa Japonica Group]
 dbj|BAD37513.1| putative tuber-specific and sucrose-responsive element binding 
factor [Oryza sativa Japonica Group]
 dbj|BAF20062.1| Os06g0637500 [Oryza sativa Japonica Group]
 gb|EAZ01805.1| hypothetical protein OsI_23829 [Oryza sativa Indica Group]
 dbj|BAG97384.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00552.1| unnamed protein product [Oryza sativa Japonica Group]
Length=311

 Score = 87.8 bits (216),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  58   EAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            EA  DRI+GPWSPEEDE L RLVE++G RNW+ IG  IPGRSGKSCRLRWC
Sbjct  8    EADCDRIRGPWSPEEDEALRRLVERHGARNWTAIGREIPGRSGKSCRLRWC  58



>ref|XP_010096284.1| Transcription factor [Morus notabilis]
 gb|EXB63679.1| Transcription factor [Morus notabilis]
Length=299

 Score = 87.8 bits (216),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            D++KGPWS EEDE+L+ LV++YGPRNWS+I  SIPGRSGKSCRLRWC
Sbjct  8    DKVKGPWSHEEDELLQSLVQRYGPRNWSIISRSIPGRSGKSCRLRWC  54



>dbj|BAD34048.1| myb-related transcription factor-like [Oryza sativa Japonica 
Group]
 gb|EAZ43731.1| hypothetical protein OsJ_28356 [Oryza sativa Japonica Group]
Length=318

 Score = 87.8 bits (216),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L+RLV ++G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  13   DRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWC  59



>gb|EAZ08096.1| hypothetical protein OsI_30362 [Oryza sativa Indica Group]
Length=318

 Score = 87.8 bits (216),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L+RLV ++G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  13   DRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWC  59



>ref|NP_001062562.1| Os09g0106700 [Oryza sativa Japonica Group]
 dbj|BAF24476.1| Os09g0106700 [Oryza sativa Japonica Group]
 dbj|BAG89840.1| unnamed protein product [Oryza sativa Japonica Group]
Length=319

 Score = 87.8 bits (216),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L+RLV ++G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  14   DRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWC  60



>ref|NP_001147631.1| LOC100281240 [Zea mays]
 gb|ACF83396.1| unknown [Zea mays]
 gb|ACG28163.1| MYB transcription factor TaMYB1 [Zea mays]
 gb|ADX60113.1| MYB transcription factor [Zea mays]
 gb|AFW70526.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=304

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  58   EAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            E+  DRIKGPWSPEEDE L RLVE++G RNW+ IG  IPGRSGKSCRLRWC
Sbjct  4    ESECDRIKGPWSPEEDEALRRLVERHGARNWTAIGRGIPGRSGKSCRLRWC  54



>emb|CDX83109.1| BnaA01g21090D [Brassica napus]
Length=162

 Score = 85.9 bits (211),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWS EEDE L R+VE YGPRNWS +  S+PGRSGKSCRLRWC
Sbjct  2    ADRVKGPWSQEEDEQLRRMVEHYGPRNWSEVSKSVPGRSGKSCRLRWC  49



>ref|XP_009101651.1| PREDICTED: transcription factor MYB44-like [Brassica rapa]
Length=328

 Score = 87.4 bits (215),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  58   EAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ++ ADR+KGPWS EEDE L R+VE YGPRNWS +  S+PGRSGKSCRLRWC
Sbjct  33   DSMADRVKGPWSQEEDEQLRRMVEHYGPRNWSEVSKSVPGRSGKSCRLRWC  83



>ref|XP_009418521.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=339

 Score = 87.8 bits (216),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  55   KEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            +    DRIKGPWS EEDE L RLVE++GPRNW+LI  SIPGRSGKSCRLRWC
Sbjct  12   RSKGMDRIKGPWSIEEDEALRRLVERHGPRNWTLISRSIPGRSGKSCRLRWC  63



>emb|CDX89554.1| BnaC04g35730D [Brassica napus]
Length=293

 Score = 87.4 bits (215),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEED++L+ LV+K+GPRNWSLI   I GRSGKSCRLRWC
Sbjct  9    TDRIKGPWSPEEDQLLQTLVQKHGPRNWSLISKPISGRSGKSCRLRWC  56



>ref|XP_010092183.1| Transcription factor [Morus notabilis]
 gb|EXB50409.1| Transcription factor [Morus notabilis]
Length=310

 Score = 87.4 bits (215),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            D++KGPWS EEDE+L+ LV++YGPRNWS+I  SIPGRSGKSCRLRWC
Sbjct  8    DKVKGPWSHEEDELLQSLVQRYGPRNWSIISRSIPGRSGKSCRLRWC  54



>gb|KEH25080.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1513

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L++LVEK+G RNWS++  SIPGRSGKSCRL WC
Sbjct  2    DRIKGPWSPEEDEALQKLVEKHGARNWSILSKSIPGRSGKSCRLPWC  48



>gb|ADX60118.1| MYB-RELATED transcription factor [Zea mays]
Length=347

 Score = 87.4 bits (215),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L+RLV ++G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  18   DRIKGPWSPEEDEALQRLVARHGARNWSLISRSIPGRSGKSCRLRWC  64



>ref|XP_009385523.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=363

 Score = 87.4 bits (215),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSP+ED  L+RLV+++GPRNWS I  SIPGRSGKSCRLRWC
Sbjct  22   VDRIKGPWSPDEDAALQRLVQRHGPRNWSPISKSIPGRSGKSCRLRWC  69



>ref|XP_004305954.1| PREDICTED: transcription factor MYB44-like [Fragaria vesca subsp. 
vesca]
Length=270

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DR+KGPWSPEED++L +LV+++G RNW+LI  SIPGRSGKSCRLRWC
Sbjct  12   DRVKGPWSPEEDDLLRKLVQRHGARNWTLISKSIPGRSGKSCRLRWC  58



>gb|AFK48638.1| unknown [Medicago truncatula]
Length=253

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGP SPEEDE L +LV++YGPRNWSLI  +IPGRSGKSCRLRWC
Sbjct  2    DRIKGPRSPEEDESLTKLVDRYGPRNWSLISRAIPGRSGKSCRLRWC  48



>dbj|BAK08030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=296

 Score = 87.0 bits (214),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  58   EAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            E+  DRIKGPWSPEEDE L RLVE++G RNW+ IG  IPGRSGKSCRLRWC
Sbjct  4    ESECDRIKGPWSPEEDEALRRLVERHGARNWTAIGRGIPGRSGKSCRLRWC  54



>emb|CDY38933.1| BnaA04g13540D [Brassica napus]
Length=292

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEED++L+ LV+K+GPRNWSLI   I GRSGKSCRLRWC
Sbjct  9    TDRIKGPWSPEEDQLLQTLVQKHGPRNWSLISKPISGRSGKSCRLRWC  56



>gb|AHB59591.1| putative R2R3 MYB protein 3 [Arachis hypogaea]
Length=253

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DR+KGPWSPEEDE L RLV  +GPRNW++I  SIPGRSGKSCRLRWC
Sbjct  2    DRVKGPWSPEEDETLRRLVGAHGPRNWTIISKSIPGRSGKSCRLRWC  48



>ref|XP_004246368.1| PREDICTED: myb-related protein 315 [Solanum lycopersicum]
Length=380

 Score = 87.4 bits (215),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  46   EEKKEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ++ ++  ADR+KGPWSPEED +L RLV  +G RNWSLI   IPGRSGKSCRLRWC
Sbjct  56   DQVRKKTADRVKGPWSPEEDAILSRLVSNFGARNWSLIARGIPGRSGKSCRLRWC  110



>ref|XP_009418325.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=365

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  73   RIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            RIKGPWSPEEDE L +LV++ GPRNWSLI  SIPGRSGKSCRLRWC
Sbjct  13   RIKGPWSPEEDEALRKLVQRNGPRNWSLISKSIPGRSGKSCRLRWC  58



>ref|XP_010526144.1| PREDICTED: transcriptional activator Myb-like [Tarenaya hassleriana]
Length=217

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  73   RIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            R+KGPWS EED +L RLVEKYGPRNWSLIG  I GRSGKSCRLRWC
Sbjct  40   RVKGPWSAEEDRILTRLVEKYGPRNWSLIGKHIKGRSGKSCRLRWC  85



>ref|XP_004951630.1| PREDICTED: transcription factor MYB44-like [Setaria italica]
Length=301

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L RLVE++G RNW+ IG  IPGRSGKSCRLRWC
Sbjct  8    DRIKGPWSPEEDEALRRLVERHGARNWTAIGRGIPGRSGKSCRLRWC  54



>ref|XP_009140453.1| PREDICTED: transcription factor MYB44 [Brassica rapa]
Length=292

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
             DRIKGPWSPEED++L+ LV+K+GPRNWSLI   I GRSGKSCRLRWC
Sbjct  9    TDRIKGPWSPEEDQLLQTLVQKHGPRNWSLISKPISGRSGKSCRLRWC  56



>gb|EYU37627.1| hypothetical protein MIMGU_mgv1a026376mg [Erythranthe guttata]
Length=292

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  43   MEEKKEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            M  +KE + DRIKGPWS EEDE+L++LVE++G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  1    MAAEKEVS-DRIKGPWSAEEDELLKKLVERHGARNWSLICRSIPGRSGKSCRLRWC  55



>emb|CDX68566.1| BnaC01g26440D [Brassica napus]
Length=314

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  58   EAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ++ ADR KGPWS EEDE L R+VE YGPRNW  +  S+PGRSGKSCRLRWC
Sbjct  39   DSMADRAKGPWSQEEDEQLRRMVEHYGPRNWLEVSKSVPGRSGKSCRLRWC  89



>ref|XP_002451692.1| hypothetical protein SORBIDRAFT_04g005940 [Sorghum bicolor]
 gb|EES04668.1| hypothetical protein SORBIDRAFT_04g005940 [Sorghum bicolor]
Length=327

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEEDE L RLVE++G RNW+ IG  IPGRSGKSCRLRWC
Sbjct  9    DRIKGPWSPEEDEALRRLVERHGARNWTAIGRGIPGRSGKSCRLRWC  55



>ref|XP_002438718.1| hypothetical protein SORBIDRAFT_10g024950 [Sorghum bicolor]
 gb|EER90085.1| hypothetical protein SORBIDRAFT_10g024950 [Sorghum bicolor]
Length=313

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  58   EAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            EA  DRI+GPWSPEED+ L RLVE++G RNW+ IG  IPGRSGKSCRLRWC
Sbjct  4    EAECDRIRGPWSPEEDDALRRLVERHGARNWTAIGREIPGRSGKSCRLRWC  54



>ref|NP_001159044.1| MYB transcription factor TaMYB1 [Zea mays]
 gb|ACG41591.1| MYB transcription factor TaMYB1 [Zea mays]
 gb|AFW87347.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB05022.1| MYB transcription factor, partial [Zea mays]
Length=304

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  58   EAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            EA  DRI+GPWSPEED+ L RLVE++G RNW+ IG  IPGRSGKSCRLRWC
Sbjct  4    EADCDRIRGPWSPEEDDALRRLVERHGARNWTAIGREIPGRSGKSCRLRWC  54



>ref|XP_002973727.1| hypothetical protein SELMODRAFT_99462, partial [Selaginella moellendorffii]
 gb|EFJ25387.1| hypothetical protein SELMODRAFT_99462, partial [Selaginella moellendorffii]
Length=122

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED  L++LV+KYG RNWSLI   I GRSGKSCRLRWC
Sbjct  19   DRIKGPWSPEEDAALQKLVDKYGARNWSLISKGIAGRSGKSCRLRWC  65



>ref|XP_006363093.1| PREDICTED: myb-like protein AA-like [Solanum tuberosum]
Length=379

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  46   EEKKEAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ++ ++  ADR+KGPWSPEED +L RLV  +G RNWSLI   IPGRSGKSCRLRWC
Sbjct  55   DQLRKKTADRVKGPWSPEEDAILSRLVSNFGARNWSLIARGIPGRSGKSCRLRWC  109



>ref|XP_010057256.1| PREDICTED: transcription factor MYB44-like [Eucalyptus grandis]
 gb|KCW74299.1| hypothetical protein EUGRSUZ_E02958 [Eucalyptus grandis]
Length=296

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  67   ADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            ADR+KGPWSP+ED++L +LV+++G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  14   ADRVKGPWSPDEDDLLRKLVQRHGARNWSLISRSIPGRSGKSCRLRWC  61



>ref|XP_009394543.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=309

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DR KG WS EEDE L RLVE++GPRNW+LIG SIPGRSGKSCRLRWC
Sbjct  2    DRTKGSWSTEEDEALRRLVERHGPRNWTLIGRSIPGRSGKSCRLRWC  48



>ref|XP_004965791.1| PREDICTED: transcription factor MYB44-like [Setaria italica]
Length=315

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  58   EAAADRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            EA  DRI+GPWSPEED+ L RLVE++G RNW+ IG  IPGRSGKSCRLRWC
Sbjct  4    EAECDRIRGPWSPEEDDALRRLVERHGARNWTAIGREIPGRSGKSCRLRWC  54



>dbj|BAJ86460.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=325

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  70   DRIKGPWSPEEDEMLERLVEKYGPRNWSLIGNSIPGRSGKSCRLRWC  210
            DRIKGPWSPEED+ L+RLV ++G RNWSLI  SIPGRSGKSCRLRWC
Sbjct  16   DRIKGPWSPEEDDALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWC  62



Lambda      K        H        a         alpha
   0.316    0.136    0.443    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512687374752