BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14495_g1_i1 len=1116 path=[1094:0-941 2036:942-988 2083:989-1115]

Length=1116
                                                                      Score     E

ref|XP_011041154.1|  PREDICTED: putative DNA-binding protein ESCA...    214   6e-63   
ref|XP_002307001.2|  hypothetical protein POPTR_0005s27850g             214   7e-63   Populus trichocarpa [western balsam poplar]
ref|XP_002510734.1|  DNA binding protein, putative                      213   2e-62   Ricinus communis
ref|XP_011074056.1|  PREDICTED: putative DNA-binding protein ESCA...    210   4e-61   
ref|XP_011100032.1|  PREDICTED: putative DNA-binding protein ESCA...    209   1e-60   
ref|XP_009791033.1|  PREDICTED: putative DNA-binding protein ESCA...    206   6e-60   
ref|XP_002273442.1|  PREDICTED: putative DNA-binding protein ESCA...    207   6e-60   Vitis vinifera
ref|XP_008343481.1|  PREDICTED: putative DNA-binding protein ESCA...    207   1e-59   
ref|XP_008373356.1|  PREDICTED: putative DNA-binding protein ESCA...    207   1e-59   
ref|XP_006342184.1|  PREDICTED: putative DNA-binding protein ESCA...    204   2e-59   
ref|XP_004301614.1|  PREDICTED: putative DNA-binding protein ESCA...    205   5e-59   
ref|XP_009372638.1|  PREDICTED: putative DNA-binding protein ESCA...    204   3e-58   
ref|XP_004238464.1|  PREDICTED: putative DNA-binding protein ESCA...    201   3e-58   
ref|XP_009592710.1|  PREDICTED: putative DNA-binding protein ESCA...    201   5e-58   
gb|EYU41204.1|  hypothetical protein MIMGU_mgv1a017994mg                202   5e-58   
ref|XP_002301896.2|  hypothetical protein POPTR_0002s00560g             201   9e-58   Populus trichocarpa [western balsam poplar]
ref|XP_011034791.1|  PREDICTED: putative DNA-binding protein ESCA...    199   1e-57   
ref|XP_006342185.1|  PREDICTED: putative DNA-binding protein ESCA...    198   1e-57   
ref|XP_010320485.1|  PREDICTED: putative DNA-binding protein ESCA...    198   3e-57   
ref|XP_010094507.1|  hypothetical protein L484_024798                   201   3e-57   
ref|XP_007043111.1|  AT-hook DNA-binding family protein, putative       200   3e-57   
gb|KDP36737.1|  hypothetical protein JCGZ_08028                         199   3e-57   
ref|XP_010270573.1|  PREDICTED: putative DNA-binding protein ESCA...    198   1e-56   
ref|XP_007210817.1|  hypothetical protein PRUPE_ppa020689mg             197   4e-56   
ref|XP_008237909.1|  PREDICTED: putative DNA-binding protein ESCA...    197   8e-56   
gb|EYU36598.1|  hypothetical protein MIMGU_mgv1a019273mg                195   1e-55   
ref|XP_010063173.1|  PREDICTED: putative DNA-binding protein ESCA...    191   2e-54   
ref|XP_010690586.1|  PREDICTED: putative DNA-binding protein ESCA...    191   3e-54   
ref|XP_010063174.1|  PREDICTED: putative DNA-binding protein ESCA...    191   4e-54   
gb|KCW70368.1|  hypothetical protein EUGRSUZ_F03609                     191   4e-54   
ref|XP_007018654.1|  AT-hook DNA-binding family protein, putative       192   1e-53   
ref|XP_010028876.1|  PREDICTED: putative DNA-binding protein ESCA...    188   2e-53   
gb|EPS63001.1|  hypothetical protein M569_11786                         188   5e-53   
ref|XP_006435457.1|  hypothetical protein CICLE_v10001818mg             189   1e-52   
gb|KDO85253.1|  hypothetical protein CISIN_1g037272mg                   189   1e-52   
ref|XP_010645606.1|  PREDICTED: putative DNA-binding protein ESCA...    186   5e-52   
ref|XP_010539761.1|  PREDICTED: putative DNA-binding protein ESCA...    185   6e-52   
ref|XP_010266286.1|  PREDICTED: putative DNA-binding protein ESCA...    185   1e-51   
ref|NP_177776.1|  AT-hook motif nuclear localized protein 29            183   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007134900.1|  hypothetical protein PHAVU_010G085300g             182   2e-50   
ref|XP_003516470.1|  PREDICTED: putative DNA-binding protein ESCA...    181   2e-50   
ref|XP_010092850.1|  hypothetical protein L484_022445                   182   2e-50   
ref|XP_002887643.1|  hypothetical protein ARALYDRAFT_476807             181   3e-50   
ref|XP_010053890.1|  PREDICTED: putative DNA-binding protein ESCA...    181   3e-50   
ref|XP_008783083.1|  PREDICTED: putative DNA-binding protein ESCA...    182   6e-50   
ref|XP_008646163.1|  PREDICTED: putative DNA-binding protein ESCA...    181   7e-50   
ref|XP_002279636.1|  PREDICTED: putative DNA-binding protein ESCA...    180   8e-50   Vitis vinifera
ref|XP_002452654.1|  hypothetical protein SORBIDRAFT_04g030040          181   8e-50   Sorghum bicolor [broomcorn]
ref|XP_010913859.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...    180   8e-50   
ref|XP_002301300.1|  DNA-binding family protein                         180   1e-49   Populus trichocarpa [western balsam poplar]
gb|KEH19036.1|  AT hook motif DNA-binding family protein                180   1e-49   
ref|XP_004510939.1|  PREDICTED: putative DNA-binding protein ESCA...    180   1e-49   
ref|XP_004953673.1|  PREDICTED: putative DNA-binding protein ESCA...    180   2e-49   
emb|CDX96613.1|  BnaA08g21560D                                          179   2e-49   
ref|XP_002320066.1|  DNA-binding family protein                         179   2e-49   Populus trichocarpa [western balsam poplar]
ref|XP_011034536.1|  PREDICTED: putative DNA-binding protein ESCA...    179   2e-49   
ref|XP_002511734.1|  ESC, putative                                      179   2e-49   Ricinus communis
ref|XP_008799138.1|  PREDICTED: putative DNA-binding protein ESCA...    179   2e-49   
ref|NP_001047914.1|  Os02g0713700                                       180   3e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010927299.1|  PREDICTED: putative DNA-binding protein ESCA...    179   3e-49   
ref|XP_006445233.1|  hypothetical protein CICLE_v10024070mg             179   3e-49   
dbj|BAJ94962.1|  predicted protein                                      179   3e-49   
ref|XP_003570225.1|  PREDICTED: putative DNA-binding protein ESCA...    180   3e-49   
ref|XP_003521618.1|  PREDICTED: putative DNA-binding protein ESCA...    178   8e-49   
ref|XP_004306909.1|  PREDICTED: putative DNA-binding protein ESCA...    178   8e-49   
ref|XP_009364460.1|  PREDICTED: putative DNA-binding protein ESCA...    177   9e-49   
gb|EPS72241.1|  hypothetical protein M569_02519                         173   1e-48   
ref|XP_007052032.1|  AT-hook motif nuclear-localized protein 22         178   1e-48   
ref|XP_010692632.1|  PREDICTED: putative DNA-binding protein ESCA...    177   1e-48   
ref|XP_006851806.1|  hypothetical protein AMTR_s00041p00022450          177   1e-48   
ref|XP_011017502.1|  PREDICTED: putative DNA-binding protein ESCA...    177   1e-48   
gb|EEC73884.1|  hypothetical protein OsI_08674                          180   2e-48   Oryza sativa Indica Group [Indian rice]
gb|KDP28740.1|  hypothetical protein JCGZ_14511                         177   3e-48   
ref|XP_011070911.1|  PREDICTED: putative DNA-binding protein ESCA...    175   3e-48   
ref|XP_010523691.1|  PREDICTED: putative DNA-binding protein ESCA...    176   4e-48   
ref|XP_006339443.1|  PREDICTED: putative DNA-binding protein ESCA...    176   4e-48   
ref|XP_010928787.1|  PREDICTED: putative DNA-binding protein ESCA...    176   5e-48   
gb|ABL63118.1|  AT-hook DNA-binding protein                             176   5e-48   Catharanthus roseus [chatas]
emb|CDX87591.1|  BnaA07g32820D                                          175   6e-48   
ref|XP_008370731.1|  PREDICTED: putative DNA-binding protein ESCA...    176   6e-48   
ref|XP_009372143.1|  PREDICTED: putative DNA-binding protein ESCA...    176   7e-48   
ref|XP_008388703.1|  PREDICTED: putative DNA-binding protein ESCA...    176   7e-48   
ref|XP_008364289.1|  PREDICTED: putative DNA-binding protein ESCA...    176   7e-48   
emb|CBI34813.3|  unnamed protein product                                173   7e-48   
ref|XP_009604907.1|  PREDICTED: putative DNA-binding protein ESCA...    175   8e-48   
ref|XP_007144108.1|  hypothetical protein PHAVU_007G129400g             176   8e-48   
ref|XP_010422173.1|  PREDICTED: putative DNA-binding protein ESCA...    176   8e-48   
ref|XP_009799054.1|  PREDICTED: putative DNA-binding protein ESCA...    175   8e-48   
ref|XP_010433825.1|  PREDICTED: putative DNA-binding protein ESCA...    176   8e-48   
ref|XP_010471803.1|  PREDICTED: putative DNA-binding protein ESCA...    175   9e-48   
ref|XP_011090893.1|  PREDICTED: putative DNA-binding protein ESCA...    175   9e-48   
ref|XP_010540129.1|  PREDICTED: putative DNA-binding protein ESCA...    176   1e-47   
gb|EYU30571.1|  hypothetical protein MIMGU_mgv1a010755mg                175   1e-47   
ref|XP_009410344.1|  PREDICTED: putative DNA-binding protein ESCA...    174   1e-47   
ref|XP_010455638.1|  PREDICTED: putative DNA-binding protein ESCA...    176   1e-47   
ref|XP_008218304.1|  PREDICTED: putative DNA-binding protein ESCA...    174   1e-47   
ref|XP_008796249.1|  PREDICTED: putative DNA-binding protein ESCA...    174   1e-47   
ref|XP_010102254.1|  hypothetical protein L484_024535                   174   2e-47   
ref|XP_010428713.1|  PREDICTED: putative DNA-binding protein ESCA...    174   2e-47   
ref|XP_007206474.1|  hypothetical protein PRUPE_ppa018950mg             174   2e-47   
ref|XP_003527629.1|  PREDICTED: putative DNA-binding protein ESCA...    173   2e-47   
ref|XP_006301299.1|  hypothetical protein CARUB_v10021706mg             174   2e-47   
gb|EYU40549.1|  hypothetical protein MIMGU_mgv1a021038mg                174   2e-47   
ref|XP_004229823.1|  PREDICTED: putative DNA-binding protein ESCA...    174   2e-47   
gb|EYU43510.1|  hypothetical protein MIMGU_mgv1a017700mg                174   2e-47   
ref|XP_010692273.1|  PREDICTED: putative DNA-binding protein ESCA...    174   3e-47   
ref|XP_011014152.1|  PREDICTED: putative DNA-binding protein ESCA...    173   3e-47   
ref|XP_011029110.1|  PREDICTED: putative DNA-binding protein ESCA...    173   4e-47   
ref|XP_004298711.1|  PREDICTED: putative DNA-binding protein ESCA...    173   4e-47   
ref|XP_010108102.1|  hypothetical protein L484_023188                   173   5e-47   
ref|XP_008346594.1|  PREDICTED: putative DNA-binding protein ESCA...    173   5e-47   
gb|KFK35357.1|  hypothetical protein AALP_AA5G274300                    174   5e-47   
ref|XP_008791267.1|  PREDICTED: putative DNA-binding protein ESCA...    174   5e-47   
ref|XP_002281296.1|  PREDICTED: putative DNA-binding protein ESCA...    173   5e-47   Vitis vinifera
ref|XP_006289235.1|  hypothetical protein CARUB_v10002691mg             174   5e-47   
ref|XP_008668970.1|  PREDICTED: putative DNA-binding protein ESCA...    173   5e-47   
ref|XP_003570419.1|  PREDICTED: putative DNA-binding protein ESCA...    172   5e-47   
gb|KFK31952.1|  hypothetical protein AALP_AA6G181300                    174   5e-47   
ref|XP_008373872.1|  PREDICTED: putative DNA-binding protein ESCA...    173   5e-47   
ref|XP_008238673.1|  PREDICTED: putative DNA-binding protein ESCA...    173   6e-47   
gb|KDO85858.1|  hypothetical protein CISIN_1g047830mg                   173   6e-47   
ref|XP_009386796.1|  PREDICTED: putative DNA-binding protein ESCA...    172   6e-47   
ref|XP_009373988.1|  PREDICTED: putative DNA-binding protein ESCA...    173   6e-47   
ref|NP_192942.1|  putative AT-hook DNA-binding family protein           174   6e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011093194.1|  PREDICTED: putative DNA-binding protein ESCA...    172   7e-47   
gb|KFK42071.1|  hypothetical protein AALP_AA2G207300                    173   7e-47   
ref|XP_010053390.1|  PREDICTED: putative DNA-binding protein ESCA...    172   8e-47   
gb|KCW61537.1|  hypothetical protein EUGRSUZ_H04257                     172   8e-47   
tpg|DAA36260.1|  TPA: hypothetical protein ZEAMMB73_652841              174   8e-47   
gb|KDO68430.1|  hypothetical protein CISIN_1g042221mg                   172   8e-47   
ref|XP_004511639.1|  PREDICTED: putative DNA-binding protein ESCA...    171   8e-47   
ref|XP_006486838.1|  PREDICTED: putative DNA-binding protein ESCA...    173   8e-47   
gb|AFW63603.1|  hypothetical protein ZEAMMB73_729481                    176   9e-47   
ref|XP_010934543.1|  PREDICTED: putative DNA-binding protein ESCA...    173   9e-47   
ref|XP_006396802.1|  hypothetical protein EUTSA_v10029174mg             173   9e-47   
ref|XP_010024974.1|  PREDICTED: putative DNA-binding protein ESCA...    172   9e-47   
emb|CDX98771.1|  BnaA03g45560D                                          172   1e-46   
ref|XP_002874744.1|  hypothetical protein ARALYDRAFT_490024             173   1e-46   
ref|XP_006440441.1|  hypothetical protein CICLE_v10021296mg             172   1e-46   
emb|CDY18931.1|  BnaC04g04190D                                          172   1e-46   
emb|CDX94128.1|  BnaC07g37620D                                          173   1e-46   
ref|XP_009763803.1|  PREDICTED: putative DNA-binding protein ESCA...    172   1e-46   
ref|XP_006477312.1|  PREDICTED: putative DNA-binding protein ESCA...    172   1e-46   
ref|XP_006655164.1|  PREDICTED: putative DNA-binding protein ESCA...    172   1e-46   
ref|XP_006827517.1|  hypothetical protein AMTR_s00009p00189120          171   1e-46   
ref|XP_009763802.1|  PREDICTED: putative DNA-binding protein ESCA...    172   1e-46   
ref|XP_004302076.1|  PREDICTED: putative DNA-binding protein ESCA...    172   1e-46   
ref|XP_009379269.1|  PREDICTED: putative DNA-binding protein ESCA...    172   2e-46   
gb|KFK37336.1|  hypothetical protein AALP_AA4G243300                    172   2e-46   
ref|XP_006846339.1|  hypothetical protein AMTR_s00012p00257450          171   2e-46   
ref|XP_010537244.1|  PREDICTED: putative DNA-binding protein ESCA...    171   2e-46   
ref|XP_009137280.1|  PREDICTED: putative DNA-binding protein ESCA...    172   2e-46   
ref|XP_010940981.1|  PREDICTED: putative DNA-binding protein ESCA...    172   2e-46   
ref|XP_008803114.1|  PREDICTED: putative DNA-binding protein ESCA...    172   2e-46   
ref|XP_009420562.1|  PREDICTED: putative DNA-binding protein ESCA...    171   2e-46   
emb|CDP17786.1|  unnamed protein product                                172   2e-46   
emb|CDY20404.1|  BnaC02g24120D                                          171   2e-46   
ref|XP_010538771.1|  PREDICTED: putative DNA-binding protein ESCA...    171   2e-46   
ref|NP_173514.1|  putative DNA-binding protein ESCAROLA                 172   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006422381.1|  hypothetical protein CICLE_v10028897mg             171   2e-46   
emb|CDP09863.1|  unnamed protein product                                171   2e-46   
ref|XP_002890414.1|  hypothetical protein ARALYDRAFT_472326             172   2e-46   
gb|AES80473.2|  AT hook motif DNA-binding family protein                170   2e-46   
ref|XP_010262897.1|  PREDICTED: putative DNA-binding protein ESCA...    173   2e-46   
gb|AFK38460.1|  unknown                                                 170   2e-46   
ref|XP_008804006.1|  PREDICTED: putative DNA-binding protein ESCA...    171   3e-46   
emb|CBI35166.3|  unnamed protein product                                170   3e-46   
ref|XP_007145832.1|  hypothetical protein PHAVU_007G271800g             170   3e-46   
ref|XP_006413619.1|  hypothetical protein EUTSA_v10025672mg             172   3e-46   
ref|XP_008663461.1|  PREDICTED: putative DNA-binding protein ESCA...    171   3e-46   
emb|CAN61523.1|  hypothetical protein VITISV_016751                     170   3e-46   Vitis vinifera
ref|XP_002448423.1|  hypothetical protein SORBIDRAFT_06g026940          171   3e-46   Sorghum bicolor [broomcorn]
ref|XP_006589299.1|  PREDICTED: putative DNA-binding protein ESCA...    171   3e-46   
emb|CDX74739.1|  BnaA05g04850D                                          171   3e-46   
emb|CDY27387.1|  BnaC04g50180D                                          171   3e-46   
ref|XP_006397724.1|  hypothetical protein EUTSA_v10001760mg             171   3e-46   
ref|XP_008801621.1|  PREDICTED: putative DNA-binding protein ESCA...    171   3e-46   
ref|XP_004511638.1|  PREDICTED: putative DNA-binding protein ESCA...    171   4e-46   
ref|XP_004976643.1|  PREDICTED: putative DNA-binding protein ESCA...    171   4e-46   
ref|XP_009142337.1|  PREDICTED: putative DNA-binding protein ESCA...    171   4e-46   
ref|XP_010416570.1|  PREDICTED: putative DNA-binding protein ESCA...    171   4e-46   
ref|XP_010477346.1|  PREDICTED: putative DNA-binding protein ESCA...    171   4e-46   
ref|XP_002880179.1|  hypothetical protein ARALYDRAFT_903987             171   4e-46   
emb|CDY37040.1|  BnaA04g26180D                                          171   4e-46   
ref|XP_009613222.1|  PREDICTED: putative DNA-binding protein ESCA...    171   4e-46   
ref|XP_006296351.1|  hypothetical protein CARUB_v10025523mg             171   4e-46   
ref|NP_182067.1|  AT-hook motif nuclear-localized protein 22            171   4e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508171.1|  PREDICTED: putative DNA-binding protein ESCA...    171   4e-46   
ref|XP_010506485.1|  PREDICTED: putative DNA-binding protein ESCA...    171   4e-46   
ref|XP_009384866.1|  PREDICTED: putative DNA-binding protein ESCA...    171   4e-46   
ref|XP_010518160.1|  PREDICTED: putative DNA-binding protein ESCA...    171   4e-46   
ref|XP_011030530.1|  PREDICTED: putative DNA-binding protein ESCA...    170   4e-46   
ref|XP_010907805.1|  PREDICTED: putative DNA-binding protein ESCA...    171   4e-46   
ref|XP_009613223.1|  PREDICTED: putative DNA-binding protein ESCA...    170   4e-46   
ref|XP_002271606.1|  PREDICTED: putative DNA-binding protein ESCA...    170   5e-46   Vitis vinifera
gb|EYU18229.1|  hypothetical protein MIMGU_mgv1a020284mg                169   5e-46   
ref|XP_007158420.1|  hypothetical protein PHAVU_002G151600g             170   5e-46   
dbj|BAJ94293.1|  predicted protein                                      171   5e-46   
ref|XP_011033866.1|  PREDICTED: putative DNA-binding protein ESCA...    171   5e-46   
ref|XP_010276261.1|  PREDICTED: putative DNA-binding protein ESCA...    170   5e-46   
ref|XP_008785537.1|  PREDICTED: putative DNA-binding protein ESCA...    171   5e-46   
ref|XP_002303540.1|  DNA-binding family protein                         171   5e-46   Populus trichocarpa [western balsam poplar]
ref|XP_002299584.2|  DNA-binding family protein                         170   5e-46   Populus trichocarpa [western balsam poplar]
gb|KHN01050.1|  Putative DNA-binding protein ESCAROLA                   170   5e-46   
ref|XP_009420779.1|  PREDICTED: putative DNA-binding protein ESCA...    170   5e-46   
ref|XP_002314642.2|  hypothetical protein POPTR_0010s08500g             170   6e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010920512.1|  PREDICTED: putative DNA-binding protein ESCA...    171   6e-46   
ref|XP_006588553.1|  PREDICTED: putative DNA-binding protein ESCA...    168   6e-46   
ref|XP_006390186.1|  hypothetical protein EUTSA_v10019495mg             170   6e-46   
ref|XP_011029905.1|  PREDICTED: putative DNA-binding protein ESCA...    170   6e-46   
ref|XP_003568662.1|  PREDICTED: putative DNA-binding protein ESCA...    171   7e-46   
gb|EPS64135.1|  hypothetical protein M569_10646                         171   7e-46   
gb|EPS71465.1|  hypothetical protein M569_03296                         168   7e-46   
ref|XP_009623613.1|  PREDICTED: putative DNA-binding protein ESCA...    170   7e-46   
ref|XP_003517441.1|  PREDICTED: putative DNA-binding protein ESCA...    170   7e-46   
ref|XP_010090728.1|  hypothetical protein L484_013750                   169   7e-46   
ref|XP_002312579.2|  hypothetical protein POPTR_0008s16440g             169   8e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010325447.1|  PREDICTED: putative DNA-binding protein ESCA...    169   8e-46   
ref|XP_010459784.1|  PREDICTED: putative DNA-binding protein ESCA...    170   8e-46   
gb|KHN30735.1|  Putative DNA-binding protein ESCAROLA                   169   8e-46   
gb|EYU29016.1|  hypothetical protein MIMGU_mgv1a023550mg                170   8e-46   
ref|XP_008456342.1|  PREDICTED: putative DNA-binding protein ESCA...    169   8e-46   
ref|XP_008777391.1|  PREDICTED: putative DNA-binding protein ESCA...    170   8e-46   
ref|XP_008811845.1|  PREDICTED: putative DNA-binding protein ESCA...    169   8e-46   
ref|XP_004245690.1|  PREDICTED: putative DNA-binding protein ESCA...    169   9e-46   
ref|NP_001048546.1|  Os02g0820800                                       169   9e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003624255.1|  AT-hook DNA-binding protein                        170   1e-45   
ref|XP_004954422.1|  PREDICTED: putative DNA-binding protein ESCA...    169   1e-45   
ref|XP_010262258.1|  PREDICTED: putative DNA-binding protein ESCA...    168   1e-45   
ref|XP_009143141.1|  PREDICTED: putative DNA-binding protein ESCA...    169   1e-45   
ref|XP_004139388.1|  PREDICTED: putative DNA-binding protein ESCA...    169   1e-45   
ref|XP_003611214.1|  AT-hook DNA-binding protein                        170   1e-45   
ref|XP_003549894.1|  PREDICTED: putative DNA-binding protein ESCA...    169   1e-45   
ref|XP_009110204.1|  PREDICTED: putative DNA-binding protein ESCA...    169   1e-45   
ref|XP_010498533.1|  PREDICTED: putative DNA-binding protein ESCA...    169   2e-45   
ref|XP_006851807.1|  hypothetical protein AMTR_s00041p00025000          169   2e-45   
ref|XP_010923237.1|  PREDICTED: putative DNA-binding protein ESCA...    169   2e-45   
ref|XP_002438341.1|  hypothetical protein SORBIDRAFT_10g012980          169   2e-45   Sorghum bicolor [broomcorn]
ref|XP_004492894.1|  PREDICTED: putative DNA-binding protein ESCA...    168   2e-45   
ref|XP_004145056.1|  PREDICTED: putative DNA-binding protein ESCA...    168   2e-45   
ref|XP_009607803.1|  PREDICTED: putative DNA-binding protein ESCA...    169   2e-45   
ref|XP_009402315.1|  PREDICTED: putative DNA-binding protein ESCA...    169   2e-45   
emb|CDY33658.1|  BnaC08g19580D                                          169   2e-45   
gb|ABL63119.1|  AT-hook DNA-binding protein                             167   2e-45   Catharanthus roseus [chatas]
ref|XP_004307477.1|  PREDICTED: putative DNA-binding protein ESCA...    169   2e-45   
ref|XP_007220373.1|  hypothetical protein PRUPE_ppa018314mg             169   2e-45   
ref|XP_006363711.1|  PREDICTED: putative DNA-binding protein ESCA...    168   2e-45   
ref|XP_009104672.1|  PREDICTED: putative DNA-binding protein ESCA...    168   2e-45   
ref|XP_007040019.1|  AT-hook DNA-binding family protein                 169   2e-45   
ref|XP_009136213.1|  PREDICTED: putative DNA-binding protein ESCA...    169   2e-45   
ref|XP_004296621.1|  PREDICTED: putative DNA-binding protein ESCA...    168   2e-45   
ref|NP_001141263.1|  hypothetical protein                               169   2e-45   Zea mays [maize]
gb|KHN22151.1|  Putative DNA-binding protein ESCAROLA                   166   2e-45   
ref|XP_011091221.1|  PREDICTED: putative DNA-binding protein ESCA...    167   3e-45   
ref|XP_009774038.1|  PREDICTED: putative DNA-binding protein ESCA...    169   3e-45   
ref|XP_003525782.1|  PREDICTED: putative DNA-binding protein ESCA...    168   3e-45   
ref|XP_010104063.1|  hypothetical protein L484_008144                   169   3e-45   
ref|XP_009106318.1|  PREDICTED: putative DNA-binding protein ESCA...    168   3e-45   
emb|CDX82978.1|  BnaC01g14280D                                          169   3e-45   
dbj|BAK03205.1|  predicted protein                                      168   3e-45   
emb|CDY41289.1|  BnaA01g12500D                                          169   3e-45   
ref|XP_007139682.1|  hypothetical protein PHAVU_008G050100g             167   4e-45   
ref|XP_003556450.2|  PREDICTED: putative DNA-binding protein ESCA...    167   4e-45   
ref|XP_008467078.1|  PREDICTED: putative DNA-binding protein ESCA...    167   4e-45   
ref|XP_009394683.1|  PREDICTED: putative DNA-binding protein ESCA...    167   4e-45   
ref|XP_003538721.1|  PREDICTED: putative DNA-binding protein ESCA...    168   4e-45   
ref|XP_007201570.1|  hypothetical protein PRUPE_ppa018299mg             166   4e-45   
ref|XP_006606925.1|  PREDICTED: putative DNA-binding protein ESCA...    170   4e-45   
ref|XP_004952401.1|  PREDICTED: putative DNA-binding protein ESCA...    168   5e-45   
ref|XP_003573204.1|  PREDICTED: putative DNA-binding protein ESCA...    168   5e-45   
ref|NP_001046754.1|  Os02g0448000                                       168   5e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007155606.1|  hypothetical protein PHAVU_003G216200g             167   5e-45   
ref|XP_009379018.1|  PREDICTED: putative DNA-binding protein ESCA...    167   5e-45   
ref|XP_002284519.1|  PREDICTED: putative DNA-binding protein ESCA...    166   5e-45   Vitis vinifera
ref|NP_001146992.1|  DNA binding protein                                168   5e-45   Zea mays [maize]
ref|XP_002869805.1|  hypothetical protein ARALYDRAFT_492588             168   5e-45   
gb|ACU24276.1|  unknown                                                 166   5e-45   Glycine max [soybeans]
ref|XP_007144002.1|  hypothetical protein PHAVU_007G120900g             167   5e-45   
ref|XP_002509637.1|  ESC, putative                                      167   6e-45   Ricinus communis
ref|XP_004242015.1|  PREDICTED: putative DNA-binding protein ESCA...    165   6e-45   
ref|XP_003576887.1|  PREDICTED: putative DNA-binding protein ESCA...    166   7e-45   
ref|XP_002451872.1|  hypothetical protein SORBIDRAFT_04g009050          168   7e-45   
gb|ACU24278.1|  unknown                                                 166   7e-45   
ref|XP_010277406.1|  PREDICTED: putative DNA-binding protein ESCA...    167   7e-45   
dbj|BAK02723.1|  predicted protein                                      167   8e-45   
ref|XP_003552472.1|  PREDICTED: putative DNA-binding protein ESCA...    166   8e-45   
ref|XP_008343156.1|  PREDICTED: putative DNA-binding protein ESCA...    167   8e-45   
ref|XP_003534486.1|  PREDICTED: putative DNA-binding protein ESCA...    166   9e-45   
ref|XP_010917984.1|  PREDICTED: putative DNA-binding protein ESCA...    167   1e-44   
ref|XP_010437478.1|  PREDICTED: putative DNA-binding protein ESCA...    167   1e-44   
ref|XP_010448831.1|  PREDICTED: putative DNA-binding protein ESCA...    167   1e-44   
ref|XP_010446930.1|  PREDICTED: putative DNA-binding protein ESCA...    167   1e-44   
ref|XP_010433987.1|  PREDICTED: putative DNA-binding protein ESCA...    167   1e-44   
ref|XP_010439279.1|  PREDICTED: putative DNA-binding protein ESCA...    167   1e-44   
gb|KDP25577.1|  hypothetical protein JCGZ_20733                         166   1e-44   
ref|XP_007030480.1|  AT-hook motif nuclear localized protein 20         166   1e-44   
ref|XP_009594477.1|  PREDICTED: putative DNA-binding protein ESCA...    164   1e-44   
ref|XP_003539199.1|  PREDICTED: putative DNA-binding protein ESCA...    165   1e-44   
gb|KEH41146.1|  AT hook motif DNA-binding family protein                168   1e-44   
dbj|BAF02122.1|  putative DNA binding protein                           167   1e-44   
ref|XP_009788952.1|  PREDICTED: putative DNA-binding protein ESCA...    164   1e-44   
ref|NP_194012.1|  putative AT-hook DNA-binding family protein           167   2e-44   
gb|KEH42696.1|  AT hook motif DNA-binding family protein                167   2e-44   
ref|XP_010432287.1|  PREDICTED: putative DNA-binding protein ESCA...    166   2e-44   
ref|XP_010257112.1|  PREDICTED: putative DNA-binding protein ESCA...    169   2e-44   
ref|XP_009103319.1|  PREDICTED: putative DNA-binding protein ESCA...    166   2e-44   
ref|XP_002529315.1|  DNA binding protein, putative                      166   2e-44   
ref|XP_011081090.1|  PREDICTED: putative DNA-binding protein ESCA...    166   2e-44   
gb|KEH34733.1|  AT hook motif DNA-binding family protein                166   2e-44   
ref|XP_006284928.1|  hypothetical protein CARUB_v10006227mg             167   2e-44   
ref|XP_007035040.1|  AT-hook motif nuclear localized protein 20         165   2e-44   
ref|XP_008780228.1|  PREDICTED: putative DNA-binding protein ESCA...    165   2e-44   
emb|CDY45983.1|  BnaA02g18130D                                          166   2e-44   
ref|XP_008229461.1|  PREDICTED: putative DNA-binding protein ESCA...    165   2e-44   
ref|XP_006358367.1|  PREDICTED: putative DNA-binding protein ESCA...    166   2e-44   
ref|XP_010691133.1|  PREDICTED: putative DNA-binding protein ESCA...    167   3e-44   
ref|XP_006305382.1|  hypothetical protein CARUB_v10009773mg             166   3e-44   
emb|CDY04391.1|  BnaC02g28570D                                          166   3e-44   
ref|XP_004172826.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...    166   3e-44   
ref|XP_004147565.1|  PREDICTED: putative DNA-binding protein ESCA...    166   3e-44   
ref|XP_008235832.1|  PREDICTED: putative DNA-binding protein ESCA...    164   3e-44   
gb|ABZ89182.1|  putative protein                                        165   3e-44   
ref|NP_001151240.1|  DNA-binding protein                                164   3e-44   
gb|ADY38789.1|  DNA-binding protein                                     165   3e-44   
emb|CDP00129.1|  unnamed protein product                                166   3e-44   
ref|XP_003516633.1|  PREDICTED: putative DNA-binding protein ESCA...    164   3e-44   
ref|XP_003536146.1|  PREDICTED: putative DNA-binding protein ESCA...    165   3e-44   
gb|KDP23697.1|  hypothetical protein JCGZ_23530                         165   3e-44   
ref|XP_010935866.1|  PREDICTED: putative DNA-binding protein ESCA...    166   3e-44   
ref|XP_006363907.1|  PREDICTED: putative DNA-binding protein ESCA...    163   4e-44   
ref|XP_010324605.1|  PREDICTED: putative DNA-binding protein ESCA...    166   4e-44   
emb|CDO99189.1|  unnamed protein product                                165   4e-44   
ref|XP_010274873.1|  PREDICTED: putative DNA-binding protein ESCA...    167   4e-44   
ref|XP_008232681.1|  PREDICTED: putative DNA-binding protein ESCA...    166   5e-44   
ref|XP_009621304.1|  PREDICTED: putative DNA-binding protein ESCA...    165   5e-44   
ref|XP_009377422.1|  PREDICTED: putative DNA-binding protein ESCA...    163   5e-44   
ref|XP_006416351.1|  hypothetical protein EUTSA_v10008220mg             166   5e-44   
ref|XP_006487869.1|  PREDICTED: putative DNA-binding protein ESCA...    165   5e-44   
ref|XP_008659508.1|  PREDICTED: putative DNA-binding protein ESCA...    165   5e-44   
ref|XP_008437165.1|  PREDICTED: putative DNA-binding protein ESCA...    165   5e-44   
gb|KFK28863.1|  hypothetical protein AALP_AA7G058200                    166   5e-44   
ref|XP_008786310.1|  PREDICTED: putative DNA-binding protein ESCA...    165   5e-44   
ref|XP_004305833.1|  PREDICTED: putative DNA-binding protein ESCA...    164   6e-44   
ref|XP_004249915.1|  PREDICTED: putative DNA-binding protein ESCA...    164   7e-44   
ref|XP_006420137.1|  hypothetical protein CICLE_v10005603mg             164   7e-44   
ref|XP_007156666.1|  hypothetical protein PHAVU_002G006900g             164   7e-44   
ref|XP_006442718.1|  hypothetical protein CICLE_v10023369mg             164   7e-44   
emb|CAA18730.1|  putative protein                                       164   7e-44   
ref|XP_004974243.1|  PREDICTED: putative DNA-binding protein ESCA...    163   8e-44   
ref|XP_006350955.1|  PREDICTED: putative DNA-binding protein ESCA...    164   8e-44   
ref|XP_002869088.1|  hypothetical protein ARALYDRAFT_491108             164   8e-44   
gb|KCW77938.1|  hypothetical protein EUGRSUZ_D02188                     164   8e-44   
ref|XP_003590930.1|  DNA-binding protein                                164   8e-44   
ref|XP_009784464.1|  PREDICTED: putative DNA-binding protein ESCA...    164   8e-44   
tpg|DAA48555.1|  TPA: hypothetical protein ZEAMMB73_420043              163   9e-44   
ref|XP_008353637.1|  PREDICTED: putative DNA-binding protein ESCA...    163   9e-44   
ref|XP_008342359.1|  PREDICTED: putative DNA-binding protein ESCA...    163   9e-44   
ref|XP_006384872.1|  hypothetical protein POPTR_0004s21840g             164   9e-44   
ref|XP_009776190.1|  PREDICTED: putative DNA-binding protein ESCA...    164   9e-44   
ref|XP_009778295.1|  PREDICTED: putative DNA-binding protein ESCA...    164   1e-43   
ref|XP_008371927.1|  PREDICTED: putative DNA-binding protein ESCA...    165   1e-43   
ref|XP_008362336.1|  PREDICTED: putative DNA-binding protein ESCA...    162   1e-43   
ref|XP_009383960.1|  PREDICTED: putative DNA-binding protein ESCA...    163   1e-43   
ref|XP_008380207.1|  PREDICTED: putative DNA-binding protein ESCA...    163   1e-43   
emb|CDP13007.1|  unnamed protein product                                164   1e-43   
gb|AFK41919.1|  unknown                                                 164   1e-43   
ref|XP_007226723.1|  hypothetical protein PRUPE_ppa019745mg             164   1e-43   
ref|XP_002527105.1|  DNA binding protein, putative                      164   1e-43   
ref|XP_010102152.1|  hypothetical protein L484_021386                   163   1e-43   
ref|XP_006282960.1|  hypothetical protein CARUB_v10007650mg             164   1e-43   
ref|XP_008224392.1|  PREDICTED: putative DNA-binding protein ESCA...    164   1e-43   
ref|XP_011040836.1|  PREDICTED: putative DNA-binding protein ESCA...    164   1e-43   
ref|XP_009356620.1|  PREDICTED: putative DNA-binding protein ESCA...    163   1e-43   
ref|XP_011040834.1|  PREDICTED: putative DNA-binding protein ESCA...    164   1e-43   
ref|XP_004495454.1|  PREDICTED: putative DNA-binding protein ESCA...    165   1e-43   
ref|XP_007163438.1|  hypothetical protein PHAVU_001G234600g             164   1e-43   
ref|XP_006601994.1|  PREDICTED: putative DNA-binding protein ESCA...    164   1e-43   
ref|XP_009351431.1|  PREDICTED: putative DNA-binding protein ESCA...    164   1e-43   
ref|XP_009757136.1|  PREDICTED: putative DNA-binding protein ESCA...    163   1e-43   
ref|XP_011094152.1|  PREDICTED: putative DNA-binding protein ESCA...    162   1e-43   
ref|XP_009775204.1|  PREDICTED: putative DNA-binding protein ESCA...    163   1e-43   
ref|NP_001053704.1|  Os04g0590200                                       164   2e-43   
ref|XP_008233653.1|  PREDICTED: putative DNA-binding protein ESCA...    164   2e-43   
ref|XP_010053603.1|  PREDICTED: putative DNA-binding protein ESCA...    163   2e-43   
ref|XP_007218339.1|  hypothetical protein PRUPE_ppa008610mg             164   2e-43   
ref|XP_009387695.1|  PREDICTED: putative DNA-binding protein ESCA...    163   2e-43   
ref|XP_004229513.1|  PREDICTED: putative DNA-binding protein ESCA...    162   2e-43   
ref|XP_010026866.1|  PREDICTED: putative DNA-binding protein ESCA...    164   2e-43   
gb|KDO60958.1|  hypothetical protein CISIN_1g040216mg                   162   2e-43   
ref|NP_001062524.1|  Os08g0563200                                       161   2e-43   
ref|XP_003581586.1|  PREDICTED: putative DNA-binding protein ESCA...    164   2e-43   
gb|KDP46909.1|  hypothetical protein JCGZ_10400                         162   2e-43   
ref|XP_006477506.1|  PREDICTED: putative DNA-binding protein ESCA...    164   3e-43   
gb|EAZ06834.1|  hypothetical protein OsI_29071                          161   3e-43   
ref|XP_004497856.1|  PREDICTED: putative DNA-binding protein ESCA...    164   3e-43   
ref|XP_006591349.1|  PREDICTED: putative DNA-binding protein ESCA...    162   3e-43   
emb|CDX75499.1|  BnaA01g02030D                                          163   3e-43   
ref|XP_009411479.1|  PREDICTED: putative DNA-binding protein ESCA...    163   3e-43   
ref|XP_006437176.1|  hypothetical protein CICLE_v10032444mg             162   3e-43   
ref|NP_195265.2|  AT-hook protein of GA feedback 1                      163   3e-43   
emb|CDP09327.1|  unnamed protein product                                162   3e-43   
ref|XP_009597193.1|  PREDICTED: putative DNA-binding protein ESCA...    162   4e-43   
emb|CAN75757.1|  hypothetical protein VITISV_028561                     162   4e-43   
ref|XP_006606853.1|  PREDICTED: putative DNA-binding protein ESCA...    164   4e-43   
ref|XP_004247701.1|  PREDICTED: putative DNA-binding protein ESCA...    162   4e-43   
ref|XP_006412109.1|  hypothetical protein EUTSA_v10025798mg             163   4e-43   
ref|XP_002319649.1|  DNA-binding family protein                         162   5e-43   
ref|XP_009382863.1|  PREDICTED: putative DNA-binding protein ESCA...    162   5e-43   
ref|XP_007039519.1|  AT-hook DNA-binding family protein                 162   5e-43   
ref|XP_010269998.1|  PREDICTED: putative DNA-binding protein ESCA...    162   5e-43   
ref|XP_007155775.1|  hypothetical protein PHAVU_003G230600g             162   6e-43   
ref|XP_006354520.1|  PREDICTED: putative DNA-binding protein ESCA...    162   6e-43   
emb|CBI31637.3|  unnamed protein product                                162   6e-43   
ref|XP_010676637.1|  PREDICTED: putative DNA-binding protein ESCA...    162   6e-43   
ref|XP_010534336.1|  PREDICTED: putative DNA-binding protein ESCA...    162   6e-43   
ref|XP_010694781.1|  PREDICTED: putative DNA-binding protein ESCA...    162   6e-43   
ref|NP_001150826.1|  DNA-binding protein                                160   6e-43   
ref|XP_009123977.1|  PREDICTED: putative DNA-binding protein ESCA...    162   7e-43   
gb|AFW74083.1|  DNA-binding protein                                     160   7e-43   
emb|CDY49327.1|  BnaA05g32890D                                          162   7e-43   
ref|XP_003524711.1|  PREDICTED: putative DNA-binding protein ESCA...    161   7e-43   
ref|XP_008391057.1|  PREDICTED: putative DNA-binding protein ESCA...    161   7e-43   
ref|XP_009343806.1|  PREDICTED: putative DNA-binding protein ESCA...    162   8e-43   
ref|XP_008799381.1|  PREDICTED: putative DNA-binding protein ESCA...    162   8e-43   
ref|XP_008453469.1|  PREDICTED: putative DNA-binding protein ESCA...    161   8e-43   
ref|XP_008801301.1|  PREDICTED: putative DNA-binding protein ESCA...    160   8e-43   
ref|XP_009403254.1|  PREDICTED: putative DNA-binding protein ESCA...    162   8e-43   
ref|XP_010104316.1|  hypothetical protein L484_023266                   161   8e-43   
ref|XP_010097716.1|  hypothetical protein L484_023857                   162   8e-43   
ref|XP_010658536.1|  PREDICTED: putative DNA-binding protein ESCA...    162   8e-43   
ref|XP_009142892.1|  PREDICTED: putative DNA-binding protein ESCA...    160   8e-43   
emb|CDY53650.1|  BnaC04g52840D                                          160   9e-43   
ref|XP_011038532.1|  PREDICTED: putative DNA-binding protein ESCA...    161   9e-43   
ref|XP_009393002.1|  PREDICTED: putative DNA-binding protein ESCA...    162   9e-43   
emb|CDX79838.1|  BnaA05g03180D                                          160   9e-43   
ref|XP_002876587.1|  hypothetical protein ARALYDRAFT_486561             160   1e-42   
dbj|BAK02851.1|  predicted protein                                      161   1e-42   
ref|XP_007048865.1|  AT-hook DNA-binding family protein                 160   1e-42   
ref|XP_011086333.1|  PREDICTED: putative DNA-binding protein ESCA...    161   1e-42   
ref|XP_006411566.1|  hypothetical protein EUTSA_v10017103mg             160   1e-42   
emb|CDY64701.1|  BnaCnng44570D                                          162   1e-42   
ref|XP_004160444.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...    160   1e-42   
ref|XP_004503162.1|  PREDICTED: putative DNA-binding protein ESCA...    161   1e-42   
ref|XP_004509027.1|  PREDICTED: putative DNA-binding protein ESCA...    161   1e-42   
ref|XP_006649829.1|  PREDICTED: putative DNA-binding protein ESCA...    160   1e-42   
ref|XP_008811429.1|  PREDICTED: putative DNA-binding protein ESCA...    161   1e-42   
ref|XP_009102369.1|  PREDICTED: putative DNA-binding protein ESCA...    161   1e-42   
ref|XP_004956262.1|  PREDICTED: putative DNA-binding protein ESCA...    160   2e-42   
ref|XP_011044786.1|  PREDICTED: putative DNA-binding protein ESCA...    160   2e-42   
ref|XP_007141404.1|  hypothetical protein PHAVU_008G192600g             160   2e-42   
ref|XP_009401827.1|  PREDICTED: putative DNA-binding protein ESCA...    160   2e-42   
ref|XP_008238264.1|  PREDICTED: putative DNA-binding protein ESCA...    160   2e-42   
ref|XP_007210169.1|  hypothetical protein PRUPE_ppa019786mg             160   2e-42   
ref|XP_010544659.1|  PREDICTED: putative DNA-binding protein ESCA...    160   2e-42   
ref|XP_008356452.1|  PREDICTED: putative DNA-binding protein ESCA...    160   2e-42   
gb|KDP44918.1|  hypothetical protein JCGZ_01418                         162   2e-42   
emb|CDX69136.1|  BnaC01g03170D                                          161   2e-42   
ref|NP_001049682.1|  Os03g0270000                                       159   2e-42   
ref|XP_008794313.1|  PREDICTED: putative DNA-binding protein ESCA...    160   2e-42   
ref|XP_002307550.2|  hypothetical protein POPTR_0005s22440g             159   2e-42   
ref|XP_010554616.1|  PREDICTED: putative DNA-binding protein ESCA...    161   2e-42   
ref|XP_009762421.1|  PREDICTED: putative DNA-binding protein ESCA...    160   2e-42   
ref|XP_008796294.1|  PREDICTED: putative DNA-binding protein ESCA...    160   3e-42   
gb|EMS64253.1|  hypothetical protein TRIUR3_00437                       160   3e-42   
ref|XP_009589802.1|  PREDICTED: putative DNA-binding protein ESCA...    160   3e-42   
ref|XP_004300243.1|  PREDICTED: putative DNA-binding protein ESCA...    160   3e-42   
gb|KFK37136.1|  hypothetical protein AALP_AA4G217700                    159   3e-42   
ref|XP_009794976.1|  PREDICTED: putative DNA-binding protein ESCA...    159   3e-42   
ref|XP_006647239.1|  PREDICTED: putative DNA-binding protein ESCA...    161   3e-42   
ref|XP_004173725.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...    159   3e-42   
ref|XP_002279677.2|  PREDICTED: putative DNA-binding protein ESCA...    159   3e-42   
ref|XP_008788674.1|  PREDICTED: putative DNA-binding protein ESCA...    160   3e-42   
ref|NP_001174762.1|  Os06g0326900                                       160   3e-42   
gb|AIV43385.1|  AHL protein                                             159   3e-42   
ref|XP_010940763.1|  PREDICTED: putative DNA-binding protein ESCA...    162   3e-42   
gb|EAZ00752.1|  hypothetical protein OsI_22779                          160   3e-42   
ref|XP_009611172.1|  PREDICTED: putative DNA-binding protein ESCA...    159   4e-42   
ref|XP_010524099.1|  PREDICTED: putative DNA-binding protein ESCA...    159   4e-42   
ref|XP_009133560.1|  PREDICTED: putative DNA-binding protein ESCA...    159   4e-42   
gb|EYU40290.1|  hypothetical protein MIMGU_mgv1a019526mg                160   4e-42   
gb|AGC22550.1|  male sterility related AT-hook DNA binding protein      159   4e-42   
ref|XP_010275243.1|  PREDICTED: putative DNA-binding protein ESCA...    159   4e-42   
gb|KGN56590.1|  hypothetical protein Csa_3G126060                       158   4e-42   
ref|XP_009344356.1|  PREDICTED: putative DNA-binding protein ESCA...    160   4e-42   
ref|XP_007220428.1|  hypothetical protein PRUPE_ppa009347mg             160   5e-42   
ref|XP_008787555.1|  PREDICTED: putative DNA-binding protein ESCA...    161   5e-42   
ref|XP_006435633.1|  hypothetical protein CICLE_v10032034mg             160   5e-42   
ref|XP_009409024.1|  PREDICTED: putative DNA-binding protein ESCA...    160   5e-42   
ref|XP_007009270.1|  AT-hook protein of GA feedback 2                   160   5e-42   
ref|XP_009386251.1|  PREDICTED: putative DNA-binding protein ESCA...    160   5e-42   
ref|XP_009128180.1|  PREDICTED: putative DNA-binding protein ESCA...    159   5e-42   
ref|XP_011093448.1|  PREDICTED: putative DNA-binding protein ESCA...    159   5e-42   
ref|XP_009417416.1|  PREDICTED: putative DNA-binding protein ESCA...    159   5e-42   
ref|XP_006366237.1|  PREDICTED: putative DNA-binding protein ESCA...    158   6e-42   
ref|XP_004495563.1|  PREDICTED: putative DNA-binding protein ESCA...    159   7e-42   
ref|XP_009347388.1|  PREDICTED: putative DNA-binding protein ESCA...    159   7e-42   
ref|XP_002312113.2|  hypothetical protein POPTR_0008s05890g             160   7e-42   
ref|XP_006436718.1|  hypothetical protein CICLE_v10032253mg             159   7e-42   
ref|XP_004137338.1|  PREDICTED: uncharacterized protein LOC101219306    161   7e-42   
emb|CAN83987.1|  hypothetical protein VITISV_032602                     159   8e-42   



>ref|XP_011041154.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=300

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 172/219 (79%), Gaps = 4/219 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHV+EIS  ADI++SV++YAR+RGRGVCVLSGSGTV NVT
Sbjct  84   SKNKPKPPIIVTRDSPNALRSHVIEISNGADIVESVSTYARKRGRGVCVLSGSGTVANVT  143

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SPAGSV+TLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGG V GPLM
Sbjct  144  LRQPASPAGSVLTLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGGNVAGPLM  203

Query  362  ASGPVVLMAATFANAVFERLPLeeeaeggagnataaaagqqvqsstaasqtsgvtgggeg  541
            A+GPV+LMAA+FANAVFERLPL+++ E G       A+     + +      G  G G G
Sbjct  204  AAGPVILMAASFANAVFERLPLDDQEEAGTVQVQPTASQSSGVTGSGGQMGDGGGGSGTG  263

Query  542  gggtsfgNTQpppppTNYPFSAEVFG-WAGNTAAAARPP  655
            G G+ F N        NYPFS ++FG W G   +AARPP
Sbjct  264  GAGSGFFNMAGGAHHGNYPFSGDLFGPWGG---SAARPP  299



>ref|XP_002307001.2| hypothetical protein POPTR_0005s27850g [Populus trichocarpa]
 gb|EEE93997.2| hypothetical protein POPTR_0005s27850g [Populus trichocarpa]
Length=301

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 174/219 (79%), Gaps = 4/219 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHV+EIS  ADI++SV++YAR+RGRGVCVLSGSGTV NVT
Sbjct  85   SKNKPKPPIIVTRDSPNALRSHVIEISNGADIVESVSTYARKRGRGVCVLSGSGTVANVT  144

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SPAGSV+TLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGG VVGPLM
Sbjct  145  LRQPASPAGSVLTLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGGNVVGPLM  204

Query  362  ASGPVVLMAATFANAVFERLPLeeeaeggagnataaaagqqvqsstaasqtsgvtgggeg  541
            A+GPVVLMAA+FANAVFERLPL+++ E GA      A+     + +      G  G G G
Sbjct  205  AAGPVVLMAASFANAVFERLPLDDQEEAGAVQVQPTASQSSGVTGSGGQMGDGGGGSGTG  264

Query  542  gggtsfgNTQpppppTNYPFSAEVFG-WAGNTAAAARPP  655
            G G+ F N        NYPFS ++FG W G   +AARPP
Sbjct  265  GAGSGFFNMAGGAHHGNYPFSGDLFGPWGG---SAARPP  300



>ref|XP_002510734.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF52921.1| DNA binding protein, putative [Ricinus communis]
Length=289

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 170/218 (78%), Gaps = 9/218 (4%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHVLE+S  +DI++SV+ YAR+RGRGVCVLSG+GTV NVT
Sbjct  80   SKNKPKPPIIVTRDSPNALRSHVLEVSTGSDIMESVSIYARKRGRGVCVLSGNGTVANVT  139

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SPAGSVVTLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGG+VVGPLM
Sbjct  140  LRQPASPAGSVVTLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGGSVVGPLM  199

Query  362  ASGPVVLMAATFANAVFERLPLeeeaeggagnataaaagqqvqsstaasqtsgvtgggeg  541
            ASGPVVLMAA+FANAVFERLPL+EE       +TA+ +         A Q     GGG  
Sbjct  200  ASGPVVLMAASFANAVFERLPLDEEDGTVPVQSTASQSSGVTGGGGGAGQLGDGGGGGGA  259

Query  542  gggtsfgNTQpppppTNYPFSAEVFGWAGNTAAAARPP  655
            G     GN        NYPFS ++FGW  N   AARPP
Sbjct  260  GLFNMGGNV------ANYPFSGDLFGWGVN---AARPP  288



>ref|XP_011074056.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
 ref|XP_011074057.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=311

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHVLE+SA +DI++SV+ YARRRGRGVCVLSGSGTVTNVT
Sbjct  83   SKNKPKPPIIVTRDSPNALRSHVLEVSAGSDIVESVSVYARRRGRGVCVLSGSGTVTNVT  142

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++PAGSVVTLHGRFEILSLSGTVLPPPAPPG+GGLSIFL+GGQGQVVGG+VVGPLM
Sbjct  143  LRQPAAPAGSVVTLHGRFEILSLSGTVLPPPAPPGSGGLSIFLAGGQGQVVGGSVVGPLM  202

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+FANAVFERLPL
Sbjct  203  ASGPVVLMAASFANAVFERLPL  224



>ref|XP_011100032.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=307

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHVLE+S+  DI+DSV+ YARRRGRGVCVLSGSGTVTNVT
Sbjct  78   SKNKPKPPIIVTRDSPNALRSHVLEVSSGNDIVDSVSVYARRRGRGVCVLSGSGTVTNVT  137

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++PAGSVVTLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGG+VVGPLM
Sbjct  138  LRQPAAPAGSVVTLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGGSVVGPLM  197

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+FANAVFERLPL
Sbjct  198  ASGPVVLMAASFANAVFERLPL  219



>ref|XP_009791033.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=269

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRD+PNALRSHVLE+SA AD+++SV++YARRRGRGVC+LSGSGTV NV 
Sbjct  46   SKNKPKPPIIVTRDTPNALRSHVLEVSAGADVMESVSNYARRRGRGVCILSGSGTVNNVN  105

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP+SPAGS+VTLHGRFEILSLSGTVLPPPAPPG+ GLSIFLSGGQGQVVGG++VGPLM
Sbjct  106  IRQPASPAGSIVTLHGRFEILSLSGTVLPPPAPPGSSGLSIFLSGGQGQVVGGSIVGPLM  165

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+FANAVFERLPL
Sbjct  166  ASGPVVLMAASFANAVFERLPL  187



>ref|XP_002273442.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=292

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHVLE++A AD+++SV +YARRRGRGVCVLSG GTV NVT
Sbjct  81   SKNKPKPPIIVTRDSPNALRSHVLEVAAGADVMESVLNYARRRGRGVCVLSGGGTVMNVT  140

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SPAGS+VTLHGRFEILSLSGTVLPPPAPP AGGLSIFLSGGQGQVVGG+VVGPLM
Sbjct  141  LRQPASPAGSIVTLHGRFEILSLSGTVLPPPAPPSAGGLSIFLSGGQGQVVGGSVVGPLM  200

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+FANAVFERLPL
Sbjct  201  ASGPVVLMAASFANAVFERLPL  222



>ref|XP_008343481.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=343

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHVLE+S  ADI+DSV+ YARRRGRGVCVLSGSGTVTNVT
Sbjct  111  SKNKPKPPIIVTRDSPNALRSHVLEVSDGADIMDSVSIYARRRGRGVCVLSGSGTVTNVT  170

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P GSVVTLHGRFE+LSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGG VVGPLM
Sbjct  171  LRQPAAPPGSVVTLHGRFELLSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGGNVVGPLM  230

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+FANAVFERLPL
Sbjct  231  ASGPVVLMAASFANAVFERLPL  252



>ref|XP_008373356.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=343

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHVLE+S  ADI+DSV+ YARRRGRGVCVLSGSGTVTNVT
Sbjct  111  SKNKPKPPIIVTRDSPNALRSHVLEVSDGADIMDSVSIYARRRGRGVCVLSGSGTVTNVT  170

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P GSVVTLHGRFE+LSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGG VVGPLM
Sbjct  171  LRQPAAPPGSVVTLHGRFELLSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGGNVVGPLM  230

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+FANAVFERLPL
Sbjct  231  ASGPVVLMAASFANAVFERLPL  252



>ref|XP_006342184.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Solanum tuberosum]
Length=260

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 165/219 (75%), Gaps = 2/219 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRD+PNALRSHVLE+S   DI++S+++YARRRGRGVC+LSGSGTV NV 
Sbjct  42   SKNKPKPPIIVTRDTPNALRSHVLEVSTDVDIMESISNYARRRGRGVCILSGSGTVANVN  101

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP+SPA +VVTLHGRFEILSLSGTVLPPPAPPG+ G+SIFLSGGQGQVVGG+VVGPLM
Sbjct  102  IRQPASPAATVVTLHGRFEILSLSGTVLPPPAPPGSSGISIFLSGGQGQVVGGSVVGPLM  161

Query  362  ASGPVVLMAATFANAVFERLPLeeeaeggagnataaaagqqvq-sstaasqtsgvtggge  538
            ASGPVVLMAA+FANAVFERLPLEEE    A     A A      ++      S  +G   
Sbjct  162  ASGPVVLMAASFANAVFERLPLEEEDAAAANANANANASGVGAPTTQVQPAASQSSGVTG  221

Query  539  ggggtsfgNTQpppppTNYPFSAEVFGWAGNTAAAARPP  655
            GG   +           NY FSAE+ GW GN AA  RPP
Sbjct  222  GGEAGTGEGGNMAFGNNNYSFSAELLGWGGN-AANERPP  259



>ref|XP_004301614.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=313

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHVLE+SA AD+++SV+ YARRRGRGVCVL+G+GTV NVT
Sbjct  92   SKNKPKPPIIVTRDSPNALRSHVLEVSAGADVMESVSHYARRRGRGVCVLNGTGTVVNVT  151

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P GSVVTLHGRFEILSLSGTVLPPPAPPGAGGLSIFL+GGQGQVVGG+VVGPL+
Sbjct  152  LRQPAAPTGSVVTLHGRFEILSLSGTVLPPPAPPGAGGLSIFLAGGQGQVVGGSVVGPLL  211

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+FANAVFERLPL
Sbjct  212  ASGPVVLMAASFANAVFERLPL  233



>ref|XP_009372638.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=349

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKN PKPPIIVTRDSPNALRSH+LE+S  ADI+DSV+ YARRRGRGVCVLSGSGTVTNVT
Sbjct  117  SKNNPKPPIIVTRDSPNALRSHLLEVSDGADIMDSVSIYARRRGRGVCVLSGSGTVTNVT  176

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P GSVVTLHGRFE+LSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGG VVGPLM
Sbjct  177  LRQPAAPPGSVVTLHGRFELLSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGGNVVGPLM  236

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+FANAVFERLPL
Sbjct  237  ASGPVVLMAASFANAVFERLPL  258



>ref|XP_004238464.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Solanum 
lycopersicum]
Length=245

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 162/218 (74%), Gaps = 12/218 (6%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRD+PNALRSHVLE+S   DI++S+++YARRRGRGVC+LSGSGTVTNV 
Sbjct  39   SKNKPKPPIIVTRDTPNALRSHVLEVSTDVDIMESISNYARRRGRGVCILSGSGTVTNVN  98

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQ   PA SVVTLHGRFEILSLSGTVLPPPAPP + G+SIFLSGGQGQVVGG+VVGPL+
Sbjct  99   LRQ---PAASVVTLHGRFEILSLSGTVLPPPAPPASSGISIFLSGGQGQVVGGSVVGPLI  155

Query  362  ASGPVVLMAATFANAVFERLPLeeeaeggagnataaaagqqvqsstaasqtsgvtgggeg  541
            ASGPVVLMAA+FANAVFERLPLEE+ E  A   T        QSS               
Sbjct  156  ASGPVVLMAASFANAVFERLPLEEDDEAPANVPTTQVQPAASQSSGVTGGGEAAGTAHPA  215

Query  542  gggtsfgNTQpppppTNYPFSAEVFGWAGNTAAAARPP  655
             G  +FGN        NY FSAE+ GW GN AA  RPP
Sbjct  216  EGNMAFGN--------NYSFSAELLGWGGN-AANERPP  244



>ref|XP_009592710.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=276

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 138/143 (97%), Gaps = 1/143 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRD+PNALRSHVLE+SA AD+++SV++YARRRGRGVC+LSGSGTV NV 
Sbjct  46   SKNKPKPPIIVTRDTPNALRSHVLEVSAGADVMESVSNYARRRGRGVCILSGSGTVNNVN  105

Query  182  LRQPSSPAGS-VVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPL  358
            +RQP+SPAGS V+TLHGRFEILSLSGT+LPPPAPPG+ GLSIFLSGGQGQVVGG++VGPL
Sbjct  106  IRQPASPAGSTVITLHGRFEILSLSGTILPPPAPPGSSGLSIFLSGGQGQVVGGSIVGPL  165

Query  359  MASGPVVLMAATFANAVFERLPL  427
            MASGPVVLMAA+FANAVFERLPL
Sbjct  166  MASGPVVLMAASFANAVFERLPL  188



>gb|EYU41204.1| hypothetical protein MIMGU_mgv1a017994mg [Erythranthe guttata]
Length=311

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHVLEIS+ +D+++SV+ YARRRGRGVCVLSGSGTV NVT
Sbjct  82   SKNKPKPPIIVTRDSPNALRSHVLEISSGSDVVESVSVYARRRGRGVCVLSGSGTVANVT  141

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++PAGSVVTLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGG+VVGPLM
Sbjct  142  LRQPAAPAGSVVTLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGGSVVGPLM  201

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASG VVLMAA+FANAVFERLPL
Sbjct  202  ASGAVVLMAASFANAVFERLPL  223



>ref|XP_002301896.2| hypothetical protein POPTR_0002s00560g [Populus trichocarpa]
 gb|EEE81169.2| hypothetical protein POPTR_0002s00560g [Populus trichocarpa]
Length=302

 Score =   201 bits (512),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 170/219 (78%), Gaps = 7/219 (3%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHVLE+S+ ADI++SV++YAR+RG GVCVLSGSG+V NVT
Sbjct  89   SKNKPKPPIIVTRDSPNALRSHVLEVSSGADIVESVSNYARKRGIGVCVLSGSGSVANVT  148

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SPAGSV+TLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGG VVG LM
Sbjct  149  LRQPASPAGSVLTLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGGNVVGLLM  208

Query  362  ASGPVVLMAATFANAVFERLPLeeeaeggagnataaaagqqvqsstaasqtsgvtgggeg  541
            A+GPVVLMAA+FANAVFERLPL+++ E GA      A+     + +      G  G   G
Sbjct  209  AAGPVVLMAASFANAVFERLPLDDQEEAGAVQVQPTASQNSGVTGSGGQMGDGGGGSSTG  268

Query  542  gggtsfgNTQpppppTNYPFSAEVFG-WAGNTAAAARPP  655
            GGG              YPFSA++FG W GN   A+RPP
Sbjct  269  GGGFF---PMGGAHHGTYPFSADLFGSWGGN---ASRPP  301



>ref|XP_011034791.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=261

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 168/219 (77%), Gaps = 8/219 (4%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHVLE+S+ ADI++SV++YAR+RG GVCVLSGSG+V NVT
Sbjct  49   SKNKPKPPIIVTRDSPNALRSHVLEVSSGADIVESVSNYARKRGIGVCVLSGSGSVANVT  108

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SPAGSV+TLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGG VVG LM
Sbjct  109  LRQPASPAGSVLTLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGGNVVGLLM  168

Query  362  ASGPVVLMAATFANAVFERLPLeeeaeggagnataaaagqqvqsstaasqtsgvtgggeg  541
            A+GPVVLMAA+FANAVFERLPL+++ E G       A+     + +      G  G   G
Sbjct  169  AAGPVVLMAASFANAVFERLPLDDQEEAGEVQVQPTASQNSGVTGSGGQMGDGGGGSSTG  228

Query  542  gggtsfgNTQpppppTNYPFSAEVFG-WAGNTAAAARPP  655
            GG    G          YPFS ++FG W GN   A+RPP
Sbjct  229  GGFFPMGGAHHG----TYPFSTDLFGSWGGN---ASRPP  260



>ref|XP_006342185.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Solanum tuberosum]
Length=212

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRD+PNALRSHVLE+S   DI++S+++YARRRGRGVC+LSGSGTV NV 
Sbjct  42   SKNKPKPPIIVTRDTPNALRSHVLEVSTDVDIMESISNYARRRGRGVCILSGSGTVANVN  101

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP+SPA +VVTLHGRFEILSLSGTVLPPPAPPG+ G+SIFLSGGQGQVVGG+VVGPLM
Sbjct  102  IRQPASPAATVVTLHGRFEILSLSGTVLPPPAPPGSSGISIFLSGGQGQVVGGSVVGPLM  161

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+FANAVFERLPL
Sbjct  162  ASGPVVLMAASFANAVFERLPL  183



>ref|XP_010320485.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Solanum 
lycopersicum]
Length=243

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 160/218 (73%), Gaps = 14/218 (6%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRD+PNALRSHVLE+S   DI++S+++YARRRGRGVC+LSGSGTVTNV 
Sbjct  39   SKNKPKPPIIVTRDTPNALRSHVLEVSTDVDIMESISNYARRRGRGVCILSGSGTVTNVN  98

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQ   PA SVVTLHGRFEILSLSGTVLPPPAPP + G+SIFLSGGQGQVVGG+VVGPL+
Sbjct  99   LRQ---PAASVVTLHGRFEILSLSGTVLPPPAPPASSGISIFLSGGQGQVVGGSVVGPLI  155

Query  362  ASGPVVLMAATFANAVFERLPLeeeaeggagnataaaagqqvqsstaasqtsgvtgggeg  541
            ASGPVVLMAA+FANAVFERLPLEE+ E  A   T   A  Q    T   + +G       
Sbjct  156  ASGPVVLMAASFANAVFERLPLEEDDEAPANVPTTQPAASQSSGVTGGGEAAGTAHPA--  213

Query  542  gggtsfgNTQpppppTNYPFSAEVFGWAGNTAAAARPP  655
                            NY FSAE+ GW GN AA  RPP
Sbjct  214  --------EGNMAFGNNYSFSAELLGWGGN-AANERPP  242



>ref|XP_010094507.1| hypothetical protein L484_024798 [Morus notabilis]
 gb|EXB56261.1| hypothetical protein L484_024798 [Morus notabilis]
Length=321

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 168/219 (77%), Gaps = 4/219 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPN LRSHVLE++A +DI+DSV++YARRRGRGVCVLSG+GTV NVT
Sbjct  105  SKNKPKPPIIVTRDSPNTLRSHVLEVTAGSDIVDSVSAYARRRGRGVCVLSGNGTVANVT  164

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQ   P GSV+TLHGRFEILSLSGTVLPPPAPP AGGLSIFLSGGQGQVVGG+VVGPL+
Sbjct  165  LRQ---PGGSVLTLHGRFEILSLSGTVLPPPAPPEAGGLSIFLSGGQGQVVGGSVVGPLV  221

Query  362  AS-GPVVLMAATFANAVFERLPLeeeaeggagnataaaagqqvqsstaasqtsgvtggge  538
            AS GPVVLMAA+FANAVFERLPL+E+  GG G+    +      S       +  TGG  
Sbjct  222  ASGGPVVLMAASFANAVFERLPLDEDETGGGGHVQQQSTTASQSSGVTNQPMTEGTGGNI  281

Query  539  ggggtsfgNTQpppppTNYPFSAEVFGWAGNTAAAARPP  655
             GGG   G +       NYPFS ++FGW G  + A RPP
Sbjct  282  SGGGVGGGVSFFGGGGGNYPFSGDLFGWPGGGSTAIRPP  320



>ref|XP_007043111.1| AT-hook DNA-binding family protein, putative [Theobroma cacao]
 gb|EOX98942.1| AT-hook DNA-binding family protein, putative [Theobroma cacao]
Length=292

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDSPNALRSHVLEI++ +DI+DSV++YARRRGRGVCVLSG+G VTNVT
Sbjct  74   SKNKPKPPIIITRDSPNALRSHVLEITSGSDIVDSVSNYARRRGRGVCVLSGTGAVTNVT  133

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++PAGSVVTLHGRFEILSL+GT LPPPAPPGAGGL+I+L+GGQGQVVGG+V GPLM
Sbjct  134  LRQPAAPAGSVVTLHGRFEILSLTGTSLPPPAPPGAGGLTIYLAGGQGQVVGGSVAGPLM  193

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+FANAV++RLP+
Sbjct  194  ASGPVVLMAASFANAVYDRLPV  215



>gb|KDP36737.1| hypothetical protein JCGZ_08028 [Jatropha curcas]
Length=289

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHVLE+S  +DI+++V++YAR+RGRGVCVLSG+GTV NVT
Sbjct  73   SKNKPKPPIIVTRDSPNALRSHVLEVSTGSDIVETVSNYARKRGRGVCVLSGNGTVANVT  132

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SPAGSVVTL GRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGG+VVGPL+
Sbjct  133  LRQPASPAGSVVTLQGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGGSVVGPLL  192

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+FANAVFERLPL
Sbjct  193  ASGPVVLMAASFANAVFERLPL  214



>ref|XP_010270573.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
 ref|XP_010270574.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=294

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 168/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSP+ALRSHVLE+SA AD+++ V++YARRRGRGVCVLSG GTV NVT
Sbjct  76   SKNKPKPPIIVTRDSPSALRSHVLEVSAGADVVECVSNYARRRGRGVCVLSGGGTVVNVT  135

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++PAGSVVTLHGRFEILSLSGTVLPPPAPPGAGGL IFL+GGQGQVVGG+VVGPL+
Sbjct  136  LRQPAAPAGSVVTLHGRFEILSLSGTVLPPPAPPGAGGLMIFLAGGQGQVVGGSVVGPLV  195

Query  362  ASGPVVLMAATFANAVFERLPLeeeaeggagnataaaagqqvqsstaasqtsgvtgggeg  541
            ASGPV+LMAA+FANA+FERLPLE E E        +A+     +        G + GG G
Sbjct  196  ASGPVMLMAASFANAMFERLPLEVEGEESPVQVQPSASQSSGVTGGGPGAQLGESSGGSG  255

Query  542  gggtsfgNTQpppppTN---YPFSAEVFGWAGNTAAAARPP  655
            GG  + G         N   Y F  +VFGW GN   A+RPP
Sbjct  256  GGAAATGGVSFYNLGVNTLNYQFPGDVFGWNGN---ASRPP  293



>ref|XP_007210817.1| hypothetical protein PRUPE_ppa020689mg [Prunus persica]
 gb|EMJ12016.1| hypothetical protein PRUPE_ppa020689mg [Prunus persica]
Length=318

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 133/142 (94%), Gaps = 3/142 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRD+PNALRSHVLEISA ADI++SV+ YARRRGRGVCVLSGSGTV NVT
Sbjct  100  SKNKPKPPIIVTRDTPNALRSHVLEISAGADIMESVSIYARRRGRGVCVLSGSGTVANVT  159

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQ   PAGSVVTLHGRFEILSLSGTVLPPPAPPGAGGLSIFL+G QGQVVGG VVGPL+
Sbjct  160  LRQ---PAGSVVTLHGRFEILSLSGTVLPPPAPPGAGGLSIFLAGVQGQVVGGCVVGPLL  216

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+F NAVFERLPL
Sbjct  217  ASGPVVLMAASFGNAVFERLPL  238



>ref|XP_008237909.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=317

 Score =   197 bits (500),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 133/142 (94%), Gaps = 3/142 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRD+PNALRSHVLEISA AD+++SV+ YARRRGRGVCVLSGSGTV NVT
Sbjct  99   SKNKPKPPIIVTRDTPNALRSHVLEISAGADVMESVSIYARRRGRGVCVLSGSGTVANVT  158

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQ   PAGSVVTLHGRFEILSLSGTVLPPPAPPGAGGLSIFL+G QGQVVGG VVGPL+
Sbjct  159  LRQ---PAGSVVTLHGRFEILSLSGTVLPPPAPPGAGGLSIFLAGVQGQVVGGCVVGPLL  215

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+F NAVFERLPL
Sbjct  216  ASGPVVLMAASFGNAVFERLPL  237



>gb|EYU36598.1| hypothetical protein MIMGU_mgv1a019273mg [Erythranthe guttata]
Length=292

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNK KPPIIVTRDSPNALRSHVLE+S+  D+++SV+ YAR+RGRGVCVLSG GTV NVT
Sbjct  72   SKNKSKPPIIVTRDSPNALRSHVLEVSSGNDVVESVSVYARQRGRGVCVLSGGGTVANVT  131

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP +PAGSVVTLHGRFEILSLSGTVLPPPAPPG+GGLSIFLSGGQGQVVGG+VVGPLM
Sbjct  132  LRQPGAPAGSVVTLHGRFEILSLSGTVLPPPAPPGSGGLSIFLSGGQGQVVGGSVVGPLM  191

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASG VVLMAA+FANAVFERLPL
Sbjct  192  ASGAVVLMAASFANAVFERLPL  213



>ref|XP_010063173.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Eucalyptus 
grandis]
Length=277

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNK KPPIIVTRDSPNALRSHVLE+S+ +DI++SVT+YAR+RGRG+CVLSG GTV NVT
Sbjct  72   SKNKAKPPIIVTRDSPNALRSHVLEVSSGSDIVESVTNYARQRGRGICVLSGGGTVANVT  131

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P GSVVTLHGRFEILSL+GTVLPPPAPPGAGGLSIFLSGGQGQVVGG+VVG L+
Sbjct  132  LRQPAAPTGSVVTLHGRFEILSLTGTVLPPPAPPGAGGLSIFLSGGQGQVVGGSVVGRLV  191

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+FANAVFERLP+
Sbjct  192  ASGPVVLMAASFANAVFERLPI  213



>ref|XP_010690586.1| PREDICTED: putative DNA-binding protein ESCAROLA [Beta vulgaris 
subsp. vulgaris]
Length=259

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDSPNALRSHVLE+SA +D+++SVT++ARRRGRGVCV SG+G VTNV 
Sbjct  41   SKNKPKPPIIITRDSPNALRSHVLEVSAGSDVVESVTNFARRRGRGVCVFSGTGAVTNVN  100

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++PAGSV+T+HGRFEILS++GT LPPPAPPGAGGL+IFLSGGQGQVVGG+VVGPLM
Sbjct  101  LRQPAAPAGSVMTMHGRFEILSITGTALPPPAPPGAGGLTIFLSGGQGQVVGGSVVGPLM  160

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+FANAVF+RLPL
Sbjct  161  ASGPVVLMAASFANAVFDRLPL  182



>ref|XP_010063174.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Eucalyptus 
grandis]
Length=285

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNK KPPIIVTRDSPNALRSHVLE+S+ +DI++SVT+YAR+RGRG+CVLSG GTV NVT
Sbjct  72   SKNKAKPPIIVTRDSPNALRSHVLEVSSGSDIVESVTNYARQRGRGICVLSGGGTVANVT  131

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P GSVVTLHGRFEILSL+GTVLPPPAPPGAGGLSIFLSGGQGQVVGG+VVG L+
Sbjct  132  LRQPAAPTGSVVTLHGRFEILSLTGTVLPPPAPPGAGGLSIFLSGGQGQVVGGSVVGRLV  191

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+FANAVFERLP+
Sbjct  192  ASGPVVLMAASFANAVFERLPI  213



>gb|KCW70368.1| hypothetical protein EUGRSUZ_F03609 [Eucalyptus grandis]
Length=284

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNK KPPIIVTRDSPNALRSHVLE+S+ +DI++SVT+YAR+RGRG+CVLSG GTV NVT
Sbjct  71   SKNKAKPPIIVTRDSPNALRSHVLEVSSGSDIVESVTNYARQRGRGICVLSGGGTVANVT  130

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P GSVVTLHGRFEILSL+GTVLPPPAPPGAGGLSIFLSGGQGQVVGG+VVG L+
Sbjct  131  LRQPAAPTGSVVTLHGRFEILSLTGTVLPPPAPPGAGGLSIFLSGGQGQVVGGSVVGRLV  190

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+FANAVFERLP+
Sbjct  191  ASGPVVLMAASFANAVFERLPI  212



>ref|XP_007018654.1| AT-hook DNA-binding family protein, putative [Theobroma cacao]
 gb|EOY15879.1| AT-hook DNA-binding family protein, putative [Theobroma cacao]
Length=347

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHVLEIS+ ADI+DS+++YARRRGRG+CVLSGSGTV NV+
Sbjct  133  SKNKPKPPIIVTRDSPNALRSHVLEISSGADIVDSLSNYARRRGRGICVLSGSGTVANVS  192

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP  SV+TLHGRFEILSL G VLPPPAPPG GGLSIFLSGGQGQVVGG VVGPL+
Sbjct  193  LRQPASPPASVLTLHGRFEILSLCGKVLPPPAPPGVGGLSIFLSGGQGQVVGGRVVGPLV  252

Query  362  ASGPVVLMAATFANAVFERLP  424
            ASGPVVLMAA+FANAVFERLP
Sbjct  253  ASGPVVLMAASFANAVFERLP  273



>ref|XP_010028876.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW55694.1| hypothetical protein EUGRSUZ_I01545 [Eucalyptus grandis]
Length=254

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRD+PNAL+SHVLE+SA +DI+D++T+YARRRGRG+ +LSG+G VTNVT
Sbjct  31   SKNKPKPPIIITRDTPNALQSHVLEVSAGSDIVDAITTYARRRGRGISILSGTGAVTNVT  90

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP+GSVVT+HGRF+ILSL+GTVLPPPAPPGAGGL+I+LSGGQGQVVGG+V GPLM
Sbjct  91   LRQPASPSGSVVTMHGRFDILSLTGTVLPPPAPPGAGGLAIYLSGGQGQVVGGSVGGPLM  150

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVVLMAA+FANA+F+RLPL
Sbjct  151  ASGPVVLMAASFANAMFDRLPL  172



>gb|EPS63001.1| hypothetical protein M569_11786, partial [Genlisea aurea]
Length=273

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = +2

Query  5    KNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVTL  184
            KNKPKPP+IVTR+SPNALRSHVLE+S   D++D V+ YARRRGRGVC+LSG GTV+NVTL
Sbjct  69   KNKPKPPVIVTRESPNALRSHVLEVSTGNDVVDCVSIYARRRGRGVCILSGGGTVSNVTL  128

Query  185  RQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLMA  364
            RQ ++PAGSVVTL GRFEILSL+GTVLPPPAPPG+GGLSIFLSGGQGQVVGG+VV PLMA
Sbjct  129  RQLAAPAGSVVTLQGRFEILSLTGTVLPPPAPPGSGGLSIFLSGGQGQVVGGSVVAPLMA  188

Query  365  SGPVVLMAATFANAVFERLPL  427
            +GPV+LMAA+F+NAVFERLPL
Sbjct  189  AGPVILMAASFSNAVFERLPL  209



>ref|XP_006435457.1| hypothetical protein CICLE_v10001818mg [Citrus clementina]
 ref|XP_006473862.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|ESR48697.1| hypothetical protein CICLE_v10001818mg [Citrus clementina]
Length=328

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 134/142 (94%), Gaps = 3/142 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI+VTRDSPNALRSHVLE+S  ADI++S+ +YA RRGRGVCVLSGSGT +NVT
Sbjct  93   SKNKPKPPIVVTRDSPNALRSHVLEVSGGADIVESMRNYASRRGRGVCVLSGSGTASNVT  152

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQ   PAGSV+TLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGGTVVGPL+
Sbjct  153  LRQ---PAGSVLTLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGGTVVGPLV  209

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+L+AA+FANAVFERLPL
Sbjct  210  ASGPVILIAASFANAVFERLPL  231



>gb|KDO85253.1| hypothetical protein CISIN_1g037272mg [Citrus sinensis]
Length=327

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 134/142 (94%), Gaps = 3/142 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI+VTRDSPNALRSHVLE+S  ADI++S+ +YA RRGRGVCVLSGSGT +NVT
Sbjct  92   SKNKPKPPIVVTRDSPNALRSHVLEVSGGADIVESMRNYASRRGRGVCVLSGSGTASNVT  151

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQ   PAGSV+TLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGGTVVGPL+
Sbjct  152  LRQ---PAGSVLTLHGRFEILSLSGTVLPPPAPPGAGGLSIFLSGGQGQVVGGTVVGPLV  208

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+L+AA+FANAVFERLPL
Sbjct  209  ASGPVILIAASFANAVFERLPL  230



>ref|XP_010645606.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=289

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNK KPPII+TRDSPNALRSHVLEISA ADI++SV++YARRRGRGVC+LSG G VT+VT
Sbjct  72   SKNKAKPPIIITRDSPNALRSHVLEISAGADIVESVSNYARRRGRGVCILSGGGAVTDVT  131

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P+GSVVTLHGRFEILSL+GT LPPPAPPGAGGL+I+L GGQGQVVGG VVGPL+
Sbjct  132  LRQPAAPSGSVVTLHGRFEILSLTGTALPPPAPPGAGGLTIYLGGGQGQVVGGRVVGPLV  191

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+LMAA+FANAV++RLPL
Sbjct  192  ASGPVLLMAASFANAVYDRLPL  213



>ref|XP_010539761.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=280

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHVLE+S  ADI++S+++YARRRGRGV VLSG+GTV +V 
Sbjct  79   SKNKPKPPIIVTRDSPNALRSHVLEVSPGADIVESLSTYARRRGRGVSVLSGNGTVADVA  138

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS  AG VV+LHGRFEILSL+GTVLPPPAPPGAGGLSIFL+G +GQVVGG+VV PL+
Sbjct  139  LRQPSVEAGGVVSLHGRFEILSLTGTVLPPPAPPGAGGLSIFLAGERGQVVGGSVVAPLV  198

Query  362  ASGPVVLMAATFANAVFERLP  424
            ASGPV+LMAA+F+NAVFERLP
Sbjct  199  ASGPVILMAASFSNAVFERLP  219



>ref|XP_010266286.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=280

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSP+ALRSHVLE+S  AD+++ ++ YARRRGRGVC+LSG G V NVT
Sbjct  75   SKNKPKPPIIVTRDSPSALRSHVLEVSTGADVVECLSDYARRRGRGVCILSGGGAVANVT  134

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P GSVVT+HGRFEILSLSGTVLPPPA PGAGGL+IFL+GGQGQVVGG+VVG L+
Sbjct  135  LRQPAAPPGSVVTMHGRFEILSLSGTVLPPPAEPGAGGLTIFLAGGQGQVVGGSVVGSLI  194

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+LMA +FANA+FERLPL
Sbjct  195  ASGPVMLMATSFANAMFERLPL  216



>ref|NP_177776.1| AT-hook motif nuclear localized protein 29 [Arabidopsis thaliana]
 gb|AAG51949.1|AC015450_10 unknown protein; 41834-42742 [Arabidopsis thaliana]
 tpd|FAA00300.1| TPA: AT-hook motif nuclear localized protein 29 [Arabidopsis 
thaliana]
 gb|AEE35850.1| AT-hook motif nuclear localized protein 29 [Arabidopsis thaliana]
Length=302

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 131/150 (87%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+IVTRDSPN LRSHVLE+S+ ADI++SVT+YARRRGRGV +LSG+GTV NV+
Sbjct  81   SKNKPKPPVIVTRDSPNVLRSHVLEVSSGADIVESVTTYARRRGRGVSILSGNGTVANVS  140

Query  182  LRQPSSPA--------GSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvg  337
            LRQP++ A        G VV LHGRFEILSL+GTVLPPPAPPG+GGLSIFLSG QGQV+G
Sbjct  141  LRQPATTAAHGANGGTGGVVALHGRFEILSLTGTVLPPPAPPGSGGLSIFLSGVQGQVIG  200

Query  338  gtvvgPLMASGPVVLMAATFANAVFERLPL  427
            G VV PL+ASGPV+LMAA+F+NA FERLPL
Sbjct  201  GNVVAPLVASGPVILMAASFSNATFERLPL  230



>ref|XP_007134900.1| hypothetical protein PHAVU_010G085300g [Phaseolus vulgaris]
 gb|ESW06894.1| hypothetical protein PHAVU_010G085300g [Phaseolus vulgaris]
Length=310

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI+   DI++SVT++ARRR RGVCVLSGSGTVTNVT
Sbjct  96   SKNKPKPPIIITRDSANALRSHVMEIANGCDIMESVTAFARRRQRGVCVLSGSGTVTNVT  155

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  156  LRQPASP-GAVVTLHGRFEILSLSGSFLPPPAPPAASGLAIYLAGGQGQVVGGSVVGPLL  214

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  215  ASGPVVIMAASFGNAAYERLPL  236



>ref|XP_003516470.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=288

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI+   DI++S+T++ARRR RGVCVLSGSGTVTNVT
Sbjct  76   SKNKPKPPIIITRDSANALRSHVMEIANGCDIMESITAFARRRQRGVCVLSGSGTVTNVT  135

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  136  LRQPASP-GAVVTLHGRFEILSLSGSFLPPPAPPAASGLAIYLAGGQGQVVGGSVVGPLV  194

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  195  ASGPVVIMAASFGNAAYERLPL  216



>ref|XP_010092850.1| hypothetical protein L484_022445 [Morus notabilis]
 gb|EXB52668.1| hypothetical protein L484_022445 [Morus notabilis]
Length=326

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 132/142 (93%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI+ A D++DS++++ARRR RG+CVLSG+GTVTNVT
Sbjct  105  SKNKPKPPIIITRDSANALRSHVMEIANACDVMDSMSAFARRRQRGICVLSGTGTVTNVT  164

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VV+LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPLM
Sbjct  165  LRQPASP-GAVVSLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLM  223

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  224  ASGPVVIMAASFGNAAYERLPL  245



>ref|XP_002887643.1| hypothetical protein ARALYDRAFT_476807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63902.1| hypothetical protein ARALYDRAFT_476807 [Arabidopsis lyrata subsp. 
lyrata]
Length=289

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 130/148 (88%), Gaps = 6/148 (4%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+IVTRDSPN LRSHVLE+S+ ADI++SVT+YARRRGRGV +LSG+GTV NV+
Sbjct  76   SKNKPKPPVIVTRDSPNVLRSHVLEVSSGADIVESVTTYARRRGRGVSILSGNGTVANVS  135

Query  182  LRQPSSP------AGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggt  343
            LRQP++        G VV LHGRFEILSL+GTVLPPPAPPG+GGLSIFLSG QGQV+GG 
Sbjct  136  LRQPAAAHGANGGTGGVVALHGRFEILSLTGTVLPPPAPPGSGGLSIFLSGVQGQVIGGN  195

Query  344  vvgPLMASGPVVLMAATFANAVFERLPL  427
            VV PL+ASGPV+LMAA+F+NA FERLPL
Sbjct  196  VVAPLVASGPVILMAASFSNATFERLPL  223



>ref|XP_010053890.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW78264.1| hypothetical protein EUGRSUZ_D02447 [Eucalyptus grandis]
Length=304

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDSPNALRSHV+E+++ ADI++S++++ARRR RGVC+LSGSGTVTNV 
Sbjct  96   SKNKPKPPIIITRDSPNALRSHVVEVASGADIVESMSTFARRRQRGVCILSGSGTVTNVA  155

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSLSG++LPPPAPP   GL+++L+GGQGQVVGG V GPLM
Sbjct  156  LRQPASP-GAVVTLHGRFEILSLSGSILPPPAPPALSGLTVYLAGGQGQVVGGNVAGPLM  214

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  215  ASGPVVIMAASFGNAAYERLPL  236



>ref|XP_008783083.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=348

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 133/144 (92%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKP+PPIIVTRDSPNALRSHVLE++  AD+++SVT YARRRGRGVCVLSG G V NV+
Sbjct  81   SKNKPRPPIIVTRDSPNALRSHVLEVAGGADVVESVTEYARRRGRGVCVLSGGGAVANVS  140

Query  182  LRQP-SSPAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP + P GSVV TL GRFEILSL+GTVLPPPAPPGAGGL++FL+GGQGQVVGG+VVGP
Sbjct  141  LRQPGAGPPGSVVATLRGRFEILSLTGTVLPPPAPPGAGGLTVFLAGGQGQVVGGSVVGP  200

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPVVLMAATFANAV+ERLPL
Sbjct  201  LVATGPVVLMAATFANAVYERLPL  224



>ref|XP_008646163.1| PREDICTED: putative DNA-binding protein ESCAROLA [Zea mays]
 gb|AFW73088.1| hypothetical protein ZEAMMB73_437326 [Zea mays]
Length=324

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 130/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNAL SHVLE++A AD++D V  YARRRGRGVCVLSG G V NV 
Sbjct  96   SKNKPKPPIIVTRDSPNALHSHVLEVAAGADVVDCVAEYARRRGRGVCVLSGGGAVVNVA  155

Query  182  LRQP-SSPAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP +SP GS+V TL GRFEILSL+GTVLPPPAPPGA GL++FLSGGQGQV+GG+VVGP
Sbjct  156  LRQPGASPPGSMVATLRGRFEILSLTGTVLPPPAPPGASGLTVFLSGGQGQVIGGSVVGP  215

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPVVLMAA+FANAV+ERLPL
Sbjct  216  LVAAGPVVLMAASFANAVYERLPL  239



>ref|XP_002279636.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
 emb|CAN81187.1| hypothetical protein VITISV_029906 [Vitis vinifera]
 emb|CBI38865.3| unnamed protein product [Vitis vinifera]
Length=300

 Score =   180 bits (457),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI+   DI+DS+ ++ARRR RG+C+LSGSGTVTNVT
Sbjct  91   SKNKPKPPIIITRDSANALRSHVMEIATGCDIMDSLNTFARRRQRGICILSGSGTVTNVT  150

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  151  LRQPASP-GAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLL  209

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  210  ASGPVVIMAASFGNAAYERLPL  231



>ref|XP_002452654.1| hypothetical protein SORBIDRAFT_04g030040 [Sorghum bicolor]
 gb|EES05630.1| hypothetical protein SORBIDRAFT_04g030040 [Sorghum bicolor]
Length=328

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 130/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNAL SHVLE++A AD++D V  YARRRGRGVCVLSG G V NV 
Sbjct  101  SKNKPKPPIIVTRDSPNALHSHVLEVAAGADVVDCVAEYARRRGRGVCVLSGGGAVVNVA  160

Query  182  LRQP-SSPAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP +SP GS+V TL GRFEILSL+GTVLPPPAPPGA GL++FLSGGQGQV+GG+VVGP
Sbjct  161  LRQPGASPPGSMVATLRGRFEILSLTGTVLPPPAPPGASGLTVFLSGGQGQVIGGSVVGP  220

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPVVLMAA+FANAV+ERLPL
Sbjct  221  LVAAGPVVLMAASFANAVYERLPL  244



>ref|XP_010913859.1| PREDICTED: LOW QUALITY PROTEIN: putative DNA-binding protein 
ESCAROLA [Elaeis guineensis]
Length=298

 Score =   180 bits (457),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 134/144 (93%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDSPNALRSHVLE+++ AD+++SVT YARRRGRGVCVLSG G+V NV+
Sbjct  81   SKNKPKPPIIITRDSPNALRSHVLEVASGADVVESVTEYARRRGRGVCVLSGGGSVANVS  140

Query  182  LRQPSS-PAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP + P GSVV TL GRFEILSL+GTVLPPPAPPGAGG+++FL+GGQGQVVGG+VVGP
Sbjct  141  LRQPGAPPPGSVVATLRGRFEILSLTGTVLPPPAPPGAGGMTVFLAGGQGQVVGGSVVGP  200

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPV+LM ATFANAV+ERLPL
Sbjct  201  LVAAGPVMLMTATFANAVYERLPL  224



>ref|XP_002301300.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE80573.1| DNA-binding family protein [Populus trichocarpa]
Length=298

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDSPNALRSHV+EI+   DI++SV+++ARRR RGVC+LS +GTVTNVT
Sbjct  89   SKNKPKPPIIITRDSPNALRSHVMEIATGCDIMESVSTFARRRQRGVCILSATGTVTNVT  148

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            L+QP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  149  LKQPASP-GAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLL  207

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  208  ASGPVVIMAASFGNAAYERLPL  229



>gb|KEH19036.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=308

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+E++   DI++SVT +ARRR RGVC+LSGSGTVTNVT
Sbjct  95   SKNKPKPPIIITRDSANALRSHVMEVANGCDIMESVTVFARRRQRGVCILSGSGTVTNVT  154

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  155  LRQPASP-GAVVTLHGRFEILSLSGSFLPPPAPPAASGLAIYLAGGQGQVVGGSVVGPLL  213

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  214  ASGPVVIMAASFGNAAYERLPL  235



>ref|XP_004510939.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=305

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+E++   DI++SVT +ARRR RGVC+LSGSGTVTNVT
Sbjct  94   SKNKPKPPIIITRDSANALRSHVMEVANGCDIMESVTVFARRRQRGVCILSGSGTVTNVT  153

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  154  LRQPASP-GAVVTLHGRFEILSLSGSFLPPPAPPAASGLAIYLAGGQGQVVGGSVVGPLL  212

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  213  ASGPVVIMAASFGNAAYERLPL  234



>ref|XP_004953673.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=324

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 129/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNAL SHVLE++A AD++D V  YARRRGRGVCVLSG G V NV 
Sbjct  98   SKNKPKPPIIVTRDSPNALHSHVLEVAAGADVVDCVAEYARRRGRGVCVLSGGGAVVNVA  157

Query  182  LRQP-SSPAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP +SP GS+V TL GRFEILSL+GTVLPPPAPPG  GL++FLSGGQGQV+GG+VVGP
Sbjct  158  LRQPGASPPGSMVATLRGRFEILSLTGTVLPPPAPPGVSGLTVFLSGGQGQVIGGSVVGP  217

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPVVLMAA+FANAV+ERLPL
Sbjct  218  LVAAGPVVLMAASFANAVYERLPL  241



>emb|CDX96613.1| BnaA08g21560D [Brassica napus]
Length=301

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 132/142 (93%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPK PIIVTRDSPN LRSHVLE+S  ADI++S+++YARRRGRGV VL G+GTV+NVT
Sbjct  93   SKNKPKAPIIVTRDSPNTLRSHVLEVSPGADIVESLSTYARRRGRGVSVLGGNGTVSNVT  152

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP +P G+VVTLHGRFEILSL+GTVLPPPAPPGAGGLSIFLSGGQGQV+GG+VV PL+
Sbjct  153  LRQPVTP-GNVVTLHGRFEILSLTGTVLPPPAPPGAGGLSIFLSGGQGQVIGGSVVAPLV  211

Query  362  ASGPVVLMAATFANAVFERLPL  427
            AS PV+LMAA+F+NAVFERLP+
Sbjct  212  ASAPVILMAASFSNAVFERLPI  233



>ref|XP_002320066.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE98381.1| DNA-binding family protein [Populus trichocarpa]
Length=300

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI+  +DI++SV+++ARRR RGVC+LSG+GTVTNVT
Sbjct  88   SKNKPKPPIIITRDSANALRSHVMEIATGSDIMESVSTFARRRQRGVCILSGTGTVTNVT  147

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            L+QP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A GL+++L+GGQGQV+GG+V GPL+
Sbjct  148  LKQPASP-GAVVTLHGRFEILSLSGSFLPPPAPPAASGLTVYLAGGQGQVIGGSVAGPLL  206

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  207  ASGPVVVMAASFGNAAYERLPL  228



>ref|XP_011034536.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=300

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI++  DI++SV+++ARRR RGVC+LSG+GTVTNVT
Sbjct  88   SKNKPKPPIIITRDSANALRSHVMEIASGCDIMESVSTFARRRQRGVCILSGTGTVTNVT  147

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            L+QP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A GL+++L+GGQGQV+GG+V GPL+
Sbjct  148  LKQPASP-GAVVTLHGRFEILSLSGSFLPPPAPPAASGLTVYLAGGQGQVIGGSVAGPLL  206

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  207  ASGPVVVMAASFGNAAYERLPL  228



>ref|XP_002511734.1| ESC, putative [Ricinus communis]
 gb|EEF50403.1| ESC, putative [Ricinus communis]
Length=299

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 132/142 (93%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI+  +DI++SV+++ARRR RGVC+LSG+GTVTNVT
Sbjct  92   SKNKPKPPIIITRDSANALRSHVMEIANGSDIMESVSTFARRRQRGVCILSGTGTVTNVT  151

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  152  LRQPASP-GAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLL  210

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  211  ASGPVVIMAASFGNAAYERLPL  232



>ref|XP_008799138.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=307

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 131/144 (91%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRD+PNALRSHVLE+S  AD+++ V+ YARRRGRGVCVLSG G V NV 
Sbjct  88   SKNKPKPPIIVTRDNPNALRSHVLEVSGGADVVECVSEYARRRGRGVCVLSGGGAVANVV  147

Query  182  LRQP-SSPAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP +SP GSVV TL GRFEILSL+GTVLPPPAPPGA GL++FL+GGQGQVVGG+VVGP
Sbjct  148  LRQPGASPPGSVVATLRGRFEILSLTGTVLPPPAPPGASGLTVFLAGGQGQVVGGSVVGP  207

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPVVLMAA+FANAV+ERLP+
Sbjct  208  LVAAGPVVLMAASFANAVYERLPI  231



>ref|NP_001047914.1| Os02g0713700 [Oryza sativa Japonica Group]
 dbj|BAD07790.1| DNA-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF09828.1| Os02g0713700 [Oryza sativa Japonica Group]
 dbj|BAH00978.1| unnamed protein product [Oryza sativa Japonica Group]
Length=336

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 129/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNAL SHVLE++  AD++D V  YARRRGRGVCVLSG G V NV 
Sbjct  108  SKNKPKPPIIVTRDSPNALHSHVLEVAGGADVVDCVAEYARRRGRGVCVLSGGGAVVNVA  167

Query  182  LRQP-SSPAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP +SP GS+V TL GRFEILSL+GTVLPPPAPPGA GL++FLSGGQGQV+GG+VVGP
Sbjct  168  LRQPGASPPGSMVATLRGRFEILSLTGTVLPPPAPPGASGLTVFLSGGQGQVIGGSVVGP  227

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPVVLMAA+FANAV+ERLPL
Sbjct  228  LVAAGPVVLMAASFANAVYERLPL  251



>ref|XP_010927299.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=309

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 132/144 (92%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKP+PPIIVTRD+PNALRSHVLE+S  AD+++ V+ YARRRGRGVCVLSG GTV NV 
Sbjct  86   SKNKPRPPIIVTRDNPNALRSHVLEVSGGADVVECVSDYARRRGRGVCVLSGGGTVANVA  145

Query  182  LRQP-SSPAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP +SP GSVV TL GRFEILSL+GTVLPPPAPPG GGL++FL+GGQGQVVGG+VVGP
Sbjct  146  LRQPGASPPGSVVATLRGRFEILSLTGTVLPPPAPPGTGGLTVFLAGGQGQVVGGSVVGP  205

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPVVLMAA+FANAV+ERLP+
Sbjct  206  LLAAGPVVLMAASFANAVYERLPI  229



>ref|XP_006445233.1| hypothetical protein CICLE_v10024070mg [Citrus clementina]
 ref|XP_006490941.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|ESR58473.1| hypothetical protein CICLE_v10024070mg [Citrus clementina]
Length=313

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI+   DI+DSV+++ARRR RG+C+LSG+GTVTNVT
Sbjct  97   SKNKPKPPIIITRDSANALRSHVMEIANGCDIMDSVSNFARRRQRGICILSGTGTVTNVT  156

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  157  LRQPASP-GAVVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLV  215

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  216  ASGPVVIMAASFGNAAYERLPL  237



>dbj|BAJ94962.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=331

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 129/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNAL SHVLE+SA ADI+D V  YARRRGRGVCVLSG G V NV 
Sbjct  107  SKNKPKPPIIVTRDSPNALHSHVLEVSAGADIVDCVAEYARRRGRGVCVLSGGGAVVNVA  166

Query  182  LRQP-SSPAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP +SP GSVV TL GRFEILSL+GTVLPPPAPPGA GL++FLSGGQGQV+GG+VVG 
Sbjct  167  LRQPGASPPGSVVATLRGRFEILSLTGTVLPPPAPPGASGLTVFLSGGQGQVIGGSVVGT  226

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPVVLMAA+F+NAV+ERLPL
Sbjct  227  LVAAGPVVLMAASFSNAVYERLPL  250



>ref|XP_003570225.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=337

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 129/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNAL SHVLE++A ADI+D V  YARRRGRGVCVLSG G V NV 
Sbjct  104  SKNKPKPPIIVTRDSPNALHSHVLEVAAGADIVDCVAEYARRRGRGVCVLSGGGAVVNVA  163

Query  182  LRQP-SSPAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP +SP GSVV TL GRFEILSL+GTVLPPPAPPGA GL++FLSGGQGQV+GG+VVG 
Sbjct  164  LRQPGASPPGSVVATLRGRFEILSLTGTVLPPPAPPGASGLTVFLSGGQGQVIGGSVVGS  223

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPVVLMAA+FANAV+ERLPL
Sbjct  224  LVAAGPVVLMAASFANAVYERLPL  247



>ref|XP_003521618.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=310

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI+   DI++SVT++ARRR RG+C+LSGSGTVTNVT
Sbjct  95   SKNKPKPPIIITRDSANALRSHVMEITNGCDIMESVTAFARRRQRGICLLSGSGTVTNVT  154

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP+ +VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  155  LRQPASPS-AVVTLHGRFEILSLSGSFLPPPAPPAASGLAIYLAGGQGQVVGGSVVGPLV  213

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  214  ASGPVVIMAASFGNAAYERLPL  235



>ref|XP_004306909.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=325

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNK KPPII+TRDS NALRSHV+E++   DI+DSV+++ARRR RGVC+LSGSGTVTNVT
Sbjct  103  SKNKAKPPIIITRDSANALRSHVMEVANGCDIMDSVSTFARRRQRGVCILSGSGTVTNVT  162

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  163  LRQPASP-GAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLL  221

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  222  ASGPVVIMAASFGNAAYERLPL  243



>ref|XP_009364460.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=299

 Score =   177 bits (450),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EIS+ ADI DSV  +ARRR RGVCV+SGSGTV NVT
Sbjct  86   SKNKPKPPIFVTRDSPNALRSHVMEISSGADIADSVAQFARRRQRGVCVMSGSGTVINVT  145

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+V+ LHGRFEILSL+G  LP PA PG+ GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  146  LRQPSAP-GAVMALHGRFEILSLTGAFLPGPALPGSTGLTIYLAGGQGQVVGGSVVGPLV  204

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATF+NA +ERLPL
Sbjct  205  ASGPVMVIAATFSNATYERLPL  226



>gb|EPS72241.1| hypothetical protein M569_02519, partial [Genlisea aurea]
Length=161

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 129/142 (91%), Gaps = 2/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP++VTRD PN+LRSHVLE+S+ +DI++S+T YAR RGRGVCVL G G VTNVT
Sbjct  17   SKNKPKPPVVVTRDYPNSLRSHVLEVSSGSDIVESLTVYARWRGRGVCVLRGGGAVTNVT  76

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+  AGS +TL G FEILSL+GT+LPPPAPPGAGGLSIFLSGGQGQVVGG+VVGPL 
Sbjct  77   LRQPA--AGSAMTLQGHFEILSLTGTILPPPAPPGAGGLSIFLSGGQGQVVGGSVVGPLS  134

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+L+AA+FANAVFERLPL
Sbjct  135  ASGPVILVAASFANAVFERLPL  156



>ref|XP_007052032.1| AT-hook motif nuclear-localized protein 22 [Theobroma cacao]
 gb|EOX96189.1| AT-hook motif nuclear-localized protein 22 [Theobroma cacao]
Length=326

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI+   DI++S++++ARRR RGVC+LSGSGTVTNVT
Sbjct  113  SKNKPKPPIIITRDSANALRSHVMEIANGCDIMESISTFARRRQRGVCILSGSGTVTNVT  172

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP +P G+VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  173  LRQPGAP-GAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLV  231

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  232  ASGPVVIMAASFGNAAYERLPL  253



>ref|XP_010692632.1| PREDICTED: putative DNA-binding protein ESCAROLA [Beta vulgaris 
subsp. vulgaris]
Length=273

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 133/142 (94%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI+VTRD+PNALRSH+LE+S+ ADI++S++SYAR+RGRGV ++SG+GTV +VT
Sbjct  70   SKNKPKPPIVVTRDTPNALRSHMLEVSSGADIMESLSSYARQRGRGVSIISGNGTVMDVT  129

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+  + SV TL GRFEILS++GTVLPPPAPPGAGGLSIFLSGGQGQVVGG VVGPL+
Sbjct  130  LRQPAD-SSSVATLQGRFEILSITGTVLPPPAPPGAGGLSIFLSGGQGQVVGGGVVGPLL  188

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+LMAA+F+NAVFERLPL
Sbjct  189  ASGPVLLMAASFSNAVFERLPL  210



>ref|XP_006851806.1| hypothetical protein AMTR_s00041p00022450 [Amborella trichopoda]
 gb|ERN13273.1| hypothetical protein AMTR_s00041p00022450 [Amborella trichopoda]
Length=303

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKP+PPII+TRDS NALRSHV+E+++  DI++SV +YARRR RGVC+LSGSGTVTNVT
Sbjct  94   SKNKPRPPIIITRDSANALRSHVMEVASGCDIVESVANYARRRQRGVCILSGSGTVTNVT  153

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G++VTLHGRFEILSLSG+ LPPP PP A GL+I+L+GGQGQVVGGTVVG L+
Sbjct  154  LRQPAAP-GAIVTLHGRFEILSLSGSFLPPPGPPAATGLTIYLAGGQGQVVGGTVVGALL  212

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV++MAA+F NA FERLPL
Sbjct  213  ASGPVIIMAASFGNAAFERLPL  234



>ref|XP_011017502.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=298

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI++  DI++SV+++A RR RGVC+LSG+GTVTNVT
Sbjct  89   SKNKPKPPIIITRDSANALRSHVMEIASGCDIMESVSTFAGRRQRGVCILSGTGTVTNVT  148

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            L+QP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  149  LKQPASP-GAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLL  207

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  208  ASGPVVIMAASFGNAAYERLPL  229



>gb|EEC73884.1| hypothetical protein OsI_08674 [Oryza sativa Indica Group]
Length=415

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 129/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNAL SHVLE++  AD++D V  YARRRGRGVCVLSG G V NV 
Sbjct  187  SKNKPKPPIIVTRDSPNALHSHVLEVAGGADVVDCVAEYARRRGRGVCVLSGGGAVVNVA  246

Query  182  LRQP-SSPAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP +SP GS+V TL GRFEILSL+GTVLPPPAPPGA GL++FLSGGQGQV+GG+VVGP
Sbjct  247  LRQPGASPPGSMVATLRGRFEILSLTGTVLPPPAPPGASGLTVFLSGGQGQVIGGSVVGP  306

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPVVLMAA+FANAV+ERLPL
Sbjct  307  LVAAGPVVLMAASFANAVYERLPL  330



>gb|KDP28740.1| hypothetical protein JCGZ_14511 [Jatropha curcas]
Length=308

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNK KPPII+TRDS NALRSHV+EI+   DI++SV+++ARRR RGVC+LSG+GTVTNVT
Sbjct  94   SKNKAKPPIIITRDSANALRSHVMEIANGCDIMESVSTFARRRQRGVCILSGTGTVTNVT  153

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  154  LRQPASP-GAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLL  212

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  213  ASGPVVIMAASFGNAAYERLPL  234



>ref|XP_011070911.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=255

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EIS   DI+D V ++ARRR RGVC++SG+G+VTNVT
Sbjct  83   SKNKPKPPIIITRDSANALRTHVMEISDGCDIMDGVANFARRRQRGVCIMSGTGSVTNVT  142

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+VVTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQV+GG+VVG L+
Sbjct  143  LRQPAAP-GAVVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVLGGSVVGQLL  201

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV++MAA+F+NA +ERLPL
Sbjct  202  ASGPVIIMAASFSNAAYERLPL  223



>ref|XP_010523691.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=297

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDS NALRSHV+EI+   D+++SVT +ARRR RGVCVLSG+G VTNVT
Sbjct  92   SKNKPKPPIIVTRDSANALRSHVMEIANGCDVMESVTVFARRRQRGVCVLSGNGAVTNVT  151

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQPS   G+VV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPLM
Sbjct  152  IRQPS--GGAVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLM  209

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  210  ASGPVVIMAASFGNAAYERLPL  231



>ref|XP_006339443.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=308

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI++  DI +S++++A RR RGVC+LSGSGTVTNVT
Sbjct  99   SKNKPKPPIIITRDSANALRSHVMEIASGCDIQESISNFATRRQRGVCILSGSGTVTNVT  158

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL 
Sbjct  159  IRQPTSP-GAVVTLHGRFEILSLSGSYLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLN  217

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  218  ASGPVVIMAASFGNAAYERLPL  239



>ref|XP_010928787.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=292

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHVLE++  AD+++SVT YARRRGRGV VLSG G V NV+
Sbjct  79   SKNKPKPPIIVTRDSPNALRSHVLEVAGGADVVESVTEYARRRGRGVSVLSGGGAVENVS  138

Query  182  LRQP-SSPAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            L+QP S P GSVV TL GRFEILSL+GTVLPPPAPPGAGGL++ L+GGQGQVVGG+VVGP
Sbjct  139  LQQPGSGPPGSVVATLRGRFEILSLTGTVLPPPAPPGAGGLTVLLAGGQGQVVGGSVVGP  198

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPV+LMAATFANAV+ERLPL
Sbjct  199  LVAAGPVMLMAATFANAVYERLPL  222



>gb|ABL63118.1| AT-hook DNA-binding protein [Catharanthus roseus]
Length=293

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++SV ++ARRR RGVC++SGSGTVTNVT
Sbjct  73   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMESVATFARRRQRGVCIMSGSGTVTNVT  132

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSL+G+ LPPPAPP A  L+I+L+GGQGQVVGG+VVG L+
Sbjct  133  LRQPASP-GAVVTLHGRFEILSLAGSFLPPPAPPAATSLTIYLAGGQGQVVGGSVVGALL  191

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  192  ASGPVVIMAASFSNAAYERLPL  213



>emb|CDX87591.1| BnaA07g32820D [Brassica napus]
Length=280

 Score =   175 bits (443),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 130/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+IVTRDSPN LRSHVLEIS+ ADI++SV +YARRRGRGV VLSG+G V+NV 
Sbjct  78   SKNKPKPPVIVTRDSPNVLRSHVLEISSGADIVESVNTYARRRGRGVSVLSGNGAVSNVV  137

Query  182  LRQPSSP--AGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP++   +  VVTLHGRF+ILS++GTVLPPPAPPGAGGLSIF++G QGQV+GG+VV P
Sbjct  138  LRQPATTHRSNGVVTLHGRFDILSMTGTVLPPPAPPGAGGLSIFVAGAQGQVIGGSVVAP  197

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+ASGPV+LMAA+F+NA FERLPL
Sbjct  198  LVASGPVILMAASFSNATFERLPL  221



>ref|XP_008370731.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=304

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EIS  ADI +SV  +ARRR RGVCV+SGSGTVTNVT
Sbjct  86   SKNKPKPPIFVTRDSPNALRSHVMEISNGADIANSVAQFARRRQRGVCVMSGSGTVTNVT  145

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+V+ LHGRFEILSL+G  LP PAPPG+ G++I+L+GGQGQVVGG+VVGPL+
Sbjct  146  LRQPSAP-GAVMALHGRFEILSLTGAFLPGPAPPGSTGMTIYLAGGQGQVVGGSVVGPLV  204

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATF NA +ERLPL
Sbjct  205  ASGPVMVIAATFTNATYERLPL  226



>ref|XP_009372143.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=305

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EIS  ADI +SV  +ARRR RGVCV+SGSGTVTNVT
Sbjct  86   SKNKPKPPIFVTRDSPNALRSHVMEISNGADIANSVAQFARRRQRGVCVMSGSGTVTNVT  145

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+V+ LHGRFEILSL+G  LP PAPPG+ G++I+L+GGQGQVVGG+VVGPL+
Sbjct  146  LRQPSAP-GAVMALHGRFEILSLTGAFLPGPAPPGSTGMTIYLAGGQGQVVGGSVVGPLV  204

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATF NA +ERLPL
Sbjct  205  ASGPVMVIAATFTNATYERLPL  226



>ref|XP_008388703.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=304

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EIS+ ADI DSV  +ARRR RGVCV+SGSGTV NVT
Sbjct  86   SKNKPKPPIFVTRDSPNALRSHVMEISSGADIADSVAQFARRRQRGVCVMSGSGTVINVT  145

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+V+ LHGRFEIL L+G  LP PA PG+ GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  146  LRQPSAP-GAVMALHGRFEILYLTGAFLPGPALPGSTGLTIYLAGGQGQVVGGSVVGPLV  204

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATF+NA +ERLPL
Sbjct  205  ASGPVMVIAATFSNATYERLPL  226



>ref|XP_008364289.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=308

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI+   DI++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  92   SKNKPKPPIIITRDSANALRSHVMEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  151

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP GSVVTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  152  LRQPASP-GSVVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLI  210

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  211  ASGPVVIMAASFSNAAYERLPL  232



>emb|CBI34813.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  38   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  97

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++VTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  98   LRQPASP-GAIVTLHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGQLL  156

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  157  ASGPVVIMAASFSNAAYERLPL  178



>ref|XP_009604907.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=304

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI++  DI +S++++A RR RGVC+LSGSGTVTNVT
Sbjct  97   SKNKPKPPIIITRDSANALRSHVMEIASGCDIQESISTFATRRQRGVCILSGSGTVTNVT  156

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL 
Sbjct  157  IRQPASP-GAVVTLHGRFEILSLSGSYLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLN  215

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  216  ASGPVVIMAASFGNAAYERLPL  237



>ref|XP_007144108.1| hypothetical protein PHAVU_007G129400g, partial [Phaseolus vulgaris]
 gb|ESW16102.1| hypothetical protein PHAVU_007G129400g, partial [Phaseolus vulgaris]
Length=310

 Score =   176 bits (445),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EI+  AD+ +SV  +ARRR RGVCVLSGSG+V NVT
Sbjct  100  SKNKPKPPIFVTRDSPNALRSHVMEITGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  159

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+VV LHGRFEILSL+GT LP PAPPG+ GL+++L+GGQGQV+GG+VVGPL+
Sbjct  160  LRQPAAP-GAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVLGGSVVGPLV  218

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATFANA +ERLPL
Sbjct  219  ATGPVMVIAATFANATYERLPL  240



>ref|XP_010422173.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=337

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPK PII+TRDS NALR+HV+EI    DI+D + ++ARRR RGVCV+SG+G VTNVT
Sbjct  124  SKNKPKAPIIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVTNVT  183

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP SPAGSVV+LHGRFEILSLSG+ LPPPAPP A GLS++L+GGQGQVVGG+VVGPL+
Sbjct  184  IRQPGSPAGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLL  243

Query  362  ASGPVVLMAATFANAVFERLPL  427
             SGPVV+MAA+F+NA +ERLPL
Sbjct  244  CSGPVVVMAASFSNAAYERLPL  265



>ref|XP_009799054.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009799060.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
sylvestris]
Length=304

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI++  DI +S++++A RR RGVC+LSGSGTVTNVT
Sbjct  97   SKNKPKPPIIITRDSANALRSHVMEIASGCDIQESISTFATRRQRGVCILSGSGTVTNVT  156

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL 
Sbjct  157  IRQPASP-GAVVTLHGRFEILSLSGSYLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLN  215

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  216  ASGPVVIMAASFGNAAYERLPL  237



>ref|XP_010433825.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=336

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPK PII+TRDS NALR+HV+EI    DI+D + ++ARRR RGVCV+SG+G VTNVT
Sbjct  122  SKNKPKAPIIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVTNVT  181

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP SPAGSVV+LHGRFEILSLSG+ LPPPAPP A GLS++L+GGQGQVVGG+VVGPL+
Sbjct  182  IRQPGSPAGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLL  241

Query  362  ASGPVVLMAATFANAVFERLPL  427
             SGPVV+MAA+F+NA +ERLPL
Sbjct  242  CSGPVVVMAASFSNAAYERLPL  263



>ref|XP_010471803.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=306

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 128/150 (85%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+IVTRDSPN LRSHVLEIS+ ADI++ V +YARRRG+GV +LSG+GTV NV+
Sbjct  86   SKNKPKPPVIVTRDSPNVLRSHVLEISSGADIIECVNTYARRRGKGVSILSGNGTVANVS  145

Query  182  LRQP--------SSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvg  337
            +RQP        +  AG VV+LHGRFE+LS++GTVLPPPAPPG+GGLS+FL+G QGQVVG
Sbjct  146  IRQPVTGTAHATNGGAGGVVSLHGRFEVLSITGTVLPPPAPPGSGGLSVFLAGTQGQVVG  205

Query  338  gtvvgPLMASGPVVLMAATFANAVFERLPL  427
            G  V PL+ASGPVVLMAA+F+NA FERLPL
Sbjct  206  GNAVSPLVASGPVVLMAASFSNATFERLPL  235



>ref|XP_011090893.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=307

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+E++   DI +S++++A RR RGVC+LSG+GTVTNVT
Sbjct  100  SKNKPKPPIIITRDSANALRSHVMEVANGCDIQESISTFATRRQRGVCILSGNGTVTNVT  159

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+VVTLHGRFEILSLSG+ LPPPAPP A  L+I+L+GGQGQV+GGTVVGPL+
Sbjct  160  LRQPAAP-GAVVTLHGRFEILSLSGSFLPPPAPPAASALTIYLAGGQGQVMGGTVVGPLL  218

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  219  ASGPVVIMAASFGNAAYERLPL  240



>ref|XP_010540129.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
 ref|XP_010540136.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=333

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI    DI+DS+ ++ARRR RGVCV+SG+G VTNVT
Sbjct  120  SKNKPKPPIIITRDSANALRTHVMEIGDGCDIVDSMATFARRRQRGVCVMSGTGNVTNVT  179

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP SP GSVV+LHGRFEILSLSG+ LPPPAPP A GLS++L+GGQGQVVGG+VVGPL+
Sbjct  180  IRQPGSPPGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLV  239

Query  362  ASGPVVLMAATFANAVFERLPL  427
             +GPVV+MAA+F+NA +ERLPL
Sbjct  240  CAGPVVVMAASFSNAAYERLPL  261



>gb|EYU30571.1| hypothetical protein MIMGU_mgv1a010755mg [Erythranthe guttata]
Length=302

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+E++   D+ DS++++A RR RGVC+LSG+GTVTNVT
Sbjct  100  SKNKPKPPIIITRDSANALRSHVMEVANGCDVQDSISTFATRRQRGVCILSGTGTVTNVT  159

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P GSV+TLHGRFEILSLSG+ LPPPAPP A GL+I+L+G QGQVVGG VVGPL+
Sbjct  160  LRQPAAP-GSVLTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGAQGQVVGGAVVGPLL  218

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  219  ASGPVVIMAASFGNAAYERLPL  240



>ref|XP_009410344.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=294

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 127/144 (88%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHVLE+++ AD+ + V+ YARRRGRGV VLSG+G VTNV 
Sbjct  81   SKNKPKPPIIVTRDSPNALRSHVLEVASGADVFECVSDYARRRGRGVSVLSGTGAVTNVA  140

Query  182  LRQP--SSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP  S+P   V TL GRFEI+SL+GTVLPPPAPPGAGGLS+FLSGGQGQV+GG+V GP
Sbjct  141  LRQPGASTPGSVVATLRGRFEIISLTGTVLPPPAPPGAGGLSVFLSGGQGQVIGGSVAGP  200

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPVVLM A+F NAV+ERLPL
Sbjct  201  LVATGPVVLMVASFTNAVYERLPL  224



>ref|XP_010455638.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=337

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPK PII+TRDS NALR+HV+EI    DI+D + ++ARRR RGVCV+SG+G VTNVT
Sbjct  123  SKNKPKAPIIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVTNVT  182

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP SPAGSVV+LHGRFEILSLSG+ LPPPAPP A GLS++L+GGQGQVVGG+VVGPL+
Sbjct  183  IRQPGSPAGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLL  242

Query  362  ASGPVVLMAATFANAVFERLPL  427
             SGPVV+MAA+F+NA +ERLPL
Sbjct  243  CSGPVVVMAASFSNAAYERLPL  264



>ref|XP_008218304.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=304

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EIS  ADI DSV  +AR R RGVCVLSGSGTVTNVT
Sbjct  86   SKNKPKPPIFVTRDSPNALRSHVMEISNGADIADSVARFARTRQRGVCVLSGSGTVTNVT  145

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQ +SPAGSV+ LHGRFEILSL+G  LP PAPPG+ G++I+L+G QGQVVGG+VVGPL+
Sbjct  146  IRQ-TSPAGSVMALHGRFEILSLTGAFLPGPAPPGSTGMTIYLAGVQGQVVGGSVVGPLV  204

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATF+NA +ERLPL
Sbjct  205  ASGPVMVIAATFSNATYERLPL  226



>ref|XP_008796249.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=305

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSHVLE+S  AD+++ V+ YARRRGRGV VLSG G V NV 
Sbjct  84   SKNKPKPPIIVTRDSPNALRSHVLEVSGGADVVECVSEYARRRGRGVFVLSGGGAVVNVA  143

Query  182  LRQP-SSPAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP +SP GSVV TL GRFEILSL+GTVLPPPAPPGAGGL++FL+GGQGQVVGG+VVGP
Sbjct  144  LRQPGASPPGSVVATLRGRFEILSLTGTVLPPPAPPGAGGLTVFLAGGQGQVVGGSVVGP  203

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPVVLMAA+FANAV+ERLP+
Sbjct  204  LVAAGPVVLMAASFANAVYERLPI  227



>ref|XP_010102254.1| hypothetical protein L484_024535 [Morus notabilis]
 gb|EXB93197.1| hypothetical protein L484_024535 [Morus notabilis]
Length=292

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EI+  ADI DSV  +ARRR RGVCVLSGSGTV NVT
Sbjct  78   SKNKPKPPIFVTRDSPNALRSHVMEIANGADIADSVAQFARRRQRGVCVLSGSGTVANVT  137

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P+ +VV LHGRFEILSL+G  LP P+PPG+ GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  138  LRQPSAPS-AVVALHGRFEILSLTGAFLPGPSPPGSTGLTIYLAGGQGQVVGGSVVGPLV  196

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATF+NA +ERLPL
Sbjct  197  AAGPVMVIAATFSNATYERLPL  218



>ref|XP_010428713.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=291

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 129/148 (87%), Gaps = 6/148 (4%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+IVTRDSPN LRSHVLEIS+ ADI++ V +YARRRG+GV +LSG+GTV NV+
Sbjct  73   SKNKPKPPVIVTRDSPNVLRSHVLEISSGADIIECVNTYARRRGKGVSILSGNGTVANVS  132

Query  182  LRQPSSP------AGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggt  343
            +RQP++       AG VV+LHGRFE+LS++GTVLPPPAPPG+GGLS+FL+G QGQVVGG 
Sbjct  133  IRQPATAHATNGGAGGVVSLHGRFEVLSITGTVLPPPAPPGSGGLSVFLAGTQGQVVGGL  192

Query  344  vvgPLMASGPVVLMAATFANAVFERLPL  427
             V PL+ASGPVVLMA++F+NA FERLPL
Sbjct  193  AVSPLVASGPVVLMASSFSNATFERLPL  220



>ref|XP_007206474.1| hypothetical protein PRUPE_ppa018950mg [Prunus persica]
 gb|EMJ07673.1| hypothetical protein PRUPE_ppa018950mg [Prunus persica]
Length=305

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EIS  ADI DSV  +AR R RGVCVLSGSGTVTNVT
Sbjct  87   SKNKPKPPIFVTRDSPNALRSHVMEISNGADIADSVARFARTRQRGVCVLSGSGTVTNVT  146

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQ +SPAGSV+ LHGRFEILSL+G  LP PAPPG+ G++I+L+G QGQVVGG+VVGPL+
Sbjct  147  IRQ-ASPAGSVMALHGRFEILSLTGAFLPGPAPPGSTGMTIYLAGVQGQVVGGSVVGPLV  205

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATF+NA +ERLPL
Sbjct  206  ASGPVMVIAATFSNATYERLPL  227



>ref|XP_003527629.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=254

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 141/211 (67%), Gaps = 32/211 (15%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+IVTRDSPN LRSHVLE+S+ AD+++S+++YARRRGRGV VLSGSGTV NV 
Sbjct  53   SKNKPKPPVIVTRDSPNVLRSHVLEVSSGADVVESLSNYARRRGRGVSVLSGSGTVANVV  112

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQ   PAGSV+TLHGRFEI+S++GTVLPPPAPPG+ GLS++LSG QGQVVGG VV PL+
Sbjct  113  LRQ---PAGSVLTLHGRFEIVSMTGTVLPPPAPPGSDGLSVYLSGAQGQVVGGVVVAPLV  169

Query  362  ASGPVVLMAATFANAVFERLPLeeeaeggagnataaaagqqvqsstaasqtsgvtgggeg  541
            AS  VVL+AA+FANA+FERLPL                                      
Sbjct  170  ASSHVVLVAASFANAMFERLPL-------------------------PLNQHDDDDQVLQ  204

Query  542  gggtsfgNTQpppppTNYPFSA----EVFGW  622
                    T+      NYPFSA    EVFGW
Sbjct  205  EAPRGVMGTEQVADGRNYPFSASLQGEVFGW  235



>ref|XP_006301299.1| hypothetical protein CARUB_v10021706mg [Capsella rubella]
 gb|EOA34197.1| hypothetical protein CARUB_v10021706mg [Capsella rubella]
Length=298

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 128/150 (85%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+IVTRDSPN LRSHVLEIS+  DI++SVT+YARRRGRGV VLSG+GTV NV+
Sbjct  79   SKNKPKPPVIVTRDSPNVLRSHVLEISSGTDIVESVTTYARRRGRGVSVLSGNGTVANVS  138

Query  182  LRQPSSPAG--------SVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvg  337
            LRQP+S            VV LHGRF+ILSLSGTVLPPPAPPG+GGLSIFLSG QGQ+VG
Sbjct  139  LRQPASATAHGTNGGTGGVVALHGRFDILSLSGTVLPPPAPPGSGGLSIFLSGAQGQMVG  198

Query  338  gtvvgPLMASGPVVLMAATFANAVFERLPL  427
            G VV PL+ASGPV+LMAA+F+NA FERLPL
Sbjct  199  GNVVAPLVASGPVILMAASFSNATFERLPL  228



>gb|EYU40549.1| hypothetical protein MIMGU_mgv1a021038mg [Erythranthe guttata]
Length=310

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+E+S   DI+DSV S+ARRR RGVCV+SG+G VTNVT
Sbjct  95   SKNKPKPPIIITRDSANALRTHVMEVSDGCDIMDSVASFARRRQRGVCVMSGTGNVTNVT  154

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+V+TLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQV+GG+VVG L+
Sbjct  155  LRQPAAP-GAVMTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVLGGSVVGQLL  213

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV++MAA+F+NA +ERLPL
Sbjct  214  ASGPVIIMAASFSNAAYERLPL  235



>ref|XP_004229823.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=302

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI+   DI +S++++A RR RGVC+LS SGTVTNVT
Sbjct  93   SKNKPKPPIIITRDSANALRSHVMEIATGCDIQESISNFATRRQRGVCILSASGTVTNVT  152

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL 
Sbjct  153  IRQPASP-GAVVTLHGRFEILSLSGSYLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLN  211

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  212  ASGPVVIMAASFGNAAYERLPL  233



>gb|EYU43510.1| hypothetical protein MIMGU_mgv1a017700mg [Erythranthe guttata]
Length=309

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+E+S   DI+DSV S+ARRR RGVCV+SG+G VTNVT
Sbjct  94   SKNKPKPPIIITRDSANALRTHVMEVSDGCDIMDSVASFARRRQRGVCVMSGTGNVTNVT  153

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+V+TLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQV+GG+VVG L+
Sbjct  154  LRQPAAP-GAVMTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVLGGSVVGQLL  212

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV++MAA+F+NA +ERLPL
Sbjct  213  ASGPVIIMAASFSNAAYERLPL  234



>ref|XP_010692273.1| PREDICTED: putative DNA-binding protein ESCAROLA [Beta vulgaris 
subsp. vulgaris]
Length=334

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+E++   DI++S+T++ARRR RGVC+L+G+GTV NVT
Sbjct  116  SKNKPKPPIIITRDSANALRSHVMEVANGCDIMESITNFARRRQRGVCILNGTGTVANVT  175

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP +P G+VVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG VVGPL+
Sbjct  176  LRQPGAP-GAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGGVVGPLL  234

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  235  ASGPVVVMAASFGNAAYERLPL  256



>ref|XP_011014152.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=302

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+H++E++   DI++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  95   SKNKPKPPIIITRDSANALRTHLMEVADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  154

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL 
Sbjct  155  LRQPASP-GAIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGPLT  213

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  214  ASGPVVIMAASFSNAAYERLPL  235



>ref|XP_011029110.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=302

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+H++E++   DI++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  95   SKNKPKPPIIITRDSANALRTHLMEVADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  154

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL 
Sbjct  155  LRQPASP-GAIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGPLT  213

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  214  ASGPVVIMAASFSNAAYERLPL  235



>ref|XP_004298711.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=309

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  96   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  155

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P GSVVTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  156  LRQPATP-GSVVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLL  214

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  215  ASGPVVIMAASFSNAAYERLPL  236



>ref|XP_010108102.1| hypothetical protein L484_023188 [Morus notabilis]
 gb|EXC17834.1| hypothetical protein L484_023188 [Morus notabilis]
Length=302

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++SV+++ARRR RGVC++SG+GTVTNVT
Sbjct  89   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVSTFARRRQRGVCIMSGTGTVTNVT  148

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  149  LRQPASP-GAIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLI  207

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  208  ASGPVVVMAASFSNAAYERLPL  229



>ref|XP_008346594.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=310

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  92   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  151

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP GS+VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L 
Sbjct  152  LRQPASP-GSIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLT  210

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  211  ASGPVVIMAASFSNAAYERLPL  232



>gb|KFK35357.1| hypothetical protein AALP_AA5G274300 [Arabis alpina]
Length=318

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 132/151 (87%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNK KPPIIVTRDSPNALRSHVLE++  ADI++SV++YARRRGRGV VL G+GTV+NVT
Sbjct  101  SKNKAKPPIIVTRDSPNALRSHVLEVTPGADIVESVSTYARRRGRGVSVLGGNGTVSNVT  160

Query  182  LRQPSSP---------AGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvv  334
            LRQP +P          G VVTLHGRFEILSL+GTVLPPPAPPGAGGLSIFL+GGQGQVV
Sbjct  161  LRQPVNPGNGGSSGAGGGGVVTLHGRFEILSLTGTVLPPPAPPGAGGLSIFLAGGQGQVV  220

Query  335  ggtvvgPLMASGPVVLMAATFANAVFERLPL  427
            GG+VV PL+AS PV+LMAA+F+NAVFERLP+
Sbjct  221  GGSVVAPLIASAPVILMAASFSNAVFERLPI  251



>ref|XP_008791267.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=322

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKN+PKPPII+TRDS NALRSHV+EI+   DI +SV+++ARRR RGVC+L GSGTVTNVT
Sbjct  105  SKNRPKPPIIITRDSANALRSHVMEIAGGCDIAESVSTFARRRQRGVCILGGSGTVTNVT  164

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP GSVV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+V+G L+
Sbjct  165  LRQPASP-GSVVALHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVLGALI  223

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NAV+ERLPL
Sbjct  224  ASGPVVIMAASFGNAVYERLPL  245



>ref|XP_002281296.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=302

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  91   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  150

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++VTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  151  LRQPASP-GAIVTLHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGQLL  209

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  210  ASGPVVIMAASFSNAAYERLPL  231



>ref|XP_006289235.1| hypothetical protein CARUB_v10002691mg [Capsella rubella]
 gb|EOA22133.1| hypothetical protein CARUB_v10002691mg [Capsella rubella]
Length=340

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPK PII+TRDS NALR+HV+EI    DI+D + ++ARRR RGVCV+SG+G V NVT
Sbjct  123  SKNKPKAPIIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVNNVT  182

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP SPAGSVV+LHGRFEILSLSG+ LPPPAPP A GLS++L+GGQGQVVGG+VVGPL+
Sbjct  183  IRQPGSPAGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLL  242

Query  362  ASGPVVLMAATFANAVFERLPL  427
             SGPVV+MAA+F+NA +ERLPL
Sbjct  243  CSGPVVVMAASFSNAAYERLPL  264



>ref|XP_008668970.1| PREDICTED: putative DNA-binding protein ESCAROLA [Zea mays]
Length=309

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+I+TR+S N LR+H+LE+++  D+ +SV++YARRR RGVCVLSGSG VTNVT
Sbjct  93   SKNKPKPPVIITRESANTLRAHILEVASGCDVFESVSTYARRRQRGVCVLSGSGVVTNVT  152

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+PAG+VVTLHGRFEILSLSG+ LPPPAPPGA  L+IFL+GGQGQVVGG VVG L 
Sbjct  153  LRQPSAPAGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGNVVGALY  212

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AA+FAN  +ERLPL
Sbjct  213  AAGPVIVIAASFANVAYERLPL  234



>ref|XP_003570419.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=261

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+E++  AD+ D++  ++RRR RGVCVLSG+GTV NV 
Sbjct  56   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAHFSRRRQRGVCVLSGAGTVANVA  115

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+VV LHGRFEILSL+GT LP PAPPG+ GL+++L+GGQGQVVGG+VVG L 
Sbjct  116  LRQPSAPGGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGALT  175

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++A+TFANA +ERLPL
Sbjct  176  AAGPVMVIASTFANATYERLPL  197



>gb|KFK31952.1| hypothetical protein AALP_AA6G181300 [Arabis alpina]
Length=335

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPK PII+TRDS NALR+HV+EI    DI+D + ++ARRR RGVCV+SG+G VTNVT
Sbjct  121  SKNKPKAPIIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVTNVT  180

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP SP GSVV+LHGRFEILSLSG+ LPPPAPP A GLS++L+GGQGQVVGG+VVGPL+
Sbjct  181  IRQPGSPPGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLL  240

Query  362  ASGPVVLMAATFANAVFERLPL  427
             SGPVV+MAA+F+NA +ERLPL
Sbjct  241  CSGPVVVMAASFSNAAYERLPL  262



>ref|XP_008373872.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=310

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  92   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  151

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP GS+VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L 
Sbjct  152  LRQPASP-GSIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLX  210

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  211  ASGPVVIMAASFSNAAYERLPL  232



>ref|XP_008238673.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=309

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  90   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  149

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP+SP GS+VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GG GQVVGG+VVG L+
Sbjct  150  IRQPASP-GSIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGGGQVVGGSVVGTLI  208

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  209  ASGPVVIMAASFSNAAYERLPL  230



>gb|KDO85858.1| hypothetical protein CISIN_1g047830mg [Citrus sinensis]
Length=313

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI+   DI+DSV+++ARRR RG+C+LSG+GTVTNVT
Sbjct  97   SKNKPKPPIIITRDSANALRSHVMEIANGCDIMDSVSNFARRRQRGICILSGTGTVTNVT  156

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  157  LRQPASP-GAVVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLV  215

Query  362  ASGPVVLMAATFANAVFER  418
            ASGPVV+MAA+F NA +ER
Sbjct  216  ASGPVVIMAASFGNAAYER  234



>ref|XP_009386796.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=293

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 130/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNALRSH++E+++ AD+ + V+ Y+RRRGRGV VLSG+G VTNV 
Sbjct  81   SKNKPKPPIIVTRDSPNALRSHMIEVASGADVFECVSEYSRRRGRGVSVLSGTGAVTNVA  140

Query  182  LRQP-SSPAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP +SP GS+V TL GRFEILSL+GTVLPPPAPPGA GLS+FL+GGQGQV+GG+V GP
Sbjct  141  LRQPGASPPGSMVATLRGRFEILSLTGTVLPPPAPPGASGLSVFLAGGQGQVMGGSVGGP  200

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPV+LM A+FANAV+ERLPL
Sbjct  201  LVATGPVMLMVASFANAVYERLPL  224



>ref|XP_009373988.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=305

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EIS  ADI +SV  +ARRR RGVCV+SGSGTVTNVT
Sbjct  86   SKNKPKPPIFVTRDSPNALRSHVMEISNGADIANSVAQFARRRQRGVCVMSGSGTVTNVT  145

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP +P G+V+ LHGRFEILSL+G  LP PAPPG+ G++I+L+GGQGQVVGG+VVGPL+
Sbjct  146  LRQPFAP-GAVMALHGRFEILSLTGAFLPGPAPPGSTGMTIYLAGGQGQVVGGSVVGPLV  204

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATF NA +ERLPL
Sbjct  205  ASGPVMVIAATFTNATYERLPL  226



>ref|NP_192942.1| putative AT-hook DNA-binding family protein [Arabidopsis thaliana]
 emb|CAB40946.1| putative DNA-binding protein [Arabidopsis thaliana]
 emb|CAB78248.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAP88365.1| At4g12050 [Arabidopsis thaliana]
 dbj|BAF00128.1| putative DNA-binding protein [Arabidopsis thaliana]
 tpd|FAA00297.1| TPA: AT-hook motif nuclear localized protein 26 [Arabidopsis 
thaliana]
 dbj|BAH30517.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83091.1| putative AT-hook DNA-binding family protein [Arabidopsis thaliana]
Length=339

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPK PII+TRDS NALR+HV+EI    DI+D + ++ARRR RGVCV+SG+G+VTNVT
Sbjct  127  SKNKPKAPIIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVCVMSGTGSVTNVT  186

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP SP GSVV+LHGRFEILSLSG+ LPPPAPP A GLS++L+GGQGQVVGG+VVGPL+
Sbjct  187  IRQPGSPPGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLL  246

Query  362  ASGPVVLMAATFANAVFERLPL  427
             SGPVV+MAA+F+NA +ERLPL
Sbjct  247  CSGPVVVMAASFSNAAYERLPL  268



>ref|XP_011093194.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=297

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+E++   DI +SV+++A RR RGVC+LSGSGTVTNVT
Sbjct  94   SKNKPKPPIIITRDSANALRSHVMEVANGCDIQESVSNFATRRQRGVCILSGSGTVTNVT  153

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+V+TLHGRFEILSLSG+ LPPPAPP A  L+I+L+G QGQVVGGTVVGPL+
Sbjct  154  LRQPAAP-GAVLTLHGRFEILSLSGSFLPPPAPPAASSLTIYLAGAQGQVVGGTVVGPLL  212

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV++MAA+F NA +ERLPL
Sbjct  213  ASGPVMIMAASFGNAAYERLPL  234



>gb|KFK42071.1| hypothetical protein AALP_AA2G207300 [Arabis alpina]
Length=314

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 131/155 (85%), Gaps = 13/155 (8%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+IVTRDSPN LRSHVLE++  ADI++SVT+YARRRGRGV VLSG+GTV+NV 
Sbjct  82   SKNKPKPPVIVTRDSPNVLRSHVLEVATGADIVESVTTYARRRGRGVSVLSGNGTVSNVA  141

Query  182  LRQPS-------------SPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggq  322
            LRQP+                G VVTLHGRF+ILSL+GTVLPPPAPPG+GGLSIF+SGGQ
Sbjct  142  LRQPAMTGTNNGGAGAGGGSGGGVVTLHGRFDILSLTGTVLPPPAPPGSGGLSIFVSGGQ  201

Query  323  gqvvggtvvgPLMASGPVVLMAATFANAVFERLPL  427
            GQV+GG+VV PL+ASGPV+LMAA+F+NA FERLPL
Sbjct  202  GQVIGGSVVPPLVASGPVILMAASFSNATFERLPL  236



>ref|XP_010053390.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW77667.1| hypothetical protein EUGRSUZ_D01968 [Eucalyptus grandis]
Length=303

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++SV ++ARRR RGVC++SGSGTVTNVT
Sbjct  91   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCIMSGSGTVTNVT  150

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  151  LRQPASP-GAIVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLI  209

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  210  ASGPVVIMAASFSNAAYERLPL  231



>gb|KCW61537.1| hypothetical protein EUGRSUZ_H04257, partial [Eucalyptus grandis]
Length=272

 Score =   172 bits (435),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EI+  ADI +SV  +ARRR RGVCVLSGSGTVTNVT
Sbjct  73   SKNKPKPPIFVTRDSPNALRSHVMEIANGADIAESVAQFARRRQRGVCVLSGSGTVTNVT  132

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+V+ LHGRFEILSL+G  LP PAPPG+ GL+I+L+GGQGQVVGG+VVG L+
Sbjct  133  LRQPTAP-GAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSLV  191

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATF+NA +ERLPL
Sbjct  192  ASGPVMVIAATFSNATYERLPL  213



>tpg|DAA36260.1| TPA: hypothetical protein ZEAMMB73_652841 [Zea mays]
Length=347

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+I+TR+S N LR+H+LE+++  D+ +SV++YARRR RGVCVLSGSG VTNVT
Sbjct  93   SKNKPKPPVIITRESANTLRAHILEVASGCDVFESVSTYARRRQRGVCVLSGSGVVTNVT  152

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+PAG+VVTLHGRFEILSLSG+ LPPPAPPGA  L+IFL+GGQGQVVGG VVG L 
Sbjct  153  LRQPSAPAGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGNVVGALY  212

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AA+FAN  +ERLPL
Sbjct  213  AAGPVIVIAASFANVAYERLPL  234



>gb|KDO68430.1| hypothetical protein CISIN_1g042221mg [Citrus sinensis]
Length=305

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 133/153 (87%), Gaps = 11/153 (7%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            S+NKPKPPIIVTRD+PNALRSHVLEIS+ ADI+DSV++YARRRGRGVC+LSG+G VTNVT
Sbjct  70   SRNKPKPPIIVTRDTPNALRSHVLEISSGADIVDSVSTYARRRGRGVCILSGAGAVTNVT  129

Query  182  LRQPSSPAGSV-----------VTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgq  328
            LRQP + AG             +TLHGRFEILSL+GT LPPPAPPGAGGL+I+L+GGQGQ
Sbjct  130  LRQPPAGAGGSSSASIAGGAVNITLHGRFEILSLTGTSLPPPAPPGAGGLTIYLAGGQGQ  189

Query  329  vvggtvvgPLMASGPVVLMAATFANAVFERLPL  427
            VVGG+VVGPL ASG VVLMAA+FANAV++RLPL
Sbjct  190  VVGGSVVGPLTASGTVVLMAASFANAVYDRLPL  222



>ref|XP_004511639.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Cicer arietinum]
Length=241

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NAL++HV+E++   DI++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  28   SKNKPKPPIIITRDSANALKTHVMEVADGCDIVESVNNFARRRQRGVCIMSGTGTVTNVT  87

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  88   LRQPASP-GAVVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALI  146

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+M+A+F+NA +ERLPL
Sbjct  147  ASGPVVIMSASFSNAAYERLPL  168



>ref|XP_006486838.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
Length=315

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 133/153 (87%), Gaps = 11/153 (7%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            S+NKPKPPIIVTRD+PNALRSHVLEIS+ ADI+DSV++YARRRGRGVC+LSG+G VTNVT
Sbjct  70   SRNKPKPPIIVTRDTPNALRSHVLEISSGADIVDSVSTYARRRGRGVCILSGAGAVTNVT  129

Query  182  LRQPSSPAGSV-----------VTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgq  328
            LRQP + AG             +TLHGRFEILSL+GT LPPPAPPGAGGL+I+L+GGQGQ
Sbjct  130  LRQPPAGAGGSSSASIAGGAVNITLHGRFEILSLTGTSLPPPAPPGAGGLTIYLAGGQGQ  189

Query  329  vvggtvvgPLMASGPVVLMAATFANAVFERLPL  427
            VVGG+VVGPL ASG VVLMAA+FANAV++RLPL
Sbjct  190  VVGGSVVGPLTASGTVVLMAASFANAVYDRLPL  222



>gb|AFW63603.1| hypothetical protein ZEAMMB73_729481 [Zea mays]
Length=434

 Score =   176 bits (445),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 129/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPNAL SHVLE++A AD++D V  +ARRRGRGVCVLSG G V NV 
Sbjct  211  SKNKPKPPIIVTRDSPNALHSHVLEVAAGADVVDCVAEFARRRGRGVCVLSGGGAVANVA  270

Query  182  LRQP-SSPAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP +SP GS+V TL GR EILSL+GTVLPPPAPPGA GL++FLSGGQGQVVGG+VVGP
Sbjct  271  LRQPGASPPGSMVATLRGRLEILSLTGTVLPPPAPPGASGLTVFLSGGQGQVVGGSVVGP  330

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPVVLMAA+FANAV+ERLPL
Sbjct  331  LVAAGPVVLMAASFANAVYERLPL  354



>ref|XP_010934543.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=319

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI++  DI DSV ++AR R RGVC+L GSGTVTNVT
Sbjct  108  SKNKPKPPIIITRDSANALRSHVMEIASGCDIADSVATFARHRQRGVCILGGSGTVTNVT  167

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P GSVV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  168  LRQPATP-GSVVALHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALI  226

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NAV+ERLPL
Sbjct  227  ASGPVVIMAASFGNAVYERLPL  248



>ref|XP_006396802.1| hypothetical protein EUTSA_v10029174mg [Eutrema salsugineum]
 gb|ESQ38255.1| hypothetical protein EUTSA_v10029174mg [Eutrema salsugineum]
Length=342

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPK PII+TRDS NALR+HV+EI    DI+D + ++ARRR RGVCV+SG+G VTNVT
Sbjct  121  SKNKPKAPIIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVTNVT  180

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP SP GSVV+LHGRFEILSLSG+ LPPPAPP A GLS++L+GGQGQVVGG+VVGPL+
Sbjct  181  IRQPGSPPGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLL  240

Query  362  ASGPVVLMAATFANAVFERLPL  427
             SGPVV+MAA+F+NA +ERLPL
Sbjct  241  CSGPVVVMAASFSNAAYERLPL  262



>ref|XP_010024974.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
Length=282

 Score =   172 bits (435),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EI+  ADI +SV  +ARRR RGVCVLSGSGTVTNVT
Sbjct  73   SKNKPKPPIFVTRDSPNALRSHVMEIANGADIAESVAQFARRRQRGVCVLSGSGTVTNVT  132

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+V+ LHGRFEILSL+G  LP PAPPG+ GL+I+L+GGQGQVVGG+VVG L+
Sbjct  133  LRQPTAP-GAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSLV  191

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATF+NA +ERLPL
Sbjct  192  ASGPVMVIAATFSNATYERLPL  213



>emb|CDX98771.1| BnaA03g45560D [Brassica napus]
Length=317

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI    D++DSV ++ARRR RGVCV+SG+G VTNVT
Sbjct  102  SKNKPKPPIIITRDSANALRTHVMEIGDGCDLVDSVATFARRRQRGVCVMSGTGNVTNVT  161

Query  182  LRQPSSPA-GSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPL  358
            +RQP SP+ GSVV+LHGRFEILSLSG+ LPPPAPP A GLS++L+GGQGQVVGG+VVGPL
Sbjct  162  IRQPGSPSPGSVVSLHGRFEILSLSGSFLPPPAPPNATGLSVYLAGGQGQVVGGSVVGPL  221

Query  359  MASGPVVLMAATFANAVFERLPL  427
            + +GPVV+MAA+F+NA +ERLPL
Sbjct  222  LCAGPVVVMAASFSNAAYERLPL  244



>ref|XP_002874744.1| hypothetical protein ARALYDRAFT_490024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51003.1| hypothetical protein ARALYDRAFT_490024 [Arabidopsis lyrata subsp. 
lyrata]
Length=331

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPK PII+TRDS NALR+HV+EI    DI+D + ++ARRR RGVCV+SG+G VTNVT
Sbjct  119  SKNKPKAPIIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVTNVT  178

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP SP GSVV+LHGRFEILSLSG+ LPPPAPP A GLS++L+GGQGQVVGG+VVGPL+
Sbjct  179  IRQPGSPPGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLL  238

Query  362  ASGPVVLMAATFANAVFERLPL  427
             SGPVV+MAA+F+NA +ERLPL
Sbjct  239  CSGPVVVMAASFSNAAYERLPL  260



>ref|XP_006440441.1| hypothetical protein CICLE_v10021296mg [Citrus clementina]
 gb|ESR53681.1| hypothetical protein CICLE_v10021296mg [Citrus clementina]
Length=308

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++SV ++ARRR RGVC+LSG+GTVTNVT
Sbjct  93   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCILSGTGTVTNVT  152

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++V+LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG LM
Sbjct  153  LRQPASP-GAIVSLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLM  211

Query  362  ASGPVVLMAATFANAVFERLPL  427
             SGPVV+MAA+F+NA +ERLPL
Sbjct  212  TSGPVVIMAASFSNAAYERLPL  233



>emb|CDY18931.1| BnaC04g04190D [Brassica napus]
Length=309

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDS NAL+SHV+E++   D+++SVT +ARRR RGVCVLSG+G VTNVT
Sbjct  90   SKNKPKPPIIVTRDSANALKSHVMEVANGCDVMESVTVFARRRQRGVCVLSGNGAVTNVT  149

Query  182  LRQPSS-PAG--SVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvg  352
            +RQP+S P G  SVV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG
Sbjct  150  IRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVG  209

Query  353  PLMASGPVVLMAATFANAVFERLPL  427
            PLMASGPVV+MAA+F NA +ERLPL
Sbjct  210  PLMASGPVVIMAASFGNAAYERLPL  234



>emb|CDX94128.1| BnaC07g37620D [Brassica napus]
Length=327

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI    D++DSV ++ARRR RGVCV+SG+G VTNVT
Sbjct  112  SKNKPKPPIIITRDSANALRTHVMEIGDGCDLVDSVATFARRRQRGVCVMSGTGNVTNVT  171

Query  182  LRQPSSPA-GSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPL  358
            +RQP SP+ GSVV+LHGRFEILSLSG+ LPPPAPP A GLS++L+GGQGQVVGG+VVGPL
Sbjct  172  IRQPGSPSPGSVVSLHGRFEILSLSGSFLPPPAPPNATGLSVYLAGGQGQVVGGSVVGPL  231

Query  359  MASGPVVLMAATFANAVFERLPL  427
            + +GPVV+MAA+F+NA +ERLPL
Sbjct  232  LCAGPVVVMAASFSNAAYERLPL  254



>ref|XP_009763803.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
sylvestris]
Length=291

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI+DS++++ARRR RGVC++SG+G VTNV 
Sbjct  84   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMDSISNFARRRQRGVCIMSGTGIVTNVN  143

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG LM
Sbjct  144  LRQPASP-GAIVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALM  202

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  203  ASGPVVIMAASFSNAAYERLPL  224



>ref|XP_006477312.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|KDO63720.1| hypothetical protein CISIN_1g021751mg [Citrus sinensis]
Length=308

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++SV ++ARRR RGVC+LSG+GTVTNVT
Sbjct  93   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCILSGTGTVTNVT  152

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++V+LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG LM
Sbjct  153  LRQPASP-GAIVSLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLM  211

Query  362  ASGPVVLMAATFANAVFERLPL  427
             SGPVV+MAA+F+NA +ERLPL
Sbjct  212  TSGPVVIMAASFSNAAYERLPL  233



>ref|XP_006655164.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Oryza 
brachyantha]
Length=303

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +2

Query  5    KNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVTL  184
            KNKPKPPII+TR+SPNALRSHVLEI+  ADI+++VT++ARRR RGV VLSGSG V NVTL
Sbjct  98   KNKPKPPIIITRESPNALRSHVLEIAGGADIMEAVTTFARRRQRGVSVLSGSGVVANVTL  157

Query  185  RQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLMA  364
            RQP++P G+V TLHGRFEILSLSG  LP P PPGA GL+++L+GGQGQVVGGTVVG L+A
Sbjct  158  RQPAAPPGAVATLHGRFEILSLSGAFLPSPCPPGATGLAVYLAGGQGQVVGGTVVGELLA  217

Query  365  SGPVVLMAATFANAVFERLPL  427
            SGPV+++AATF+NA +ERLPL
Sbjct  218  SGPVMVIAATFSNATYERLPL  238



>ref|XP_006827517.1| hypothetical protein AMTR_s00009p00189120 [Amborella trichopoda]
 gb|ERM94933.1| hypothetical protein AMTR_s00009p00189120 [Amborella trichopoda]
Length=262

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDSPNALRSHV+E+++ +D+ +SV ++ARRR RGVCVLSGSG V NVT
Sbjct  90   SKNKPKPPIIITRDSPNALRSHVMEVASGSDVAESVAAFARRRQRGVCVLSGSGVVANVT  149

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G++VTLHGRFEILSLSG  LP PAPPGA GL+++L+GGQGQVVGG VVG L+
Sbjct  150  LRQPAAP-GAIVTLHGRFEILSLSGAFLPGPAPPGATGLTVYLAGGQGQVVGGCVVGALV  208

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATFANA +ERLPL
Sbjct  209  ASGPVMVVAATFANATYERLPL  230



>ref|XP_009763802.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
sylvestris]
Length=294

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI+DS++++ARRR RGVC++SG+G VTNV 
Sbjct  87   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMDSISNFARRRQRGVCIMSGTGIVTNVN  146

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG LM
Sbjct  147  LRQPASP-GAIVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALM  205

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  206  ASGPVVIMAASFSNAAYERLPL  227



>ref|XP_004302076.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=306

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EI+  ADI +SV  +AR R RGVCV+SGSGTVTNVT
Sbjct  93   SKNKPKPPIFVTRDSPNALRSHVMEIANGADIAESVAQFARARQRGVCVMSGSGTVTNVT  152

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+V+ LHGRFEILSL+G  LP PAPPGA G++I+L+GGQGQVVGG+VVGPL+
Sbjct  153  LRQPSAP-GAVMALHGRFEILSLTGAFLPGPAPPGATGMTIYLAGGQGQVVGGSVVGPLV  211

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATF+NA +ERLPL
Sbjct  212  ASGPVMVIAATFSNATYERLPL  233



>ref|XP_009379269.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=320

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 124/139 (89%), Gaps = 1/139 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNK KPPII+TRDS NALRSHV+E++   DI++SV+++ARRR RGVC+LSGSGTVTNVT
Sbjct  100  SKNKAKPPIIITRDSANALRSHVMEVANGCDIMESVSTFARRRQRGVCILSGSGTVTNVT  159

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSLSG+ LPPPAPP A  L+I+L+GGQGQ VGG VVGPL+
Sbjct  160  LRQPASP-GAVVTLHGRFEILSLSGSFLPPPAPPAASCLTIYLAGGQGQGVGGGVVGPLL  218

Query  362  ASGPVVLMAATFANAVFER  418
            ASGPVV+MAA+F NA +ER
Sbjct  219  ASGPVVIMAASFGNAAYER  237



>gb|KFK37336.1| hypothetical protein AALP_AA4G243300 [Arabis alpina]
Length=314

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NAL+SHV+E++   D+++SVT +ARRR RGVCVLSG+G VTNVT
Sbjct  95   SKNKPKPPIIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRGVCVLSGNGAVTNVT  154

Query  182  LRQPSS-PAG--SVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvg  352
            +RQP+S P G  SVV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG
Sbjct  155  IRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVG  214

Query  353  PLMASGPVVLMAATFANAVFERLPL  427
            PLMASGPVV+MAA+F NA +ERLPL
Sbjct  215  PLMASGPVVIMAASFGNAAYERLPL  239



>ref|XP_006846339.1| hypothetical protein AMTR_s00012p00257450 [Amborella trichopoda]
 gb|ERN08014.1| hypothetical protein AMTR_s00012p00257450 [Amborella trichopoda]
Length=284

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 126/141 (89%), Gaps = 1/141 (1%)
 Frame = +2

Query  5    KNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVTL  184
            KNKPKPPII+TR+SPNALRSHVLE++  AD+ +SV ++ARRR RGVCVLSGSG V NVTL
Sbjct  80   KNKPKPPIIITRESPNALRSHVLEVAGGADVAESVAAFARRRQRGVCVLSGSGVVANVTL  139

Query  185  RQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLMA  364
            RQP++P G+VVTLHGRFEILSLSG  LP P+PP A GL+++L+GGQGQVVGG+VVG L+A
Sbjct  140  RQPAAP-GAVVTLHGRFEILSLSGAFLPAPSPPAATGLTVYLAGGQGQVVGGSVVGALVA  198

Query  365  SGPVVLMAATFANAVFERLPL  427
            SGPV+++AATF+NA +ERLPL
Sbjct  199  SGPVMVIAATFSNATYERLPL  219



>ref|XP_010537244.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=292

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 133/148 (90%), Gaps = 6/148 (4%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+IVTRDSPNALRSHVLE+SA ADI++SV++YARRRGRGV +L G+GTV+NVT
Sbjct  83   SKNKPKPPVIVTRDSPNALRSHVLEVSAGADIVESVSTYARRRGRGVSILGGNGTVSNVT  142

Query  182  LRQP------SSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggt  343
            +RQP       +  G VVTLHGRFEILSL GTVLPPPAPPGAGGLSIFL+GGQGQVVGGT
Sbjct  143  IRQPTAATGGGAGGGGVVTLHGRFEILSLMGTVLPPPAPPGAGGLSIFLAGGQGQVVGGT  202

Query  344  vvgPLMASGPVVLMAATFANAVFERLPL  427
            VV PL+ASGPV+LMAA+F+NAVFERLP+
Sbjct  203  VVAPLVASGPVILMAASFSNAVFERLPI  230



>ref|XP_009137280.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=327

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI    D++DSV ++ARRR RGVCV+SG+G VTNVT
Sbjct  112  SKNKPKPPIIITRDSANALRTHVMEIGDGCDLVDSVATFARRRQRGVCVMSGTGNVTNVT  171

Query  182  LRQPSSPA-GSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPL  358
            +RQP SP+ GSVV+LHGRFEILSLSG+ LPPPAPP A GLS++L+GGQGQVVGG+VVGPL
Sbjct  172  IRQPGSPSPGSVVSLHGRFEILSLSGSFLPPPAPPNATGLSVYLAGGQGQVVGGSVVGPL  231

Query  359  MASGPVVLMAATFANAVFERLPL  427
            + +GPVV+MAA+F+NA +ERLPL
Sbjct  232  LCAGPVVVMAASFSNAAYERLPL  254



>ref|XP_010940981.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=317

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI+   DI +SV ++ARRR RGVC+LSGSGTVTNVT
Sbjct  106  SKNKPKPPIIITRDSANALRSHVMEIAGGCDIAESVATFARRRQRGVCILSGSGTVTNVT  165

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHG FEILSLSG+ LPPPAPP A GL+++L+GGQGQVVGG+VVG L+
Sbjct  166  LRQPASP-GAVVTLHGCFEILSLSGSFLPPPAPPAATGLTVYLAGGQGQVVGGSVVGALI  224

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  225  ASGPVVIMAASFSNAAYERLPL  246



>ref|XP_008803114.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=318

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +2

Query  5    KNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVTL  184
            KNKPKPP+I+TR+SPNALRSHVLEI++  DI+D++  +ARRR RG+ +LSGSG VTNVTL
Sbjct  94   KNKPKPPVIITRESPNALRSHVLEIASGTDIMDAIAVFARRRQRGMSILSGSGVVTNVTL  153

Query  185  RQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLMA  364
            RQP++P G+VVTLHGRFEILSLSG  LP P+ PGA GL+++L+G QGQ+VGG+VVG L+A
Sbjct  154  RQPAAPPGAVVTLHGRFEILSLSGAFLPAPSLPGASGLTVYLAGRQGQMVGGSVVGELVA  213

Query  365  SGPVVLMAATFANAVFERLPL  427
            SGPV+++AATFANA++ERLPL
Sbjct  214  SGPVMVIAATFANAIYERLPL  234



>ref|XP_009420562.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=294

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 129/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDSPN+L SHVLE+   +D+++ VT YARRRGRGV VLSGSG V NV 
Sbjct  81   SKNKPKPPIIVTRDSPNSLHSHVLEVVGGSDVVECVTDYARRRGRGVSVLSGSGAVVNVA  140

Query  182  LRQPSS-PAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            +RQP + P GSVV TL GRFEILSL+GTVLPPPAPPGAGGL+IFLSGGQGQV+GG+VVGP
Sbjct  141  IRQPGALPPGSVVATLRGRFEILSLTGTVLPPPAPPGAGGLTIFLSGGQGQVIGGSVVGP  200

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPVVLMAA+FANA++ERLPL
Sbjct  201  LVAAGPVVLMAASFANAMYERLPL  224



>emb|CDP17786.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+EI++  DI +SV+++A RR RGVC+LSG+GTV NVT
Sbjct  99   SKNKPKPPIIITRDSANALRSHVMEIASGCDIQESVSNFATRRQRGVCILSGNGTVNNVT  158

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+VVTLHGRFEILSLSG+ LPPPAP  A GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  159  LRQPAAP-GAVVTLHGRFEILSLSGSFLPPPAPAAASGLTIYLAGGQGQVVGGSVVGPLL  217

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPVV+MAA+F NA +ERLPL
Sbjct  218  AAGPVVIMAASFGNAAYERLPL  239



>emb|CDY20404.1| BnaC02g24120D [Brassica napus]
Length=271

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 125/142 (88%), Gaps = 6/142 (4%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+IVTRDSPN LRSHVLE+S+ ADI++SV +YARRRGRGV VLSG+GTV NV 
Sbjct  78   SKNKPKPPVIVTRDSPNVLRSHVLEVSSGADIVESVNTYARRRGRGVSVLSGNGTVANVV  137

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            L       G VVTLHG+F+ILS++GTVLPPPAPPG+GGLSIFLSGGQGQV+GG VV PL+
Sbjct  138  L------LGGVVTLHGKFDILSITGTVLPPPAPPGSGGLSIFLSGGQGQVIGGNVVAPLV  191

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+LMAA+F+NA FERLPL
Sbjct  192  ASGPVILMAASFSNATFERLPL  213



>ref|XP_010538771.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=307

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+E++   DI++S++ +ARRR RGVCV+SG+G VTNVT
Sbjct  104  SKNKPKPPIIITRDSANALRTHVMEVADGCDIVESMSVFARRRQRGVCVMSGTGNVTNVT  163

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP SP GSVV+LHGRFEILSLSG+ LPPPAPP A GLS++LSGGQGQVVGG+VVGPL+
Sbjct  164  IRQPGSPPGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLSGGQGQVVGGSVVGPLV  223

Query  362  ASGPVVLMAATFANAVFERLPL  427
             +GPVV+MAA+F+NA +ERLP+
Sbjct  224  CAGPVVVMAASFSNAAYERLPM  245



>ref|NP_173514.1| putative DNA-binding protein ESCAROLA [Arabidopsis thaliana]
 sp|Q9S7C9.1|ESCA_ARATH RecName: Full=Putative DNA-binding protein ESCAROLA [Arabidopsis 
thaliana]
 gb|AAD30602.1|AC007369_12 Unknown protein [Arabidopsis thaliana]
 gb|AAF07197.1|AF194974_1 ESCAROLA [Arabidopsis thaliana]
 gb|AAP21268.1| At1g20900 [Arabidopsis thaliana]
 dbj|BAF00240.1| putative DNA-binding protein [Arabidopsis thaliana]
 tpd|FAA00298.1| TPA: AT-hook motif nuclear localized protein 27 [Arabidopsis 
thaliana]
 dbj|BAH30307.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30038.1| putative DNA-binding protein ESCAROLA [Arabidopsis thaliana]
Length=311

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNK KPPIIVTRDSPNALRSHVLE+S  ADI++SV++YARRRGRGV VL G+GTV+NVT
Sbjct  95   SKNKAKPPIIVTRDSPNALRSHVLEVSPGADIVESVSTYARRRGRGVSVLGGNGTVSNVT  154

Query  182  LRQPSSP--------AGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvg  337
            LRQP +P         G VVTLHGRFEILSL+GTVLPPPAPPGAGGLSIFL+GGQGQVVG
Sbjct  155  LRQPVTPGNGGGVSGGGGVVTLHGRFEILSLTGTVLPPPAPPGAGGLSIFLAGGQGQVVG  214

Query  338  gtvvgPLMASGPVVLMAATFANAVFERLPL  427
            G+VV PL+AS PV+LMAA+F+NAVFERLP+
Sbjct  215  GSVVAPLIASAPVILMAASFSNAVFERLPI  244



>ref|XP_006422381.1| hypothetical protein CICLE_v10028897mg [Citrus clementina]
 gb|ESR35621.1| hypothetical protein CICLE_v10028897mg [Citrus clementina]
Length=308

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 132/153 (86%), Gaps = 11/153 (7%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNK KPPIIVTRD+PNALRSHVLEIS+ ADI+DSV++YARRRGRGVC+LSG+G VTNVT
Sbjct  70   SKNKQKPPIIVTRDTPNALRSHVLEISSGADIVDSVSTYARRRGRGVCILSGTGAVTNVT  129

Query  182  LRQPSSPAGSV-----------VTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgq  328
            LRQP + AG             +TLHGRFEILSL+GT LPPPAPPGAGGL+I+L+GGQGQ
Sbjct  130  LRQPPAGAGGSSSASSAGGAVNITLHGRFEILSLTGTSLPPPAPPGAGGLTIYLAGGQGQ  189

Query  329  vvggtvvgPLMASGPVVLMAATFANAVFERLPL  427
            VVGG+VVGPL ASG VVLMAA+FANAV++RLPL
Sbjct  190  VVGGSVVGPLTASGTVVLMAASFANAVYDRLPL  222



>emb|CDP09863.1| unnamed protein product [Coffea canephora]
Length=291

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  87   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMESVANFARRRQRGVCIMSGTGTVTNVT  146

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSL+G+ LPPPAPP A  L+I+L+GGQGQVVGG+VVG LM
Sbjct  147  LRQPASP-GAVVTLHGRFEILSLAGSFLPPPAPPAATTLTIYLAGGQGQVVGGSVVGALM  205

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  206  ASGPVVIMAASFSNAAYERLPL  227



>ref|XP_002890414.1| hypothetical protein ARALYDRAFT_472326 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66673.1| hypothetical protein ARALYDRAFT_472326 [Arabidopsis lyrata subsp. 
lyrata]
Length=314

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNK KPPIIVTRDSPNALRSHVLE+S  ADI++SV++YARRRGRGV VL G+GTV+NVT
Sbjct  98   SKNKAKPPIIVTRDSPNALRSHVLEVSPGADIVESVSTYARRRGRGVSVLGGNGTVSNVT  157

Query  182  LRQPSSP--------AGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvg  337
            LRQP +P         G VVTLHGRFEILSL+GTVLPPPAPPGAGGLSIFL+GGQGQVVG
Sbjct  158  LRQPVNPGNGGGVSGGGGVVTLHGRFEILSLTGTVLPPPAPPGAGGLSIFLAGGQGQVVG  217

Query  338  gtvvgPLMASGPVVLMAATFANAVFERLPL  427
            G+VV PL+AS PV+LMAA+F+NAVFERLP+
Sbjct  218  GSVVAPLIASAPVILMAASFSNAVFERLPI  247



>gb|AES80473.2| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=269

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+I+TR+S N LR+H+LE+S+  D+ DSV +YAR+R RG+CVLSGSGTVTNVT
Sbjct  66   SKNKPKPPVIITRESANTLRAHILEVSSGCDVFDSVATYARKRQRGICVLSGSGTVTNVT  125

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++ AGSVVTLHGRFEILSLSG+ LPPPAPPGA  LS+FL GGQGQVVGG VVGPL+
Sbjct  126  LRQPAA-AGSVVTLHGRFEILSLSGSFLPPPAPPGATSLSVFLGGGQGQVVGGNVVGPLV  184

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++A++F N  +ERLPL
Sbjct  185  ASGPVIVIASSFTNVAYERLPL  206



>ref|XP_010262897.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=360

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TR+SPNALRSHVLEIS+ +D+++S+ ++ARRR RGVCVLSGSG VTNVT
Sbjct  152  SKNKPKPPIIITRESPNALRSHVLEISSGSDVVESIATFARRRQRGVCVLSGSGVVTNVT  211

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++ +G+V+TLHGRFEILSLSG  LP P+PPGA GL+++L+GGQGQVVGG+VVG LM
Sbjct  212  LRQPAA-SGAVITLHGRFEILSLSGAFLPAPSPPGASGLTVYLAGGQGQVVGGSVVGALM  270

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATFANA +ERLP+
Sbjct  271  ASGPVMVIAATFANATYERLPI  292



>gb|AFK38460.1| unknown [Medicago truncatula]
Length=269

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+I+TR+S N LR+H+LE+S+  D+ DSV +YAR+R RG+CVLSGSGTVTNVT
Sbjct  66   SKNKPKPPVIITRESANTLRAHILEVSSGCDVFDSVATYARKRQRGICVLSGSGTVTNVT  125

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++ AGSVVTLHGRFEILSLSG+ LPPPAPPGA  LS+FL GGQGQVVGG VVGPL+
Sbjct  126  LRQPAA-AGSVVTLHGRFEILSLSGSFLPPPAPPGATSLSVFLGGGQGQVVGGNVVGPLV  184

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++A++F N  +ERLPL
Sbjct  185  ASGPVIVIASSFTNVAYERLPL  206



>ref|XP_008804006.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=314

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+T+DS NALRSHV+EI+A  DI ++V ++ARRR RGVC+LSGSGTVTNVT
Sbjct  104  SKNKPKPPIIITKDSANALRSHVMEIAAGCDIAETVATFARRRQRGVCILSGSGTVTNVT  163

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHG FEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  164  LRQPASP-GAVVTLHGCFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALI  222

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  223  ASGPVVIMAASFSNAAYERLPL  244



>emb|CBI35166.3| unnamed protein product [Vitis vinifera]
Length=275

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+E++  +DI +S+  +ARRR RGVCVLS SGTV NVT
Sbjct  76   SKNKPKPPIFVTRDSPNALRSHVMEVANGSDITESIAQFARRRQRGVCVLSASGTVMNVT  135

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+V+ LHGRFEILSL+G  LP PAPPG+ GL+I+L+GGQ QVVGG+VVG L+
Sbjct  136  LRQPSAPGGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQAQVVGGSVVGSLI  195

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATF+NA +ERLPL
Sbjct  196  AAGPVMVIAATFSNATYERLPL  217



>ref|XP_007145832.1| hypothetical protein PHAVU_007G271800g [Phaseolus vulgaris]
 gb|ESW17826.1| hypothetical protein PHAVU_007G271800g [Phaseolus vulgaris]
Length=268

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPN+LRSHV+E++  AD+ +SV  +ARRR RGVCVLSGSG+V NVT
Sbjct  47   SKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  106

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+VV LHGRFEILSL+G  LP PAPPGA GL+++L+GGQGQVVGG+VVGPL+
Sbjct  107  LRQPAAP-GAVVALHGRFEILSLTGAFLPGPAPPGATGLTVYLAGGQGQVVGGSVVGPLV  165

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATFANA +ERLPL
Sbjct  166  AAGPVMIIAATFANATYERLPL  187



>ref|XP_006413619.1| hypothetical protein EUTSA_v10025672mg [Eutrema salsugineum]
 gb|ESQ55072.1| hypothetical protein EUTSA_v10025672mg [Eutrema salsugineum]
Length=333

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI    D+++SV ++ARRR RGVCV+SG+G VTNVT
Sbjct  121  SKNKPKPPIIITRDSANALRTHVMEIGDGCDLVESVATFARRRQRGVCVMSGTGNVTNVT  180

Query  182  LRQPSSPA-GSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPL  358
            +RQP SP+ GSVV+LHGRFEILSLSG+ LPPPAPP A GLS++L+GGQGQVVGG+VVGPL
Sbjct  181  IRQPGSPSPGSVVSLHGRFEILSLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPL  240

Query  359  MASGPVVLMAATFANAVFERLPL  427
            + +GPVV+MAA+F+NA +ERLPL
Sbjct  241  LCAGPVVVMAASFSNAAYERLPL  263



>ref|XP_008663461.1| PREDICTED: putative DNA-binding protein ESCAROLA [Zea mays]
 gb|AFW59108.1| hypothetical protein ZEAMMB73_282218 [Zea mays]
Length=310

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+I+TR+S N LR+H+LE+++  D+ +SV++YARRR RGVCVLSGSG VTNVT
Sbjct  93   SKNKPKPPVIITRESANTLRAHILEVASGCDVFESVSTYARRRQRGVCVLSGSGEVTNVT  152

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+VVTLHGRFEILSLSG+ LPPPAPPGA  L+IFL+GGQGQVVGG VVG L 
Sbjct  153  LRQPSAPTGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGNVVGALY  212

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AA+FAN  +ERLPL
Sbjct  213  AAGPVIVIAASFANVAYERLPL  234



>emb|CAN61523.1| hypothetical protein VITISV_016751 [Vitis vinifera]
Length=259

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+E++  +DI +S+  +ARRR RGVCVLS SGTV NVT
Sbjct  44   SKNKPKPPIFVTRDSPNALRSHVMEVANGSDITESIAQFARRRQRGVCVLSASGTVMNVT  103

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+V+ LHGRFEILSL+G  LP PAPPG+ GL+I+L+GGQ QVVGG+VVG L+
Sbjct  104  LRQPSAPGGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQAQVVGGSVVGSLI  163

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATF+NA +ERLPL
Sbjct  164  AAGPVMVIAATFSNATYERLPL  185



>ref|XP_002448423.1| hypothetical protein SORBIDRAFT_06g026940 [Sorghum bicolor]
 gb|EES12751.1| hypothetical protein SORBIDRAFT_06g026940 [Sorghum bicolor]
Length=312

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+I+TR+S N LR+H+LE+ +  D+ +SV++YARRR RGVCVLSGSG VTNVT
Sbjct  96   SKNKPKPPVIITRESANTLRAHILEVGSGCDVFESVSTYARRRQRGVCVLSGSGVVTNVT  155

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+VVTLHGRFEILSLSG+ LPPPAPPGA  L+IFL+GGQGQVVGG VVG L 
Sbjct  156  LRQPSAPTGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGNVVGALY  215

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AA+FAN  +ERLPL
Sbjct  216  AAGPVIVIAASFANVAYERLPL  237



>ref|XP_006589299.1| PREDICTED: putative DNA-binding protein ESCAROLA-like, partial 
[Glycine max]
Length=316

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EI+  AD+ +SV  +ARRR RGVCVLSGSG+V NVT
Sbjct  103  SKNKPKPPIFVTRDSPNALRSHVMEITGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  162

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+VV LHGRFEILSL+GT LP PAPPG+ GL+++L+GGQGQVVGG+VVG L+
Sbjct  163  LRQPSAP-GAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLV  221

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATFANA +ERLPL
Sbjct  222  AAGPVMVIAATFANATYERLPL  243



>emb|CDX74739.1| BnaA05g04850D [Brassica napus]
Length=310

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDS NAL+SHV+E++   D+++SVT +ARRR RGVCVLSG+G VTNVT
Sbjct  93   SKNKPKPPIIVTRDSANALKSHVMEVANGCDVMESVTVFARRRQRGVCVLSGNGAVTNVT  152

Query  182  LRQPSS-PAG--SVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvg  352
            +RQP++ P G  SVV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG
Sbjct  153  IRQPATVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVG  212

Query  353  PLMASGPVVLMAATFANAVFERLPL  427
            PLMASGPVV+MAA+F NA +ERLPL
Sbjct  213  PLMASGPVVIMAASFGNAAYERLPL  237



>emb|CDY27387.1| BnaC04g50180D [Brassica napus]
Length=312

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+I+TRDS NAL+SHV+E++   D+++SVT +ARRR RG+CVLSG+G VTNVT
Sbjct  100  SKNKPKPPVIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVT  159

Query  182  LRQPSS-PAG--SVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvg  352
            +RQP+S P G  SVV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG
Sbjct  160  IRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVG  219

Query  353  PLMASGPVVLMAATFANAVFERLPL  427
            PLMASGPVV+MAA+F NA +ERLPL
Sbjct  220  PLMASGPVVIMAASFGNAAYERLPL  244



>ref|XP_006397724.1| hypothetical protein EUTSA_v10001760mg [Eutrema salsugineum]
 gb|ESQ39177.1| hypothetical protein EUTSA_v10001760mg [Eutrema salsugineum]
Length=319

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NAL+SHV+E++   D+++SVT +ARRR RG+CVLSG+G VTNVT
Sbjct  97   SKNKPKPPIIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVT  156

Query  182  LRQPSS-PAG--SVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvg  352
            +RQP+S P G  SVV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG
Sbjct  157  IRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVG  216

Query  353  PLMASGPVVLMAATFANAVFERLPL  427
            PLMASGPVV+MAA+F NA +ERLPL
Sbjct  217  PLMASGPVVIMAASFGNAAYERLPL  241



>ref|XP_008801621.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
 ref|XP_008801622.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
 ref|XP_008801623.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=320

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +2

Query  5    KNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVTL  184
            KNKPKPPII+TR+SPNALRSHVLEI++  DI+D+V  +ARRR RGV +LSGSG VTNVTL
Sbjct  100  KNKPKPPIIITRESPNALRSHVLEIASGTDIMDAVAVFARRRQRGVSILSGSGVVTNVTL  159

Query  185  RQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLMA  364
            RQP++P G+VVTLHGRFEILSLSG  LPPP+PPGA GL+++L+GGQGQVVGG+VVG L+A
Sbjct  160  RQPAAPPGAVVTLHGRFEILSLSGAFLPPPSPPGASGLTVYLAGGQGQVVGGSVVGELVA  219

Query  365  SGPVVLMAATFANAVFERLPL  427
            SGPV+++AATF NA +ERLPL
Sbjct  220  SGPVMVIAATFTNATYERLPL  240



>ref|XP_004511638.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Cicer arietinum]
Length=312

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NAL++HV+E++   DI++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  99   SKNKPKPPIIITRDSANALKTHVMEVADGCDIVESVNNFARRRQRGVCIMSGTGTVTNVT  158

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  159  LRQPASP-GAVVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALI  217

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+M+A+F+NA +ERLPL
Sbjct  218  ASGPVVIMSASFSNAAYERLPL  239



>ref|XP_004976643.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=310

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+I+TR+S N LR+H+LE+ +  D+ +SV++YARRR RGVCVLSGSG VTNVT
Sbjct  95   SKNKPKPPVIITRESANTLRAHILEVGSGCDVFESVSTYARRRQRGVCVLSGSGVVTNVT  154

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+VVTLHGRFEILSLSG+ LPPPAPPGA  L+IFL+GGQGQVVGG VVG L 
Sbjct  155  LRQPSAPTGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGNVVGALY  214

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AA+FAN  +ERLPL
Sbjct  215  AAGPVIVIAASFANVAYERLPL  236



>ref|XP_009142337.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=308

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+I+TRDS NAL+SHV+E++   D+++SVT +ARRR RG+CVLSG+G VTNVT
Sbjct  96   SKNKPKPPVIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVT  155

Query  182  LRQPSS-PAG--SVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvg  352
            +RQP+S P G  SVV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG
Sbjct  156  IRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVG  215

Query  353  PLMASGPVVLMAATFANAVFERLPL  427
            PLMASGPVV+MAA+F NA +ERLPL
Sbjct  216  PLMASGPVVIMAASFGNAAYERLPL  240



>ref|XP_010416570.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=300

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 127/148 (86%), Gaps = 6/148 (4%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+IVTRDSPN LRSHVLEIS+ ADI++ V +YARR G+GV +LSG+GTV NV+
Sbjct  82   SKNKPKPPVIVTRDSPNVLRSHVLEISSGADIIECVNTYARRGGKGVSILSGNGTVANVS  141

Query  182  LRQPSSP------AGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggt  343
            +RQP++       AG VV+LHGRFE+LS++GTVLPPPAPPG+GGLS+FL+G QGQVVGG 
Sbjct  142  IRQPATAHATNGGAGGVVSLHGRFEVLSITGTVLPPPAPPGSGGLSVFLAGTQGQVVGGY  201

Query  344  vvgPLMASGPVVLMAATFANAVFERLPL  427
             V PL+ASGPVVL AA+F+NA FERLPL
Sbjct  202  AVSPLVASGPVVLTAASFSNATFERLPL  229



>ref|XP_010477346.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=318

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 132/152 (87%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNK KPPIIVTRDSPNALRSHVLE+S  ADI++SV++YARRRGRGV VL G+GTV+NVT
Sbjct  98   SKNKAKPPIIVTRDSPNALRSHVLEVSPGADIVESVSTYARRRGRGVSVLGGNGTVSNVT  157

Query  182  LRQPSSP----------AGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqv  331
            LRQP +P           G VVTLHGRFEILSL+GTVLPPPAPPGAGGLSIFL+GGQGQV
Sbjct  158  LRQPVTPGNGGGVSGGGGGGVVTLHGRFEILSLTGTVLPPPAPPGAGGLSIFLAGGQGQV  217

Query  332  vggtvvgPLMASGPVVLMAATFANAVFERLPL  427
            VGG+VV PL+AS PV+LMAA+F+NAVFERLP+
Sbjct  218  VGGSVVAPLIASAPVILMAASFSNAVFERLPM  249



>ref|XP_002880179.1| hypothetical protein ARALYDRAFT_903987 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56438.1| hypothetical protein ARALYDRAFT_903987 [Arabidopsis lyrata subsp. 
lyrata]
Length=318

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NAL+SHV+E++   D+++SVT +ARRR RG+CVLSG+G VTNVT
Sbjct  97   SKNKPKPPIIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVT  156

Query  182  LRQPSS-PAG--SVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvg  352
            +RQP+S P G  SVV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG
Sbjct  157  IRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVG  216

Query  353  PLMASGPVVLMAATFANAVFERLPL  427
            PLMASGPVV+MAA+F NA +ERLPL
Sbjct  217  PLMASGPVVIMAASFGNAAYERLPL  241



>emb|CDY37040.1| BnaA04g26180D [Brassica napus]
Length=308

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+I+TRDS NAL+SHV+E++   D+++SVT +ARRR RG+CVLSG+G VTNVT
Sbjct  96   SKNKPKPPVIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVT  155

Query  182  LRQPSS-PAG--SVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvg  352
            +RQP+S P G  SVV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG
Sbjct  156  IRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVG  215

Query  353  PLMASGPVVLMAATFANAVFERLPL  427
            PLMASGPVV+MAA+F NA +ERLPL
Sbjct  216  PLMASGPVVIMAASFGNAAYERLPL  240



>ref|XP_009613222.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
tomentosiformis]
Length=299

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++S++++ARRR RGVC++SG+G VTNV 
Sbjct  90   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMESISNFARRRQRGVCIMSGTGIVTNVN  149

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG LM
Sbjct  150  LRQPASP-GAIVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALM  208

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  209  ASGPVVIMAASFSNAAYERLPL  230



>ref|XP_006296351.1| hypothetical protein CARUB_v10025523mg [Capsella rubella]
 gb|EOA29249.1| hypothetical protein CARUB_v10025523mg [Capsella rubella]
Length=316

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NAL+SHV+E++   D+++SVT +ARRR RG+CVLSG+G VTNVT
Sbjct  94   SKNKPKPPIIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVT  153

Query  182  LRQPSS-PAG--SVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvg  352
            +RQP+S P G  SVV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG
Sbjct  154  IRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVG  213

Query  353  PLMASGPVVLMAATFANAVFERLPL  427
            PLMASGPVV+MAA+F NA +ERLPL
Sbjct  214  PLMASGPVVIMAASFGNAAYERLPL  238



>ref|NP_182067.1| AT-hook motif nuclear-localized protein 22 [Arabidopsis thaliana]
 gb|AAB82621.1| putative AT-hook DNA-binding protein [Arabidopsis thaliana]
 gb|AAT70431.1| At2g45430 [Arabidopsis thaliana]
 gb|AAV74244.1| At2g45430 [Arabidopsis thaliana]
 tpd|FAA00293.1| TPA: AT-hook motif nuclear localized protein 22 [Arabidopsis 
thaliana]
 dbj|BAH30430.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10552.1| AT-hook motif nuclear-localized protein 22 [Arabidopsis thaliana]
Length=317

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NAL+SHV+E++   D+++SVT +ARRR RG+CVLSG+G VTNVT
Sbjct  98   SKNKPKPPIIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVT  157

Query  182  LRQPSS-PAG--SVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvg  352
            +RQP+S P G  SVV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG
Sbjct  158  IRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVG  217

Query  353  PLMASGPVVLMAATFANAVFERLPL  427
            PLMASGPVV+MAA+F NA +ERLPL
Sbjct  218  PLMASGPVVIMAASFGNAAYERLPL  242



>ref|XP_010508171.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=322

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NAL+SHV+E++   D+++SVT +ARRR RG+CVLSG+G VTNVT
Sbjct  98   SKNKPKPPIIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVT  157

Query  182  LRQPSS-PAG--SVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvg  352
            +RQP+S P G  SVV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG
Sbjct  158  IRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVG  217

Query  353  PLMASGPVVLMAATFANAVFERLPL  427
            PLMASGPVV+MAA+F NA +ERLPL
Sbjct  218  PLMASGPVVIMAASFGNAAYERLPL  242



>ref|XP_010506485.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=322

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NAL+SHV+E++   D+++SVT +ARRR RG+CVLSG+G VTNVT
Sbjct  98   SKNKPKPPIIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVT  157

Query  182  LRQPSS-PAG--SVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvg  352
            +RQP+S P G  SVV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG
Sbjct  158  IRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVG  217

Query  353  PLMASGPVVLMAATFANAVFERLPL  427
            PLMASGPVV+MAA+F NA +ERLPL
Sbjct  218  PLMASGPVVIMAASFGNAAYERLPL  242



>ref|XP_009384866.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384867.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=322

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+I+TR+SPNALRSHVLEI +  DI+D++  +ARRR RGV +LSGSG VTNVT
Sbjct  102  SKNKPKPPVIITRESPNALRSHVLEIVSGTDIMDAIAVFARRRQRGVSILSGSGVVTNVT  161

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P GSV+TLHGRFEILS+SG  LP P+PPGA GL+++L+GGQGQVVGG V G L+
Sbjct  162  LRQPAAPPGSVITLHGRFEILSVSGAFLPAPSPPGATGLTVYLAGGQGQVVGGVVAGELV  221

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATFANA +ERLPL
Sbjct  222  ASGPVLIIAATFANATYERLPL  243



>ref|XP_010518160.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=321

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NAL+SHV+E++   D+++SVT +ARRR RG+CVLSG+G VTNVT
Sbjct  98   SKNKPKPPIIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVT  157

Query  182  LRQPSS-PAG--SVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvg  352
            +RQP+S P G  SVV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG
Sbjct  158  IRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVG  217

Query  353  PLMASGPVVLMAATFANAVFERLPL  427
            PLMASGPVV+MAA+F NA +ERLPL
Sbjct  218  PLMASGPVVIMAASFGNAAYERLPL  242



>ref|XP_011030530.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Populus 
euphratica]
Length=289

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EI+  AD+ +SV  +ARRR RGVCVLSGSG+V NVT
Sbjct  78   SKNKPKPPIFVTRDSPNALRSHVMEIAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  137

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+VV LHGRFEILSL+G  LP PAPPG+ GL+++L+GGQGQVVGG+VVG L+
Sbjct  138  LRQPAAP-GAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLI  196

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATFANA +ERLPL
Sbjct  197  AAGPVMVIAATFANATYERLPL  218



>ref|XP_010907805.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=318

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TR+SPNALRSHVLEI++  DI+D++  +ARRR RGV +LSGSG VT+VT
Sbjct  90   SKNKPKPPIIITRESPNALRSHVLEIASGTDIMDAIAVFARRRQRGVSILSGSGVVTDVT  149

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+VVTLHGRFEILSLSG  LP P+PPGA GL+++L+GGQGQVVGG V+G L+
Sbjct  150  LRQPAAPPGAVVTLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGRVMGELV  209

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATF NA++ERLPL
Sbjct  210  ASGPVMVIAATFTNAIYERLPL  231



>ref|XP_009613223.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
tomentosiformis]
Length=296

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++S++++ARRR RGVC++SG+G VTNV 
Sbjct  87   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMESISNFARRRQRGVCIMSGTGIVTNVN  146

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG LM
Sbjct  147  LRQPASP-GAIVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALM  205

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  206  ASGPVVIMAASFSNAAYERLPL  227



>ref|XP_002271606.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=291

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+E++  +DI +S+  +ARRR RGVCVLS SGTV NVT
Sbjct  76   SKNKPKPPIFVTRDSPNALRSHVMEVANGSDITESIAQFARRRQRGVCVLSASGTVMNVT  135

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+V+ LHGRFEILSL+G  LP PAPPG+ GL+I+L+GGQ QVVGG+VVG L+
Sbjct  136  LRQPSAPGGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQAQVVGGSVVGSLI  195

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATF+NA +ERLPL
Sbjct  196  AAGPVMVIAATFSNATYERLPL  217



>gb|EYU18229.1| hypothetical protein MIMGU_mgv1a020284mg [Erythranthe guttata]
Length=240

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NAL++H +E+++  D+ +S+T++ARR+ RG+CVLS +G VTNVT
Sbjct  32   SKNKPKPPIIITRDSANALKAHAMEVTSGCDVGESLTTFARRKQRGICVLSATGCVTNVT  91

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPSS AGSVVTLHGRFEILSL G++LPPPAPPG  GL+++L+G QGQVVGG+VVGPL+
Sbjct  92   LRQPSS-AGSVVTLHGRFEILSLLGSILPPPAPPGVAGLAVYLAGAQGQVVGGSVVGPLV  150

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAATF NA F+RLPL
Sbjct  151  ASGPVVIMAATFMNATFDRLPL  172



>ref|XP_007158420.1| hypothetical protein PHAVU_002G151600g [Phaseolus vulgaris]
 gb|ESW30414.1| hypothetical protein PHAVU_002G151600g [Phaseolus vulgaris]
Length=299

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NAL++HV+E++   DI+DSV+++ARRR RGVC++SG+GTVTNVT
Sbjct  92   SKNKPKPPIIITRDSANALKTHVMEVADGCDIVDSVSTFARRRQRGVCIMSGTGTVTNVT  151

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+S +G+VVTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  152  LRQPAS-SGAVVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALV  210

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+M+A+F+NA +ERLPL
Sbjct  211  ASGPVVIMSASFSNAAYERLPL  232



>dbj|BAJ94293.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=322

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TR+SPN LRSHVLEI++ ADI+++V ++ARRR RGV VLSGSG V NVT
Sbjct  102  SKNKPKPPIIITRESPNTLRSHVLEIASGADIMEAVATFARRRQRGVSVLSGSGVVGNVT  161

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P GSVVTLHGRFEILSLSG  LP P PPGA GL+++L+GGQGQVVGGTV+G L+
Sbjct  162  LRQPAAPPGSVVTLHGRFEILSLSGAFLPSPCPPGATGLAVYLAGGQGQVVGGTVIGELV  221

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATF+NA +ERLPL
Sbjct  222  ASGPVMVVAATFSNATYERLPL  243



>ref|XP_011033866.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=303

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+H++E++   DI++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  96   SKNKPKPPIIITRDSANALRTHLMEVADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  155

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L 
Sbjct  156  LRQPASP-GAIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLT  214

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  215  ASGPVVIMAASFSNAAYERLPL  236



>ref|XP_010276261.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=295

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   D+ +SV ++ARRR RGVC+LSGSGTVTNVT
Sbjct  87   SKNKPKPPIIITRDSANALRTHVMEIANGCDVGESVATFARRRQRGVCILSGSGTVTNVT  146

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G++VTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  147  LRQPATP-GAIVTLHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALV  205

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  206  ASGPVVIMAASFGNAAYERLPL  227



>ref|XP_008785537.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=317

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+T++SPNALRSHVLEI++  DI+D+V  +ARRR RG+ +LSGSG VTNVT
Sbjct  91   SKNKPKPPIIITKESPNALRSHVLEIASGTDIMDAVAVFARRRQRGISILSGSGVVTNVT  150

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+VVTLHGRFEILSLSG  LP P+P  + GL+++ +GGQGQVVGG+VVG L+
Sbjct  151  LRQPAAPPGTVVTLHGRFEILSLSGAFLPEPSPTVSTGLTVYFAGGQGQVVGGSVVGELV  210

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATF NA++ERLPL
Sbjct  211  ASGPVMVIAATFTNAMYERLPL  232



>ref|XP_002303540.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE78519.1| DNA-binding family protein [Populus trichocarpa]
Length=303

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+H++E++   DI++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  96   SKNKPKPPIIITRDSANALRTHLMEVADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  155

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L 
Sbjct  156  LRQPASP-GAIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLT  214

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  215  ASGPVVIMAASFSNAAYERLPL  236



>ref|XP_002299584.2| DNA-binding family protein [Populus trichocarpa]
 gb|EEE84389.2| DNA-binding family protein [Populus trichocarpa]
Length=302

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+H++E++   DI++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  95   SKNKPKPPIIITRDSANALRTHLMEVADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  154

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L 
Sbjct  155  LRQPASP-GAIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLT  213

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  214  ASGPVVIMAASFSNAAYERLPL  235



>gb|KHN01050.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=295

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPN LRSHV+E++  AD+ +SV  +ARRR RGVCVLSGSG+V NVT
Sbjct  83   SKNKPKPPIFVTRDSPNTLRSHVMEVTGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  142

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+VV LHGRFEILSL+GT LP PAPPG+ GL+++L+GGQGQ+VGG+VVG L+
Sbjct  143  LRQPSAP-GAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLTGGQGQIVGGSVVGSLV  201

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATFANA +ERLPL
Sbjct  202  AAGPVMVIAATFANATYERLPL  223



>ref|XP_009420779.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=305

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            S+NKPKPPII+ +DS NAL SHV+EI+   DI+D V ++ARRR RGVCVLSGSGTV NVT
Sbjct  97   SRNKPKPPIIINQDSANALSSHVMEIAGGCDIVDGVATFARRRQRGVCVLSGSGTVANVT  156

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQ+VGG+VVGPL+
Sbjct  157  LRQPASP-GAVVNLHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQIVGGSVVGPLI  215

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV++MAA+F NA +ERLPL
Sbjct  216  ASGPVIIMAASFGNAAYERLPL  237



>ref|XP_002314642.2| hypothetical protein POPTR_0010s08500g [Populus trichocarpa]
 gb|EEF00813.2| hypothetical protein POPTR_0010s08500g [Populus trichocarpa]
Length=289

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EI+  AD+ +SV  +ARRR RGVCVLSGSG+V NVT
Sbjct  92   SKNKPKPPIFVTRDSPNALRSHVMEIAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  151

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+VV LHGRFEILSL+G  LP PAPPG+ GL+++L+GGQGQVVGG+VVG L+
Sbjct  152  LRQPAAP-GAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLI  210

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATFANA +ERLPL
Sbjct  211  AAGPVMVIAATFANATYERLPL  232



>ref|XP_010920512.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=320

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +2

Query  5    KNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVTL  184
            KNKPKPPII+TR+SPN+LRSHVLEI++  DI+D+V  +ARRR RGV +LSGSG VTNVTL
Sbjct  100  KNKPKPPIIITRESPNSLRSHVLEIASGTDIMDAVAVFARRRQRGVSILSGSGVVTNVTL  159

Query  185  RQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLMA  364
            RQP++P G+VVTLHGRFEILSLSG  LPPP+PPGA GL+++L+GGQGQVVGG+VVG L+A
Sbjct  160  RQPAAPPGAVVTLHGRFEILSLSGAFLPPPSPPGASGLTVYLAGGQGQVVGGSVVGELVA  219

Query  365  SGPVVLMAATFANAVFERLPL  427
            SGPV+++AATF NA FERLPL
Sbjct  220  SGPVMVIAATFTNATFERLPL  240



>ref|XP_006588553.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=230

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPN+LRSHV+E++  AD+ +SV  +ARRR RGVCVLSGSG+V NVT
Sbjct  50   SKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  109

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+VV LHGRFEILSL+G  LP PAPPGA GL+++L+GGQGQVVGG+VVG L+
Sbjct  110  LRQPSAP-GAVVALHGRFEILSLTGAFLPGPAPPGATGLTVYLAGGQGQVVGGSVVGSLV  168

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATFANA +ERLPL
Sbjct  169  AAGPVMVIAATFANATYERLPL  190



>ref|XP_006390186.1| hypothetical protein EUTSA_v10019495mg [Eutrema salsugineum]
 gb|ESQ27472.1| hypothetical protein EUTSA_v10019495mg [Eutrema salsugineum]
Length=306

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 130/156 (83%), Gaps = 14/156 (9%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+IVTRDSPN LRSHVLE+S+ ADI++SV +YARRRGRGV VLSG+GTV NV 
Sbjct  86   SKNKPKPPVIVTRDSPNVLRSHVLEVSSGADIVESVNTYARRRGRGVSVLSGNGTVANVV  145

Query  182  LRQP--------------SSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSgg  319
            LRQP               + AG VVTLHGRF+ILSL+GTVLPPPAPPG+GGLS+FL+GG
Sbjct  146  LRQPVTTHGNNGGIGAGAGAGAGGVVTLHGRFDILSLTGTVLPPPAPPGSGGLSVFLAGG  205

Query  320  qgqvvggtvvgPLMASGPVVLMAATFANAVFERLPL  427
            QGQV+GG V+ PL+ASGPV+LMAA+F+NA FERLPL
Sbjct  206  QGQVIGGNVMAPLVASGPVILMAASFSNATFERLPL  241



>ref|XP_011029905.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Populus 
euphratica]
Length=292

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EI+  AD+ +SV  +ARRR RGVCVLSGSG+V NVT
Sbjct  81   SKNKPKPPIFVTRDSPNALRSHVMEIAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  140

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+VV LHGRFEILSL+G  LP PAPPG+ GL+++L+GGQGQVVGG+VVG L+
Sbjct  141  LRQPAAP-GAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLV  199

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATFANA +ERLPL
Sbjct  200  AAGPVMVIAATFANATYERLPL  221



>ref|XP_003568662.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=321

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +2

Query  5    KNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVTL  184
            KNKPKPPII+TR+SPN LRSHVLEI++ ADI+D+V ++ARRR RGV VLSGSG V NVTL
Sbjct  99   KNKPKPPIIITRESPNTLRSHVLEIASGADIMDAVATFARRRQRGVSVLSGSGVVGNVTL  158

Query  185  RQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLMA  364
            RQP++P G+VVTLHGRFEILSLSG  LP P PPGA GL+++L+GGQGQVVGGTVVG L+A
Sbjct  159  RQPAAPPGAVVTLHGRFEILSLSGAFLPSPCPPGATGLAVYLAGGQGQVVGGTVVGELVA  218

Query  365  SGPVVLMAATFANAVFERLPL  427
            SGP++++AATF+NA +ERLPL
Sbjct  219  SGPIMVVAATFSNATYERLPL  239



>gb|EPS64135.1| hypothetical protein M569_10646 [Genlisea aurea]
Length=318

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSHV+E++   DI +SV+++A RR RGVC+LSG+GTVTNVT
Sbjct  104  SKNKPKPPIIITRDSANALRSHVIEVATGCDIQESVSTFATRRQRGVCILSGTGTVTNVT  163

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP+SP G+V+TL GRFEILSL+G+ LPPPAPP A  L+I+L+G QGQV+GGT+VGPL+
Sbjct  164  IRQPTSP-GAVLTLQGRFEILSLTGSFLPPPAPPAASSLTIYLAGSQGQVMGGTIVGPLI  222

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F NA +ERLPL
Sbjct  223  ASGPVVIMAASFGNAAYERLPL  244



>gb|EPS71465.1| hypothetical protein M569_03296, partial [Genlisea aurea]
Length=229

 Score =   168 bits (425),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 152/219 (69%), Gaps = 17/219 (8%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPK P++VTRD PN++ SHVLE+SA  D+++ +T+YARR+GRG+CVLSG GTV +VT
Sbjct  26   SKNKPKLPMVVTRDGPNSMGSHVLEVSAGDDVVEGLTAYARRKGRGICVLSGGGTVASVT  85

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS   GS +TL GRFEIL+LSGT+LPPPAPPGAGGLS+F++GG GQVVGG+VVGPL 
Sbjct  86   LRQPS---GSALTLQGRFEILNLSGTILPPPAPPGAGGLSVFMAGGHGQVVGGSVVGPLT  142

Query  362  ASGPVVLMAATFANAVFERLPLeeeaeggagnataaaagqqvqsstaasqtsgvtgggeg  541
            A+GPV+L+AA+FANA+FERLPL  E +        +   Q    +      +G       
Sbjct  143  AAGPVILIAASFANALFERLPLAAEEKEDGARPQGSWGSQSSGVTAGGGGRAGHV-----  197

Query  542  gggtsfgNTQpppppTNYPFSAEVFGWAG-NTAAAARPP  655
                     +      NY +S E+FGW   N ++++RPP
Sbjct  198  --------GEDGSASLNYEYSDELFGWGNINASSSSRPP  228



>ref|XP_009623613.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
 ref|XP_009623614.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=297

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+E++  AD+ +S+  +AR+R RGVCVLS +GTVTNVT
Sbjct  75   SKNKPKPPIFVTRDSPNALRSHVMEVANGADVAESIAQFARKRQRGVCVLSATGTVTNVT  134

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P  +V+ LHGRFEILSL+G  LP PAPPG+ GL+I+L+GGQGQVVGG+VVGPL+
Sbjct  135  LRQPSAPGSAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGPLV  194

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++A+TF+NA +ERLPL
Sbjct  195  ASGPVMVIASTFSNATYERLPL  216



>ref|XP_003517441.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=300

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NAL++HV+E++   DI+DSV+++ARRR RGVC++SG+GTVTNVT
Sbjct  88   SKNKPKPPIIITRDSANALKTHVMEVADGCDIVDSVSAFARRRQRGVCIMSGTGTVTNVT  147

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+S +G+VVTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  148  LRQPAS-SGAVVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALI  206

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+M+A+F+NA +ERLPL
Sbjct  207  ASGPVVIMSASFSNAAYERLPL  228



>ref|XP_010090728.1| hypothetical protein L484_013750 [Morus notabilis]
 gb|EXB40447.1| hypothetical protein L484_013750 [Morus notabilis]
Length=288

 Score =   169 bits (429),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 132/148 (89%), Gaps = 7/148 (5%)
 Frame = +2

Query  5    KNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVTL  184
            KNKPKPPI VTRDSPNALRSHVLEI++ +D+++SV+SYARR GRG+CVLSGSG VTNVTL
Sbjct  76   KNKPKPPIFVTRDSPNALRSHVLEIASGSDVVESVSSYARRHGRGICVLSGSGAVTNVTL  135

Query  185  RQ-------PSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggt  343
            RQ       P++P G V+TLHGRFEILSL+GT LPPPAPPGAGGL+I+L GGQGQVVGG+
Sbjct  136  RQPAGSAAAPAAPTGGVMTLHGRFEILSLTGTSLPPPAPPGAGGLTIYLGGGQGQVVGGS  195

Query  344  vvgPLMASGPVVLMAATFANAVFERLPL  427
            VVGPL ASGPV+LMAA+FANAVF+RLPL
Sbjct  196  VVGPLTASGPVMLMAASFANAVFDRLPL  223



>ref|XP_002312579.2| hypothetical protein POPTR_0008s16440g, partial [Populus trichocarpa]
 gb|EEE89946.2| hypothetical protein POPTR_0008s16440g, partial [Populus trichocarpa]
Length=291

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+EI+  AD+ +SV  +ARRR RGVCVLSGSG+V NVT
Sbjct  80   SKNKPKPPIFVTRDSPNALRSHVMEIAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  139

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+VV LHGRFEILSL+G  LP PAPPG+ GL+++L+GGQGQVVGG+VVG L+
Sbjct  140  LRQPAAP-GAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLV  198

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATFANA +ERLPL
Sbjct  199  AAGPVMVIAATFANATYERLPL  220



>ref|XP_010325447.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Solanum 
lycopersicum]
Length=289

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++S++++ARRR RGVC++SG+G VTNV 
Sbjct  83   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMESISNFARRRQRGVCIMSGTGVVTNVN  142

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG LM
Sbjct  143  LRQPASP-GAIVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALM  201

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+M+A+F+NA +ERLPL
Sbjct  202  ASGPVVIMSASFSNAAYERLPL  223



>ref|XP_010459784.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=315

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 131/150 (87%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNK KPPIIVTRDSPNALRSHVLE+S  ADI++SV++YARRRGRGV VL G+GTV+NVT
Sbjct  97   SKNKAKPPIIVTRDSPNALRSHVLEVSPGADIVESVSTYARRRGRGVSVLGGNGTVSNVT  156

Query  182  LRQPSSP--------AGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvg  337
            LRQP +P         G VVTLHGRFEILSL+GTVLPPPAPPGAGGLSIFL+GGQGQVVG
Sbjct  157  LRQPVTPGNGGGVSGGGGVVTLHGRFEILSLTGTVLPPPAPPGAGGLSIFLAGGQGQVVG  216

Query  338  gtvvgPLMASGPVVLMAATFANAVFERLPL  427
            G+VV PL+ S PV+LMAA+F+NAVFERLP+
Sbjct  217  GSVVAPLITSAPVILMAASFSNAVFERLPM  246



>gb|KHN30735.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=290

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPN LRSHV+EI+  AD+ +SV  +ARRR RGVCVLSGSG+V NVT
Sbjct  77   SKNKPKPPIFVTRDSPNTLRSHVMEITGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  136

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+VV LHGRFEILSL+GT LP PAPPG+ GL+++L+GGQGQVVGG+VVG L+
Sbjct  137  LRQPSAP-GAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLV  195

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATFANA +ERLPL
Sbjct  196  AAGPVMVIAATFANATYERLPL  217



>gb|EYU29016.1| hypothetical protein MIMGU_mgv1a023550mg [Erythranthe guttata]
Length=298

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 126/141 (89%), Gaps = 1/141 (1%)
 Frame = +2

Query  5    KNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVTL  184
            KN+PKPPII++RDS NALR+HV+EIS   D++DSV S+AR R RGVC++SGSG VTNVTL
Sbjct  88   KNRPKPPIIISRDSANALRTHVMEISDGCDVMDSVASFARSRQRGVCIMSGSGNVTNVTL  147

Query  185  RQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLMA  364
            RQP+SP G+VVTL GRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG VVGPL+A
Sbjct  148  RQPASP-GAVVTLQGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQVVGGGVVGPLVA  206

Query  365  SGPVVLMAATFANAVFERLPL  427
            SGPV++MAA+F+NA +ERLPL
Sbjct  207  SGPVIVMAASFSNAAYERLPL  227



>ref|XP_008456342.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=293

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNAL+SHV+EIS  ADI +SV  +ARRR RGV VLSGSGTVTNVT
Sbjct  79   SKNKPKPPIFVTRDSPNALKSHVMEISNGADIAESVAQFARRRQRGVSVLSGSGTVTNVT  138

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+V+ L GRFEILSL+GT LP PAPPG+ GL+I+L+GGQGQVVGG+VVGPL 
Sbjct  139  LRQPSAP-GAVLALQGRFEILSLTGTFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGPLT  197

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATF+NA +ERLPL
Sbjct  198  AAGPVMVIAATFSNATYERLPL  219



>ref|XP_008777391.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=317

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TR+SPNALRSHVLEI++  DI+D++  +ARRR RGV +LSGSG VT+VT
Sbjct  90   SKNKPKPPIIITRESPNALRSHVLEIASGTDIMDAIAVFARRRQRGVSILSGSGVVTDVT  149

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+VVTLHGRFEILSLSG  LP P+PPGA GL+++L+GGQGQV GG VVG L+
Sbjct  150  LRQPAAPPGAVVTLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVAGGKVVGELV  209

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATF NA +ERLPL
Sbjct  210  ASGPVMVIAATFTNATYERLPL  231



>ref|XP_008811845.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=293

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 131/144 (91%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDSPN L SH+LE+++ AD+++SVT YARRRGRGVCVLSG G V NV+
Sbjct  77   SKNKPKPPIIITRDSPNGLHSHMLEVASGADVVESVTEYARRRGRGVCVLSGGGAVVNVS  136

Query  182  LRQP-SSPAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP ++P GSVV TL GRFEILSL+GTVLPPPAPPG GGL++FL+GGQGQVVGG+VVGP
Sbjct  137  LRQPGAAPPGSVVATLTGRFEILSLTGTVLPPPAPPGVGGLTVFLAGGQGQVVGGSVVGP  196

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPV+LM ATFANAV+ERLPL
Sbjct  197  LVAAGPVMLMTATFANAVYERLPL  220



>ref|XP_004245690.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Solanum 
lycopersicum]
Length=292

 Score =   169 bits (429),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++S++++ARRR RGVC++SG+G VTNV 
Sbjct  86   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMESISNFARRRQRGVCIMSGTGVVTNVN  145

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG LM
Sbjct  146  LRQPASP-GAIVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALM  204

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+M+A+F+NA +ERLPL
Sbjct  205  ASGPVVIMSASFSNAAYERLPL  226



>ref|NP_001048546.1| Os02g0820800 [Oryza sativa Japonica Group]
 dbj|BAD22878.1| DNA-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAD23110.1| DNA-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF10460.1| Os02g0820800 [Oryza sativa Japonica Group]
 gb|EAY88054.1| hypothetical protein OsI_09483 [Oryza sativa Indica Group]
Length=266

 Score =   169 bits (427),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+E++  AD+ D++  ++RRR RGVCVLSG+GTV NV 
Sbjct  67   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAQFSRRRQRGVCVLSGAGTVANVA  126

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+VV LHGRFEILSL+GT LP PAPPG+ GL+++L+GGQGQVVGG+VVG L+
Sbjct  127  LRQPSAP-GAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLI  185

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++A+TFANA +ERLPL
Sbjct  186  AAGPVMVIASTFANATYERLPL  207



>ref|XP_003624255.1| AT-hook DNA-binding protein [Medicago truncatula]
Length=316

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+I+TR+S N LR+H+LE+S+  D+ DSV +YAR+R RG+CVLSGSGTVTNVT
Sbjct  113  SKNKPKPPVIITRESANTLRAHILEVSSGCDVFDSVATYARKRQRGICVLSGSGTVTNVT  172

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++ AGSVVTLHGRFEILSLSG+ LPPPAPPGA  LS+FL GGQGQVVGG VVGPL+
Sbjct  173  LRQPAA-AGSVVTLHGRFEILSLSGSFLPPPAPPGATSLSVFLGGGQGQVVGGNVVGPLV  231

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++A++F N  +ERLPL
Sbjct  232  ASGPVIVIASSFTNVAYERLPL  253



>ref|XP_004954422.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=274

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+E++  AD+ D++  ++RRR RGVCVLSG+GTV NV 
Sbjct  77   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAQFSRRRQRGVCVLSGAGTVANVA  136

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+VV LHGRFEILSL+GT LP PAPPG+ GL+++L+GGQGQVVGG+VVG L+
Sbjct  137  LRQPSAP-GAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLI  195

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++A+TFANA +ERLPL
Sbjct  196  AAGPVMVIASTFANATYERLPL  217



>ref|XP_010262258.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=255

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHV+E++  AD+ +SV  +ARRR RGVCVLSGSG V NVT
Sbjct  43   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGAVANVT  102

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+VV LHGRFEILSL+G  LP PAPPG+ GL+++L+GGQGQVVGG+VVG L+
Sbjct  103  LRQPAAP-GAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLV  161

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATFANA +ERLPL
Sbjct  162  AAGPVMVIAATFANATYERLPL  183



>ref|XP_009143141.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=308

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPIIVTRDS NAL+SHV+E++   D+++SVT +ARRR RGVCVLSG+G VTNVT
Sbjct  90   SKNKPKPPIIVTRDSANALKSHVMEVANGCDVMESVTVFARRRQRGVCVLSGNGAVTNVT  149

Query  182  LRQPSS-PAG--SVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvg  352
            +RQP++ P G  SVV LHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG
Sbjct  150  IRQPATVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVG  209

Query  353  PLMASGPVVLMAATFANAVFERLPL  427
            PLMASGPV++MAA+F NA +ERLPL
Sbjct  210  PLMASGPVMIMAASFGNAAYERLPL  234



>ref|XP_004139388.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 ref|XP_004156496.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 gb|KGN60776.1| hypothetical protein Csa_2G010120 [Cucumis sativus]
Length=293

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNAL+SHV+EIS  ADI +SV  +ARRR RGV VLSGSGTVTNVT
Sbjct  79   SKNKPKPPIFVTRDSPNALKSHVMEISNGADIAESVAQFARRRQRGVSVLSGSGTVTNVT  138

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPS+P G+V+ L GRFEILSL+GT LP PAPPG+ GL+I+L+GGQGQVVGG+VVGPL 
Sbjct  139  LRQPSAP-GAVLALQGRFEILSLTGTFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGPLT  197

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATF+NA +ERLPL
Sbjct  198  AAGPVMVIAATFSNATYERLPL  219



>ref|XP_003611214.1| AT-hook DNA-binding protein [Medicago truncatula]
 gb|AES94172.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=325

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NAL++HV+E++   D+++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  109  SKNKPKPPIIITRDSANALKTHVMEVADGCDVVESVNNFARRRQRGVCIMSGTGTVTNVT  168

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G+VVTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  169  LRQPASP-GAVVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALI  227

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+M+A+F+NA +ERLPL
Sbjct  228  ASGPVVIMSASFSNAAYERLPL  249



>ref|XP_003549894.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=287

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NA+R+H++E++   DI++SV+ +AR+R RG+C++SG+GTVTNVT
Sbjct  82   SKNKPKPPIIITRDSANAMRTHMMEVADGYDIVESVSEFARKRQRGICIMSGTGTVTNVT  141

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+S +GSVVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  142  LRQPAS-SGSVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLV  200

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+MAA+F+NA +ERLPL
Sbjct  201  ASGPVVIMAASFSNAAYERLPL  222



>ref|XP_009110204.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=315

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 132/151 (87%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPK PIIVTRDSPN LRSHVLE+S  ADI++S+++YARRRGRGV VL G+GTV+NVT
Sbjct  98   SKNKPKAPIIVTRDSPNTLRSHVLEVSPGADIVESLSTYARRRGRGVSVLGGNGTVSNVT  157

Query  182  LRQPSSP---------AGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvv  334
            LRQP +P         AG VVTLHGRFEILSL+GTVLPPPAPPGAGGLSIFLSGGQGQV+
Sbjct  158  LRQPVTPGNGGGVGAGAGGVVTLHGRFEILSLTGTVLPPPAPPGAGGLSIFLSGGQGQVI  217

Query  335  ggtvvgPLMASGPVVLMAATFANAVFERLPL  427
            GG+VV PL+AS PV+LMAA+F+NAVFERLP+
Sbjct  218  GGSVVAPLVASAPVILMAASFSNAVFERLPI  248



>ref|XP_010498533.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=315

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 131/152 (86%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNK KPPIIVTRDSPNALRSHVLE+S  ADI++SV++YARRRGRGV VL G+GTV+NVT
Sbjct  97   SKNKAKPPIIVTRDSPNALRSHVLEVSPGADIVESVSTYARRRGRGVSVLGGNGTVSNVT  156

Query  182  LRQPSSP----------AGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqv  331
            LRQP +P           G VVTLHGRFEILSL+GTVLPPPAPPGAGGLSIFL+GGQGQV
Sbjct  157  LRQPVTPGNGGGVSGGGGGGVVTLHGRFEILSLTGTVLPPPAPPGAGGLSIFLAGGQGQV  216

Query  332  vggtvvgPLMASGPVVLMAATFANAVFERLPL  427
            VGG+VV PL+ S PV+LMAA+F+NAVFERLP+
Sbjct  217  VGGSVVAPLITSAPVILMAASFSNAVFERLPM  248



>ref|XP_006851807.1| hypothetical protein AMTR_s00041p00025000 [Amborella trichopoda]
 gb|ERN13274.1| hypothetical protein AMTR_s00041p00025000 [Amborella trichopoda]
Length=307

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TR+S NALR+HV+E+++  D+ +SV ++ARRR RGVC+LSGSGTVTNVT
Sbjct  95   SKNKPKPPIIITRESANALRAHVMEVASGCDVGESVANFARRRQRGVCILSGSGTVTNVT  154

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G++VTLHGRFEILSLSG+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  155  LRQPAAP-GAIVTLHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALV  213

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV++MAA+F NA +ERLPL
Sbjct  214  ASGPVIIMAASFGNAAYERLPL  235



>ref|XP_010923237.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=312

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TR+SPNALRSHVLEI++  DI+D++  +ARRR RG+ +LSGSG VTNVT
Sbjct  91   SKNKPKPPIIITRESPNALRSHVLEIASGTDIMDAIAVFARRRQRGISILSGSGVVTNVT  150

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+VVTLHGRFEILSLSG  LP P+PPGA GL+++L+GGQGQVVGG+VVG L+
Sbjct  151  LRQPAAPPGAVVTLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGSVVGELV  210

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASG V+++AATF NA++ERLPL
Sbjct  211  ASGQVMVIAATFTNAIYERLPL  232



>ref|XP_002438341.1| hypothetical protein SORBIDRAFT_10g012980 [Sorghum bicolor]
 gb|EER89708.1| hypothetical protein SORBIDRAFT_10g012980 [Sorghum bicolor]
Length=310

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDSPNAL SHVLE++A ADI++ V+ YARRR RGVCVLSG G V+N+ 
Sbjct  81   SKNKPKPPIIITRDSPNALHSHVLEVAAGADIVECVSEYARRRCRGVCVLSGGGAVSNLA  140

Query  182  LRQP-SSPAGSVV-TLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgP  355
            LRQP + P GS+V TL G+FEILSL+GTVLPPPAPPGA  LS++++GGQGQV+GG+VVG 
Sbjct  141  LRQPGAEPPGSLVATLRGQFEILSLTGTVLPPPAPPGASSLSVYVAGGQGQVMGGSVVGQ  200

Query  356  LMASGPVVLMAATFANAVFERLPL  427
            L+A+GPVVLMAA+FANAV+ERLPL
Sbjct  201  LIAAGPVVLMAASFANAVYERLPL  224



>ref|XP_004492894.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Cicer arietinum]
 ref|XP_004492895.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Cicer arietinum]
 ref|XP_004492896.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X3 [Cicer arietinum]
Length=267

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+I+TR+S N LR+H+LE+S+  D+ DSV +YAR+R RG+CVLSGSGTVTNV 
Sbjct  65   SKNKPKPPVIITRESANTLRAHILEVSSGCDVFDSVATYARKRQRGICVLSGSGTVTNVI  124

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++ AGSVVTLHGRFEILSLSG+ LPPPAPPGA  LS+FL GGQGQVVGG VVGPL+
Sbjct  125  LRQPAA-AGSVVTLHGRFEILSLSGSFLPPPAPPGATSLSVFLGGGQGQVVGGNVVGPLV  183

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++A++F N  +ERLPL
Sbjct  184  ASGPVIVIASSFTNVAYERLPL  205



>ref|XP_004145056.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 ref|XP_004153892.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 ref|XP_004172845.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 gb|KGN46234.1| hypothetical protein Csa_6G076820 [Cucumis sativus]
Length=282

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALRSH++EIS A+DI+DS+ ++ARRR RGVC+LS +GTV NVT
Sbjct  76   SKNKPKPPIIITRDSANALRSHLIEISTASDIVDSLATFARRRQRGVCILSATGTVANVT  135

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQPSSP G+V+TL GRFEILSLSG+ LPPPAPP A GL+++L+GGQGQVVGG V+GPL 
Sbjct  136  LRQPSSP-GAVITLPGRFEILSLSGSFLPPPAPPAASGLTVYLAGGQGQVVGGNVIGPLS  194

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV++MAA+F NA +ERLP+
Sbjct  195  ASGPVIIMAASFGNAAYERLPI  216



>ref|XP_009607803.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=319

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI+VT++SPN+LRSHVLEI + +DI++S+ ++A RRGRGV VLSGSG VTNVT
Sbjct  113  SKNKPKPPIVVTKESPNSLRSHVLEIKSGSDIVESIATFAHRRGRGVSVLSGSGIVTNVT  172

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++ AG V+TLHGRFEILSLSG  LP P+PPGA GL+++L+G QGQVVGG VVG LM
Sbjct  173  LRQPAA-AGGVITLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGSQGQVVGGNVVGELM  231

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATF NA FERLPL
Sbjct  232  ASGPVMVIAATFTNATFERLPL  253



>ref|XP_009402315.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=319

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +2

Query  5    KNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVTL  184
            KNKPKPP+I+TR+SPNALRSHVLEI++  DI+D+VT +ARRR RG+ +LSG+G VTNVTL
Sbjct  98   KNKPKPPVIITRESPNALRSHVLEIASGTDIMDAVTVFARRRQRGLSILSGTGVVTNVTL  157

Query  185  RQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLMA  364
            RQP++P G+VV+LHGRFEILSLSG  LP P+PPGA GL+++L+GGQGQVVGG+VVG L+A
Sbjct  158  RQPAAPPGTVVSLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGSVVGELVA  217

Query  365  SGPVVLMAATFANAVFERLPL  427
            SGPV+++AATF NA +ERLPL
Sbjct  218  SGPVMIIAATFTNATYERLPL  238



>emb|CDY33658.1| BnaC08g19580D [Brassica napus]
Length=292

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 115/142 (81%), Gaps = 15/142 (11%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPK PIIVTRDSPN LRSHVLE+S  ADI++S+++YARRRGRG+ VL G+GTV+NVT
Sbjct  99   SKNKPKAPIIVTRDSPNTLRSHVLEVSPGADIVESLSTYARRRGRGISVLGGNGTVSNVT  158

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP +PAG VVTLHGRFEILSL+GTVLPPPAPPGAGG  +                PL+
Sbjct  159  LRQPVTPAGGVVTLHGRFEILSLTGTVLPPPAPPGAGGSVV---------------APLV  203

Query  362  ASGPVVLMAATFANAVFERLPL  427
            AS PV+LMAA+F+NAVFERLP+
Sbjct  204  ASAPVILMAASFSNAVFERLPI  225



>gb|ABL63119.1| AT-hook DNA-binding protein, partial [Catharanthus roseus]
Length=256

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPI VTRDSPNALRSHVLE+S  +D+ +S+  +AR+R RGVCVLSGSG+V NVT
Sbjct  34   SKNKPKPPIFVTRDSPNALRSHVLEVSGGSDVAESIAVFARKRQRGVCVLSGSGSVANVT  93

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P G+VV LHGRFEILSLSG  LP PAPPG+ GL+++L+GGQGQVVGG+VVG L+
Sbjct  94   LRQPAAP-GAVVALHGRFEILSLSGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLV  152

Query  362  ASGPVVLMAATFANAVFERLPL  427
            A+GPV+++AATFANA +ERLPL
Sbjct  153  AAGPVLIIAATFANATYERLPL  174



>ref|XP_004307477.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=320

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+T++SPNALRSHVLEIS+ +DI+DS+ ++A+RR RGV VLSGSG V+NVT
Sbjct  100  SKNKPKPPIIITKESPNALRSHVLEISSGSDIVDSIATFAQRRHRGVSVLSGSGIVSNVT  159

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP++P+G V+TLHGRFEILSL+G  LP P+PPGA GL+++L GGQGQVVGGTVVGPL+
Sbjct  160  LRQPAAPSG-VITLHGRFEILSLNGAFLPAPSPPGASGLTVYLGGGQGQVVGGTVVGPLV  218

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPV+++AATF NA +ERLPL
Sbjct  219  ASGPVMIIAATFTNATYERLPL  240



>ref|XP_007220373.1| hypothetical protein PRUPE_ppa018314mg [Prunus persica]
 gb|EMJ21572.1| hypothetical protein PRUPE_ppa018314mg [Prunus persica]
Length=312

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNK KPPII+TRDS NALRSHV+E++   DI+DSV+++ARRR RGVC+LSGSGTVTNVT
Sbjct  97   SKNKAKPPIIITRDSANALRSHVMEVANGCDIMDSVSTFARRRQRGVCILSGSGTVTNVT  156

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            +RQP+SP GSVVTLHGRFEILSLSG+ LPPPAPP A GL+I+L+G QGQVVGG VVGPL+
Sbjct  157  IRQPASP-GSVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGVQGQVVGGGVVGPLL  215

Query  362  ASGPVVLMAATFANAVF  412
            ASGPVV+MAA+F NA +
Sbjct  216  ASGPVVIMAASFGNAAY  232



>ref|XP_006363711.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=293

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI+   DI++S++++ARRR RGVC++SG+G VTNV 
Sbjct  84   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMESISNFARRRQRGVCIMSGTGIVTNVN  143

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+SP G++VTLHGRFEILSL+G+ LPPPAPP   GL+I+L+GGQGQVVGG+VVG LM
Sbjct  144  LRQPASP-GAIVTLHGRFEILSLAGSFLPPPAPPTTSGLTIYLAGGQGQVVGGSVVGALM  202

Query  362  ASGPVVLMAATFANAVFERLPL  427
            ASGPVV+M+A+F+NA +ERLPL
Sbjct  203  ASGPVVIMSASFSNAAYERLPL  224



>ref|XP_009104672.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=287

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 124/149 (83%), Gaps = 10/149 (7%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPP+IVTRDSPN LRSHVLE+S+ ADI++SV +YARRRGRGV +LSG+GTV N+T
Sbjct  80   SKNKPKPPVIVTRDSPNVLRSHVLEVSSGADIIESVNNYARRRGRGVSILSGNGTVANLT  139

Query  182  LRQP----------SSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqv  331
            LRQP           + AG VVTL GRFEILS++G VLPPPAPPG GGLSIF++G QG+V
Sbjct  140  LRQPVTTHGNNGGTEAGAGGVVTLRGRFEILSITGAVLPPPAPPGCGGLSIFVAGEQGRV  199

Query  332  vggtvvgPLMASGPVVLMAATFANAVFER  418
            +GG VV PL+ASGPV+LMAA+F+NA FER
Sbjct  200  IGGRVVAPLVASGPVILMAASFSNATFER  228



>ref|XP_007040019.1| AT-hook DNA-binding family protein [Theobroma cacao]
 gb|EOY24520.1| AT-hook DNA-binding family protein [Theobroma cacao]
Length=302

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI    DI++SV ++ARRR RGVC++SG+GTVTNVT
Sbjct  96   SKNKPKPPIIITRDSANALRTHVMEIGDGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  155

Query  182  LRQPSSPAGSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPLM  361
            LRQP+S AG++VTLHGRFEILSL+G+ LPPPAPP A GL+I+L+GGQGQVVGG+VVG L+
Sbjct  156  LRQPAS-AGAIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLI  214

Query  362  ASGPVVLMAATFANAVFERLPL  427
             SGPVV+MAA+F+NA +ERLPL
Sbjct  215  CSGPVVIMAASFSNAAYERLPL  236



>ref|XP_009136213.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=326

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = +2

Query  2    SKNKPKPPIIVTRDSPNALRSHVLEISAAADILDSVTSYARRRGRGVCVLSGSGTVTNVT  181
            SKNKPKPPII+TRDS NALR+HV+EI    D+++SV ++ARRR RGVCV+SG+G V NVT
Sbjct  114  SKNKPKPPIIITRDSANALRTHVMEIGDGCDLVESVATFARRRQRGVCVMSGTGNVMNVT  173

Query  182  LRQPSSPA-GSVVTLHGRFEILSLSGTVLpppappgaggLSIFLSggqgqvvggtvvgPL  358
            +RQP SP+ GSVV+LHGRFEILSLSG+ LPPPAPP A GLS++L+GGQGQVVGG+  GPL
Sbjct  174  IRQPGSPSPGSVVSLHGRFEILSLSGSFLPPPAPPNATGLSVYLAGGQGQVVGGSGGGPL  233

Query  359  MASGPVVLMAATFANAVFERLPL  427
            + +GPVV+MAA+F+NA +ERLPL
Sbjct  234  LCAGPVVVMAASFSNAAYERLPL  256



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2677841696448