BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14490_g2_i1 len=552 path=[530:0-68 599:69-551]

Length=552
                                                                      Score     E

dbj|BAO57484.1|  transcription factor InNAP                             285   2e-93   
ref|XP_009781251.1|  PREDICTED: NAC transcription factor 29-like        266   4e-86   
ref|XP_009598866.1|  PREDICTED: NAC transcription factor 29-like        266   5e-86   
ref|NP_001275015.1|  NAC transcription factor 29-like                   265   1e-85   
ref|XP_006344264.1|  PREDICTED: NAC transcription factor 29-like        265   2e-85   
emb|CDP00360.1|  unnamed protein product                                264   3e-85   
ref|XP_009773865.1|  PREDICTED: NAC transcription factor 29-like        264   5e-85   
gb|AGL39683.1|  NAC transcription factor 027                            263   7e-85   
ref|XP_009606198.1|  PREDICTED: NAC transcription factor 29-like        263   9e-85   
gb|EYU28780.1|  hypothetical protein MIMGU_mgv1a021552mg                264   1e-84   
ref|XP_007046037.1|  NAC domain protein, IPR003441                      263   2e-84   
gb|ABI34386.1|  NAC-domain containing protein 29 , putative             259   2e-84   Solanum demissum
ref|XP_004237044.1|  PREDICTED: NAC transcription factor 29-like        262   2e-84   
ref|XP_011075519.1|  PREDICTED: LOW QUALITY PROTEIN: NAC transcri...    262   3e-84   
gb|AAW28573.2|  NAC-domain containing protein 29 , putative             259   4e-84   Solanum demissum
gb|AEQ61906.1|  NAC domain protein NAC2                                 262   4e-84   
ref|XP_002522466.1|  NAC domain-containing protein, putative            261   6e-84   Ricinus communis
ref|XP_004238810.1|  PREDICTED: NAC transcription factor 29             259   2e-83   
ref|XP_011070984.1|  PREDICTED: NAC transcription factor 29-like        259   3e-83   
ref|XP_007223324.1|  hypothetical protein PRUPE_ppa009530mg             259   5e-83   
ref|XP_010651865.1|  PREDICTED: NAC transcription factor 29             258   6e-83   
gb|ACX47024.1|  NAP-like transcription factor                           258   7e-83   Vitis vinifera
ref|XP_008221592.1|  PREDICTED: NAC transcription factor 29             258   7e-83   
ref|XP_010258284.1|  PREDICTED: NAC transcription factor 29-like        258   7e-83   
ref|XP_006438726.1|  hypothetical protein CICLE_v10032304mg             258   2e-82   
ref|NP_001280939.1|  NAC transcription factor 29-like                   257   2e-82   
gb|ABM67699.1|  NAC domain protein                                      256   2e-82   Citrus sinensis [Valencia orange]
gb|AGC27312.1|  NAC domain protein 9                                    257   3e-82   
ref|XP_010108694.1|  NAC domain-containing protein 29                   257   3e-82   
gb|AIA57511.1|  NAC domain-containing protein                           258   3e-82   
ref|XP_002312256.2|  hypothetical protein POPTR_0008s08850g             256   3e-82   Populus trichocarpa [western balsam poplar]
ref|XP_011017514.1|  PREDICTED: NAC transcription factor 29             256   5e-82   
ref|XP_008368238.1|  PREDICTED: NAC transcription factor 29-like        256   7e-82   
ref|XP_008361781.1|  PREDICTED: NAC transcription factor 29-like        256   8e-82   
ref|XP_010258043.1|  PREDICTED: NAC transcription factor 29-like        255   1e-81   
ref|XP_004135168.1|  PREDICTED: NAC transcription factor 29-like        255   1e-81   
ref|XP_002315038.1|  hypothetical protein POPTR_0010s17350g             255   2e-81   Populus trichocarpa [western balsam poplar]
ref|XP_011013028.1|  PREDICTED: NAC transcription factor 29-like        254   2e-81   
gb|ABZ89747.1|  NAC transcription factor NAP                            254   2e-81   
ref|XP_008446385.1|  PREDICTED: NAC transcription factor 29             254   2e-81   
ref|XP_003556789.1|  PREDICTED: NAC transcription factor 29             254   3e-81   
ref|XP_004297288.1|  PREDICTED: NAC transcription factor 29-like        254   4e-81   
gb|EPS70298.1|  hypothetical protein M569_04459                         251   1e-80   
gb|KHG28640.1|  NAC domain-containing 29 -like protein                  252   2e-80   
ref|XP_010066895.1|  PREDICTED: NAC transcription factor 29             251   4e-80   
ref|XP_004490093.1|  PREDICTED: NAC transcription factor 29-like        251   4e-80   
gb|ACU17872.1|  unknown                                                 246   5e-80   Glycine max [soybeans]
gb|EYU22403.1|  hypothetical protein MIMGU_mgv1a012228mg                250   5e-80   
gb|AGS08770.1|  NAC domain protein                                      251   5e-80   
gb|KCW64937.1|  hypothetical protein EUGRSUZ_G02486                     251   8e-80   
gb|KFK41373.1|  hypothetical protein AALP_AA2G121900                    250   1e-79   
ref|XP_006391010.1|  hypothetical protein EUTSA_v10018997mg             249   1e-79   
gb|KHN28140.1|  NAC domain-containing protein 29                        248   1e-79   
ref|XP_007153556.1|  hypothetical protein PHAVU_003G045600g             248   2e-79   
gb|KHN14494.1|  NAC domain-containing protein 29                        249   2e-79   
ref|NP_001238204.1|  NAC domain protein                                 249   2e-79   
gb|AFN55272.1|  NAC domain-containing protein                           250   2e-79   
ref|XP_010511986.1|  PREDICTED: NAC transcription factor 29-like        249   3e-79   
ref|XP_010415593.1|  PREDICTED: NAC transcription factor 29             248   4e-79   
gb|AIU47058.1|  NAC transcription factor                                248   4e-79   
ref|XP_010470936.1|  PREDICTED: NAC transcription factor 29-like        248   4e-79   
ref|NP_001235915.1|  transcriptional factor NAC51                       247   5e-79   
gb|AFI56994.1|  NAC2                                                    247   5e-79   
ref|NP_564966.1|  NAC transcription factor protein family               248   5e-79   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63330.1|  NAC domain protein NAC2                                 248   7e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887238.1|  NAC domain protein NAC2                            248   8e-79   
ref|XP_009105493.1|  PREDICTED: NAC transcription factor 29             247   1e-78   
emb|CDY40930.1|  BnaC06g30680D                                          247   1e-78   
gb|KHN01256.1|  NAC domain-containing protein 29                        247   2e-78   
ref|NP_001236855.1|  NAC domain protein NAC1                            247   2e-78   
ref|XP_006302669.1|  hypothetical protein CARUB_v10020776mg             246   2e-78   
gb|AHE80972.1|  NAC domain-containing protein                           246   4e-78   
ref|XP_007158644.1|  hypothetical protein PHAVU_002G170200g             245   5e-78   
ref|XP_003613866.1|  NAC domain protein                                 244   8e-78   
ref|XP_003613867.1|  NAC domain protein                                 241   8e-78   
gb|AFK39171.1|  unknown                                                 244   1e-77   
ref|XP_010683140.1|  PREDICTED: NAC transcription factor 29-like        243   5e-77   
emb|CDY51500.1|  BnaC06g43410D                                          243   7e-77   
ref|XP_009105596.1|  PREDICTED: NAC transcription factor 29-like        242   1e-76   
emb|CDY07348.1|  BnaA07g24270D                                          242   1e-76   
gb|ADK23915.1|  NAC protein                                             241   3e-76   
gb|AFK38271.1|  unknown                                                 241   3e-76   
ref|XP_003607731.1|  NAC domain protein                                 241   3e-76   
ref|XP_010044485.1|  PREDICTED: NAC transcription factor 29-like        232   8e-73   
dbj|BAF36563.1|  NAC domain protein                                     233   3e-72   Cymbidium hybrid cultivar
ref|XP_009406848.1|  PREDICTED: NAC transcription factor 29-like        230   3e-71   
ref|XP_009387374.1|  PREDICTED: NAC transcription factor 29-like        229   4e-71   
ref|XP_010938117.1|  PREDICTED: NAC transcription factor 29-like        229   2e-70   
ref|XP_009394856.1|  PREDICTED: NAC transcription factor 25-like        228   2e-70   
ref|XP_010931442.1|  PREDICTED: NAC transcription factor 29-like        228   3e-70   
ref|XP_004505411.1|  PREDICTED: NAC transcription factor 29-like        225   3e-70   
ref|XP_008793367.1|  PREDICTED: NAC transcription factor 29-like        228   3e-70   
ref|XP_003518189.1|  PREDICTED: NAC transcription factor NAM-2-like     228   3e-70   
ref|XP_010922870.1|  PREDICTED: NAC transcription factor 29-like        228   4e-70   
ref|XP_010921289.1|  PREDICTED: NAC transcription factor 25-like        228   4e-70   
ref|XP_008792524.1|  PREDICTED: NAC transcription factor 29-like        227   5e-70   
ref|XP_009416337.1|  PREDICTED: NAC transcription factor 29-like        225   7e-70   
gb|ABU40774.1|  NAP-like protein                                        222   3e-69   Crocus sativus [saffron crocus]
ref|XP_008782759.1|  PREDICTED: NAC transcription factor 25-like        224   7e-69   
gb|EMT02241.1|  NAC domain-containing protein 29                        221   8e-69   
ref|XP_003548053.1|  PREDICTED: NAC transcription factor NAM-2          224   1e-68   
ref|XP_003557998.1|  PREDICTED: NAC transcription factor NAM-B1-like    223   4e-68   
ref|XP_006829778.1|  hypothetical protein AMTR_s00119p00040230          223   4e-68   
gb|ACD39374.1|  NAC domain protein                                      216   4e-68   Glycine max [soybeans]
ref|XP_009392736.1|  PREDICTED: NAC domain-containing protein 67-...    222   5e-68   
ref|XP_002442733.1|  hypothetical protein SORBIDRAFT_08g001940          224   6e-68   Sorghum bicolor [broomcorn]
ref|XP_009410477.1|  PREDICTED: NAC transcription factor 29-like        219   1e-67   
ref|XP_010088481.1|  NAC domain-containing protein 29                   222   1e-67   
ref|XP_008240449.1|  PREDICTED: NAC transcription factor 25             222   1e-67   
emb|CBI32712.3|  unnamed protein product                                221   2e-67   
ref|XP_002275457.1|  PREDICTED: NAC domain-containing protein 2         221   2e-67   Vitis vinifera
ref|XP_009345059.1|  PREDICTED: NAC transcription factor 29-like        222   2e-67   
ref|XP_007151816.1|  hypothetical protein PHAVU_004G077400g             221   2e-67   
ref|XP_009366417.1|  PREDICTED: NAC transcription factor 29-like        222   2e-67   
ref|XP_007202090.1|  hypothetical protein PRUPE_ppa007445mg             221   2e-67   
ref|XP_010418059.1|  PREDICTED: NAC transcription factor 25-like        221   2e-67   
ref|NP_001049997.2|  Os03g0327800                                       216   2e-67   Oryza sativa Japonica Group [Japonica rice]
gb|AGS08758.1|  NAC domain protein                                      221   2e-67   
ref|XP_009353167.1|  PREDICTED: NAC transcription factor 29-like        221   2e-67   
ref|XP_002532683.1|  NAC domain-containing protein, putative            221   2e-67   Ricinus communis
ref|NP_001280963.1|  NAC transcription factor 29                        221   3e-67   
ref|XP_010473311.1|  PREDICTED: NAC transcription factor 25-like        220   3e-67   
gb|AGL39684.1|  NAC transcription factor 028                            220   4e-67   
ref|XP_002465328.1|  hypothetical protein SORBIDRAFT_01g036560          221   4e-67   Sorghum bicolor [broomcorn]
ref|XP_010430102.1|  PREDICTED: NAC transcription factor 25             219   4e-67   
ref|XP_006300981.1|  hypothetical protein CARUB_v10021371mg             219   4e-67   
ref|XP_007030230.1|  NAC domain containing protein 47, putative i...    220   4e-67   
ref|XP_010549620.1|  PREDICTED: NAC transcription factor 29             220   5e-67   
ref|XP_009769986.1|  PREDICTED: NAC transcription factor 25             220   5e-67   
gb|AHJ79165.1|  NAC domain protein NAC24                                220   5e-67   
ref|XP_008780790.1|  PREDICTED: NAC transcription factor 29-like        213   6e-67   
emb|CBI38329.3|  unnamed protein product                                219   6e-67   
ref|XP_008660189.1|  PREDICTED: NAC transcription factor 29-like        216   6e-67   
gb|KHG07368.1|  NAC domain-containing 18 -like protein                  219   6e-67   
ref|XP_004493136.1|  PREDICTED: NAC transcription factor 25-like        219   7e-67   
ref|XP_003635288.1|  PREDICTED: NAC transcription factor 25             219   7e-67   
gb|KEH38791.1|  NAC transcription factor-like protein                   219   8e-67   
emb|CDY12886.1|  BnaA09g13880D                                          218   8e-67   
emb|CDY40970.1|  BnaCnng10130D                                          218   8e-67   
ref|XP_011027905.1|  PREDICTED: NAC transcription factor 25-like        219   9e-67   
ref|XP_009113148.1|  PREDICTED: NAC transcription factor 25             218   9e-67   
ref|XP_002888109.1|  ANAC025                                            218   9e-67   
ref|XP_010100577.1|  NAC domain-containing protein 29                   219   9e-67   
ref|XP_006451941.1|  hypothetical protein CICLE_v10008628mg             220   1e-66   
gb|KHN36793.1|  NAC domain-containing protein 18                        220   1e-66   
ref|XP_007021327.1|  NAC domain protein, IPR003441                      219   1e-66   
ref|XP_003543257.1|  PREDICTED: NAC domain-containing protein 18        220   1e-66   
gb|ADP69101.1|  NAC transcription factor 1                              219   1e-66   
gb|AGC97438.1|  NAC protein 8                                           219   1e-66   
ref|XP_009780447.1|  PREDICTED: NAC transcription factor 25-like        216   1e-66   
ref|XP_006392059.1|  hypothetical protein EUTSA_v10023591mg             218   1e-66   
ref|NP_001281058.1|  NAC transcription factor 25-like                   219   1e-66   
gb|AAM65392.1|  NAM protein, putative                                   218   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006841705.1|  hypothetical protein AMTR_s00003p00252470          219   1e-66   
gb|EMS63328.1|  NAC domain-containing protein 29                        224   1e-66   
ref|XP_010999473.1|  PREDICTED: NAC transcription factor 29-like        219   1e-66   
ref|XP_006443351.1|  hypothetical protein CICLE_v10020717mg             219   1e-66   
ref|XP_002325400.1|  hypothetical protein POPTR_0019s04690g             219   2e-66   Populus trichocarpa [western balsam poplar]
gb|AHJ79194.1|  NAC domain protein NAC53                                218   2e-66   
ref|XP_008655238.1|  PREDICTED: NAC transcription factor NAM-2-like     219   2e-66   
gb|ACI15346.1|  NAC domain protein NAC5                                 219   2e-66   Gossypium hirsutum [American cotton]
ref|XP_010276466.1|  PREDICTED: NAC transcription factor 25-like ...    219   2e-66   
ref|XP_004293567.1|  PREDICTED: NAC transcription factor 25-like        219   2e-66   
ref|XP_007149615.1|  hypothetical protein PHAVU_005G084600g             219   2e-66   
ref|XP_003624592.1|  NAC domain transcription factor                    218   2e-66   
emb|CDP05873.1|  unnamed protein product                                218   2e-66   
ref|XP_002519008.1|  transcription factor, putative                     218   2e-66   Ricinus communis
gb|AGL39685.1|  NAC transcription factor 029                            219   2e-66   
ref|NP_564771.1|  NAC domain containing protein 25                      218   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001236142.1|  transcriptional factor NAC11                       218   2e-66   
ref|XP_009594217.1|  PREDICTED: NAC transcription factor 25-like        218   2e-66   
gb|AAB71483.1|  similar to NAM (gp|X92205|1321924) and CUC2 (gp|A...    216   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007133059.1|  hypothetical protein PHAVU_011G148000g             218   3e-66   
ref|XP_003540450.1|  PREDICTED: NAC domain-containing protein 18-...    219   3e-66   
gb|ADP69102.1|  NAC transcription factor 1                              218   3e-66   
ref|XP_010089502.1|  NAC domain-containing protein 18                   219   3e-66   
ref|XP_002316635.1|  no apical meristem family protein                  217   3e-66   Populus trichocarpa [western balsam poplar]
gb|AAN64999.1|  Putative NAM (no apical meristem) protein               219   3e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011095244.1|  PREDICTED: NAC transcription factor 25-like        218   3e-66   
ref|XP_008383789.1|  PREDICTED: NAC transcription factor 25-like ...    218   4e-66   
ref|XP_010686575.1|  PREDICTED: NAC transcription factor 25-like        218   4e-66   
gb|EEE58985.1|  hypothetical protein OsJ_10691                          219   4e-66   Oryza sativa Japonica Group [Japonica rice]
emb|CAN81855.1|  hypothetical protein VITISV_041250                     214   4e-66   Vitis vinifera
ref|XP_004487678.1|  PREDICTED: NAC domain-containing protein 18-...    218   4e-66   
ref|XP_010036180.1|  PREDICTED: NAC transcription factor 29-like        217   5e-66   
gb|AID55352.1|  NAC protein 1                                           216   5e-66   
ref|XP_003541120.1|  PREDICTED: NAC domain-containing protein 18-...    218   5e-66   
ref|XP_010644222.1|  PREDICTED: NAC transcription factor 25 isofo...    217   5e-66   
gb|KHG20342.1|  NAC domain-containing 18 -like protein                  217   6e-66   
gb|KHG14643.1|  NAC domain-containing 29 -like protein                  217   6e-66   
ref|XP_007211453.1|  hypothetical protein PRUPE_ppa007314mg             218   6e-66   
ref|XP_002305677.1|  no apical meristem family protein                  217   6e-66   Populus trichocarpa [western balsam poplar]
ref|XP_003559782.1|  PREDICTED: NAC domain-containing protein 18-...    218   6e-66   
gb|AID55348.1|  NAC protein 1                                           216   6e-66   
gb|EAZ19492.1|  hypothetical protein OsJ_35058                          214   7e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010268761.1|  PREDICTED: NAC transcription factor 25-like        217   7e-66   
ref|NP_001065627.1|  Os11g0126900                                       211   7e-66   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066034.2|  Os12g0123700                                       211   7e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010278293.1|  PREDICTED: NAC transcription factor NAM-B2-like    217   7e-66   
ref|XP_011047846.1|  PREDICTED: NAC transcription factor 25-like        217   7e-66   
gb|AGT56012.1|  sinor-like protein 1                                    216   8e-66   
ref|XP_006650022.1|  PREDICTED: NAC transcription factor NAM-B2-like    218   8e-66   
ref|NP_001266277.1|  uncharacterized protein LOC101247735               216   8e-66   
ref|XP_007161811.1|  hypothetical protein PHAVU_001G100200g             216   8e-66   
sp|A2YMR0.1|NAC10_ORYSI  RecName: Full=NAC transcription factor O...    219   9e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_010939827.1|  PREDICTED: NAC transcription factor 29-like ...    214   9e-66   
gb|AGL39682.1|  NAC transcription factor 026                            218   9e-66   
gb|AGS08767.1|  NAC domain protein                                      218   1e-65   
ref|NP_001280970.1|  NAC transcription factor 25-like                   217   1e-65   
ref|XP_004984512.1|  PREDICTED: NAC transcription factor NAM-B1-like    217   1e-65   
ref|XP_007025712.1|  NAC domain containing protein 25                   216   1e-65   
ref|XP_009379434.1|  PREDICTED: NAC transcription factor 25             217   1e-65   
gb|AIW49540.1|  NAC transcription factor NAM-A2                         218   1e-65   
ref|XP_007159283.1|  hypothetical protein PHAVU_002G224900g             216   1e-65   
ref|XP_006657850.1|  PREDICTED: NAC transcription factor ONAC010-...    219   1e-65   
gb|EYU33415.1|  hypothetical protein MIMGU_mgv1a009589mg                216   2e-65   
ref|XP_002284654.2|  PREDICTED: NAC transcription factor 25 isofo...    216   2e-65   Vitis vinifera
ref|XP_007030229.1|  NAC domain containing protein 47, putative i...    218   2e-65   
ref|XP_006449287.1|  hypothetical protein CICLE_v10015688mg             216   2e-65   
gb|KFK42926.1|  hypothetical protein AALP_AA1G056200                    215   2e-65   
ref|XP_006663768.1|  PREDICTED: NAC transcription factor 25-like        217   2e-65   
ref|XP_009420951.1|  PREDICTED: NAC transcription factor 29-like        214   2e-65   
ref|XP_006467845.1|  PREDICTED: NAC transcription factor 25-like        216   2e-65   
ref|XP_008224995.1|  PREDICTED: NAC transcription factor 25             216   2e-65   
ref|XP_011042501.1|  PREDICTED: NAC domain-containing protein 18-...    216   2e-65   
ref|XP_006370307.1|  no apical meristem family protein                  216   2e-65   
emb|CBI20351.3|  unnamed protein product                                215   2e-65   
gb|AHC54052.1|  transcriptional factor NAC11                            216   2e-65   
gb|KHN46799.1|  NAC domain-containing protein 29                        216   2e-65   
ref|XP_010060527.1|  PREDICTED: NAC domain-containing protein 18-...    216   2e-65   
ref|XP_003553546.1|  PREDICTED: NAC transcription factor 25-like        215   2e-65   
ref|NP_001060017.1|  Os07g0566500                                       218   2e-65   Oryza sativa Japonica Group [Japonica rice]
gb|KHN02351.1|  NAC domain-containing protein 29                        215   2e-65   
gb|ABI94356.1|  NAC transcription factor NAM-D2                         216   3e-65   Aegilops tauschii
ref|XP_010054307.1|  PREDICTED: NAC transcription factor 25-like        216   3e-65   
ref|XP_004958056.1|  PREDICTED: NAC transcription factor NAM-2-like     217   4e-65   
gb|AEH68228.1|  NAC transcription factor                                216   4e-65   
gb|AID55350.1|  NAC protein 3                                           214   4e-65   
gb|AIZ97668.1|  NAC transcription factor NAM-D2                         216   4e-65   
dbj|BAK04712.1|  predicted protein                                      216   5e-65   
ref|XP_003562891.1|  PREDICTED: NAC transcription factor NAM-B2-like    217   5e-65   
ref|XP_004147807.1|  PREDICTED: NAC transcription factor ONAC010-...    214   5e-65   
gb|KEH31125.1|  NAC transcription factor-like protein                   214   5e-65   
ref|XP_011098344.1|  PREDICTED: NAC domain-containing protein 18        214   5e-65   
gb|EAY82108.1|  hypothetical protein OsI_37306                          216   6e-65   Oryza sativa Indica Group [Indian rice]
gb|EAZ17264.1|  hypothetical protein OsJ_32784                          216   6e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977420.1|  PREDICTED: NAC transcription factor 25-like        215   6e-65   
ref|XP_002519550.1|  transcription factor, putative                     213   6e-65   Ricinus communis
gb|AEI00651.1|  NAC3                                                    216   6e-65   
ref|XP_010533896.1|  PREDICTED: NAC transcription factor 25 isofo...    213   7e-65   
gb|AGC27313.1|  NAC domain protein 10                                   214   7e-65   
ref|NP_001284435.1|  NAC domain-containing protein 18-like              213   7e-65   
sp|A0SPJ6.1|NAMB2_TRITD  RecName: Full=NAC transcription factor N...    216   7e-65   Triticum turgidum subsp. durum
gb|ABA95705.1|  NAC domain transcription factor, putative, expressed    216   7e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004958721.1|  PREDICTED: NAC transcription factor ONAC010-...    214   8e-65   
emb|CDM83185.1|  unnamed protein product                                216   8e-65   
ref|XP_011029435.1|  PREDICTED: NAC domain-containing protein 18-...    214   8e-65   
gb|AAU08785.1|  NAC domain transcription factor                         214   9e-65   Triticum aestivum [Canadian hard winter wheat]
gb|EAY79778.1|  hypothetical protein OsI_34934                          215   9e-65   Oryza sativa Indica Group [Indian rice]
gb|KHG11072.1|  NAC domain-containing 29 -like protein                  214   9e-65   
gb|ABA91266.1|  NAC domain transcription factor, putative, expressed    215   9e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007148205.1|  hypothetical protein PHAVU_006G188900g             214   1e-64   
ref|XP_002316919.2|  no apical meristem family protein                  214   1e-64   Populus trichocarpa [western balsam poplar]
ref|NP_001238061.1|  NAC domain protein                                 214   1e-64   
gb|EMT28859.1|  NAC domain-containing protein 29                        214   1e-64   
ref|XP_002448919.1|  hypothetical protein SORBIDRAFT_05g001580          215   1e-64   Sorghum bicolor [broomcorn]
ref|XP_003528438.1|  PREDICTED: NAC transcription factor 25-like        214   1e-64   
gb|AHB63580.1|  NAC transcription factor                                214   1e-64   
ref|XP_002525467.1|  transcription factor, putative                     214   1e-64   Ricinus communis
ref|XP_010533895.1|  PREDICTED: NAC transcription factor 25 isofo...    214   1e-64   
ref|XP_006662692.1|  PREDICTED: NAC transcription factor 25-like        214   2e-64   
ref|XP_008226677.1|  PREDICTED: NAC transcription factor 25             214   2e-64   
ref|XP_006408226.1|  hypothetical protein EUTSA_v10021011mg             214   2e-64   
ref|XP_008452274.1|  PREDICTED: NAC transcription factor 25-like        213   2e-64   
ref|XP_011034424.1|  PREDICTED: NAC transcription factor 29-like        214   2e-64   
ref|XP_004149287.1|  PREDICTED: NAC transcription factor 25-like        213   2e-64   
emb|CAG28971.1|  NAM-like protein                                       214   2e-64   Prunus persica
ref|XP_004505006.1|  PREDICTED: NAC transcription factor 25-like        213   2e-64   
tpg|DAA63172.1|  TPA: putative NAC domain transcription factor su...    215   2e-64   
ref|XP_002463039.1|  hypothetical protein SORBIDRAFT_02g036620          215   2e-64   
ref|XP_004978485.1|  PREDICTED: NAC transcription factor 25-like        213   2e-64   
sp|A0SPJ9.1|NAM2_HORVD  RecName: Full=NAC transcription factor NA...    214   2e-64   
gb|AET07181.1|  NAC transcription factor                                213   3e-64   
ref|XP_007211475.1|  hypothetical protein PRUPE_ppa007577mg             213   3e-64   
ref|XP_006297959.1|  hypothetical protein CARUB_v10014000mg             213   3e-64   
ref|NP_001151613.1|  NAC domain transcription factor                    214   3e-64   
ref|XP_006645427.1|  PREDICTED: NAC transcription factor NAM-B1-like    212   3e-64   
gb|AID55353.1|  NAC protein 2                                           211   4e-64   
emb|CDY42902.1|  BnaC05g47490D                                          210   5e-64   
ref|XP_008800137.1|  PREDICTED: NAC transcription factor 25             213   5e-64   
ref|XP_009130419.1|  PREDICTED: LOW QUALITY PROTEIN: NAC domain-c...    212   6e-64   
ref|XP_009593586.1|  PREDICTED: NAC transcription factor ONAC010 ...    206   6e-64   
ref|XP_004172388.1|  PREDICTED: LOW QUALITY PROTEIN: NAC transcri...    211   6e-64   
gb|EEC82702.1|  hypothetical protein OsI_27367                          212   6e-64   
sp|D2SMN4.1|NAMB1_HORVS  RecName: Full=NAC transcription factor N...    214   6e-64   
ref|XP_010518139.1|  PREDICTED: NAC transcription factor 29-like        212   7e-64   
ref|XP_010463881.1|  PREDICTED: NAC transcription factor 25-like        212   7e-64   
ref|XP_002319143.2|  hypothetical protein POPTR_0013s05080g             212   7e-64   
gb|AAY44097.1|  NAC domain transcription factor                         212   8e-64   
emb|CDY29983.1|  BnaC01g40250D                                          212   8e-64   
gb|KFK35761.1|  hypothetical protein AALP_AA4G032900                    209   8e-64   
gb|KFK37842.1|  hypothetical protein AALP_AA3G036200                    211   9e-64   
emb|CDY50880.1|  BnaA05g37410D                                          211   1e-63   
ref|XP_010485778.1|  PREDICTED: NAC transcription factor 29-like        211   1e-63   
ref|XP_003597198.1|  NAC domain-containing protein                      211   1e-63   
gb|EMT14095.1|  NAC domain-containing protein 29                        211   1e-63   
tpe|CBZ41159.1|  TPA: NAC transcription factor                          211   1e-63   
gb|KEH15120.1|  NAC transcription factor-like protein                   209   1e-63   
gb|AAY44098.1|  NAC domain transcription factor                         211   1e-63   
ref|NP_001274379.1|  NAC domain-containing protein 18-like              212   1e-63   
gb|KHN36348.1|  NAC domain-containing protein 18                        212   1e-63   
ref|XP_006843547.1|  hypothetical protein AMTR_s00007p00063550          211   1e-63   
ref|XP_002884426.1|  ANAC047                                            211   1e-63   
ref|XP_009125011.1|  PREDICTED: NAC domain-containing protein 67-...    211   1e-63   
ref|NP_001234652.1|  NAC domain protein                                 211   1e-63   
ref|XP_007027296.1|  NAC domain protein, IPR003441, putative            211   2e-63   
ref|XP_003541742.1|  PREDICTED: NAC transcription factor 25-like        211   2e-63   
gb|EPS69130.1|  hypothetical protein M569_05637                         205   2e-63   
ref|XP_003541998.1|  PREDICTED: NAC transcription factor ONAC010-...    210   2e-63   
ref|NP_001118568.1|  NAC domain containing protein 47                   210   2e-63   
gb|AEI00653.1|  NAC5                                                    212   2e-63   
gb|KHN08560.1|  NAC domain-containing protein 18                        211   3e-63   
ref|XP_006362947.1|  PREDICTED: NAC transcription factor 25-like        210   3e-63   
gb|AAU43923.2|  NAC domain protein                                      210   3e-63   
ref|XP_009593583.1|  PREDICTED: NAC transcription factor 25 isofo...    207   3e-63   
ref|NP_187057.2|  NAC domain containing protein 47                      210   3e-63   
ref|XP_004291668.1|  PREDICTED: NAC transcription factor ONAC010-...    210   3e-63   
gb|AID55349.1|  NAC protein 2                                           209   3e-63   
gb|AEI00649.1|  NAC1                                                    212   3e-63   
gb|ABI94354.1|  NAC transcription factor NAM-D1                         212   3e-63   
ref|XP_006381471.1|  hypothetical protein POPTR_0006s13140g             206   4e-63   
ref|XP_007150216.1|  hypothetical protein PHAVU_005G136400g             210   4e-63   
gb|AFD54031.1|  NAC transcription factor NAM-1                          211   4e-63   
gb|AFD54039.1|  NAC transcription factor NAM-1                          211   4e-63   
emb|CBZ39285.1|  NAC transcription factor                               210   4e-63   
dbj|BAJ99416.1|  predicted protein                                      210   4e-63   
gb|AFD54035.1|  NAC transcription factor NAM-1                          211   5e-63   
ref|XP_009392346.1|  PREDICTED: NAC transcription factor NAM-B2-like    211   5e-63   
gb|AFD54037.1|  NAC transcription factor NAM-1                          211   5e-63   
gb|AFD54040.1|  NAC transcription factor NAM-1                          211   5e-63   
gb|AFD54033.1|  NAC transcription factor NAM-1                          211   6e-63   
sp|A0SPJ8.1|NAM1_HORVD  RecName: Full=NAC transcription factor NA...    211   6e-63   
gb|AFD54034.1|  NAC transcription factor NAM-1                          211   6e-63   
gb|AFD54036.1|  NAC transcription factor NAM-1                          211   7e-63   
ref|XP_002282566.1|  PREDICTED: NAC domain-containing protein 67        209   7e-63   
gb|AEI00650.1|  NAC2                                                    211   7e-63   
ref|XP_002991700.1|  hypothetical protein SELMODRAFT_133982             204   7e-63   
ref|XP_002967149.1|  hypothetical protein SELMODRAFT_86855              204   8e-63   
tpg|DAA64160.1|  TPA: putative NAC domain transcription factor su...    210   8e-63   
ref|XP_011096265.1|  PREDICTED: NAC transcription factor 25             209   8e-63   
ref|XP_010651145.1|  PREDICTED: NAC transcription factor 25-like        203   8e-63   
gb|AEH68227.1|  NAC transcription factor                                211   9e-63   
sp|A0SPJ3.1|NAMA1_TRITD  RecName: Full=NAC transcription factor N...    211   9e-63   
ref|XP_008782049.1|  PREDICTED: NAC transcription factor 29-like        208   1e-62   
ref|XP_009334622.1|  PREDICTED: NAC domain-containing protein 18        209   1e-62   
ref|XP_002463403.1|  hypothetical protein SORBIDRAFT_02g043210          210   1e-62   
ref|XP_010542275.1|  PREDICTED: LOW QUALITY PROTEIN: NAC domain-c...    208   1e-62   
emb|CDP06728.1|  unnamed protein product                                209   1e-62   
ref|XP_008799211.1|  PREDICTED: NAC transcription factor ONAC010-...    203   1e-62   
gb|AIA57531.1|  NAC domain-containing protein                           209   1e-62   
gb|AEI98789.1|  NAC transcription factor NAM-G1                         210   1e-62   
gb|AFD54030.1|  NAC transcription factor NAM-1                          210   1e-62   
gb|ACJ14498.1|  mutant NAC domain protein                               209   1e-62   
gb|AEI98791.1|  NAC transcription factor NAM-G1                         210   1e-62   
gb|AFD54038.1|  NAC transcription factor NAM-1                          210   1e-62   
gb|AEI98793.1|  NAC transcription factor NAM-G1                         210   1e-62   
ref|XP_010107555.1|  NAC domain-containing protein 29                   208   1e-62   
gb|AEI98794.1|  NAC transcription factor NAM-G1                         210   1e-62   
ref|XP_010904917.1|  PREDICTED: NAC transcription factor NAM-B2-like    207   1e-62   
gb|EYU27944.1|  hypothetical protein MIMGU_mgv1a020591mg                207   2e-62   
gb|AGL39678.1|  NAC transcription factor 022                            206   2e-62   
ref|XP_006392856.1|  hypothetical protein EUTSA_v10012308mg             206   2e-62   
gb|ABY67950.1|  NAM-1                                                   210   2e-62   
ref|XP_007162738.1|  hypothetical protein PHAVU_001G176100g             207   2e-62   
ref|XP_008243919.1|  PREDICTED: NAC transcription factor 29-like        208   2e-62   
ref|XP_007206224.1|  hypothetical protein PRUPE_ppa015363mg             208   2e-62   
gb|AGC27321.1|  NAC domain protein 10                                   207   2e-62   
ref|XP_003547137.1|  PREDICTED: NAC transcription factor 25-like        208   2e-62   
ref|XP_008651547.1|  PREDICTED: NAC domain transcription factor i...    211   2e-62   
ref|XP_010924066.1|  PREDICTED: NAC transcription factor 25-like        209   3e-62   
gb|EMT26194.1|  NAC domain-containing protein 18                        209   3e-62   
ref|XP_008386130.1|  PREDICTED: NAC domain-containing protein 18-...    208   3e-62   
ref|XP_006658973.1|  PREDICTED: NAC transcription factor ONAC010-...    207   3e-62   
ref|XP_002991033.1|  hypothetical protein SELMODRAFT_47266              203   3e-62   
ref|XP_009609295.1|  PREDICTED: NAC transcription factor 25-like        207   4e-62   
ref|XP_009759753.1|  PREDICTED: NAC transcription factor 25-like        207   4e-62   
ref|XP_002526377.1|  NAC domain-containing protein, putative            207   4e-62   
ref|XP_003539409.1|  PREDICTED: NAC domain-containing protein 2-like    207   5e-62   
ref|XP_003525764.2|  PREDICTED: NAC transcription factor 29-like        204   5e-62   
ref|XP_003625606.1|  NAC domain transcription factor                    206   5e-62   
ref|XP_007015431.1|  NAC domain containing protein 25, putative         208   5e-62   
gb|AGH32788.1|  NAC transcription factor NAM-B1                         208   6e-62   
gb|AEI98788.1|  NAC transcription factor NAM-G1                         208   7e-62   
ref|XP_004487133.1|  PREDICTED: NAC transcription factor NAM-B2-like    206   7e-62   
gb|AGS08759.1|  NAC domain protein                                      207   7e-62   
gb|AGZ20132.1|  NAC transcription factor NAM-B1                         208   7e-62   
gb|AEI98787.1|  NAC transcription factor NAM-G1                         208   7e-62   
ref|NP_001280984.1|  NAC domain-containing protein 18                   207   7e-62   
gb|AGZ20119.1|  NAC transcription factor NAM-B1                         208   7e-62   
sp|A0SPJ4.1|NAMB1_TRIDC  RecName: Full=NAC transcription factor N...    208   8e-62   
emb|CDY22671.1|  BnaC08g43050D                                          202   8e-62   
gb|AGH32785.1|  NAC transcription factor NAM-B1                         208   8e-62   
gb|AGZ20118.1|  NAC transcription factor NAM-B1                         208   8e-62   
gb|AGH32787.1|  NAC transcription factor NAM-B1                         208   9e-62   
gb|AEQ28762.1|  NAC domain class transcription factor                   206   9e-62   
gb|AGZ20123.1|  NAC transcription factor NAM-B1                         208   1e-61   
ref|XP_004493961.1|  PREDICTED: NAC transcription factor ONAC010-...    206   1e-61   
emb|CDX97675.1|  BnaA05g24040D                                          206   1e-61   
gb|AEI98795.1|  NAC transcription factor NAM-G1                         207   1e-61   
ref|XP_010524963.1|  PREDICTED: NAC domain-containing protein 18-...    206   1e-61   
gb|AGZ20129.1|  NAC transcription factor NAM-B1                         207   1e-61   
emb|CBI16292.3|  unnamed protein product                                206   1e-61   
ref|NP_001183815.1|  putative NAC domain transcription factor sup...    209   1e-61   
emb|CDX82430.1|  BnaA03g33910D                                          201   1e-61   
gb|AGZ20135.1|  NAC transcription factor NAM-B1                         207   2e-61   
ref|XP_002960864.1|  hypothetical protein SELMODRAFT_71307              199   2e-61   
ref|XP_010921105.1|  PREDICTED: NAC transcription factor NAM-B2-like    206   2e-61   
gb|AID55354.1|  NAC protein 3                                           204   2e-61   
ref|XP_006593180.1|  PREDICTED: NAC transcription factor 29-like        199   2e-61   
gb|AEI98790.1|  NAC transcription factor NAM-G1                         207   2e-61   
ref|XP_008799210.1|  PREDICTED: NAC transcription factor 25-like ...    207   2e-61   
gb|ACN31888.1|  unknown                                                 200   2e-61   
ref|XP_009146237.1|  PREDICTED: NAC domain-containing protein 18        205   3e-61   
ref|XP_010558707.1|  PREDICTED: NAC transcription factor 29-like        205   3e-61   
gb|AGZ20137.1|  NAC transcription factor NAM-B1                         206   3e-61   
gb|KHN09490.1|  NAC domain-containing protein 29                        203   3e-61   
gb|AHJ79180.1|  NAC domain protein NAC39                                205   3e-61   
ref|XP_011048576.1|  PREDICTED: putative NAC domain-containing pr...    205   4e-61   
ref|NP_188170.1|  NAC domain containing protein 2                       205   4e-61   
emb|CDY69545.1|  BnaCnng64100D                                          204   4e-61   
ref|XP_009377421.1|  PREDICTED: NAC transcription factor 29-like        204   4e-61   
gb|KFK38893.1|  hypothetical protein AALP_AA3G174600                    204   4e-61   
emb|CDY20131.1|  BnaA01g28710D                                          204   4e-61   
emb|CDY56427.1|  BnaCnng30350D                                          204   5e-61   
gb|AGV29510.1|  putative NAC domain class transcription factor          199   5e-61   
ref|XP_002882948.1|  ATNAC2                                             205   5e-61   
gb|KHN47410.1|  NAC domain-containing protein 29                        199   5e-61   
ref|XP_006297968.1|  hypothetical protein CARUB_v10014008mg             205   5e-61   
ref|XP_009378497.1|  PREDICTED: NAC domain-containing protein 18-...    205   5e-61   
ref|XP_006406961.1|  hypothetical protein EUTSA_v10022353mg             205   5e-61   
ref|XP_008355629.1|  PREDICTED: NAC transcription factor 29-like        204   5e-61   
gb|AFD54032.1|  NAC transcription factor NAM-1                          206   5e-61   
gb|AGZ20133.1|  NAC transcription factor NAM-B1                         206   6e-61   
gb|AGZ20124.1|  NAC transcription factor NAM-B1                         206   6e-61   
ref|XP_002976404.1|  hypothetical protein SELMODRAFT_105213             198   7e-61   
ref|XP_010503061.1|  PREDICTED: NAC domain-containing protein 18-...    204   7e-61   
ref|XP_009147651.1|  PREDICTED: NAC domain-containing protein 18 ...    203   7e-61   
ref|XP_010465520.1|  PREDICTED: NAC domain-containing protein 18-...    204   8e-61   
ref|XP_009418167.1|  PREDICTED: NAC transcription factor NAM-B2-like    206   8e-61   
gb|ABK24803.1|  unknown                                                 199   8e-61   
emb|CDY53806.1|  BnaA06g01770D                                          203   9e-61   
ref|XP_001771652.1|  predicted protein                                  199   9e-61   
ref|XP_002987237.1|  hypothetical protein SELMODRAFT_125697             198   1e-60   
gb|ACN62416.1|  NAC transcription factor                                204   1e-60   
ref|XP_009115491.1|  PREDICTED: NAC domain-containing protein 18-...    204   1e-60   
gb|EMS58089.1|  NAC domain-containing protein 29                        204   1e-60   
gb|ACJ48971.1|  cold stress-induced NAC domain protein                  203   2e-60   
ref|XP_006305156.1|  hypothetical protein CARUB_v10009524mg             203   2e-60   
emb|CDO99476.1|  unnamed protein product                                202   2e-60   
emb|CDX98562.1|  BnaC05g38130D                                          203   2e-60   
ref|XP_010052353.1|  PREDICTED: NAC transcription factor 25-like        203   2e-60   
ref|XP_001773582.1|  predicted protein                                  197   2e-60   
gb|EPS59407.1|  hypothetical protein M569_15400                         197   2e-60   
ref|XP_010675608.1|  PREDICTED: NAC transcription factor 25             204   2e-60   
ref|XP_001769642.1|  predicted protein                                  198   2e-60   
ref|XP_009135446.1|  PREDICTED: NAC domain-containing protein 18-...    202   3e-60   
ref|XP_001779494.1|  predicted protein                                  197   3e-60   
ref|XP_004306241.1|  PREDICTED: NAC transcription factor 29-like        202   4e-60   
gb|AGL39679.1|  NAC transcription factor 023                            202   4e-60   
emb|CBI29915.3|  unnamed protein product                                209   5e-60   
ref|XP_010535118.1|  PREDICTED: NAC domain-containing protein 18-...    201   5e-60   
gb|ABK23477.1|  unknown                                                 201   5e-60   
ref|XP_006488646.1|  PREDICTED: NAC domain-containing protein 18-...    202   6e-60   
gb|ABK22535.1|  unknown                                                 201   6e-60   
ref|XP_010276467.1|  PREDICTED: NAC transcription factor 25-like ...    202   7e-60   
ref|XP_006424612.1|  hypothetical protein CICLE_v10030252mg             201   7e-60   
ref|XP_001752718.1|  predicted protein                                  197   7e-60   
ref|XP_003564478.1|  PREDICTED: NAC domain-containing protein 68-...    200   1e-59   
gb|KDO73209.1|  hypothetical protein CISIN_1g045934mg                   201   1e-59   
ref|NP_001146648.1|  putative NAC domain transcription factor sup...    199   1e-59   
tpg|DAA60058.1|  TPA: putative NAC domain transcription factor su...    195   2e-59   
ref|XP_002459566.1|  hypothetical protein SORBIDRAFT_02g006680          198   3e-59   
tpg|DAA57121.1|  TPA: putative NAC domain and pentatricopeptide r...    211   3e-59   
ref|XP_010239042.1|  PREDICTED: NAC domain-containing protein 67-...    198   4e-59   
ref|XP_002305109.1|  hypothetical protein POPTR_0004s04920g             198   9e-59   
dbj|BAJ96161.1|  predicted protein                                      197   1e-58   
emb|CAM57977.1|  putative NAC transcription factor                      196   1e-58   
ref|XP_004174082.1|  PREDICTED: LOW QUALITY PROTEIN: NAC transcri...    198   1e-58   
ref|XP_002317321.2|  hypothetical protein POPTR_0011s05760g             197   1e-58   
gb|ADE34585.1|  NAC transcription factor 4                              197   2e-58   
ref|XP_008359072.1|  PREDICTED: NAC domain-containing protein 2-like    197   2e-58   
ref|XP_010931441.1|  PREDICTED: NAC domain-containing protein 68-...    196   2e-58   
emb|CDM84716.1|  unnamed protein product                                197   2e-58   
tpg|DAA57122.1|  TPA: putative NAC domain and pentatricopeptide r...    206   2e-58   
gb|ADD10666.1|  transcription factor TaNAC4                             196   2e-58   
gb|KCW85722.1|  hypothetical protein EUGRSUZ_B02485                     196   2e-58   
ref|XP_011027935.1|  PREDICTED: protein FEZ-like                        197   2e-58   
gb|ADX60089.1|  NAC transcription factor                                196   2e-58   
ref|XP_007025526.1|  NAC domain containing protein 25                   196   2e-58   
ref|NP_001141629.2|  putative NAC domain transcription factor sup...    196   3e-58   



>dbj|BAO57484.1| transcription factor InNAP [Ipomoea nil]
 dbj|BAO57485.1| transcription factor InNAP [Ipomoea nil]
 dbj|BAO57486.1| transcription factor InNAP [Ipomoea nil]
Length=282

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/134 (100%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE
Sbjct  1    MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP
Sbjct  61   FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  120

Query  42   PKGIKTDWIMHEYR  1
            PKGIKTDWIMHEYR
Sbjct  121  PKGIKTDWIMHEYR  134



>ref|XP_009781251.1| PREDICTED: NAC transcription factor 29-like [Nicotiana sylvestris]
Length=280

 Score =   266 bits (681),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M+G   +  LPPGFRFHPTDEELIMYYLRNQATS PCPVSIIPEVD+YKFDPWELPEKAE
Sbjct  1    MVGKNNSEQLPPGFRFHPTDEELIMYYLRNQATSRPCPVSIIPEVDVYKFDPWELPEKAE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGE+EWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVG+KKALVFYKG+P
Sbjct  61   FGEREWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGIKKALVFYKGKP  120

Query  42   PKGIKTDWIMHEYR  1
            PKGIKTDWIMHEYR
Sbjct  121  PKGIKTDWIMHEYR  134



>ref|XP_009598866.1| PREDICTED: NAC transcription factor 29-like [Nicotiana tomentosiformis]
Length=283

 Score =   266 bits (681),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M+G   + +LPPGFRFHPTDEELIMYYLRNQATS PCPVSIIPEVD+YKFDPWELPEKAE
Sbjct  1    MVGKNCSEELPPGFRFHPTDEELIMYYLRNQATSRPCPVSIIPEVDVYKFDPWELPEKAE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGE+EWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVG+KKALVFY+GRP
Sbjct  61   FGEREWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGIKKALVFYEGRP  120

Query  42   PKGIKTDWIMHEYR  1
            PKGIKTDWIMHEYR
Sbjct  121  PKGIKTDWIMHEYR  134



>ref|NP_001275015.1| NAC transcription factor 29-like [Solanum tuberosum]
 gb|ABK96797.1| NAC domain protein NAC2 [Solanum tuberosum]
Length=282

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M GK +SDLPPGFRFHPTDEELIMYYLR QATS PCPVSIIPE+DIYKFDPWELPEKAEF
Sbjct  1    MVGKTSSDLPPGFRFHPTDEELIMYYLRYQATSRPCPVSIIPEIDIYKFDPWELPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS +KYVG+KKALVFYKG+PP
Sbjct  61   GENEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSANKYVGIKKALVFYKGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGVKTDWIMHEYR  133



>ref|XP_006344264.1| PREDICTED: NAC transcription factor 29-like [Solanum tuberosum]
Length=283

 Score =   265 bits (676),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M+G   ++ LPPGFRFHPTDEELI+YYLRNQATS PCP SIIPEVDIYKFDPWELPEKAE
Sbjct  1    MIGKNNSNHLPPGFRFHPTDEELIIYYLRNQATSRPCPSSIIPEVDIYKFDPWELPEKAE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSG+KYVG+KKALVFYKG+P
Sbjct  61   FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGTKYVGIKKALVFYKGKP  120

Query  42   PKGIKTDWIMHEYR  1
            PKGIKTDWIMHEYR
Sbjct  121  PKGIKTDWIMHEYR  134



>emb|CDP00360.1| unnamed protein product [Coffea canephora]
Length=274

 Score =   264 bits (675),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M G+ +SDLPPGFRFHPTDEELIMYYLRNQA S PCPVSIIPEVDIYKFDPW+LPEK EF
Sbjct  1    MVGRNSSDLPPGFRFHPTDEELIMYYLRNQAISRPCPVSIIPEVDIYKFDPWDLPEKTEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDK+IYSGSKYVGVKKALVFY+GRPP
Sbjct  61   GENEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKSIYSGSKYVGVKKALVFYQGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>ref|XP_009773865.1| PREDICTED: NAC transcription factor 29-like [Nicotiana sylvestris]
Length=291

 Score =   264 bits (675),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M GK +SDLPPGFRFHPTDEELIMYYLR QATS PCPVSIIPEVD+YKFDPWELPEKAEF
Sbjct  1    MVGKISSDLPPGFRFHPTDEELIMYYLRYQATSRPCPVSIIPEVDLYKFDPWELPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS SKYVGVKKALVFYKG+PP
Sbjct  61   GENEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSASKYVGVKKALVFYKGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGVKTDWIMHEYR  133



>gb|AGL39683.1| NAC transcription factor 027 [Jatropha curcas]
 gb|KDP41227.1| hypothetical protein JCGZ_15634 [Jatropha curcas]
Length=283

 Score =   263 bits (673),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M GK +S+LPPGFRFHPTDEEL++YYLRNQA+S PCPV+IIPEVDIYKFDPW+LPEKAEF
Sbjct  1    MLGKNSSNLPPGFRFHPTDEELVVYYLRNQASSKPCPVAIIPEVDIYKFDPWQLPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PRDRKYPNGVRPNRA VSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP
Sbjct  61   GENEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGVKTDWIMHEYR  133



>ref|XP_009606198.1| PREDICTED: NAC transcription factor 29-like [Nicotiana tomentosiformis]
Length=292

 Score =   263 bits (673),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M GK +SDLPPGFRFHPTDEELIMYYLR QATS PCPVSIIPEVD+YKFDPWELPEKAEF
Sbjct  1    MVGKISSDLPPGFRFHPTDEELIMYYLRYQATSRPCPVSIIPEVDLYKFDPWELPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS SKYVGVKKALVFYKG+PP
Sbjct  61   GENEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSASKYVGVKKALVFYKGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGVKTDWIMHEYR  133



>gb|EYU28780.1| hypothetical protein MIMGU_mgv1a021552mg [Erythranthe guttata]
Length=308

 Score =   264 bits (674),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 129/134 (96%), Gaps = 1/134 (1%)
 Frame = -1

Query  399  MGGK-QTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            MGGK   S+LPPGFRFHPTDEELIM+YLRNQATS PCPVSIIPEVDIYKFDPWELPEKAE
Sbjct  1    MGGKFINSNLPPGFRFHPTDEELIMHYLRNQATSKPCPVSIIPEVDIYKFDPWELPEKAE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGE EWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKG+P
Sbjct  61   FGENEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGKP  120

Query  42   PKGIKTDWIMHEYR  1
            PKGIKTDWIMHEYR
Sbjct  121  PKGIKTDWIMHEYR  134



>ref|XP_007046037.1| NAC domain protein, IPR003441 [Theobroma cacao]
 gb|EOY01869.1| NAC domain protein, IPR003441 [Theobroma cacao]
Length=284

 Score =   263 bits (671),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M GK +SDLPPGFRFHPTDEELIMYYLRNQA S PCPVSIIPEVDIYKFDPW+LP+KA F
Sbjct  1    MEGKASSDLPPGFRFHPTDEELIMYYLRNQAKSRPCPVSIIPEVDIYKFDPWQLPDKAGF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PRDRKYPNGVRPNRA VSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP
Sbjct  61   GENEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>gb|ABI34386.1| NAC-domain containing protein 29 , putative [Solanum demissum]
Length=194

 Score =   259 bits (662),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M GK +SDLPPGFRFHPTDEELIMYYLR QATS PCPVSIIPE+D+YKFDPWELPEKAEF
Sbjct  1    MVGKISSDLPPGFRFHPTDEELIMYYLRYQATSRPCPVSIIPEIDVYKFDPWELPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS +KYVG+KKALVFYKG+PP
Sbjct  61   GENEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSANKYVGIKKALVFYKGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGVKTDWIMHEYR  133



>ref|XP_004237044.1| PREDICTED: NAC transcription factor 29-like [Solanum lycopersicum]
Length=275

 Score =   262 bits (669),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M+G   ++ LPPGFRFHPTDEELIMYYLRNQATS PCP SIIPEVD+YKFDPWELPEK E
Sbjct  1    MVGKNNSNHLPPGFRFHPTDEELIMYYLRNQATSKPCPSSIIPEVDVYKFDPWELPEKTE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDK IYSG+KYVG+KKALVFYKG+P
Sbjct  61   FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKGIYSGTKYVGIKKALVFYKGKP  120

Query  42   PKGIKTDWIMHEYR  1
            PKGIKTDWIMHEYR
Sbjct  121  PKGIKTDWIMHEYR  134



>ref|XP_011075519.1| PREDICTED: LOW QUALITY PROTEIN: NAC transcription factor 29 [Sesamum 
indicum]
Length=291

 Score =   262 bits (669),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -1

Query  411  VQKMMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPE  232
            + K M G+ +S LPPGFRFHPTDEELIM+YLRNQATS PCPVSIIPEVDIYKFDPWELP 
Sbjct  1    MTKNMVGRNSSALPPGFRFHPTDEELIMHYLRNQATSRPCPVSIIPEVDIYKFDPWELPA  60

Query  231  KAEFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYK  52
            KAEFGE EWYFF+PRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVG+KKALVFYK
Sbjct  61   KAEFGENEWYFFSPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGIKKALVFYK  120

Query  51   GRPPKGIKTDWIMHEYR  1
            GRPPKGIKTDWIM EYR
Sbjct  121  GRPPKGIKTDWIMXEYR  137



>gb|AAW28573.2| NAC-domain containing protein 29 , putative [Solanum demissum]
Length=199

 Score =   259 bits (661),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M GK +SDLPPGFRFHPTDEELIMYYLR QATS PCPVSIIPE+D+YKFDPWELPEKAEF
Sbjct  1    MVGKISSDLPPGFRFHPTDEELIMYYLRYQATSRPCPVSIIPEIDVYKFDPWELPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS +KYVG+KKALVFYKG+PP
Sbjct  61   GENEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSANKYVGIKKALVFYKGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGVKTDWIMHEYR  133



>gb|AEQ61906.1| NAC domain protein NAC2 [Salvia miltiorrhiza]
Length=287

 Score =   262 bits (669),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M+G + +S LPPGFRFHPTDEELI+YYLRNQATS PCPV IIPEVDIYKFDPW+LP+KAE
Sbjct  1    MVGSRISSGLPPGFRFHPTDEELIIYYLRNQATSRPCPVPIIPEVDIYKFDPWQLPDKAE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGE EWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAI+SGSKYVGVKKALVFYKGRP
Sbjct  61   FGENEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIHSGSKYVGVKKALVFYKGRP  120

Query  42   PKGIKTDWIMHEYR  1
            PKG+KTDWIMHEYR
Sbjct  121  PKGVKTDWIMHEYR  134



>ref|XP_002522466.1| NAC domain-containing protein, putative [Ricinus communis]
 gb|EEF39958.1| NAC domain-containing protein, putative [Ricinus communis]
Length=281

 Score =   261 bits (667),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M G    S+LPPGFRFHPTDEELIMYYLRNQATS PCPVSIIPEVDIYKFDPW+LPEK+E
Sbjct  1    MQGRTCNSELPPGFRFHPTDEELIMYYLRNQATSRPCPVSIIPEVDIYKFDPWQLPEKSE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            F E EWYFFTPRDRKYPNGVRPNRA VSGYWKATGTDKAIYS SKYVGVKKALVFYKGRP
Sbjct  61   FVENEWYFFTPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSASKYVGVKKALVFYKGRP  120

Query  42   PKGIKTDWIMHEYR  1
            PKGIKTDWIMHEYR
Sbjct  121  PKGIKTDWIMHEYR  134



>ref|XP_004238810.1| PREDICTED: NAC transcription factor 29 [Solanum lycopersicum]
Length=282

 Score =   259 bits (663),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M GK +SDLPPGFRFHPTDEELIMYYLR QATS PCPVSIIPE+D+YKFDPW LPEKAEF
Sbjct  1    MVGKISSDLPPGFRFHPTDEELIMYYLRYQATSRPCPVSIIPEIDVYKFDPWVLPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            G+ EWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS +KYVG+KKALVFYKG+PP
Sbjct  61   GDNEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSANKYVGIKKALVFYKGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGVKTDWIMHEYR  133



>ref|XP_011070984.1| PREDICTED: NAC transcription factor 29-like [Sesamum indicum]
Length=285

 Score =   259 bits (662),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M G  +SDLPPGFRFHPTDEELI YYLRNQA S PCPVSIIPEVDIYKFDPWELPEKAEF
Sbjct  1    MVGGNSSDLPPGFRFHPTDEELITYYLRNQAKSRPCPVSIIPEVDIYKFDPWELPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSK+VGVKKALVFYKG+PP
Sbjct  61   GENEWYFFSPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKFVGVKKALVFYKGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+K+DWIMHEYR
Sbjct  121  KGVKSDWIMHEYR  133



>ref|XP_007223324.1| hypothetical protein PRUPE_ppa009530mg [Prunus persica]
 gb|EMJ24523.1| hypothetical protein PRUPE_ppa009530mg [Prunus persica]
Length=288

 Score =   259 bits (661),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M  K +S+LPPGFRFHPTDEELIM+YL+NQATS PCPVSIIPEVD+YKFDPW+LPEKAEF
Sbjct  1    MEAKHSSELPPGFRFHPTDEELIMFYLKNQATSRPCPVSIIPEVDLYKFDPWQLPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFFTPRDRKYPNGVRPNRA VSGYWKATGTDKAIYSG+KYVGVKKALVFY+G+PP
Sbjct  61   GENEWYFFTPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSGTKYVGVKKALVFYQGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+K+DWIMHEYR
Sbjct  121  KGVKSDWIMHEYR  133



>ref|XP_010651865.1| PREDICTED: NAC transcription factor 29 [Vitis vinifera]
 emb|CBI31935.3| unnamed protein product [Vitis vinifera]
Length=282

 Score =   258 bits (660),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M GK +S LPPGFRFHPTDEELIMYYL+NQATS PCPVSIIPEVDIYKF+PWELPEKAEF
Sbjct  1    MDGKGSSQLPPGFRFHPTDEELIMYYLKNQATSKPCPVSIIPEVDIYKFEPWELPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PRDRKYPNG RPNRA VSGYWKATGTDKAIYSG+KYVGVKKALVFYKGRPP
Sbjct  61   GENEWYFFSPRDRKYPNGARPNRATVSGYWKATGTDKAIYSGAKYVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>gb|ACX47024.1| NAP-like transcription factor [Vitis vinifera]
Length=282

 Score =   258 bits (660),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M GK +S LPPGFRFHPTDEELIMYYL+NQATS PCPVSIIPEVDIYKF+PWELPEKAEF
Sbjct  1    MDGKGSSQLPPGFRFHPTDEELIMYYLKNQATSKPCPVSIIPEVDIYKFEPWELPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PRDRKYPNG RPNRA VSGYWKATGTDKAIYSG+KYVGVKKALVFYKGRPP
Sbjct  61   GENEWYFFSPRDRKYPNGARPNRATVSGYWKATGTDKAIYSGAKYVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>ref|XP_008221592.1| PREDICTED: NAC transcription factor 29 [Prunus mume]
Length=288

 Score =   258 bits (660),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M  K +S+LPPGFRFHPTDEELIM+YL+NQATS PCPVSIIPEVD+YKFDPW+LPEKAEF
Sbjct  1    MEAKHSSELPPGFRFHPTDEELIMFYLKNQATSRPCPVSIIPEVDLYKFDPWQLPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFFTPRDRKYPNGVRPNRA VSGYWKATGTDKAIYSG+KYVGVKKALVFY+G+PP
Sbjct  61   GENEWYFFTPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSGAKYVGVKKALVFYQGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+K+DWIMHEYR
Sbjct  121  KGVKSDWIMHEYR  133



>ref|XP_010258284.1| PREDICTED: NAC transcription factor 29-like [Nelumbo nucifera]
 ref|XP_010258289.1| PREDICTED: NAC transcription factor 29-like [Nelumbo nucifera]
Length=281

 Score =   258 bits (660),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M G K++SDLPPGFRFHPTDEELIMYYLRNQA SMPCPVSIIPEVDIYKFDPWELPEKAE
Sbjct  1    MDGRKKSSDLPPGFRFHPTDEELIMYYLRNQARSMPCPVSIIPEVDIYKFDPWELPEKAE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGE EWYFF+PR+RKYPNGVRPNRA  SGYWKATGTDKAI SG KYVGVKKALVFYKGRP
Sbjct  61   FGETEWYFFSPRERKYPNGVRPNRATGSGYWKATGTDKAIRSGPKYVGVKKALVFYKGRP  120

Query  42   PKGIKTDWIMHEYR  1
            PKG+KTDWIMHEYR
Sbjct  121  PKGVKTDWIMHEYR  134



>ref|XP_006438726.1| hypothetical protein CICLE_v10032304mg [Citrus clementina]
 gb|ESR51966.1| hypothetical protein CICLE_v10032304mg [Citrus clementina]
 gb|KDO82984.1| hypothetical protein CISIN_1g023197mg [Citrus sinensis]
Length=286

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M  + +++LPPGFRFHPTDEELI++YLRNQATS PCPVSIIPEVDIYKFDPW+LPEKAEF
Sbjct  1    MEAQASTELPPGFRFHPTDEELIVHYLRNQATSRPCPVSIIPEVDIYKFDPWQLPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GEKEWYFF+PRDRKYPNG RPNRA VSGYWKATGTDKAIY GSKY+GVKKALVFYKGRPP
Sbjct  61   GEKEWYFFSPRDRKYPNGTRPNRATVSGYWKATGTDKAIYGGSKYLGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>ref|NP_001280939.1| NAC transcription factor 29-like [Malus domestica]
 gb|ADL36790.1| NAC domain class transcription factor [Malus domestica]
Length=280

 Score =   257 bits (656),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M  K++SDLPPGFRFHPTDEELI++YL+NQA+S PCPVSIIPEVDIYKFDPWELPEKAEF
Sbjct  1    MEAKRSSDLPPGFRFHPTDEELIVFYLKNQASSRPCPVSIIPEVDIYKFDPWELPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFFTPRDRKYPNGVRPNRA VSGYWKATGTDKAIYS SKYVGVKKALVFY+GRPP
Sbjct  61   GENEWYFFTPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSESKYVGVKKALVFYQGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+K+DWIMHEYR
Sbjct  121  KGVKSDWIMHEYR  133



>gb|ABM67699.1| NAC domain protein [Citrus sinensis]
Length=264

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M  + +++LPPGFRFHPTDEELI++YLRNQATS PCPVSIIPEVDIYKFDPW+LPEKAEF
Sbjct  1    MEAQASTELPPGFRFHPTDEELIVHYLRNQATSRPCPVSIIPEVDIYKFDPWQLPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GEKEWYFF+PRDRKYPNG RPNRA VSGYWKATGTDKAIY GSKY+GVKKALVFYKGRPP
Sbjct  61   GEKEWYFFSPRDRKYPNGTRPNRATVSGYWKATGTDKAIYGGSKYLGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>gb|AGC27312.1| NAC domain protein 9 [Gossypium hirsutum]
Length=286

 Score =   257 bits (656),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M  K +SDLPPGFRFHPTDEELI +YL+NQA S PCPVSIIPEVDIYKFDPW+LP+KAEF
Sbjct  1    METKTSSDLPPGFRFHPTDEELITFYLKNQAKSKPCPVSIIPEVDIYKFDPWQLPDKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GEKEWYFF+PRDRKYPNGVRPNRA VSGYWKATGTDKAIYSGSKYVGVKKALVFYKG+PP
Sbjct  61   GEKEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGLKTDWIMHEYR  133



>ref|XP_010108694.1| NAC domain-containing protein 29 [Morus notabilis]
 gb|EXC20005.1| NAC domain-containing protein 29 [Morus notabilis]
Length=294

 Score =   257 bits (657),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M G   +  LPPGFRFHPTDEELI+YYL+NQATS PCPVSIIPEVDIYKFDPWELP+KAE
Sbjct  1    MEGKANSGVLPPGFRFHPTDEELIVYYLKNQATSRPCPVSIIPEVDIYKFDPWELPDKAE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGEKEWYFF+PRDRKYPNGVRPNRA VSGYWKATGTDKAIYSGSKYVGVKKALVFYKG+P
Sbjct  61   FGEKEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGKP  120

Query  42   PKGIKTDWIMHEYR  1
            PKGIKTDWIMHEYR
Sbjct  121  PKGIKTDWIMHEYR  134



>gb|AIA57511.1| NAC domain-containing protein [Boehmeria nivea]
Length=307

 Score =   258 bits (658),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M G   +  LPPGFRFHPTDEELI+YYL+NQATS PCPVSIIPEVDIYKFDPWELP+KAE
Sbjct  1    MEGKASSGSLPPGFRFHPTDEELIVYYLKNQATSKPCPVSIIPEVDIYKFDPWELPDKAE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGE EWYFFTPRDRKYPNGVRPNRA VSGYWKATGTDKAIYSGSKYVGVKK+LVFYKG+P
Sbjct  61   FGENEWYFFTPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSGSKYVGVKKSLVFYKGKP  120

Query  42   PKGIKTDWIMHEYR  1
            PKGIKTDWIMHEYR
Sbjct  121  PKGIKTDWIMHEYR  134



>ref|XP_002312256.2| hypothetical protein POPTR_0008s08850g [Populus trichocarpa]
 gb|EEE89623.2| hypothetical protein POPTR_0008s08850g [Populus trichocarpa]
Length=283

 Score =   256 bits (655),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M G    + LPPGFRFHPTDEELI+YYLRNQATS PCP SIIPEVDIYKFDPW+LPEKAE
Sbjct  1    MQGKTIYNQLPPGFRFHPTDEELIVYYLRNQATSRPCPASIIPEVDIYKFDPWQLPEKAE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGE EWYFFTPRDRKYPNGVRPNRA VSGYWKATGTDKAI+SGSKYVGVKKALVFYKGRP
Sbjct  61   FGENEWYFFTPRDRKYPNGVRPNRATVSGYWKATGTDKAIHSGSKYVGVKKALVFYKGRP  120

Query  42   PKGIKTDWIMHEYR  1
            PKG KTDWIMHEYR
Sbjct  121  PKGAKTDWIMHEYR  134



>ref|XP_011017514.1| PREDICTED: NAC transcription factor 29 [Populus euphratica]
Length=283

 Score =   256 bits (654),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M G    + LPPGFRFHPTDEELI+YYLRNQATS PCP SIIPEVDIYKFDPW+LPEKAE
Sbjct  1    MQGKTIYNQLPPGFRFHPTDEELIVYYLRNQATSRPCPASIIPEVDIYKFDPWQLPEKAE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGE EWYFFTPRDRKYPNGVRPNRA VSGYWKATGTDKAI+SGSKYVGVKKALVFYKGRP
Sbjct  61   FGENEWYFFTPRDRKYPNGVRPNRATVSGYWKATGTDKAIHSGSKYVGVKKALVFYKGRP  120

Query  42   PKGIKTDWIMHEYR  1
            PKG KTDWIMHEYR
Sbjct  121  PKGAKTDWIMHEYR  134



>ref|XP_008368238.1| PREDICTED: NAC transcription factor 29-like [Malus domestica]
Length=279

 Score =   256 bits (653),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M  KQ+S LPPGFRFHPTDEELIM+YL+ QATS PCPVSIIPEVDIYKFDPWELPEKAEF
Sbjct  1    MEAKQSSQLPPGFRFHPTDEELIMFYLKYQATSRPCPVSIIPEVDIYKFDPWELPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFFTPRDRKYPNG+RPNRA VSGYWKATGTDKAIYS SKYVGVKKALVFY+GRPP
Sbjct  61   GENEWYFFTPRDRKYPNGIRPNRATVSGYWKATGTDKAIYSESKYVGVKKALVFYQGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+K+DWIMHEYR
Sbjct  121  KGVKSDWIMHEYR  133



>ref|XP_008361781.1| PREDICTED: NAC transcription factor 29-like [Malus domestica]
 gb|ADL36812.1| NAC domain class transcription factor [Malus domestica]
Length=279

 Score =   256 bits (653),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M  KQ+S LPPGFRFHPTDEELIM+YL+ QATS PCPVSIIPEVDIYKFDPWELPEKAEF
Sbjct  1    MEAKQSSQLPPGFRFHPTDEELIMFYLKYQATSRPCPVSIIPEVDIYKFDPWELPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFFTPRDRKYPNG+RPNRA VSGYWKATGTDKAIYS SKYVGVKKALVFY+GRPP
Sbjct  61   GENEWYFFTPRDRKYPNGIRPNRATVSGYWKATGTDKAIYSESKYVGVKKALVFYQGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+K+DWIMHEYR
Sbjct  121  KGVKSDWIMHEYR  133



>ref|XP_010258043.1| PREDICTED: NAC transcription factor 29-like [Nelumbo nucifera]
Length=281

 Score =   255 bits (651),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M G +   LPPGFRFHPTDEELIMYYLRNQA SMPCPVSIIPEVDIYKFDPWELPEKAEF
Sbjct  1    MEGTKKCALPPGFRFHPTDEELIMYYLRNQARSMPCPVSIIPEVDIYKFDPWELPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PR+RKYPNGVRPNRA  SGYWKATGTDKAI+SGS YVGVKKALVFYKGRPP
Sbjct  61   GETEWYFFSPRERKYPNGVRPNRATSSGYWKATGTDKAIHSGSTYVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGVKTDWIMHEYR  133



>ref|XP_004135168.1| PREDICTED: NAC transcription factor 29-like [Cucumis sativus]
 ref|XP_004172196.1| PREDICTED: NAC transcription factor 29-like [Cucumis sativus]
 gb|KGN51939.1| hypothetical protein Csa_5G606310 [Cucumis sativus]
Length=290

 Score =   255 bits (652),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M  K  ++LPPGFRFHPTDEELIM+YLRNQATS PCPVSIIPEVDIYKFDPW+LPEKA+ 
Sbjct  1    MKKKTCTELPPGFRFHPTDEELIMFYLRNQATSKPCPVSIIPEVDIYKFDPWDLPEKADS  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS SKYVGVKKALVFYKG+PP
Sbjct  61   GENEWYFFSPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSASKYVGVKKALVFYKGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGVKTDWIMHEYR  133



>ref|XP_002315038.1| hypothetical protein POPTR_0010s17350g [Populus trichocarpa]
 gb|EEF01209.1| hypothetical protein POPTR_0010s17350g [Populus trichocarpa]
Length=282

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M G   +  LPPGFRFHPTDEELIMYYLRNQATS PCP SIIPEVDIYKFDPW+LPEKA+
Sbjct  1    MQGKTNSEQLPPGFRFHPTDEELIMYYLRNQATSRPCPASIIPEVDIYKFDPWQLPEKAD  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGE EWYFFTP DRKYPNGVRPNRA VSGYWKATGTDKAI+SGSKYVGVKKALVFYKGRP
Sbjct  61   FGENEWYFFTPLDRKYPNGVRPNRATVSGYWKATGTDKAIHSGSKYVGVKKALVFYKGRP  120

Query  42   PKGIKTDWIMHEYR  1
            PKG KTDWIM EYR
Sbjct  121  PKGTKTDWIMQEYR  134



>ref|XP_011013028.1| PREDICTED: NAC transcription factor 29-like [Populus euphratica]
Length=282

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M G   +  LPPGFRFHPTDEELIMYYLRNQATS PCP SIIPEVDIYKFDPW+LPEKA+
Sbjct  1    MQGKTNSEQLPPGFRFHPTDEELIMYYLRNQATSRPCPASIIPEVDIYKFDPWQLPEKAD  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGE EWYFFTP DRKYPNGVRPNRA VSGYWKATGTDKAI+SGSKYVGVKKALVFYKGRP
Sbjct  61   FGENEWYFFTPLDRKYPNGVRPNRATVSGYWKATGTDKAIHSGSKYVGVKKALVFYKGRP  120

Query  42   PKGIKTDWIMHEYR  1
            PKG KTDWIM EYR
Sbjct  121  PKGTKTDWIMQEYR  134



>gb|ABZ89747.1| NAC transcription factor NAP [Mikania micrantha]
 gb|ACZ51442.1| NAC transcription factor NAP [Mikania micrantha]
Length=278

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M G+  S+LPPGFRFHPTDEELIMYYLRNQA S PCPVSIIPEVDIYKFDPW+LPEK + 
Sbjct  1    MVGRDNSNLPPGFRFHPTDEELIMYYLRNQALSKPCPVSIIPEVDIYKFDPWDLPEKTKS  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
             EKEWYFF+PRDRKYPNG+RPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP
Sbjct  61   EEKEWYFFSPRDRKYPNGIRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KG KTDWIMHEYR
Sbjct  121  KGTKTDWIMHEYR  133



>ref|XP_008446385.1| PREDICTED: NAC transcription factor 29 [Cucumis melo]
Length=292

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M  K  ++LPPGFRFHPTDEELIM+YLRNQATS PCPVSIIPEVDIYKFDPW+LPEKA+ 
Sbjct  1    MKKKTCTELPPGFRFHPTDEELIMFYLRNQATSKPCPVSIIPEVDIYKFDPWDLPEKADS  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS SKYVGVKKALVFYKG+PP
Sbjct  61   GENEWYFFSPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSASKYVGVKKALVFYKGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGVKTDWIMHEYR  133



>ref|XP_003556789.1| PREDICTED: NAC transcription factor 29 [Glycine max]
 gb|KHN25034.1| NAC domain-containing protein 29 [Glycine soja]
Length=280

 Score =   254 bits (649),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M GG  +S+LPPGFRFHPTDEELI+YYL NQATS PCP SIIPEVD+YKFDPWELP+K E
Sbjct  1    MEGGTTSSELPPGFRFHPTDEELIVYYLCNQATSKPCPASIIPEVDLYKFDPWELPDKTE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGE EWYFFTPRDRKYPNGVRPNRA VSGYWKATGTDKAIYSGSK+VGVKK+LVFYKGRP
Sbjct  61   FGENEWYFFTPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSGSKHVGVKKSLVFYKGRP  120

Query  42   PKGIKTDWIMHEYR  1
            PKG KTDWIMHEYR
Sbjct  121  PKGAKTDWIMHEYR  134



>ref|XP_004297288.1| PREDICTED: NAC transcription factor 29-like [Fragaria vesca subsp. 
vesca]
Length=288

 Score =   254 bits (649),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M    +S LPPGFRFHPTDEELI+YYL+NQA S PCPVSIIPEVDIYKFDPW+LPEKAEF
Sbjct  1    MEANSSSGLPPGFRFHPTDEELIVYYLKNQAISKPCPVSIIPEVDIYKFDPWQLPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PRDRKYPNGVRPNRA VSGYWKATGTDKAI+S SKYVGVKKALVFYKGRPP
Sbjct  61   GENEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKAIHSASKYVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>gb|EPS70298.1| hypothetical protein M569_04459, partial [Genlisea aurea]
Length=238

 Score =   251 bits (641),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            ++LPPGFRFHPTDEELI++YLRNQATSMPCP SIIPEVDIYKFDPW+LPEK EFGE EWY
Sbjct  4    TNLPPGFRFHPTDEELIVHYLRNQATSMPCPASIIPEVDIYKFDPWDLPEKTEFGENEWY  63

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPPKGIKTD  22
            FFTPRDRKYPNG+RPNRAAVSGYWKATGTDKAIYSG+KYVG+KKALVFYKGRPPKG+K++
Sbjct  64   FFTPRDRKYPNGIRPNRAAVSGYWKATGTDKAIYSGAKYVGIKKALVFYKGRPPKGVKSN  123

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  124  WIMHEYR  130



>gb|KHG28640.1| NAC domain-containing 29 -like protein [Gossypium arboreum]
 gb|KHG29900.1| NAC domain-containing 29 -like protein [Gossypium arboreum]
Length=281

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            SDLPPGFRFHPTDEELIM+YL+NQA S PCPVSIIPEVDIYKFDPW+LP+KAEFGE EWY
Sbjct  9    SDLPPGFRFHPTDEELIMFYLKNQAKSKPCPVSIIPEVDIYKFDPWQLPDKAEFGENEWY  68

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPPKGIKTD  22
            FF+PRDRKYPNGVRPNRA VSGYWKATGTDKAI+SGSKYVGVKKALVFY GRPPKG+KT+
Sbjct  69   FFSPRDRKYPNGVRPNRATVSGYWKATGTDKAIHSGSKYVGVKKALVFYNGRPPKGVKTN  128

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  129  WIMHEYR  135



>ref|XP_010066895.1| PREDICTED: NAC transcription factor 29 [Eucalyptus grandis]
 gb|KCW64938.1| hypothetical protein EUGRSUZ_G02486 [Eucalyptus grandis]
Length=282

 Score =   251 bits (642),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -1

Query  405  KMMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKA  226
            K +     S LPPGFRFHPTDEELIM+YLRNQATS PCPV IIPEVDIYKFDPW+LP+KA
Sbjct  2    KGLSVSSGSGLPPGFRFHPTDEELIMHYLRNQATSRPCPVDIIPEVDIYKFDPWQLPDKA  61

Query  225  EFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGR  46
            EF E EWYFFTPRDRKYPNGVRPNRA VSGYWKATGTDKAIYS SKYVGVKKALVFYKGR
Sbjct  62   EFWENEWYFFTPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSASKYVGVKKALVFYKGR  121

Query  45   PPKGIKTDWIMHEYR  1
            PPKGIKTDWIMHEYR
Sbjct  122  PPKGIKTDWIMHEYR  136



>ref|XP_004490093.1| PREDICTED: NAC transcription factor 29-like [Cicer arietinum]
 gb|ACO40486.1| NAC family transcription factor 3 [Cicer arietinum]
Length=285

 Score =   251 bits (642),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M G+ +SDLPPGFRFHPTDEELI+YYL NQATS PCP SIIPEVDIYKFDPWELP+K++F
Sbjct  1    MNGRTSSDLPPGFRFHPTDEELIVYYLCNQATSQPCPASIIPEVDIYKFDPWELPDKSDF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
             E EWYFF+PR+RKYPNGVRPNRA VSGYWKATGTDK+I+SGSK++GVKKALVFYKGRPP
Sbjct  61   VENEWYFFSPRERKYPNGVRPNRATVSGYWKATGTDKSIFSGSKHIGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGLKTDWIMHEYR  133



>gb|ACU17872.1| unknown [Glycine max]
Length=139

 Score =   246 bits (628),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M G   +S+LPPGFRFHPTDEELI+YYL NQATS PCP SIIPEVD+YKFDPWELP+K E
Sbjct  1    MEGSTTSSELPPGFRFHPTDEELIVYYLCNQATSKPCPASIIPEVDLYKFDPWELPDKTE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGE EWYFF+PRDRKYPNGVRPNRA VSGYWKATGTDKAIYSGSK VGVKK+LVFYKGRP
Sbjct  61   FGENEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSGSKNVGVKKSLVFYKGRP  120

Query  42   PKGIKTDWIMHEYR  1
            PKG KTDWIMHEYR
Sbjct  121  PKGAKTDWIMHEYR  134



>gb|EYU22403.1| hypothetical protein MIMGU_mgv1a012228mg [Erythranthe guttata]
Length=257

 Score =   250 bits (639),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = -1

Query  402  MMGGKQTSD-LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKA  226
            M G   +SD LPPGFRFHPTDEELI+YYLRNQA+S PCPVS+I E+DIYKFDPWELPEKA
Sbjct  1    MFGENISSDQLPPGFRFHPTDEELIVYYLRNQASSNPCPVSVIHEIDIYKFDPWELPEKA  60

Query  225  EFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGR  46
            E GEKEWYFF+PRDRKYPNG RPNRAAVSGYWKATGTDK IYSGSKYVGVKK+LVFYKG+
Sbjct  61   EVGEKEWYFFSPRDRKYPNGARPNRAAVSGYWKATGTDKGIYSGSKYVGVKKSLVFYKGK  120

Query  45   PPKGIKTDWIMHEYR  1
            PPKGIKTDWIMHEYR
Sbjct  121  PPKGIKTDWIMHEYR  135



>gb|AGS08770.1| NAC domain protein [Malus hupehensis]
Length=279

 Score =   251 bits (641),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M  K++S LPPGFRFHPTD ELIM+YL+ QATS PCPVSIIPEVDIYKFDPWELPEKAEF
Sbjct  1    MEAKRSSQLPPGFRFHPTDGELIMFYLKYQATSRPCPVSIIPEVDIYKFDPWELPEKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFFTPRDRKYPNG+RPNRA VSGYWKATGTDKAIYS SKYVGVKKALVFY+GRPP
Sbjct  61   GENEWYFFTPRDRKYPNGIRPNRATVSGYWKATGTDKAIYSESKYVGVKKALVFYQGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+K+DWIMHEYR
Sbjct  121  KGVKSDWIMHEYR  133



>gb|KCW64937.1| hypothetical protein EUGRSUZ_G02486 [Eucalyptus grandis]
Length=289

 Score =   251 bits (640),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -1

Query  405  KMMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKA  226
            K +     S LPPGFRFHPTDEELIM+YLRNQATS PCPV IIPEVDIYKFDPW+LP+KA
Sbjct  2    KGLSVSSGSGLPPGFRFHPTDEELIMHYLRNQATSRPCPVDIIPEVDIYKFDPWQLPDKA  61

Query  225  EFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGR  46
            EF E EWYFFTPRDRKYPNGVRPNRA VSGYWKATGTDKAIYS SKYVGVKKALVFYKGR
Sbjct  62   EFWENEWYFFTPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSASKYVGVKKALVFYKGR  121

Query  45   PPKGIKTDWIMHEYR  1
            PPKGIKTDWIMHEYR
Sbjct  122  PPKGIKTDWIMHEYR  136



>gb|KFK41373.1| hypothetical protein AALP_AA2G121900 [Arabis alpina]
Length=272

 Score =   250 bits (638),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M     S LPPGFRFHPTDEELI+YYLRNQ  S PCPVSIIPEVDIYKFDPW+LPE+ EF
Sbjct  1    MEINSNSTLPPGFRFHPTDEELIVYYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPEQTEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAI+SGS  VGVKKALVFYKGRPP
Sbjct  61   GENEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIHSGSSNVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>ref|XP_006391010.1| hypothetical protein EUTSA_v10018997mg [Eutrema salsugineum]
 dbj|BAJ34610.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ28296.1| hypothetical protein EUTSA_v10018997mg [Eutrema salsugineum]
Length=272

 Score =   249 bits (637),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M    +S+LPPGFRFHPTDEELI++YLRNQ  S PCPVSIIPEVDIYKFDPW+LPEK EF
Sbjct  1    MEANSSSNLPPGFRFHPTDEELIVHYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPEKTEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PRDRKYPNGVRPNRAAVSGYWKATGTDKAI+SGS  VGVKKALVFYKGRPP
Sbjct  61   GENEWYFFSPRDRKYPNGVRPNRAAVSGYWKATGTDKAIHSGSSNVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>gb|KHN28140.1| NAC domain-containing protein 29 [Glycine soja]
Length=233

 Score =   248 bits (634),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M G   +S+LPPGFRFHPTDEELI+YYL NQATS PCP SIIPEVD+YKFDPWELP+K E
Sbjct  1    MEGSTTSSELPPGFRFHPTDEELIVYYLCNQATSKPCPASIIPEVDLYKFDPWELPDKTE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGE EWYFF+PRDRKYPNGVRPNRA VSGYWKATGTDKAIYSGSK VGVKK+LVFYKGRP
Sbjct  61   FGENEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSGSKNVGVKKSLVFYKGRP  120

Query  42   PKGIKTDWIMHEYR  1
            PKG KTDWIMHEYR
Sbjct  121  PKGAKTDWIMHEYR  134



>ref|XP_007153556.1| hypothetical protein PHAVU_003G045600g [Phaseolus vulgaris]
 gb|ESW25550.1| hypothetical protein PHAVU_003G045600g [Phaseolus vulgaris]
Length=236

 Score =   248 bits (633),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M G+ +S LPPGFRFHPTDEELI+YYL NQATS PCP SIIPEVDIYKFDPWELPEK +F
Sbjct  1    MEGRTSSVLPPGFRFHPTDEELIVYYLCNQATSKPCPASIIPEVDIYKFDPWELPEKTDF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PR+RKYPNGVRPNRA VSGYWKATGTDKAIYSGSK++GVKKALVFYKG+PP
Sbjct  61   GENEWYFFSPRERKYPNGVRPNRATVSGYWKATGTDKAIYSGSKHIGVKKALVFYKGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGLKTDWIMHEYR  133



>gb|KHN14494.1| NAC domain-containing protein 29 [Glycine soja]
Length=279

 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M  + +S LPPGFRFHPTDEELI+YYL NQATS PCP SIIPEVDIYKFDPWELPEK +F
Sbjct  1    MENRTSSVLPPGFRFHPTDEELIVYYLCNQATSRPCPASIIPEVDIYKFDPWELPEKTDF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GEKEWYFF+PR+RKYPNGVRPNRA VSGYWKATGTDKAIYSGSK+VGVKKALVFYKG+PP
Sbjct  61   GEKEWYFFSPRERKYPNGVRPNRATVSGYWKATGTDKAIYSGSKHVGVKKALVFYKGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGLKTDWIMHEYR  133



>ref|NP_001238204.1| NAC domain protein [Glycine max]
 gb|ACD39381.1| NAC domain protein [Glycine max]
Length=279

 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M  + +S LPPGFRFHPTDEELI+YYL NQATS PCP SIIPEVDIYKFDPWELPEK +F
Sbjct  1    MENRTSSVLPPGFRFHPTDEELIVYYLCNQATSRPCPASIIPEVDIYKFDPWELPEKTDF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GEKEWYFF+PR+RKYPNGVRPNRA VSGYWKATGTDKAIYSGSK+VGVKKALVFYKG+PP
Sbjct  61   GEKEWYFFSPRERKYPNGVRPNRATVSGYWKATGTDKAIYSGSKHVGVKKALVFYKGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGLKTDWIMHEYR  133



>gb|AFN55272.1| NAC domain-containing protein [Tamarix hispida]
Length=316

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 127/135 (94%), Gaps = 1/135 (1%)
 Frame = -1

Query  402  MMGGKQT-SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKA  226
            M GG+++ S+LPPGFRFHPTDEELI+ YL+NQA S+PCP SIIPEVDIYKFDPW+LPEKA
Sbjct  1    MEGGRRSCSNLPPGFRFHPTDEELIVCYLKNQAVSLPCPASIIPEVDIYKFDPWQLPEKA  60

Query  225  EFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGR  46
            EFGE EWYFFTPR+RKYPNG RPNRAAVSGYWKATGTDKAIYSG+KYVG+KKALVFYKGR
Sbjct  61   EFGESEWYFFTPRERKYPNGARPNRAAVSGYWKATGTDKAIYSGNKYVGIKKALVFYKGR  120

Query  45   PPKGIKTDWIMHEYR  1
            PPKG KT+WIMHEYR
Sbjct  121  PPKGNKTEWIMHEYR  135



>ref|XP_010511986.1| PREDICTED: NAC transcription factor 29-like [Camelina sativa]
Length=273

 Score =   249 bits (635),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M    +S LPPGFRFHPTDEELI+YYLRNQ  S PCPVSIIPEVDIYKFDPW+LPEK EF
Sbjct  1    MEVNSSSSLPPGFRFHPTDEELIVYYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPEKTEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PR+RKYPNGVRPNRAAVSGYWKATGTDKAI+SGS  VGVKKALVFYKGRPP
Sbjct  61   GENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHSGSSNVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>ref|XP_010415593.1| PREDICTED: NAC transcription factor 29 [Camelina sativa]
Length=272

 Score =   248 bits (634),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M    +S LPPGFRFHPTDEELI+YYLRNQ  S PCPVSIIPEVDIYKFDPW+LPEK EF
Sbjct  1    MEVNSSSSLPPGFRFHPTDEELIVYYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPEKTEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PR+RKYPNGVRPNRAA+SGYWKATGTDKAI+SGS  VGVKKALVFYKGRPP
Sbjct  61   GENEWYFFSPRERKYPNGVRPNRAAISGYWKATGTDKAIHSGSSNVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>gb|AIU47058.1| NAC transcription factor [Medicago sativa]
Length=274

 Score =   248 bits (634),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEELIMYYL NQATS PCP SIIPEVDIYKFDPWELP+K++FGE EWYF
Sbjct  2    ELPPGFRFHPTDEELIMYYLCNQATSQPCPASIIPEVDIYKFDPWELPDKSDFGENEWYF  61

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPPKGIKTDW  19
            FTPR+RKYPNGVRPNRA VSGYWKATGTDK+I+SGSK++GVKKALVFYKGRPPKGIKTDW
Sbjct  62   FTPRERKYPNGVRPNRATVSGYWKATGTDKSIFSGSKHIGVKKALVFYKGRPPKGIKTDW  121

Query  18   IMHEYR  1
            IMHEYR
Sbjct  122  IMHEYR  127



>ref|XP_010470936.1| PREDICTED: NAC transcription factor 29-like [Camelina sativa]
Length=272

 Score =   248 bits (634),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M    +S LPPGFRFHPTDEELI+YYLRNQ  S PCPVSIIPEVDIYKFDPW+LPEK EF
Sbjct  1    MEVNSSSSLPPGFRFHPTDEELIVYYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPEKTEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PR+RKYPNGVRPNRAAVSGYWKATGTDKAI+SG+  VGVKKALVFYKGRPP
Sbjct  61   GENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHSGTSNVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>ref|NP_001235915.1| transcriptional factor NAC51 [Glycine max]
 gb|ACC66317.1| transcriptional factor NAC51 [Glycine max]
Length=233

 Score =   247 bits (630),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M G   +S+LPPGFRFHPTDEELI+YYL NQ TS PCP SIIPEVD+YKFDPWELP+K E
Sbjct  1    MEGSTTSSELPPGFRFHPTDEELIVYYLCNQTTSKPCPASIIPEVDLYKFDPWELPDKTE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGE EWYFF+PRDRKYPNGVRPNRA VSGYWKATGTDKAIYSGSK VGVKK+LVFYKGRP
Sbjct  61   FGENEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSGSKNVGVKKSLVFYKGRP  120

Query  42   PKGIKTDWIMHEYR  1
            PKG KTDWIMHEYR
Sbjct  121  PKGAKTDWIMHEYR  134



>gb|AFI56994.1| NAC2, partial [Brassica napus]
Length=244

 Score =   247 bits (631),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M     + LPPGFRFHPTDEELI+YYL+NQ  S PCPVSIIPEVDIYKFDPW+LPEK EF
Sbjct  1    MDMNPNTTLPPGFRFHPTDEELIVYYLKNQTMSRPCPVSIIPEVDIYKFDPWQLPEKTEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS  VGVKKALVFYKGRPP
Sbjct  61   GENEWYFFSPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSSNVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>ref|NP_564966.1| NAC transcription factor protein family [Arabidopsis thaliana]
 sp|O49255.1|NAC29_ARATH RecName: Full=NAC transcription factor 29; Short=AtNAC029; AltName: 
Full=Protein NAC-LIKE, ACTIVATED BY AP3/PI; Short=AtNAP 
[Arabidopsis thaliana]
 gb|AAG60108.1|AC073178_19 unknown protein [Arabidopsis thaliana]
 gb|AAK25911.1|AF360201_1 unknown protein [Arabidopsis thaliana]
 emb|CAA10955.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK93692.1| unknown protein [Arabidopsis thaliana]
 gb|AEE34932.1| NAC transcription factor protein family [Arabidopsis thaliana]
Length=268

 Score =   248 bits (633),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M     S LPPGFRFHPTDEELI+YYLRNQ  S PCPVSIIPEVDIYKFDPW+LPEK EF
Sbjct  1    MEVTSQSTLPPGFRFHPTDEELIVYYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPEKTEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PR+RKYPNGVRPNRAAVSGYWKATGTDKAI+SGS  VGVKKALVFYKGRPP
Sbjct  61   GENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHSGSSNVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>gb|AAM63330.1| NAC domain protein NAC2 [Arabidopsis thaliana]
Length=268

 Score =   248 bits (632),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M     S LPPGFRFHPTDEELI+YYLRNQ  S PCPVSIIPEVDIYKFDPW+LPEK EF
Sbjct  1    MEVTSQSTLPPGFRFHPTDEELIVYYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPEKTEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PR+RKYPNGVRPNRAAVSGYWKATGTDKAI+SGS  VGVKKALVFYKGRPP
Sbjct  61   GENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHSGSSNVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>ref|XP_002887238.1| NAC domain protein NAC2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63497.1| NAC domain protein NAC2 [Arabidopsis lyrata subsp. lyrata]
Length=270

 Score =   248 bits (632),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M    +S LPPGFRFHPTDEELI+YYLRNQ  S PCPVSIIPEVDIYKFDPW+LPEK EF
Sbjct  1    MEVNSSSTLPPGFRFHPTDEELIVYYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPEKTEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PR+RKYPNGVRPNRAAVSGYWKATGTDKAI+SGS  VGVKKALVFYKGRPP
Sbjct  61   GENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHSGSSNVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>ref|XP_009105493.1| PREDICTED: NAC transcription factor 29 [Brassica rapa]
 gb|AHN60138.1| NAC transcription factor 29 [Brassica napus]
 emb|CDX95931.1| BnaA07g28000D [Brassica napus]
Length=270

 Score =   247 bits (631),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M     + LPPGFRFHPTDEELI+YYL+NQ  S PCPVSIIPEVDIYKFDPW+LPEK EF
Sbjct  1    MDMNPNTTLPPGFRFHPTDEELIVYYLKNQTMSRPCPVSIIPEVDIYKFDPWQLPEKTEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS  VGVKKALVFYKGRPP
Sbjct  61   GENEWYFFSPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSSNVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>emb|CDY40930.1| BnaC06g30680D [Brassica napus]
Length=270

 Score =   247 bits (631),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M     + LPPGFRFHPTDEELI+YYL+NQ  S PCPVSIIPEVDIYKFDPW+LPEK EF
Sbjct  1    MDMNPNTTLPPGFRFHPTDEELIVYYLKNQTMSRPCPVSIIPEVDIYKFDPWQLPEKTEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS  VGVKKALVFYKGRPP
Sbjct  61   GENEWYFFSPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSSNVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>gb|KHN01256.1| NAC domain-containing protein 29 [Glycine soja]
Length=279

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M  + +S LPPGFRFHPTDEELI+YYL NQA+S PCP SIIPEVDIYKFDPWELP+K +F
Sbjct  1    MENRTSSVLPPGFRFHPTDEELIVYYLCNQASSRPCPASIIPEVDIYKFDPWELPDKTDF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GEKEWYFF+PR+RKYPNGVRPNRA VSGYWKATGTDKAIYSGSK+VGVKKALVFYKG+PP
Sbjct  61   GEKEWYFFSPRERKYPNGVRPNRATVSGYWKATGTDKAIYSGSKHVGVKKALVFYKGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGLKTDWIMHEYR  133



>ref|NP_001236855.1| NAC domain protein NAC1 [Glycine max]
 gb|AAX85978.1| NAC1 protein [Glycine max]
 gb|AAY46121.1| NAC domain protein NAC1 [Glycine max]
Length=279

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M  + +S LPPGFRFHPTDEELI+YYL NQA+S PCP SIIPEVDIYKFDPWELP+K +F
Sbjct  1    MENRTSSVLPPGFRFHPTDEELIVYYLCNQASSRPCPASIIPEVDIYKFDPWELPDKTDF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GEKEWYFF+PR+RKYPNGVRPNRA VSGYWKATGTDKAIYSGSK+VGVKKALVFYKG+PP
Sbjct  61   GEKEWYFFSPRERKYPNGVRPNRATVSGYWKATGTDKAIYSGSKHVGVKKALVFYKGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGLKTDWIMHEYR  133



>ref|XP_006302669.1| hypothetical protein CARUB_v10020776mg [Capsella rubella]
 gb|EOA35567.1| hypothetical protein CARUB_v10020776mg [Capsella rubella]
Length=276

 Score =   246 bits (629),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M    ++ LPPGFRFHPTDEELI+YYLRNQ  S PCPVSIIPEVDIYKFDPW+LPEK EF
Sbjct  1    MEVNSSTTLPPGFRFHPTDEELIVYYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPEKTEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PR+RKYPNGVRPNRAAVSGYWKATGTDKAI+SGS  VGVKKALVFYKGRPP
Sbjct  61   GENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHSGSSNVGVKKALVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KGIKTDWIMHEYR
Sbjct  121  KGIKTDWIMHEYR  133



>gb|AHE80972.1| NAC domain-containing protein [Ammopiptanthus mongolicus]
Length=281

 Score =   246 bits (628),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M     SDLPPGFRFHPTDEELI++YL NQATS PCP SIIPEVDIYKFDPWELP+K +F
Sbjct  1    MESITCSDLPPGFRFHPTDEELIVHYLCNQATSKPCPASIIPEVDIYKFDPWELPDKTDF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PR+RKYPNGVRPNRA VSGYWKATGTDKAIYSGSK++GVKKALVFY GRPP
Sbjct  61   GENEWYFFSPRERKYPNGVRPNRATVSGYWKATGTDKAIYSGSKHIGVKKALVFYTGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGVKTDWIMHEYR  133



>ref|XP_007158644.1| hypothetical protein PHAVU_002G170200g [Phaseolus vulgaris]
 gb|AAK84884.1|AF402603_1 NAC domain protein NAC2 [Phaseolus vulgaris]
 gb|ESW30638.1| hypothetical protein PHAVU_002G170200g [Phaseolus vulgaris]
Length=256

 Score =   245 bits (626),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M     S+LPPGFRFHPTDEELI+YYL NQATS PCP SIIPEVD+YKFDPWELP+K EF
Sbjct  1    MDATTPSELPPGFRFHPTDEELIVYYLCNQATSKPCPASIIPEVDLYKFDPWELPDKTEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PRDRKYPNGVRPNRA VSGYWKATGTDKAIYSGSK VGVKK+LVFYKGRPP
Sbjct  61   GENEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSGSKLVGVKKSLVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KG KTDWIMHEYR
Sbjct  121  KGDKTDWIMHEYR  133



>ref|XP_003613866.1| NAC domain protein [Medicago truncatula]
 gb|AES96824.1| NAC transcription factor-like protein [Medicago truncatula]
Length=260

 Score =   244 bits (624),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEELI+YYL NQATS PCP SIIPEVDIYKFDPWELP+K+ FGE EWYF
Sbjct  2    ELPPGFRFHPTDEELIVYYLCNQATSQPCPASIIPEVDIYKFDPWELPDKSGFGENEWYF  61

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPPKGIKTDW  19
            FTPR+RKYPNGVRPNRA VSGYWKATGTDK+I+SGSK++GVKKALVFYKGRPPKGIKTDW
Sbjct  62   FTPRERKYPNGVRPNRATVSGYWKATGTDKSIFSGSKHIGVKKALVFYKGRPPKGIKTDW  121

Query  18   IMHEYR  1
            IMHEYR
Sbjct  122  IMHEYR  127



>ref|XP_003613867.1| NAC domain protein [Medicago truncatula]
 gb|AFK38804.1| unknown [Medicago truncatula]
 gb|AFK45780.1| unknown [Medicago truncatula]
Length=152

 Score =   241 bits (614),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEELI+YYL NQATS PCP SIIPEVDIYKFDPWELP+K+ FGE EWYF
Sbjct  2    ELPPGFRFHPTDEELIVYYLCNQATSQPCPASIIPEVDIYKFDPWELPDKSGFGENEWYF  61

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPPKGIKTDW  19
            FTPR+RKYPNGVRPNRA VSGYWKATGTDK+I+SGSK++GVKKALVFYKGRPPKGIKTDW
Sbjct  62   FTPRERKYPNGVRPNRATVSGYWKATGTDKSIFSGSKHIGVKKALVFYKGRPPKGIKTDW  121

Query  18   IMHEYR  1
            IMHEYR
Sbjct  122  IMHEYR  127



>gb|AFK39171.1| unknown [Medicago truncatula]
Length=260

 Score =   244 bits (623),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEELI+YYL NQATS PCP SIIPEVDIYKFDPWELP+K+ FGE EWYF
Sbjct  2    ELPPGFRFHPTDEELIVYYLCNQATSQPCPASIIPEVDIYKFDPWELPDKSGFGENEWYF  61

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPPKGIKTDW  19
            FTPR+RKYPNGVRPNRA VSGYWKATGTDK+I+SGSK++GVKKALVFYKGRPPKGIKTDW
Sbjct  62   FTPRERKYPNGVRPNRATVSGYWKATGTDKSIFSGSKHIGVKKALVFYKGRPPKGIKTDW  121

Query  18   IMHEYR  1
            IMHEYR
Sbjct  122  IMHEYR  127



>ref|XP_010683140.1| PREDICTED: NAC transcription factor 29-like [Beta vulgaris subsp. 
vulgaris]
Length=274

 Score =   243 bits (620),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = -1

Query  384  TSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEW  205
            +++LPPGFRFHPTDEELI++YL+NQA S PCPVSIIPE+DIYKFDPW+LP+KA FGE EW
Sbjct  8    SNNLPPGFRFHPTDEELIIHYLKNQAMSKPCPVSIIPEIDIYKFDPWQLPDKAVFGENEW  67

Query  204  YFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPPKGIKT  25
            YFFTPRDRKYPNG+RPNRA +SGYWKATGTDK+IYSG+KYVG+KKALVFYKGRPPKG KT
Sbjct  68   YFFTPRDRKYPNGIRPNRATLSGYWKATGTDKSIYSGAKYVGIKKALVFYKGRPPKGSKT  127

Query  24   DWIMHEYR  1
            DWIMHEYR
Sbjct  128  DWIMHEYR  135



>emb|CDY51500.1| BnaC06g43410D [Brassica napus]
Length=272

 Score =   243 bits (619),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M     ++ LPPGFRFHPTDEELI++YLRNQ  S PCPVSIIPEVDIYKFDPW+LP+  E
Sbjct  1    MEINSNSTTLPPGFRFHPTDEELIVHYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPDLTE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGE EWYFF+PR+RKYPNGVRPNRAAVSGYWKATGTDKAI+SGS  VGVKKALVFYKGRP
Sbjct  61   FGENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHSGSSNVGVKKALVFYKGRP  120

Query  42   PKGIKTDWIMHEYR  1
            PKGIKTDWIMHEYR
Sbjct  121  PKGIKTDWIMHEYR  134



>ref|XP_009105596.1| PREDICTED: NAC transcription factor 29-like, partial [Brassica 
rapa]
Length=268

 Score =   242 bits (618),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
               ++ LPPGFRFHPTDEELI++YLRNQ  S PCPVSIIPEVDIYKFDPW+LP+  EFGE
Sbjct  1    NSNSTTLPPGFRFHPTDEELIVHYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPDLTEFGE  60

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPPKG  34
             EWYFF+PR+RKYPNGVRPNRAAVSGYWKATGTDKAI+SGS  VGVKKALVFYKGRPPKG
Sbjct  61   NEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHSGSSNVGVKKALVFYKGRPPKG  120

Query  33   IKTDWIMHEYR  1
            IKTDWIMHEYR
Sbjct  121  IKTDWIMHEYR  131



>emb|CDY07348.1| BnaA07g24270D [Brassica napus]
Length=271

 Score =   242 bits (617),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M      + LPPGFRFHPTDEELI++YLRNQ  S PCPVSIIPEVDIYKFDPW+LP+  E
Sbjct  1    MEINSNCTTLPPGFRFHPTDEELIVHYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPDLTE  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRP  43
            FGE EWYFF+PR+RKYPNGVRPNRAAVSGYWKATGTDKAI+SGS  VGVKKALVFYKGRP
Sbjct  61   FGENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHSGSSNVGVKKALVFYKGRP  120

Query  42   PKGIKTDWIMHEYR  1
            PKGIKTDWIMHEYR
Sbjct  121  PKGIKTDWIMHEYR  134



>gb|ADK23915.1| NAC protein [Medicago sativa]
Length=271

 Score =   241 bits (615),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M    + +LPPGFRFHPTDEELI++YL NQATS PCP SIIPEVDIYKFDPWELP+K+EF
Sbjct  1    MESSTSYELPPGFRFHPTDEELIVHYLCNQATSKPCPASIIPEVDIYKFDPWELPDKSEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GE EWYFF+PR+RKYPNGVRPNRA +SGYWKATGTDKAI SGSK +GVKK+LVFYKGRPP
Sbjct  61   GENEWYFFSPRERKYPNGVRPNRATLSGYWKATGTDKAIKSGSKQIGVKKSLVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGVKTDWIMHEYR  133



>gb|AFK38271.1| unknown [Lotus japonicus]
Length=283

 Score =   241 bits (616),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M G  +S+LPPGFRFHPTDEELI++YL NQ +S PCP  IIPEVDIYKFDPWELP+K  F
Sbjct  1    MEGSSSSELPPGFRFHPTDEELIVHYLCNQVSSHPCPAPIIPEVDIYKFDPWELPDKTAF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
            GEKEWYFF+PR+RKYPNG RPNRAAVSGYWKATGTDK+I+SGS++VGVKKALVFYKG+PP
Sbjct  61   GEKEWYFFSPRERKYPNGARPNRAAVSGYWKATGTDKSIFSGSQHVGVKKALVFYKGKPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGVKTDWIMHEYR  133



>ref|XP_003607731.1| NAC domain protein [Medicago truncatula]
 gb|AES89928.1| NAC transcription factor-like protein [Medicago truncatula]
 gb|AEV41578.1| NAC969 [Medicago truncatula]
Length=271

 Score =   241 bits (615),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M    +S+LPPGFRFHPTDEELI++YL NQATS PCP SIIPEVDIYKFDPWELP+K+EF
Sbjct  1    MESSASSELPPGFRFHPTDEELIVHYLCNQATSKPCPASIIPEVDIYKFDPWELPDKSEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
             E EWYFF+PR+RKYPNGVRPNRA +SGYWKATGTDKAI SGSK +GVKK+LVFYKGRPP
Sbjct  61   EENEWYFFSPRERKYPNGVRPNRATLSGYWKATGTDKAIKSGSKQIGVKKSLVFYKGRPP  120

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  121  KGVKTDWIMHEYR  133



>ref|XP_010044485.1| PREDICTED: NAC transcription factor 29-like [Eucalyptus grandis]
 gb|KCW86573.1| hypothetical protein EUGRSUZ_B03208 [Eucalyptus grandis]
Length=255

 Score =   232 bits (591),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEELI+YYL+NQ  S PCPVSII E+DIYKFDPW+L E A+ GEKEWYF
Sbjct  4    ELPPGFRFHPTDEELIVYYLQNQVMSRPCPVSIISELDIYKFDPWQLTENAKLGEKEWYF  63

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPPKGIKTDW  19
            FT R RKY NG RPNRAAVSGYWKATG+DKAIYSGSK+VGVKK+LVFYKGRPPKG+KTDW
Sbjct  64   FTLRSRKYLNGARPNRAAVSGYWKATGSDKAIYSGSKHVGVKKSLVFYKGRPPKGLKTDW  123

Query  18   IMHEYR  1
            IMHEYR
Sbjct  124  IMHEYR  129



>dbj|BAF36563.1| NAC domain protein [Cymbidium hybrid cultivar]
Length=339

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRN+A S PCP SII EVDIYKFDPW+LPEKA FG++EWYFF
Sbjct  8    LPPGFRFHPTDEELILHYLRNRAASSPCPASIIAEVDIYKFDPWDLPEKAAFGDREWYFF  67

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPPKGIKTDWI  16
            TPRDRKYPNG RPNRAA SGYWKATGTDK I SGS+ +GVKKALVFYKGRPPKG+KT+WI
Sbjct  68   TPRDRKYPNGNRPNRAAGSGYWKATGTDKPISSGSENIGVKKALVFYKGRPPKGLKTNWI  127

Query  15   MHEYR  1
            MHE+R
Sbjct  128  MHEFR  132



>ref|XP_009406848.1| PREDICTED: NAC transcription factor 29-like [Musa acuminata subsp. 
malaccensis]
Length=345

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 119/129 (92%), Gaps = 2/129 (2%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            + LPPGFRFHPTDEELI++YLRNQA+S+PCPVSII EVDIYKFDPW+LP KA FGE+EWY
Sbjct  5    ASLPPGFRFHPTDEELILHYLRNQASSVPCPVSIIAEVDIYKFDPWDLPAKAMFGEQEWY  64

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIY--SGSKYVGVKKALVFYKGRPPKGIK  28
            FF+PRDRKYPNGVRPNRAA SGYWKATGTDK I+   G++++GVKKALVFYKGRPP+G K
Sbjct  65   FFSPRDRKYPNGVRPNRAAASGYWKATGTDKPIHRSGGNEHIGVKKALVFYKGRPPRGRK  124

Query  27   TDWIMHEYR  1
            T+WIMHEYR
Sbjct  125  TNWIMHEYR  133



>ref|XP_009387374.1| PREDICTED: NAC transcription factor 29-like [Musa acuminata subsp. 
malaccensis]
Length=327

 Score =   229 bits (585),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 117/130 (90%), Gaps = 3/130 (2%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            + LPPGFRFHPTDEELI++YLRN+A+SMPCPVSII EVDIYKFDPWELP KA FG++EWY
Sbjct  5    TSLPPGFRFHPTDEELILHYLRNRASSMPCPVSIIAEVDIYKFDPWELPAKALFGDREWY  64

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSG---SKYVGVKKALVFYKGRPPKGI  31
            FF+PRDRKYPNGVRPNRAA SGYWKATGTDK I +    S  +GVKKALVFYKG+PPKG+
Sbjct  65   FFSPRDRKYPNGVRPNRAAASGYWKATGTDKPIVASKGMSDNIGVKKALVFYKGKPPKGV  124

Query  30   KTDWIMHEYR  1
            KTDWIMHEYR
Sbjct  125  KTDWIMHEYR  134



>ref|XP_010938117.1| PREDICTED: NAC transcription factor 29-like [Elaeis guineensis]
Length=339

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 116/127 (91%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRNQA S+PCPVSII EVDIYKFDPWELP KA FG++EWYFF
Sbjct  7    LPPGFRFHPTDEELILHYLRNQAASLPCPVSIIAEVDIYKFDPWELPAKAMFGDREWYFF  66

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAI--YSGSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG+RPNR+A SGYWKATGTDK I    G++ +GVKKALVFYKGRPPKG+KT+
Sbjct  67   SPRDRKYPNGMRPNRSAASGYWKATGTDKPIRLSKGNENIGVKKALVFYKGRPPKGVKTN  126

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  127  WIMHEYR  133



>ref|XP_009394856.1| PREDICTED: NAC transcription factor 25-like [Musa acuminata subsp. 
malaccensis]
Length=334

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 117/127 (92%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRN+A ++PCPVSII EVDIYKFDPW+LP KA FG++EWYFF
Sbjct  8    LPPGFRFHPTDEELILHYLRNRAAAVPCPVSIIAEVDIYKFDPWDLPAKATFGDREWYFF  67

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNGVRPNRAA SGYWKATGTDK + +  GS+ +GVKKALVFY+GRPP+G+KTD
Sbjct  68   SPRDRKYPNGVRPNRAAASGYWKATGTDKPVMASKGSESIGVKKALVFYQGRPPRGVKTD  127

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  128  WIMHEYR  134



>ref|XP_010931442.1| PREDICTED: NAC transcription factor 29-like [Elaeis guineensis]
Length=341

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = -1

Query  384  TSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEW  205
            T+ LPPGFRFHPTDEELI +YLRN+  S+PCPVSII EVDIYKFDPW+LP KA FG++EW
Sbjct  5    TTSLPPGFRFHPTDEELIQHYLRNRVASLPCPVSIIAEVDIYKFDPWDLPVKAMFGDREW  64

Query  204  YFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGI  31
            YFF+PRDRKYPNG+RPNRAA SGYWKATGTDK I S  G++ +GVKKALVFYKGRPPKG+
Sbjct  65   YFFSPRDRKYPNGIRPNRAAASGYWKATGTDKPIVSSKGNENIGVKKALVFYKGRPPKGV  124

Query  30   KTDWIMHEYR  1
            KT WIMHEYR
Sbjct  125  KTGWIMHEYR  134



>ref|XP_004505411.1| PREDICTED: NAC transcription factor 29-like [Cicer arietinum]
Length=253

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 116/133 (87%), Gaps = 3/133 (2%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M    +S+LPPGFRFHPTDEELI+YYL NQATS PCP SIIPEVDIYKFDPWELP   E 
Sbjct  1    MESNTSSELPPGFRFHPTDEELIVYYLGNQATSKPCPASIIPEVDIYKFDPWELPGMLE-  59

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPP  40
               EWYFF+PR+RKYPNGVRPNRA +SGYWKATGTDK I SGSK++GVKK+LVFYKGRPP
Sbjct  60   --NEWYFFSPRERKYPNGVRPNRATLSGYWKATGTDKPINSGSKHIGVKKSLVFYKGRPP  117

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  118  KGIKTNWIMHEYR  130



>ref|XP_008793367.1| PREDICTED: NAC transcription factor 29-like [Phoenix dactylifera]
Length=340

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 115/127 (91%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRNQA S+PCPVSII EVDIYKFDPWELP KA FG++EWYFF
Sbjct  7    LPPGFRFHPTDEELIVHYLRNQAASVPCPVSIIAEVDIYKFDPWELPAKAMFGDREWYFF  66

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAI--YSGSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG+RPNRAA SGYWKATGTDK I    G+  +GVKKALVFYKGRPPKG+KT+
Sbjct  67   SPRDRKYPNGMRPNRAAASGYWKATGTDKPIRMSRGNGNIGVKKALVFYKGRPPKGLKTN  126

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  127  WIMHEYR  133



>ref|XP_003518189.1| PREDICTED: NAC transcription factor NAM-2-like [Glycine max]
 gb|KHN00659.1| NAC domain-containing protein 29 [Glycine soja]
Length=354

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 118/139 (85%), Gaps = 6/139 (4%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            MG  Q+++LPPGFRFHPTDEELI++YLR +  S+P PVSII EVDIYKFDPWELP KAEF
Sbjct  1    MGTPQSNNLPPGFRFHPTDEELILHYLRKKVASIPLPVSIIAEVDIYKFDPWELPAKAEF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSG------SKYVGVKKALVF  58
            GEKEWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +        ++ GVKKALVF
Sbjct  61   GEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKNIVASLPGGGVREHFGVKKALVF  120

Query  57   YKGRPPKGIKTDWIMHEYR  1
            YKGRPPKG+KT+WIMHEYR
Sbjct  121  YKGRPPKGVKTNWIMHEYR  139



>ref|XP_010922870.1| PREDICTED: NAC transcription factor 29-like [Elaeis guineensis]
Length=341

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 119/135 (88%), Gaps = 3/135 (2%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M    TS LPPGFRFHPTDEELI++YL+N+A S PCPVSII EVDIYKF+PW+LP KA F
Sbjct  1    MSNPATS-LPPGFRFHPTDEELILHYLKNRAASFPCPVSIIAEVDIYKFNPWDLPAKAMF  59

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGR  46
            G+KEWYFF+PRDRKYPNG+RPNRAA SGYWKATGTDK I S  G++ +GVKKALVFY+GR
Sbjct  60   GDKEWYFFSPRDRKYPNGIRPNRAAASGYWKATGTDKPIISSKGNQNIGVKKALVFYQGR  119

Query  45   PPKGIKTDWIMHEYR  1
            PPKG+KTDWIMHEYR
Sbjct  120  PPKGVKTDWIMHEYR  134



>ref|XP_010921289.1| PREDICTED: NAC transcription factor 25-like [Elaeis guineensis]
Length=340

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 119/129 (92%), Gaps = 2/129 (2%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            + LPPGFRFHPTDEELI++YL+N+A S+PCPVSII EVDIYKFDPW+LP KA FG++EWY
Sbjct  5    TSLPPGFRFHPTDEELILHYLKNRAASVPCPVSIIAEVDIYKFDPWDLPAKAMFGDREWY  64

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIK  28
            FF+PRDRKYPNG+RPNRAA SGYWKATGTDK I++  G++ +GVKKALVFYKGRPPKG+K
Sbjct  65   FFSPRDRKYPNGIRPNRAAASGYWKATGTDKPIHTSKGNENIGVKKALVFYKGRPPKGLK  124

Query  27   TDWIMHEYR  1
            T+WIMHEYR
Sbjct  125  TNWIMHEYR  133



>ref|XP_008792524.1| PREDICTED: NAC transcription factor 29-like [Phoenix dactylifera]
Length=341

 Score =   227 bits (579),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 117/135 (87%), Gaps = 3/135 (2%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M    TS LPPGFRFHPTDEELI++YLRN+A S PCPVSII EVDIYKFDPW LP KA F
Sbjct  1    MSNPATS-LPPGFRFHPTDEELILHYLRNRAASFPCPVSIIAEVDIYKFDPWNLPAKALF  59

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSG--SKYVGVKKALVFYKGR  46
            G++EWYFF+PRDRKYPNG+RPNRAA SGYWKATGTDK I S   +K +GVKKALVFY+GR
Sbjct  60   GDREWYFFSPRDRKYPNGIRPNRAAASGYWKATGTDKPIISSKENKNIGVKKALVFYQGR  119

Query  45   PPKGIKTDWIMHEYR  1
            PPKG+KTDWIMHEYR
Sbjct  120  PPKGLKTDWIMHEYR  134



>ref|XP_009416337.1| PREDICTED: NAC transcription factor 29-like [Musa acuminata subsp. 
malaccensis]
Length=284

 Score =   225 bits (574),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 116/129 (90%), Gaps = 2/129 (2%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            + LPPGFRFHPTDEELI++YLRNQA S+PCPVSII EVDIYK DPW+LP KA FGE+EWY
Sbjct  5    ASLPPGFRFHPTDEELILHYLRNQAASLPCPVSIIAEVDIYKLDPWDLPGKAVFGEREWY  64

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIK  28
            FF+PRDRKYPNGVRPNRAA SGYWKATGTDK I+   G++ +GVKKALVFY+GRPPKG K
Sbjct  65   FFSPRDRKYPNGVRPNRAAASGYWKATGTDKPIHDSRGNERIGVKKALVFYEGRPPKGSK  124

Query  27   TDWIMHEYR  1
            T+WIMHEYR
Sbjct  125  TNWIMHEYR  133



>gb|ABU40774.1| NAP-like protein [Crocus sativus]
Length=247

 Score =   222 bits (566),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YL+NQATS PCPV IIPEV+IYKFDPWELP K+   +++WYFF
Sbjct  6    LPPGFRFHPTDEELIVHYLQNQATSRPCPVPIIPEVNIYKFDPWELPGKSSMSDEQWYFF  65

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPPKGIKTDWI  16
            TPRDRKYPNGVRPNRA  SGYWKATGTDKAIYSG   VG+KKALVFY GRPP+G KTDWI
Sbjct  66   TPRDRKYPNGVRPNRATRSGYWKATGTDKAIYSGPHLVGIKKALVFYGGRPPRGKKTDWI  125

Query  15   MHEYR  1
            MHEYR
Sbjct  126  MHEYR  130



>ref|XP_008782759.1| PREDICTED: NAC transcription factor 25-like [Phoenix dactylifera]
Length=339

 Score =   224 bits (572),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 116/127 (91%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRN+A S+PCPVSII EVDIYKFDPW+LP KA FG++EWYFF
Sbjct  7    LPPGFRFHPTDEELILHYLRNRAASVPCPVSIIAEVDIYKFDPWDLPAKAMFGDREWYFF  66

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG+RPNRAA SGYWKATGTDK I +  G++ +GVKKALVFY GRPPKG+KT+
Sbjct  67   SPRDRKYPNGIRPNRAAASGYWKATGTDKPIRTSKGNENIGVKKALVFYMGRPPKGLKTN  126

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  127  WIMHEYR  133



>gb|EMT02241.1| NAC domain-containing protein 29 [Aegilops tauschii]
Length=228

 Score =   221 bits (562),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 112/127 (88%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRN+A   PCPVSII +VDIYKFDPW LP KA +G++EWYFF
Sbjct  2    LPPGFRFHPTDEELILHYLRNRAAESPCPVSIIADVDIYKFDPWALPSKASYGDREWYFF  61

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS--KYVGVKKALVFYKGRPPKGIKTD  22
            TPRDRKYPNGVRPNRAA SGYWKATGTDK I   +  + VGVKKALVFYKGRPPKGIKT+
Sbjct  62   TPRDRKYPNGVRPNRAAGSGYWKATGTDKPIRCSATGESVGVKKALVFYKGRPPKGIKTN  121

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  122  WIMHEYR  128



>ref|XP_003548053.1| PREDICTED: NAC transcription factor NAM-2 [Glycine max]
 gb|KHN32743.1| NAC domain-containing protein 29 [Glycine soja]
Length=363

 Score =   224 bits (571),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 117/138 (85%), Gaps = 5/138 (4%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            MG  Q+++LPPGFRFHPTDEELI++YLR +  S+P PV+II EVDIYKFDPWELP KA F
Sbjct  1    MGTPQSNNLPPGFRFHPTDEELILHYLRKKVASIPLPVAIIAEVDIYKFDPWELPAKAAF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSG-----SKYVGVKKALVFY  55
            GEKEWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +       ++ GVKKALVFY
Sbjct  61   GEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKNIVASLAGGVREHFGVKKALVFY  120

Query  54   KGRPPKGIKTDWIMHEYR  1
            KG+PPKG+KT+WIMHEYR
Sbjct  121  KGKPPKGVKTNWIMHEYR  138



>ref|XP_003557998.1| PREDICTED: NAC transcription factor NAM-B1-like [Brachypodium 
distachyon]
Length=347

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRN+A   PCPVSII +VDIYKFDPW LP KA +G++EWYFF
Sbjct  9    LPPGFRFHPTDEELILHYLRNRAAESPCPVSIIADVDIYKFDPWALPSKANYGDREWYFF  68

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSG--SKYVGVKKALVFYKGRPPKGIKTD  22
            TPRDRKYPNGVRPNRAA SGYWKATGTDK I S   S+ VGVKKALVFYKGRPPKG+KT+
Sbjct  69   TPRDRKYPNGVRPNRAAGSGYWKATGTDKPIRSSATSESVGVKKALVFYKGRPPKGVKTN  128

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  129  WIMHEYR  135



>ref|XP_006829778.1| hypothetical protein AMTR_s00119p00040230 [Amborella trichopoda]
 gb|ERM97194.1| hypothetical protein AMTR_s00119p00040230 [Amborella trichopoda]
Length=357

 Score =   223 bits (568),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 113/138 (82%), Gaps = 12/138 (9%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEELI++YLRN+A S PCPVSII EVDIYKFDPW+LP KA FGE+EWYF
Sbjct  4    NLPPGFRFHPTDEELILHYLRNRAASNPCPVSIIAEVDIYKFDPWDLPAKAAFGEREWYF  63

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIY------------SGSKYVGVKKALVFY  55
            F+PRDRKYPNG RPNRAA SGYWKATGTDK I              G   +GVKKALVFY
Sbjct  64   FSPRDRKYPNGERPNRAAASGYWKATGTDKPIVRSSSNNNNNHNNEGKAIIGVKKALVFY  123

Query  54   KGRPPKGIKTDWIMHEYR  1
            KGRPPKGIKT+WIMHEYR
Sbjct  124  KGRPPKGIKTNWIMHEYR  141



>gb|ACD39374.1| NAC domain protein, partial [Glycine max]
Length=149

 Score =   216 bits (550),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 115/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q  +LPPGFRFHPTDEEL+++YL+ +A S P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSQQPNLPPGFRFHPTDEELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPAKAAFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFFTPRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFTPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            +GIKT+WIMHEYR
Sbjct  129  RGIKTNWIMHEYR  141



>ref|XP_009392736.1| PREDICTED: NAC domain-containing protein 67-like [Musa acuminata 
subsp. malaccensis]
Length=322

 Score =   222 bits (565),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 117/129 (91%), Gaps = 2/129 (2%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            + LPPGFRFHPTDEELI++YLRN+A++ PCPV II EVDIYK+DPW+LP KA +G++EWY
Sbjct  5    ASLPPGFRFHPTDEELILHYLRNRASASPCPVPIIAEVDIYKYDPWDLPAKAAYGDREWY  64

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIK  28
            FF+PRDRKYPNG RPNRAA SGYWKATGTDK I++  G++ VGVKKALVFY+GRPPKG+K
Sbjct  65   FFSPRDRKYPNGFRPNRAAASGYWKATGTDKPIHATHGNESVGVKKALVFYRGRPPKGVK  124

Query  27   TDWIMHEYR  1
            T+WIMHEYR
Sbjct  125  TNWIMHEYR  133



>ref|XP_002442733.1| hypothetical protein SORBIDRAFT_08g001940 [Sorghum bicolor]
 gb|EES16571.1| hypothetical protein SORBIDRAFT_08g001940 [Sorghum bicolor]
Length=429

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 117/140 (84%), Gaps = 2/140 (1%)
 Frame = -1

Query  414  SVQKMMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELP  235
            S  ++ GG    +LP GFRFHPTDEELI++YL NQA S+PCPV II EV+IY+ +PW+LP
Sbjct  7    SSSRVPGGGGNLNLPAGFRFHPTDEELIVHYLMNQAASIPCPVPIIAEVNIYQCNPWDLP  66

Query  234  EKAEFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALV  61
             KA FGE EWYFF+PRDRKYPNGVRPNRAA SGYWKATGTDKAI S   S+ +GVKKALV
Sbjct  67   AKALFGENEWYFFSPRDRKYPNGVRPNRAAGSGYWKATGTDKAILSTPTSQNIGVKKALV  126

Query  60   FYKGRPPKGIKTDWIMHEYR  1
            FY GRPPKG+KTDWIMHEYR
Sbjct  127  FYGGRPPKGVKTDWIMHEYR  146



>ref|XP_009410477.1| PREDICTED: NAC transcription factor 29-like [Musa acuminata subsp. 
malaccensis]
Length=285

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YL N+A S+PCPVSII EVDIYKFDPWELP KA FG+ EWYFF
Sbjct  8    LPPGFRFHPTDEELILHYLGNRAASLPCPVSIIAEVDIYKFDPWELPAKATFGDGEWYFF  67

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIY--SGSKYVGVKKALVFYKGRPPKGIKTD  22
            +PR+RKYPNG RPNRAA SGYWKATG DK +   SG+ Y+GVKKALVFYKGRPPKG+KT+
Sbjct  68   SPRERKYPNGYRPNRAAASGYWKATGIDKPVVTSSGNSYIGVKKALVFYKGRPPKGVKTN  127

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  128  WIMHEYR  134



>ref|XP_010088481.1| NAC domain-containing protein 29 [Morus notabilis]
 gb|EXB36251.1| NAC domain-containing protein 29 [Morus notabilis]
Length=358

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 116/139 (83%), Gaps = 7/139 (5%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            M   QTS LPPGFRFHPTDEELI++YLR +  S+P PVSII EVDIYKFDPW+LP KA F
Sbjct  1    MKNPQTS-LPPGFRFHPTDEELILHYLRKRVISIPLPVSIIAEVDIYKFDPWDLPAKATF  59

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS------GSKYVGVKKALVF  58
            GEKEWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +      G + +GVKKALVF
Sbjct  60   GEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKTIMTLVTPGGGQQNIGVKKALVF  119

Query  57   YKGRPPKGIKTDWIMHEYR  1
            YKGRPPKG+KT+WIMHEYR
Sbjct  120  YKGRPPKGVKTNWIMHEYR  138



>ref|XP_008240449.1| PREDICTED: NAC transcription factor 25 [Prunus mume]
Length=384

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 111/130 (85%), Gaps = 3/130 (2%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            S LPPGFRFHPTDEELI++YL  +  S P PVSII EVDIYKFDPWELP KA FGEKEWY
Sbjct  7    SSLPPGFRFHPTDEELILHYLTKKVASTPLPVSIIAEVDIYKFDPWELPAKAAFGEKEWY  66

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS---GSKYVGVKKALVFYKGRPPKGI  31
            FF+PRDRKYPNG RPNRAA SGYWKATGTDK I +   G + VGVKKALVFYKGRPPKGI
Sbjct  67   FFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVASLGGRQNVGVKKALVFYKGRPPKGI  126

Query  30   KTDWIMHEYR  1
            KT+WIMHEYR
Sbjct  127  KTNWIMHEYR  136



>emb|CBI32712.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 114/127 (90%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHP+DEELI++YLRN+ATS P P SII EVD+YK++PWELP KA FG+ EWYFF
Sbjct  13   LPPGFRFHPSDEELIIHYLRNKATSSPIPASIIAEVDLYKYNPWELPTKALFGQDEWYFF  72

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            TPRDRKYPNGVRPNRAA SGYWKATGTDK I +  G++ +GVKKALVFYKGRPPKG+KTD
Sbjct  73   TPRDRKYPNGVRPNRAAASGYWKATGTDKPILTSCGTRSIGVKKALVFYKGRPPKGVKTD  132

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  133  WIMHEYR  139



>ref|XP_002275457.1| PREDICTED: NAC domain-containing protein 2 [Vitis vinifera]
Length=342

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 114/127 (90%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHP+DEELI++YLRN+ATS P P SII EVD+YK++PWELP KA FG+ EWYFF
Sbjct  13   LPPGFRFHPSDEELIIHYLRNKATSSPIPASIIAEVDLYKYNPWELPTKALFGQDEWYFF  72

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            TPRDRKYPNGVRPNRAA SGYWKATGTDK I +  G++ +GVKKALVFYKGRPPKG+KTD
Sbjct  73   TPRDRKYPNGVRPNRAAASGYWKATGTDKPILTSCGTRSIGVKKALVFYKGRPPKGVKTD  132

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  133  WIMHEYR  139



>ref|XP_009345059.1| PREDICTED: NAC transcription factor 29-like [Pyrus x bretschneideri]
Length=372

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 111/130 (85%), Gaps = 3/130 (2%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            S LPPGFRFHPTDEELI++YL  +  S P PVS+I EVDIYKFDPWELP KA FGEKEWY
Sbjct  6    SRLPPGFRFHPTDEELILHYLVKKVASTPLPVSVIAEVDIYKFDPWELPAKAAFGEKEWY  65

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS---GSKYVGVKKALVFYKGRPPKGI  31
            FF+PRDRKYPNG RPNRAA SGYWKATGTDK I +   G + VGVKKALVFYKGRPPKGI
Sbjct  66   FFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVAPSGGGQNVGVKKALVFYKGRPPKGI  125

Query  30   KTDWIMHEYR  1
            KT+WIMHEYR
Sbjct  126  KTNWIMHEYR  135



>ref|XP_007151816.1| hypothetical protein PHAVU_004G077400g [Phaseolus vulgaris]
 gb|ESW23810.1| hypothetical protein PHAVU_004G077400g [Phaseolus vulgaris]
Length=343

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 115/138 (83%), Gaps = 5/138 (4%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            MG  Q+++LPPGFRFHPTDEELI++YLR +  S+P  VSII EVDIYK DPWELP KA F
Sbjct  1    MGTPQSNNLPPGFRFHPTDEELILHYLRKKVASIPLAVSIIAEVDIYKCDPWELPAKAAF  60

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSG-----SKYVGVKKALVFY  55
            GEKEWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +       ++ GVKKALVFY
Sbjct  61   GEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKNIVASLAGGVREHFGVKKALVFY  120

Query  54   KGRPPKGIKTDWIMHEYR  1
            KGRPPKG+KT+WIMHEYR
Sbjct  121  KGRPPKGVKTNWIMHEYR  138



>ref|XP_009366417.1| PREDICTED: NAC transcription factor 29-like [Pyrus x bretschneideri]
Length=372

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 111/130 (85%), Gaps = 3/130 (2%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            S LPPGFRFHPTDEELI++YL  +  S P PVS+I EVDIYKFDPWELP KA FGEKEWY
Sbjct  6    SRLPPGFRFHPTDEELILHYLVKKVASTPLPVSVIAEVDIYKFDPWELPAKAAFGEKEWY  65

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS---GSKYVGVKKALVFYKGRPPKGI  31
            FF+PRDRKYPNG RPNRAA SGYWKATGTDK I +   G + VGVKKALVFYKGRPPKGI
Sbjct  66   FFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVAPSGGGQNVGVKKALVFYKGRPPKGI  125

Query  30   KTDWIMHEYR  1
            KT+WIMHEYR
Sbjct  126  KTNWIMHEYR  135



>ref|XP_007202090.1| hypothetical protein PRUPE_ppa007445mg [Prunus persica]
 gb|EMJ03289.1| hypothetical protein PRUPE_ppa007445mg [Prunus persica]
Length=367

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 111/130 (85%), Gaps = 3/130 (2%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            S LPPGFRFHPTDEELI++YL  +  S P PVSII EVDIYKFDPWELP KA FGEKEWY
Sbjct  7    SSLPPGFRFHPTDEELILHYLTKKVASTPLPVSIIAEVDIYKFDPWELPAKAAFGEKEWY  66

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS---GSKYVGVKKALVFYKGRPPKGI  31
            FF+PRDRKYPNG RPNRAA SGYWKATGTDK I +   G + VGVKKALVFYKGRPPKGI
Sbjct  67   FFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVASLGGRQNVGVKKALVFYKGRPPKGI  126

Query  30   KTDWIMHEYR  1
            KT+WIMHEYR
Sbjct  127  KTNWIMHEYR  136



>ref|XP_010418059.1| PREDICTED: NAC transcription factor 25-like [Camelina sativa]
Length=340

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +ATS+P PVSII E+D+YKFDPWELP KA FGE EWYFF
Sbjct  16   LPPGFRFHPTDEELVVHYLKKKATSVPLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFF  75

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKY-VGVKKALVFYKGRPPKGIKTDW  19
            TPRDRKYPNGVRPNRAA SGYWKATGTDK I++ + + VGVKKALVFY G+PPKGIKTDW
Sbjct  76   TPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKTDW  135

Query  18   IMHEYR  1
            IMHEYR
Sbjct  136  IMHEYR  141



>ref|NP_001049997.2| Os03g0327800 [Oryza sativa Japonica Group]
 dbj|BAF11911.2| Os03g0327800 [Oryza sativa Japonica Group]
Length=187

 Score =   216 bits (549),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 114/130 (88%), Gaps = 5/130 (4%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRN+A S PCPVSII +VDIYKFDPW+LP K  +G++EWYFF
Sbjct  9    LPPGFRFHPTDEELIVHYLRNRAASSPCPVSIIADVDIYKFDPWDLPSKENYGDREWYFF  68

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSG-----SKYVGVKKALVFYKGRPPKGI  31
            +PRDRKYPNG+RPNRAA SGYWKATGTDK I+S      ++ VGVKKALVFYKGRPPKG 
Sbjct  69   SPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHSSGGAATNESVGVKKALVFYKGRPPKGT  128

Query  30   KTDWIMHEYR  1
            KT+WIMHEYR
Sbjct  129  KTNWIMHEYR  138



>gb|AGS08758.1| NAC domain protein [Malus hupehensis]
Length=373

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 111/130 (85%), Gaps = 3/130 (2%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            S LPPGFRFHPTDEELI++YL  +  S P PVSII EVDIYKFDPWELP KA FGEKEWY
Sbjct  6    SRLPPGFRFHPTDEELILHYLIKKVASTPLPVSIIAEVDIYKFDPWELPAKAAFGEKEWY  65

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS---GSKYVGVKKALVFYKGRPPKGI  31
            FF+PRDRKYPNG RPNRAA SGYWKATGTDK I +   G + VGVKKALVFYKGRPPKGI
Sbjct  66   FFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVAPSGGRQNVGVKKALVFYKGRPPKGI  125

Query  30   KTDWIMHEYR  1
            KT+WIMHEYR
Sbjct  126  KTNWIMHEYR  135



>ref|XP_009353167.1| PREDICTED: NAC transcription factor 29-like [Pyrus x bretschneideri]
Length=373

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 111/130 (85%), Gaps = 3/130 (2%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            S LPPGFRFHPTDEELI++YL  +  S P PVSII EVDIYKFDPWELP KA FGEKEWY
Sbjct  6    SRLPPGFRFHPTDEELILHYLIKKVASTPLPVSIIAEVDIYKFDPWELPAKAAFGEKEWY  65

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS---GSKYVGVKKALVFYKGRPPKGI  31
            FF+PRDRKYPNG RPNRAA SGYWKATGTDK I +   G + VGVKKALVFYKGRPPKGI
Sbjct  66   FFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVAPSGGRQNVGVKKALVFYKGRPPKGI  125

Query  30   KTDWIMHEYR  1
            KT+WIMHEYR
Sbjct  126  KTNWIMHEYR  135



>ref|XP_002532683.1| NAC domain-containing protein, putative [Ricinus communis]
 gb|EEF29696.1| NAC domain-containing protein, putative [Ricinus communis]
Length=346

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 117/133 (88%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q  +LPPGFRFHPTDEEL+++YL+ +A+S P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSQQPNLPPGFRFHPTDEELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNGVRPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGVRPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  129  KGIKTNWIMHEYR  141



>ref|NP_001280963.1| NAC transcription factor 29 [Malus domestica]
 gb|ADL36804.1| NAC domain class transcription factor [Malus domestica]
Length=373

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 111/130 (85%), Gaps = 3/130 (2%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            S LPPGFRFHPTDEELI++YL  +  S P PVSII EVDIYKFDPWELP KA FGEKEWY
Sbjct  6    SRLPPGFRFHPTDEELILHYLIKKVASTPLPVSIIAEVDIYKFDPWELPAKAAFGEKEWY  65

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS---GSKYVGVKKALVFYKGRPPKGI  31
            FF+PRDRKYPNG RPNRAA SGYWKATGTDK I +   G + VGVKKALVFYKGRPPKGI
Sbjct  66   FFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVAPSGGRQNVGVKKALVFYKGRPPKGI  125

Query  30   KTDWIMHEYR  1
            KT+WIMHEYR
Sbjct  126  KTNWIMHEYR  135



>ref|XP_010473311.1| PREDICTED: NAC transcription factor 25-like [Camelina sativa]
Length=328

 Score =   220 bits (560),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +ATS+P PVSII E+D+YKFDPWELP KA FGE EWYFF
Sbjct  16   LPPGFRFHPTDEELVVHYLKKKATSVPLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFF  75

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKY-VGVKKALVFYKGRPPKGIKTDW  19
            +PRDRKYPNGVRPNRAA SGYWKATGTDK I++ + + VGVKKALVFY G+PPKGIKTDW
Sbjct  76   SPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKTDW  135

Query  18   IMHEYR  1
            IMHEYR
Sbjct  136  IMHEYR  141



>gb|AGL39684.1| NAC transcription factor 028 [Jatropha curcas]
 gb|KDP38908.1| hypothetical protein JCGZ_00665 [Jatropha curcas]
Length=345

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 117/133 (88%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q  +LPPGFRFHPTDEEL+++YL+ +A+S P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSQQPNLPPGFRFHPTDEELVVHYLKRKASSAPLPVAIIAEVDLYKFDPWELPAKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNGVRPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGVRPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  129  KGIKTNWIMHEYR  141



>ref|XP_002465328.1| hypothetical protein SORBIDRAFT_01g036560 [Sorghum bicolor]
 gb|EER92326.1| hypothetical protein SORBIDRAFT_01g036560 [Sorghum bicolor]
Length=380

 Score =   221 bits (563),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 115/127 (91%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRN+A ++PCPV+II +VDIYKFDPW+LP +A +G+KEWYFF
Sbjct  9    LPPGFRFHPTDEELILHYLRNRAANVPCPVAIIADVDIYKFDPWDLPSRAAYGDKEWYFF  68

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS--KYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG+RPNRAA SGYWKATGTDK I S +  + VGVKKALVFY+GRPPKG KT+
Sbjct  69   SPRDRKYPNGIRPNRAAGSGYWKATGTDKPIQSSATGESVGVKKALVFYRGRPPKGTKTN  128

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  129  WIMHEYR  135



>ref|XP_010430102.1| PREDICTED: NAC transcription factor 25 [Camelina sativa]
Length=324

 Score =   219 bits (559),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +ATS+P PVSII E+D+YKFDPWELP KA FGE EWYFF
Sbjct  16   LPPGFRFHPTDEELVVHYLKKKATSVPLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFF  75

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKY-VGVKKALVFYKGRPPKGIKTDW  19
            +PRDRKYPNGVRPNRAA SGYWKATGTDK I++ + + VGVKKALVFY G+PPKGIKTDW
Sbjct  76   SPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKTDW  135

Query  18   IMHEYR  1
            IMHEYR
Sbjct  136  IMHEYR  141



>ref|XP_006300981.1| hypothetical protein CARUB_v10021371mg [Capsella rubella]
 gb|EOA33879.1| hypothetical protein CARUB_v10021371mg [Capsella rubella]
Length=324

 Score =   219 bits (559),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +ATS+P PVSII E+D+YKFDPWELP KA FGE EWYFF
Sbjct  16   LPPGFRFHPTDEELVVHYLKKKATSVPLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFF  75

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKY-VGVKKALVFYKGRPPKGIKTDW  19
            +PRDRKYPNGVRPNRAA SGYWKATGTDK I++ + + VGVKKALVFY G+PPKGIKTDW
Sbjct  76   SPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKTDW  135

Query  18   IMHEYR  1
            IMHEYR
Sbjct  136  IMHEYR  141



>ref|XP_007030230.1| NAC domain containing protein 47, putative isoform 2 [Theobroma 
cacao]
 gb|EOY10732.1| NAC domain containing protein 47, putative isoform 2 [Theobroma 
cacao]
Length=356

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 114/136 (84%), Gaps = 9/136 (7%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            S LPPGFRFHPTDEELI++YL+ + +S P PVSII +VDIYKFDPWELP KA FGEKEWY
Sbjct  6    SSLPPGFRFHPTDEELILHYLKKKLSSSPFPVSIIADVDIYKFDPWELPAKAAFGEKEWY  65

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS---------KYVGVKKALVFYKG  49
            FF+PRDRKYPNG RPNRAA SGYWKATGTDK I++ S         + +GVKKALVFYKG
Sbjct  66   FFSPRDRKYPNGARPNRAAASGYWKATGTDKVIFTSSMVAGGGGVQENIGVKKALVFYKG  125

Query  48   RPPKGIKTDWIMHEYR  1
            RPPKGIKT+WIMHEYR
Sbjct  126  RPPKGIKTNWIMHEYR  141



>ref|XP_010549620.1| PREDICTED: NAC transcription factor 29 [Tarenaya hassleriana]
Length=342

 Score =   220 bits (560),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 113/127 (89%), Gaps = 1/127 (1%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            S+LPPGFRFHPTDEELI++YLR + +S P PVSII +VDIYKFDPW+LP KA FGEKEWY
Sbjct  7    SNLPPGFRFHPTDEELILHYLRKKVSSSPVPVSIIADVDIYKFDPWDLPAKAPFGEKEWY  66

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPPKGIKTD  22
            FF+PRDRKYPNG RPNRAA SGYWKATGTD+ I  G + +GVKKALVFYKGRPPKG+KT+
Sbjct  67   FFSPRDRKYPNGGRPNRAAASGYWKATGTDRMI-GGDENIGVKKALVFYKGRPPKGVKTN  125

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  126  WIMHEYR  132



>ref|XP_009769986.1| PREDICTED: NAC transcription factor 25 [Nicotiana sylvestris]
Length=353

 Score =   220 bits (560),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 116/140 (83%), Gaps = 2/140 (1%)
 Frame = -1

Query  414  SVQKMMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELP  235
            S     G  Q   LPPGFRFHPTDEEL+++YL+ +A S+P PV+II EVD+YKFDPWELP
Sbjct  3    STDSSSGSHQQPQLPPGFRFHPTDEELVVHYLKKKAASIPLPVAIIAEVDLYKFDPWELP  62

Query  234  EKAEFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALV  61
             KA FGE+EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALV
Sbjct  63   AKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALV  122

Query  60   FYKGRPPKGIKTDWIMHEYR  1
            FY G+PPKG+KT+WIMHEYR
Sbjct  123  FYGGKPPKGVKTNWIMHEYR  142



>gb|AHJ79165.1| NAC domain protein NAC24 [Gossypium hirsutum]
Length=344

 Score =   220 bits (560),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 116/133 (87%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q  +LPPGFRFHPTDEEL+++YL+ +A+S P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSQQPNLPPGFRFHPTDEELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNGVRPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGVRPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT WIMHEYR
Sbjct  129  KGIKTSWIMHEYR  141



>ref|XP_008780790.1| PREDICTED: NAC transcription factor 29-like, partial [Phoenix 
dactylifera]
Length=142

 Score =   213 bits (542),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEELI+YYL N A S PCP SIIPEV+I KFDPWELP K+   E EWYF
Sbjct  4    ELPPGFRFHPTDEELIIYYLHNHAMSRPCPASIIPEVNICKFDPWELPGKSYLREGEWYF  63

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPPKGIKTDW  19
            F+PRDRKYPNG RPNRA  SG+WKATG DKAI+S SK+VGVKKALVFY+GRPPKG KT+W
Sbjct  64   FSPRDRKYPNGGRPNRATASGFWKATGADKAIHSNSKHVGVKKALVFYRGRPPKGSKTEW  123

Query  18   IMHEYR  1
            IMHEYR
Sbjct  124  IMHEYR  129



>emb|CBI38329.3| unnamed protein product [Vitis vinifera]
Length=331

 Score =   219 bits (558),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G     LPPGFRFHPTDEEL+++YL+ +A S+P PV+II +VD+YKFDPWELP KA FGE
Sbjct  9    GSHHPQLPPGFRFHPTDEELVVHYLKRKAASVPLPVTIIADVDLYKFDPWELPSKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +  GS+ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTSNGSQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  129  KGIKTNWIMHEYR  141



>ref|XP_008660189.1| PREDICTED: NAC transcription factor 29-like [Zea mays]
 gb|AFW88485.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
Length=241

 Score =   216 bits (550),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 115/137 (84%), Gaps = 3/137 (2%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M+     S LPPGFRFHPTDEELI+ YLRN+A + PCPV+II +VDIYK DPW+LP +A 
Sbjct  1    MIKANPDSMLPPGFRFHPTDEELIVNYLRNRAANTPCPVAIIADVDIYKLDPWDLPSRAA  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIY---SGSKYVGVKKALVFYK  52
            +G+KEWYFF+PRDRKYPNGVRPNRAA SGYWKATGTDK I+   +G   VGVKKALVFYK
Sbjct  61   YGDKEWYFFSPRDRKYPNGVRPNRAAGSGYWKATGTDKPIHGSATGGSVVGVKKALVFYK  120

Query  51   GRPPKGIKTDWIMHEYR  1
            GRPPKG KT+WIMHEYR
Sbjct  121  GRPPKGAKTNWIMHEYR  137



>gb|KHG07368.1| NAC domain-containing 18 -like protein [Gossypium arboreum]
Length=347

 Score =   219 bits (559),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 116/133 (87%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q  +LPPGFRFHPTDEEL+++YL+ +A+S P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSQQPNLPPGFRFHPTDEELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNGVRPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGVRPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT WIMHEYR
Sbjct  129  KGIKTSWIMHEYR  141



>ref|XP_004493136.1| PREDICTED: NAC transcription factor 25-like [Cicer arietinum]
Length=335

 Score =   219 bits (558),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 113/142 (80%), Gaps = 10/142 (7%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            MG  Q S+LPPGFRFHPTD ELI++YLR +  S+P PVSII EVDIYK DPWELP KA F
Sbjct  1    MGTPQ-SNLPPGFRFHPTDAELILHYLRKKIASIPLPVSIIAEVDIYKLDPWELPAKASF  59

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIY---------SGSKYVGVKKA  67
            GEKEWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I          S    +GVKKA
Sbjct  60   GEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVASLPSGGRRSHDNIIGVKKA  119

Query  66   LVFYKGRPPKGIKTDWIMHEYR  1
            LVFYKG+PPKG+KT+WIMHEYR
Sbjct  120  LVFYKGKPPKGVKTNWIMHEYR  141



>ref|XP_003635288.1| PREDICTED: NAC transcription factor 25 [Vitis vinifera]
Length=326

 Score =   219 bits (557),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G     LPPGFRFHPTDEEL+++YL+ +A S+P PV+II +VD+YKFDPWELP KA FGE
Sbjct  9    GSHHPQLPPGFRFHPTDEELVVHYLKRKAASVPLPVTIIADVDLYKFDPWELPSKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +  GS+ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTSNGSQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  129  KGIKTNWIMHEYR  141



>gb|KEH38791.1| NAC transcription factor-like protein [Medicago truncatula]
Length=354

 Score =   219 bits (559),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q  +LPPGFRFHPTDEEL+++YL+ +A S P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSQQPNLPPGFRFHPTDEELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPAKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            +GIKT+WIMHEYR
Sbjct  129  RGIKTNWIMHEYR  141



>emb|CDY12886.1| BnaA09g13880D [Brassica napus]
Length=321

 Score =   218 bits (556),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A S+P PVSII E+D+YKFDPWELP KA FGE+EWYFF
Sbjct  16   LPPGFRFHPTDEELVVHYLKKKAASIPLPVSIIAEIDLYKFDPWELPSKASFGEQEWYFF  75

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS-GSKYVGVKKALVFYKGRPPKGIKTDW  19
            +PRDRKYPNGVRPNRAA SGYWKATGTDK I++  S  VGVKKALVFY G+PPKGIKTDW
Sbjct  76   SPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKTDW  135

Query  18   IMHEYR  1
            IMHEYR
Sbjct  136  IMHEYR  141



>emb|CDY40970.1| BnaCnng10130D [Brassica napus]
Length=322

 Score =   218 bits (556),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A S+P PVSII E+D+YKFDPWELP KA FGE+EWYFF
Sbjct  16   LPPGFRFHPTDEELVVHYLKKKAASIPLPVSIIAEIDLYKFDPWELPSKASFGEQEWYFF  75

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKY-VGVKKALVFYKGRPPKGIKTDW  19
            +PRDRKYPNGVRPNRAA SGYWKATGTDK I++ + + VGVKKALVFY G+PPKGIKTDW
Sbjct  76   SPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKTDW  135

Query  18   IMHEYR  1
            IMHEYR
Sbjct  136  IMHEYR  141



>ref|XP_011027905.1| PREDICTED: NAC transcription factor 25-like [Populus euphratica]
Length=351

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 115/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q   LPPGFRFHPTDEEL+++YL+ +A S+P PV+II E+D+YKFDPWELP KA FGE
Sbjct  9    GSQHPQLPPGFRFHPTDEELVVHYLKKKAASVPLPVTIIAEIDLYKFDPWELPSKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTSNGAQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  129  KGIKTNWIMHEYR  141



>ref|XP_009113148.1| PREDICTED: NAC transcription factor 25 [Brassica rapa]
Length=322

 Score =   218 bits (556),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A S+P PVSII E+D+YKFDPWELP KA FGE+EWYFF
Sbjct  16   LPPGFRFHPTDEELVVHYLKKKAASIPLPVSIIAEIDLYKFDPWELPSKASFGEQEWYFF  75

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS-GSKYVGVKKALVFYKGRPPKGIKTDW  19
            +PRDRKYPNGVRPNRAA SGYWKATGTDK I++  S  VGVKKALVFY G+PPKGIKTDW
Sbjct  76   SPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKTDW  135

Query  18   IMHEYR  1
            IMHEYR
Sbjct  136  IMHEYR  141



>ref|XP_002888109.1| ANAC025 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64368.1| ANAC025 [Arabidopsis lyrata subsp. lyrata]
Length=326

 Score =   218 bits (556),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 1/126 (1%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A S+P PVSII E+D+YKFDPWELP KA FGE EWYFF
Sbjct  16   LPPGFRFHPTDEELVVHYLKKKAASVPLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFF  75

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS-GSKYVGVKKALVFYKGRPPKGIKTDW  19
            +PRDRKYPNGVRPNRAA SGYWKATGTDK I++  S  VGVKKALVFY G+PPKGIKTDW
Sbjct  76   SPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKTDW  135

Query  18   IMHEYR  1
            IMHEYR
Sbjct  136  IMHEYR  141



>ref|XP_010100577.1| NAC domain-containing protein 29 [Morus notabilis]
 gb|EXB82820.1| NAC domain-containing protein 29 [Morus notabilis]
Length=345

 Score =   219 bits (558),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 116/134 (87%), Gaps = 2/134 (1%)
 Frame = -1

Query  396  GGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFG  217
             G Q   LPPGFRFHPTDEEL+++YL+ +A+S+P PV+II EVD+YKFDPWELP KA FG
Sbjct  8    SGSQHPQLPPGFRFHPTDEELVVHYLKRKASSVPLPVTIIAEVDLYKFDPWELPSKASFG  67

Query  216  EKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRP  43
            E+EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALVFY G+P
Sbjct  68   EQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTSNGTQKVGVKKALVFYGGKP  127

Query  42   PKGIKTDWIMHEYR  1
            PKGIKT+WIMHEYR
Sbjct  128  PKGIKTNWIMHEYR  141



>ref|XP_006451941.1| hypothetical protein CICLE_v10008628mg [Citrus clementina]
 ref|XP_006464707.1| PREDICTED: NAC transcription factor 25-like [Citrus sinensis]
 gb|ESR65181.1| hypothetical protein CICLE_v10008628mg [Citrus clementina]
 gb|KDO74152.1| hypothetical protein CISIN_1g016791mg [Citrus sinensis]
Length=382

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 116/140 (83%), Gaps = 2/140 (1%)
 Frame = -1

Query  414  SVQKMMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELP  235
            S     GG    +LPPGFRFHPTDEEL+++YL+ +A+S P PVSII EVD+YKFDPWELP
Sbjct  3    SADSSTGGSPQPNLPPGFRFHPTDEELVVHYLKKKASSAPLPVSIIAEVDLYKFDPWELP  62

Query  234  EKAEFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALV  61
             KA FGE+EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + S   ++ VGVKKALV
Sbjct  63   AKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVMSSGSNQKVGVKKALV  122

Query  60   FYKGRPPKGIKTDWIMHEYR  1
            FY G+PPKGIKT+WIMHEYR
Sbjct  123  FYGGKPPKGIKTNWIMHEYR  142



>gb|KHN36793.1| NAC domain-containing protein 18 [Glycine soja]
Length=375

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 115/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q  +LPPGFRFHPTDEEL+++YL+ +A S P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSQQPNLPPGFRFHPTDEELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPAKAAFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFFTPRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFTPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            +GIKT+WIMHEYR
Sbjct  129  RGIKTNWIMHEYR  141



>ref|XP_007021327.1| NAC domain protein, IPR003441 [Theobroma cacao]
 gb|EOY12852.1| NAC domain protein, IPR003441 [Theobroma cacao]
Length=347

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 116/133 (87%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q  +LPPGFRFHPTDEEL+++YL+ +A+S P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSQQPNLPPGFRFHPTDEELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  129  KGIKTNWIMHEYR  141



>ref|XP_003543257.1| PREDICTED: NAC domain-containing protein 18 [Glycine max]
Length=375

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 115/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q  +LPPGFRFHPTDEEL+++YL+ +A S P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSQQPNLPPGFRFHPTDEELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPAKAAFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFFTPRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFTPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            +GIKT+WIMHEYR
Sbjct  129  RGIKTNWIMHEYR  141



>gb|ADP69101.1| NAC transcription factor 1 [Bambusa emeiensis]
Length=355

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 114/127 (90%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRN+A S PCPV+II +VDIYKFDPW+LP KA +G+KEWYFF
Sbjct  9    LPPGFRFHPTDEELILHYLRNRAGSSPCPVAIIADVDIYKFDPWDLPSKAAYGDKEWYFF  68

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS--KYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG+RPNRAA SGYWKATGTDK I++ +  + +GVKKALVFY GRPPKG KT+
Sbjct  69   SPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHNSATGESLGVKKALVFYTGRPPKGTKTN  128

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  129  WIMHEYR  135



>gb|AGC97438.1| NAC protein 8 [Gossypium hirsutum]
Length=356

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 113/136 (83%), Gaps = 9/136 (7%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            S LPPGFRFHPTDEELI++YL+ + TS P PVSII +VDIYKFDPW+LP KA FGEKEWY
Sbjct  8    SSLPPGFRFHPTDEELILHYLKKKITSSPFPVSIIADVDIYKFDPWDLPGKAAFGEKEWY  67

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS---------KYVGVKKALVFYKG  49
            FF+PRDRKYPNG RPNRAA SGYWKATGTDK I + S         + +GVKKALVFYKG
Sbjct  68   FFSPRDRKYPNGARPNRAAASGYWKATGTDKVIVTSSMADRRGEVQENIGVKKALVFYKG  127

Query  48   RPPKGIKTDWIMHEYR  1
            RPPKG+KTDWIMHEYR
Sbjct  128  RPPKGMKTDWIMHEYR  143



>ref|XP_009780447.1| PREDICTED: NAC transcription factor 25-like [Nicotiana sylvestris]
Length=269

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 113/136 (83%), Gaps = 2/136 (1%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            +M G     LPPGFRFHPTDEEL+++YL+ +  S P PV II EVD+YKFDPWELP KA 
Sbjct  6    LMSGSSHLQLPPGFRFHPTDEELVVHYLKKKVASAPLPVKIIAEVDLYKFDPWELPSKAN  65

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKG  49
            FGE+EWYFF+PRDRKYPNG RPNRAA SGYWKATG DK IY+  G+K +GVKK LVFY+G
Sbjct  66   FGEQEWYFFSPRDRKYPNGTRPNRAATSGYWKATGIDKPIYTCGGTKKIGVKKTLVFYRG  125

Query  48   RPPKGIKTDWIMHEYR  1
            +PPKGIK++W+MHEYR
Sbjct  126  KPPKGIKSNWVMHEYR  141



>ref|XP_006392059.1| hypothetical protein EUTSA_v10023591mg [Eutrema salsugineum]
 gb|ESQ29345.1| hypothetical protein EUTSA_v10023591mg [Eutrema salsugineum]
Length=325

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A+S+P PVSII E+D+YKFDPWELP K  FGE+EWYFF
Sbjct  16   LPPGFRFHPTDEELVVHYLKKKASSIPLPVSIIAEIDLYKFDPWELPSKTSFGEQEWYFF  75

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS-GSKYVGVKKALVFYKGRPPKGIKTDW  19
            +PRDRKYPNGVRPNRAA SGYWKATGTDK I++  S  VGVKKALVFY G+PPKGIKTDW
Sbjct  76   SPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKTDW  135

Query  18   IMHEYR  1
            IMHEYR
Sbjct  136  IMHEYR  141



>ref|NP_001281058.1| NAC transcription factor 25-like [Malus domestica]
 gb|ADL36805.1| NAC domain class transcription factor [Malus domestica]
Length=373

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 114/134 (85%), Gaps = 2/134 (1%)
 Frame = -1

Query  396  GGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFG  217
             G Q   LPPGFRFHPTDEEL+++YL+ +A S+P PV+II EVD+YKFDPWELP KA FG
Sbjct  8    SGSQHPQLPPGFRFHPTDEELVVHYLKKKAASIPLPVTIIAEVDLYKFDPWELPSKATFG  67

Query  216  EKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRP  43
            E+EWYFFTPRDRKYPNG RPNRAA SGYWKATGTDK I +  G+  VGVKKALVFY G+P
Sbjct  68   EQEWYFFTPRDRKYPNGARPNRAATSGYWKATGTDKPILTSIGNHNVGVKKALVFYGGKP  127

Query  42   PKGIKTDWIMHEYR  1
            PKGIKT+WIMHEYR
Sbjct  128  PKGIKTNWIMHEYR  141



>gb|AAM65392.1| NAM protein, putative [Arabidopsis thaliana]
Length=323

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 1/126 (1%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A S+P PVSII E+D+YKFDPWELP KA FGE EWYFF
Sbjct  16   LPPGFRFHPTDEELVVHYLKKKAASVPLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFF  75

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS-GSKYVGVKKALVFYKGRPPKGIKTDW  19
            +PRDRKYPNGVRPNRAA SGYWKATGTDK I++  S  VGVKKALVFY G+PPKGIKTDW
Sbjct  76   SPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKTDW  135

Query  18   IMHEYR  1
            IMHEYR
Sbjct  136  IMHEYR  141



>ref|XP_006841705.1| hypothetical protein AMTR_s00003p00252470 [Amborella trichopoda]
 gb|ERN03380.1| hypothetical protein AMTR_s00003p00252470 [Amborella trichopoda]
Length=349

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = -1

Query  387  QTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKE  208
            Q   LPPGFRFHPTDEEL+++YL+ +A+S P PV+II EVD+YKFDPWELP KA FGE+E
Sbjct  11   QQPQLPPGFRFHPTDEELVVHYLKKKASSAPLPVTIIAEVDLYKFDPWELPGKATFGEQE  70

Query  207  WYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKG  34
            WYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALVFY GRPPKG
Sbjct  71   WYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTSGGTQKVGVKKALVFYGGRPPKG  130

Query  33   IKTDWIMHEYR  1
            IKT+WIMHEYR
Sbjct  131  IKTNWIMHEYR  141



>gb|EMS63328.1| NAC domain-containing protein 29 [Triticum urartu]
Length=568

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 112/127 (88%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRN+A   PCPVSII +VDIYKFDPW LP KA +G++EWYFF
Sbjct  80   LPPGFRFHPTDEELILHYLRNRAAESPCPVSIIADVDIYKFDPWALPSKASYGDREWYFF  139

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS--KYVGVKKALVFYKGRPPKGIKTD  22
            TPRDRKYPNGVRPNRAA SGYWKATGTDK I   +  + VGVKKALVFYKGRPPKGIKT+
Sbjct  140  TPRDRKYPNGVRPNRAAGSGYWKATGTDKPIRCSATGESVGVKKALVFYKGRPPKGIKTN  199

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  200  WIMHEYR  206



>ref|XP_010999473.1| PREDICTED: NAC transcription factor 29-like [Populus euphratica]
Length=365

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 112/140 (80%), Gaps = 10/140 (7%)
 Frame = -1

Query  390  KQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEK  211
             Q S LPPGFRFHPTDEELI++YLR +  S P PVSII +VDIYKFDPW+LP KA  GEK
Sbjct  3    NQQSSLPPGFRFHPTDEELILHYLRKKVASTPFPVSIIADVDIYKFDPWDLPAKAALGEK  62

Query  210  EWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS----------GSKYVGVKKALV  61
            EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +          G + VGVKKALV
Sbjct  63   EWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKVIMASTITPGGVIQGQENVGVKKALV  122

Query  60   FYKGRPPKGIKTDWIMHEYR  1
            FYKG+PPKG+KTDWIMHEYR
Sbjct  123  FYKGKPPKGVKTDWIMHEYR  142



>ref|XP_006443351.1| hypothetical protein CICLE_v10020717mg [Citrus clementina]
 ref|XP_006479050.1| PREDICTED: NAC domain-containing protein 18-like [Citrus sinensis]
 gb|ESR56591.1| hypothetical protein CICLE_v10020717mg [Citrus clementina]
 gb|KDO45538.1| hypothetical protein CISIN_1g017665mg [Citrus sinensis]
Length=368

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 113/132 (86%), Gaps = 5/132 (4%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            S LPPGFRFHPTDEELI++YL+ +  SMP PVSII +VDIYKFDPW+LP KA FGEKEWY
Sbjct  9    SALPPGFRFHPTDEELILHYLKKKVASMPFPVSIIADVDIYKFDPWDLPAKAAFGEKEWY  68

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS-----KYVGVKKALVFYKGRPPK  37
            FF+PRDRKYPNG RPNRAA SGYWKATGTDK I + S     + +GVKKALVFYKGRPPK
Sbjct  69   FFSPRDRKYPNGARPNRAAASGYWKATGTDKIILATSVGAHQENIGVKKALVFYKGRPPK  128

Query  36   GIKTDWIMHEYR  1
            G+KT+WIMHEYR
Sbjct  129  GVKTNWIMHEYR  140



>ref|XP_002325400.1| hypothetical protein POPTR_0019s04690g [Populus trichocarpa]
 gb|EEE99781.1| hypothetical protein POPTR_0019s04690g [Populus trichocarpa]
Length=367

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 112/141 (79%), Gaps = 11/141 (8%)
 Frame = -1

Query  390  KQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEK  211
             Q S LPPGFRFHPTDEELI++YLR +  S P PVSII +VDIYKFDPW+LP KA  GEK
Sbjct  3    NQQSSLPPGFRFHPTDEELILHYLRKKVASTPFPVSIIADVDIYKFDPWDLPAKAALGEK  62

Query  210  EWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS-----------GSKYVGVKKAL  64
            EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +           G + VGVKKAL
Sbjct  63   EWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKVIMASTITPGGVIIQGQENVGVKKAL  122

Query  63   VFYKGRPPKGIKTDWIMHEYR  1
            VFYKG+PPKG+KTDWIMHEYR
Sbjct  123  VFYKGKPPKGVKTDWIMHEYR  143



>gb|AHJ79194.1| NAC domain protein NAC53 [Gossypium hirsutum]
Length=335

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 116/133 (87%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q  +LPPGFRFHPTDEEL+++YL+ +A+S P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSQQPNLPPGFRFHPTDEELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  129  KGIKTNWIMHEYR  141



>ref|XP_008655238.1| PREDICTED: NAC transcription factor NAM-2-like [Zea mays]
 tpg|DAA45151.1| TPA: putative NAC domain transcription factor superfamily protein 
[Zea mays]
 gb|AIB05520.1| NAC transcription factor, partial [Zea mays]
Length=373

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 115/128 (90%), Gaps = 3/128 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRN+A + PCPV+II +VDIYKFDPW+LP +A +G+KEWYFF
Sbjct  9    LPPGFRFHPTDEELILHYLRNRAANAPCPVAIIADVDIYKFDPWDLPSRAAYGDKEWYFF  68

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS---KYVGVKKALVFYKGRPPKGIKT  25
            +PRDRKYPNG+RPNRAA SGYWKATGTDK I+S +   + VGVKKALVFY+GRPPKG KT
Sbjct  69   SPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHSSTTAGESVGVKKALVFYEGRPPKGTKT  128

Query  24   DWIMHEYR  1
            +WIMHEYR
Sbjct  129  NWIMHEYR  136



>gb|ACI15346.1| NAC domain protein NAC5 [Gossypium hirsutum]
 gb|ACI15351.1| NAC domain protein NAC5 [Gossypium hirsutum]
Length=356

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 114/136 (84%), Gaps = 9/136 (7%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            S LPPGFRFHPTDEELI++YL+ + TS P PVSII +VDIYKFDPW+LP+KA FGEKEWY
Sbjct  8    SSLPPGFRFHPTDEELILHYLKKKITSSPFPVSIIADVDIYKFDPWDLPDKAAFGEKEWY  67

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS---------KYVGVKKALVFYKG  49
            FF+PRDRKYPNG RPNRAA SGYWKATGTDK I + S         + +GVKKALVFYKG
Sbjct  68   FFSPRDRKYPNGARPNRAAASGYWKATGTDKVIVTSSMADRRGEVQENIGVKKALVFYKG  127

Query  48   RPPKGIKTDWIMHEYR  1
            RPPKG+KT+WIMHEYR
Sbjct  128  RPPKGMKTNWIMHEYR  143



>ref|XP_010276466.1| PREDICTED: NAC transcription factor 25-like isoform X1 [Nelumbo 
nucifera]
Length=383

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 114/132 (86%), Gaps = 5/132 (4%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            S LPPGFRFHPTDEELI++YLRN+ATS   PVS+I EVDIYKFDPW+LP KA FG+KEWY
Sbjct  6    STLPPGFRFHPTDEELILHYLRNKATSSLYPVSLIAEVDIYKFDPWDLPAKAAFGDKEWY  65

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKY-----VGVKKALVFYKGRPPK  37
            FF+PRDRKYPNG RPNRAA SGYWKATGTDK I + S+      +GVKKALVFYKGRPPK
Sbjct  66   FFSPRDRKYPNGARPNRAAASGYWKATGTDKPIVAISRSGRKENIGVKKALVFYKGRPPK  125

Query  36   GIKTDWIMHEYR  1
            GIKT+WIMHEYR
Sbjct  126  GIKTNWIMHEYR  137



>ref|XP_004293567.1| PREDICTED: NAC transcription factor 25-like [Fragaria vesca subsp. 
vesca]
Length=360

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A S+P PV+II E+D+YKFDPWELP KA FGE+EWYFF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKAASVPLPVTIIAEIDLYKFDPWELPSKATFGEQEWYFF  74

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG RPNRAA SGYWKATGTDK I +  GS+ VGVKKALVFY G+PPKGIKT+
Sbjct  75   SPRDRKYPNGARPNRAATSGYWKATGTDKPILTSNGSQKVGVKKALVFYGGKPPKGIKTN  134

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  135  WIMHEYR  141



>ref|XP_007149615.1| hypothetical protein PHAVU_005G084600g [Phaseolus vulgaris]
 gb|ESW21609.1| hypothetical protein PHAVU_005G084600g [Phaseolus vulgaris]
Length=369

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 116/140 (83%), Gaps = 2/140 (1%)
 Frame = -1

Query  414  SVQKMMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELP  235
            S     G +Q   LPPGFRFHPTDEEL+++YL+ +  S+P PV+II EVD+YKFDPWELP
Sbjct  3    STDSSTGSQQQPQLPPGFRFHPTDEELVVHYLKKKTASVPLPVAIIAEVDLYKFDPWELP  62

Query  234  EKAEFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALV  61
             KA FGE+EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALV
Sbjct  63   AKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALV  122

Query  60   FYKGRPPKGIKTDWIMHEYR  1
            FY G+PP+GIKT+WIMHEYR
Sbjct  123  FYGGKPPRGIKTNWIMHEYR  142



>ref|XP_003624592.1| NAC domain transcription factor [Medicago truncatula]
 gb|AES80810.1| NAC transcription factor-like protein [Medicago truncatula]
Length=340

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 113/142 (80%), Gaps = 10/142 (7%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            MG  QT +LPPGFRFHPTD ELI++YLR +  S+P PVSII EVDIYK DPW+LP KA F
Sbjct  1    MGTPQT-NLPPGFRFHPTDAELILHYLRKKIASIPLPVSIIAEVDIYKLDPWDLPAKASF  59

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIY---------SGSKYVGVKKA  67
            GEKEWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I          S    +GVKKA
Sbjct  60   GEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVASLPCGGGRSQENIIGVKKA  119

Query  66   LVFYKGRPPKGIKTDWIMHEYR  1
            LVFYKG+PPKGIKT+WIMHEYR
Sbjct  120  LVFYKGKPPKGIKTNWIMHEYR  141



>emb|CDP05873.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q   LPPGFRFHPTDEEL+++YL+ +A S P PVSII EVD+YKFDPWELP KA FGE
Sbjct  9    GSQQPQLPPGFRFHPTDEELVVHYLKKKAASAPLPVSIIAEVDLYKFDPWELPAKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  129  KGIKTNWIMHEYR  141



>ref|XP_002519008.1| transcription factor, putative [Ricinus communis]
 gb|EEF43219.1| transcription factor, putative [Ricinus communis]
Length=355

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q   LPPGFRFHPTDEEL+++YL+ +A S P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSQHPHLPPGFRFHPTDEELVVHYLKKKAASAPLPVTIIAEVDLYKFDPWELPSKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILASNGAQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  129  KGIKTNWIMHEYR  141



>gb|AGL39685.1| NAC transcription factor 029 [Jatropha curcas]
 gb|KDP20923.1| hypothetical protein JCGZ_21394 [Jatropha curcas]
Length=369

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q   LPPGFRFHPTDEEL+++YL+ +A S P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSQHPQLPPGFRFHPTDEELVVHYLKKKAASAPLPVTIIAEVDLYKFDPWELPSKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTSNGAQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  129  KGIKTNWIMHEYR  141



>ref|NP_564771.1| NAC domain containing protein 25 [Arabidopsis thaliana]
 sp|Q8GY42.1|NAC25_ARATH RecName: Full=NAC transcription factor 25; Short=AtNAC025 [Arabidopsis 
thaliana]
 dbj|BAC42518.1| unknown protein [Arabidopsis thaliana]
 gb|AAP37705.1| At1g61110 [Arabidopsis thaliana]
 gb|AEE33783.1| NAC domain containing protein 25 [Arabidopsis thaliana]
Length=323

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A S+P PVSII E+D+YKFDPWELP KA FGE EWYFF
Sbjct  16   LPPGFRFHPTDEELVVHYLKKKADSVPLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFF  75

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKY-VGVKKALVFYKGRPPKGIKTDW  19
            +PRDRKYPNGVRPNRAA SGYWKATGTDK I++ + + VGVKKALVFY G+PPKGIKTDW
Sbjct  76   SPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKTDW  135

Query  18   IMHEYR  1
            IMHEYR
Sbjct  136  IMHEYR  141



>ref|NP_001236142.1| transcriptional factor NAC11 [Glycine max]
 gb|ACC66315.1| transcriptional factor NAC11 [Glycine max]
 gb|KHN08169.1| NAC domain-containing protein 29 [Glycine soja]
Length=351

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 112/136 (82%), Gaps = 5/136 (4%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G   S+LPPGFRFHPTDEELI++YL  +  S+P PVSII EVDIYK DPW+LP KA FGE
Sbjct  2    GNPESNLPPGFRFHPTDEELILHYLSKKVASIPLPVSIIAEVDIYKLDPWDLPAKATFGE  61

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS-----GSKYVGVKKALVFYKG  49
            KEWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +       + VGVKKALVFYKG
Sbjct  62   KEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVTSLQGGAQESVGVKKALVFYKG  121

Query  48   RPPKGIKTDWIMHEYR  1
            RPPKG+KT+WIMHEYR
Sbjct  122  RPPKGVKTNWIMHEYR  137



>ref|XP_009594217.1| PREDICTED: NAC transcription factor 25-like [Nicotiana tomentosiformis]
Length=350

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 115/140 (82%), Gaps = 2/140 (1%)
 Frame = -1

Query  414  SVQKMMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELP  235
            S     G  Q   LPPGFRFHPTDEEL+++YL+ +  S+P PV+II EVD+YKFDPWELP
Sbjct  3    STDSSSGSHQQPQLPPGFRFHPTDEELVVHYLKKRVASVPLPVAIIAEVDLYKFDPWELP  62

Query  234  EKAEFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALV  61
             KA FGE+EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALV
Sbjct  63   AKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALV  122

Query  60   FYKGRPPKGIKTDWIMHEYR  1
            FY G+PPKG+KT+WIMHEYR
Sbjct  123  FYGGKPPKGVKTNWIMHEYR  142



>gb|AAB71483.1| similar to NAM (gp|X92205|1321924) and CUC2 (gp|AB002560|1944132) 
proteins [Arabidopsis thaliana]
Length=300

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A S+P PVSII E+D+YKFDPWELP KA FGE EWYFF
Sbjct  13   LPPGFRFHPTDEELVVHYLKKKADSVPLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFF  72

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKY-VGVKKALVFYKGRPPKGIKTDW  19
            +PRDRKYPNGVRPNRAA SGYWKATGTDK I++ + + VGVKKALVFY G+PPKGIKTDW
Sbjct  73   SPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKTDW  132

Query  18   IMHEYR  1
            IMHEYR
Sbjct  133  IMHEYR  138



>ref|XP_007133059.1| hypothetical protein PHAVU_011G148000g [Phaseolus vulgaris]
 gb|ESW05053.1| hypothetical protein PHAVU_011G148000g [Phaseolus vulgaris]
Length=356

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEEL+++YL+ +  S+P PVSII +VD+YKFDPWELP KA FGE+EWYF
Sbjct  16   NLPPGFRFHPTDEELVVHYLKKKVDSVPLPVSIIADVDLYKFDPWELPAKASFGEEEWYF  75

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPPKGIKTDW  19
            F+PRDRKYPNG RPNRAA SGYWKATGTDK I SG + VGVKK+LVFY G+PPKG+KTDW
Sbjct  76   FSPRDRKYPNGARPNRAATSGYWKATGTDKPICSGIQKVGVKKSLVFYGGKPPKGVKTDW  135

Query  18   IMHEYR  1
            IMHEYR
Sbjct  136  IMHEYR  141



>ref|XP_003540450.1| PREDICTED: NAC domain-containing protein 18-like [Glycine max]
 gb|KHN28035.1| NAC domain-containing protein 18 [Glycine soja]
Length=375

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q  +LPPGFRFHPTDEEL+++YL+ +  S P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSQQPNLPPGFRFHPTDEELVVHYLKKKTASAPLPVAIIAEVDLYKFDPWELPAKAAFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFFTPRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFTPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            +GIKT+WIMHEYR
Sbjct  129  RGIKTNWIMHEYR  141



>gb|ADP69102.1| NAC transcription factor 1 [Bambusa emeiensis]
Length=355

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 114/127 (90%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRN+A S PCPV+II +VDIYKFDPW+LP KA +G+KEWYFF
Sbjct  9    LPPGFRFHPTDEELILHYLRNRAGSSPCPVAIIADVDIYKFDPWDLPSKAAYGDKEWYFF  68

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS--KYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG+RPNRAA SGYWKATGTDK I++ +  + +GVKKALVFY GRPPKG KT+
Sbjct  69   SPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHNSATGESLGVKKALVFYTGRPPKGNKTN  128

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  129  WIMHEYR  135



>ref|XP_010089502.1| NAC domain-containing protein 18 [Morus notabilis]
 gb|EXB37905.1| NAC domain-containing protein 18 [Morus notabilis]
Length=391

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 114/128 (89%), Gaps = 2/128 (2%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEEL+++YL+ +ATS P PV+II EVD+YKFDPWELP KA FGE+EWYF
Sbjct  26   NLPPGFRFHPTDEELVVHYLKKKATSAPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYF  85

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKT  25
            F+PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PPKGIKT
Sbjct  86   FSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKT  145

Query  24   DWIMHEYR  1
            +WIMHEYR
Sbjct  146  NWIMHEYR  153



>ref|XP_002316635.1| no apical meristem family protein [Populus trichocarpa]
 gb|EEE97247.1| no apical meristem family protein [Populus trichocarpa]
Length=335

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q   LPPGFRFHPTDEEL+++YL+ +  S+P PV+II E+D+YKFDPWELP KA FGE
Sbjct  9    GSQHPQLPPGFRFHPTDEELVVHYLKKKVASVPLPVTIIAEIDLYKFDPWELPSKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTSNGAQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  129  KGIKTNWIMHEYR  141



>gb|AAN64999.1| Putative NAM (no apical meristem) protein [Oryza sativa Japonica 
Group]
 gb|ABF95729.1| NAC domain transcription factor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAH01634.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AFL91795.1| NAC transcription factor 58 [Oryza sativa Japonica Group]
Length=392

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 114/130 (88%), Gaps = 5/130 (4%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRN+A S PCPVSII +VDIYKFDPW+LP K  +G++EWYFF
Sbjct  9    LPPGFRFHPTDEELIVHYLRNRAASSPCPVSIIADVDIYKFDPWDLPSKENYGDREWYFF  68

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSG-----SKYVGVKKALVFYKGRPPKGI  31
            +PRDRKYPNG+RPNRAA SGYWKATGTDK I+S      ++ VGVKKALVFYKGRPPKG 
Sbjct  69   SPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHSSGGAATNESVGVKKALVFYKGRPPKGT  128

Query  30   KTDWIMHEYR  1
            KT+WIMHEYR
Sbjct  129  KTNWIMHEYR  138



>ref|XP_011095244.1| PREDICTED: NAC transcription factor 25-like [Sesamum indicum]
Length=354

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q   LPPGFRFHPTDEEL+++YL+ +A S P PV+II EVD+YKFDPWELP KA FGE
Sbjct  24   GSQQPQLPPGFRFHPTDEELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPAKATFGE  83

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PP
Sbjct  84   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPP  143

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  144  KGIKTNWIMHEYR  156



>ref|XP_008383789.1| PREDICTED: NAC transcription factor 25-like isoform X2 [Malus 
domestica]
Length=357

 Score =   218 bits (555),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q   LPPGFRFHPTDEEL+++YL+ +A S+P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSQHPQLPPGFRFHPTDEELVVHYLKKKAASIPLPVTIIAEVDLYKFDPWELPSKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + S  G+  VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLSSIGNHKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KG KT+WIMHEYR
Sbjct  129  KGTKTNWIMHEYR  141



>ref|XP_010686575.1| PREDICTED: NAC transcription factor 25-like [Beta vulgaris subsp. 
vulgaris]
Length=341

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YL+ +A+S P PVSII EVD+YKFDPWELP KA FGE+EWYFF
Sbjct  15   LPPGFRFHPTDEELIVHYLKRKASSSPLPVSIIAEVDLYKFDPWELPSKAIFGEQEWYFF  74

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALVFY G+PP+GIKTD
Sbjct  75   SPRDRKYPNGARPNRAATSGYWKATGTDKPILTSNGNQKVGVKKALVFYGGKPPRGIKTD  134

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  135  WIMHEYR  141



>gb|EEE58985.1| hypothetical protein OsJ_10691 [Oryza sativa Japonica Group]
Length=385

 Score =   219 bits (557),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 114/130 (88%), Gaps = 5/130 (4%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRN+A S PCPVSII +VDIYKFDPW+LP K  +G++EWYFF
Sbjct  2    LPPGFRFHPTDEELIVHYLRNRAASSPCPVSIIADVDIYKFDPWDLPSKENYGDREWYFF  61

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSG-----SKYVGVKKALVFYKGRPPKGI  31
            +PRDRKYPNG+RPNRAA SGYWKATGTDK I+S      ++ VGVKKALVFYKGRPPKG 
Sbjct  62   SPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHSSGGAATNESVGVKKALVFYKGRPPKGT  121

Query  30   KTDWIMHEYR  1
            KT+WIMHEYR
Sbjct  122  KTNWIMHEYR  131



>emb|CAN81855.1| hypothetical protein VITISV_041250 [Vitis vinifera]
Length=226

 Score =   214 bits (544),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G     LPPGFRFHPTDEEL+++YL+ +A S+P PV+II +VD+YKFDPWELP KA FGE
Sbjct  9    GSHHPQLPPGFRFHPTDEELVVHYLKRKAASVPLPVTIIADVDLYKFDPWELPSKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +  GS+ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTSNGSQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  129  KGIKTNWIMHEYR  141



>ref|XP_004487678.1| PREDICTED: NAC domain-containing protein 18-like [Cicer arietinum]
Length=356

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q  +LPPGFRFHPTDEEL+++YL+ +A S P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSQQPNLPPGFRFHPTDEELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPAKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            +GIKT+WIMHEYR
Sbjct  129  RGIKTNWIMHEYR  141



>ref|XP_010036180.1| PREDICTED: NAC transcription factor 29-like [Eucalyptus grandis]
 gb|KCW47719.1| hypothetical protein EUGRSUZ_K01471 [Eucalyptus grandis]
Length=329

 Score =   217 bits (552),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 110/128 (86%), Gaps = 2/128 (2%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEELI++YLR + TS P PVSII EVD+YKFDPWELP KA FGE EWYF
Sbjct  8    NLPPGFRFHPTDEELILHYLRKKMTSTPLPVSIIAEVDLYKFDPWELPGKATFGETEWYF  67

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS--KYVGVKKALVFYKGRPPKGIKT  25
            F+PRDRKYPNG RPNR+A SGYWKATGTDK I   S  K +GVKKALVFY+G+PPKGIK+
Sbjct  68   FSPRDRKYPNGARPNRSAASGYWKATGTDKIILDSSTGKNLGVKKALVFYQGKPPKGIKS  127

Query  24   DWIMHEYR  1
             WIMHEYR
Sbjct  128  QWIMHEYR  135



>gb|AID55352.1| NAC protein 1 [Actinidia chinensis]
Length=321

 Score =   216 bits (551),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 112/127 (88%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A S P PVSII EVD+YKFDPWELP KA FGE+EWYFF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKAASAPLPVSIIAEVDLYKFDPWELPAKATFGEQEWYFF  74

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG RPNRAA SGYWKATGTDK + S  GS+ VGVKKALVFY G+PPKG+KT+
Sbjct  75   SPRDRKYPNGARPNRAATSGYWKATGTDKPVLSSGGSQKVGVKKALVFYGGKPPKGVKTN  134

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  135  WIMHEYR  141



>ref|XP_003541120.1| PREDICTED: NAC domain-containing protein 18-like [Glycine max]
 gb|KHN48759.1| NAC domain-containing protein 18 [Glycine soja]
Length=360

 Score =   218 bits (554),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  390  KQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEK  211
            +Q  +LPPGFRFHPTDEEL+++YL+ +  S+P PVSII +VD+YKFDPWELP KA FG +
Sbjct  12   QQQPNLPPGFRFHPTDEELVVHYLKKKVDSVPLPVSIIADVDLYKFDPWELPAKASFGAE  71

Query  210  EWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPPKGI  31
            EWYFF+PR+RKYPNG RPNRAA SGYWKATGTDK I SG++ VGVKK+LVFY G+PPKG+
Sbjct  72   EWYFFSPRERKYPNGARPNRAATSGYWKATGTDKPICSGTQKVGVKKSLVFYGGKPPKGV  131

Query  30   KTDWIMHEYR  1
            KTDWIMHEYR
Sbjct  132  KTDWIMHEYR  141



>ref|XP_010644222.1| PREDICTED: NAC transcription factor 25 isoform X2 [Vitis vinifera]
Length=341

 Score =   217 bits (552),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A+S P PV+II EVD+YKFDPWELP KA FGE+EWYFF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFF  74

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PPKGIKT+
Sbjct  75   SPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTN  134

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  135  WIMHEYR  141



>gb|KHG20342.1| NAC domain-containing 18 -like protein [Gossypium arboreum]
Length=349

 Score =   217 bits (553),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = -1

Query  387  QTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKE  208
            Q  +LPPGFRFHPTDEEL+++YL+ +ATS P PV+II EVD+YKFDPWELP KA FGE+E
Sbjct  11   QRPNLPPGFRFHPTDEELVVHYLKKKATSAPLPVAIIAEVDLYKFDPWELPAKATFGERE  70

Query  207  WYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKG  34
            WYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PPKG
Sbjct  71   WYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLNSKGTQKVGVKKALVFYGGKPPKG  130

Query  33   IKTDWIMHEYR  1
            IKT+WIMHEYR
Sbjct  131  IKTNWIMHEYR  141



>gb|KHG14643.1| NAC domain-containing 29 -like protein [Gossypium arboreum]
Length=356

 Score =   217 bits (553),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 113/136 (83%), Gaps = 9/136 (7%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            S LPPGFRFHPTDEELI++YL+ + TS P PVSII +VDIYKFDPW+LP KA FGEKEWY
Sbjct  8    SSLPPGFRFHPTDEELILHYLKKKITSSPFPVSIIADVDIYKFDPWDLPGKAAFGEKEWY  67

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS---------KYVGVKKALVFYKG  49
            FF+PRDRKYPNG RPNRAA SGYWKATGTDK I + S         + +GVKKALVFYKG
Sbjct  68   FFSPRDRKYPNGARPNRAAASGYWKATGTDKVIVTSSMADRRGEVQENIGVKKALVFYKG  127

Query  48   RPPKGIKTDWIMHEYR  1
            RPPKG+KT+WIMHEYR
Sbjct  128  RPPKGMKTNWIMHEYR  143



>ref|XP_007211453.1| hypothetical protein PRUPE_ppa007314mg [Prunus persica]
 gb|EMJ12652.1| hypothetical protein PRUPE_ppa007314mg [Prunus persica]
Length=373

 Score =   218 bits (555),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 115/140 (82%), Gaps = 2/140 (1%)
 Frame = -1

Query  414  SVQKMMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELP  235
            S     G +    LPPGFRFHPTDEEL+++YL+ +A S P PV+II EVD+YKFDPWELP
Sbjct  3    STDSSSGSQAHPQLPPGFRFHPTDEELVVHYLKKKAASAPLPVTIIAEVDLYKFDPWELP  62

Query  234  EKAEFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALV  61
             KA FGE+EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALV
Sbjct  63   SKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTSIGNQKVGVKKALV  122

Query  60   FYKGRPPKGIKTDWIMHEYR  1
            FY G+PPKGIK++WIMHEYR
Sbjct  123  FYGGKPPKGIKSNWIMHEYR  142



>ref|XP_002305677.1| no apical meristem family protein [Populus trichocarpa]
 gb|EEE86188.1| no apical meristem family protein [Populus trichocarpa]
Length=351

 Score =   217 bits (553),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = -1

Query  387  QTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKE  208
            Q   LPPGFRFHPTDEEL+++YL+ +A S+P PV+II E+D+YKFDPWELP KA FGE+E
Sbjct  11   QHPQLPPGFRFHPTDEELVVHYLKKKAASVPLPVTIIAEIDLYKFDPWELPSKATFGEQE  70

Query  207  WYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKG  34
            WYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALVFY G+PPKG
Sbjct  71   WYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTSNGAQKVGVKKALVFYGGKPPKG  130

Query  33   IKTDWIMHEYR  1
            IKT+WIMHEYR
Sbjct  131  IKTNWIMHEYR  141



>ref|XP_003559782.1| PREDICTED: NAC domain-containing protein 18-like [Brachypodium 
distachyon]
Length=375

 Score =   218 bits (555),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 113/128 (88%), Gaps = 3/128 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRN+A S PCPV II +VDIYKFDPW+LP +A +GE+EWYFF
Sbjct  8    LPPGFRFHPTDEELILHYLRNRAASAPCPVPIIADVDIYKFDPWDLPCQAVYGEQEWYFF  67

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIY---SGSKYVGVKKALVFYKGRPPKGIKT  25
            +PRDRKYPNG+RPNRAA SGYWKATGTDK I+   +G + VGVKKALVFYKGRPPKG KT
Sbjct  68   SPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHDPATGGEPVGVKKALVFYKGRPPKGSKT  127

Query  24   DWIMHEYR  1
             WIMHEYR
Sbjct  128  SWIMHEYR  135



>gb|AID55348.1| NAC protein 1 [Actinidia arguta]
Length=321

 Score =   216 bits (550),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 112/127 (88%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A S P PVSII EVD+YKFDPWELP KA FGE+EWYFF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKAASAPLPVSIIAEVDLYKFDPWELPAKATFGEQEWYFF  74

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG RPNRAA SGYWKATGTDK + S  GS+ VGVKKALVFY G+PPKG+KT+
Sbjct  75   SPRDRKYPNGARPNRAATSGYWKATGTDKPVLSSGGSQKVGVKKALVFYGGKPPKGVKTN  134

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  135  WIMHEYR  141



>gb|EAZ19492.1| hypothetical protein OsJ_35058 [Oryza sativa Japonica Group]
Length=251

 Score =   214 bits (544),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YL NQA S+ CPV II EV+IYK +PW+LP KA FGE EWYFF
Sbjct  4    LPPGFRFHPTDEELIVHYLMNQAASVKCPVPIIAEVNIYKCNPWDLPGKALFGENEWYFF  63

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG RPNRAA SGYWKATGTDK+I S   S  +GVKKALVFYKG+PPKG+KTD
Sbjct  64   SPRDRKYPNGARPNRAAGSGYWKATGTDKSILSTPTSDNIGVKKALVFYKGKPPKGVKTD  123

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  124  WIMHEYR  130



>ref|XP_010268761.1| PREDICTED: NAC transcription factor 25-like [Nelumbo nucifera]
Length=353

 Score =   217 bits (553),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A+S P PV+II EVD+YKFDPWELP KA FG++EWYFF
Sbjct  16   LPPGFRFHPTDEELVVHYLKKKASSAPLPVTIIAEVDLYKFDPWELPGKATFGDQEWYFF  75

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALVFY GRPPKGIKT+
Sbjct  76   SPRDRKYPNGARPNRAATSGYWKATGTDKPILTSGGTQKVGVKKALVFYGGRPPKGIKTN  135

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  136  WIMHEYR  142



>ref|NP_001065627.1| Os11g0126900 [Oryza sativa Japonica Group]
 dbj|BAF27472.1| Os11g0126900 [Oryza sativa Japonica Group]
Length=171

 Score =   211 bits (537),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G     LPPGFRFHPTDEELI++YL NQA S+ CPV II EV+IYK +PW+LP KA FGE
Sbjct  5    GGAMPALPPGFRFHPTDEELIVHYLMNQAASVKCPVPIIAEVNIYKCNPWDLPGKALFGE  64

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
             EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK+I S   S  +GVKKALVFYKG+PP
Sbjct  65   NEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKSILSTPTSDNIGVKKALVFYKGKPP  124

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  125  KGVKTDWIMHEYR  137



>ref|NP_001066034.2| Os12g0123700 [Oryza sativa Japonica Group]
 dbj|BAF29053.2| Os12g0123700 [Oryza sativa Japonica Group]
Length=164

 Score =   211 bits (536),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G     LPPGFRFHPTDEELI++YL NQA S+ CPV II EV+IYK +PW+LP KA FGE
Sbjct  5    GGAMPALPPGFRFHPTDEELIVHYLMNQAASIKCPVPIIAEVNIYKCNPWDLPGKALFGE  64

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
             EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK+I S   S  +GVKKALVFYKG+PP
Sbjct  65   NEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKSILSTPTSDNIGVKKALVFYKGKPP  124

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  125  KGVKTDWIMHEYR  137



>ref|XP_010278293.1| PREDICTED: NAC transcription factor NAM-B2-like [Nelumbo nucifera]
Length=359

 Score =   217 bits (553),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A+S P PV+II EVD+YKFDPWELP KA FGE+EWYFF
Sbjct  20   LPPGFRFHPTDEELVVHYLKKKASSAPLPVTIIAEVDLYKFDPWELPGKATFGEQEWYFF  79

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALVFY GRPPKG+KT+
Sbjct  80   SPRDRKYPNGARPNRAATSGYWKATGTDKPILTSGGTQKVGVKKALVFYGGRPPKGVKTN  139

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  140  WIMHEYR  146



>ref|XP_011047846.1| PREDICTED: NAC transcription factor 25-like [Populus euphratica]
Length=355

 Score =   217 bits (553),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 115/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q   LPPGFRFHPTDEEL+++YL+ +A S+P PV+II E+D+YKFDPWELP KA FGE
Sbjct  9    GSQHPRLPPGFRFHPTDEELVVHYLKKKAASVPLPVTIIAEIDLYKFDPWELPSKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAAPSGYWKATGTDKPILTSNGAQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  129  KGIKTNWIMHEYR  141



>gb|AGT56012.1| sinor-like protein 1 [Solanum lycopersicum]
 gb|AGT56013.1| sinor-like protein 1 [Solanum lycopersicum]
Length=329

 Score =   216 bits (550),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 114/140 (81%), Gaps = 2/140 (1%)
 Frame = -1

Query  414  SVQKMMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELP  235
            S     G      LPPGFRFHPTDEEL+++YL+ +  S+P PVSII EVD+YKFDPWELP
Sbjct  3    STDSSTGSHHQPQLPPGFRFHPTDEELVVHYLKKRVASVPLPVSIIAEVDLYKFDPWELP  62

Query  234  EKAEFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALV  61
             KA FGE+EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALV
Sbjct  63   AKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALV  122

Query  60   FYKGRPPKGIKTDWIMHEYR  1
            FY G+PPKG+KT+WIMHEYR
Sbjct  123  FYGGKPPKGVKTNWIMHEYR  142



>ref|XP_006650022.1| PREDICTED: NAC transcription factor NAM-B2-like [Oryza brachyantha]
Length=382

 Score =   218 bits (554),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 6/131 (5%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YLRN+A S PCPVSII +VDIYKFDPW LP KA +G+KEWYFF
Sbjct  9    LPPGFRFHPTDEELIVHYLRNRAASSPCPVSIIADVDIYKFDPWVLPSKAAYGDKEWYFF  68

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIY------SGSKYVGVKKALVFYKGRPPKG  34
            +PRDRKYPNG+RPNRAA SGYWKATGTDK I+        ++ VGVKKALVFYKGRPPKG
Sbjct  69   SPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHSSGGGGGSNESVGVKKALVFYKGRPPKG  128

Query  33   IKTDWIMHEYR  1
             KT+WIMHEYR
Sbjct  129  TKTNWIMHEYR  139



>ref|NP_001266277.1| uncharacterized protein LOC101247735 [Solanum lycopersicum]
 gb|AFD22355.1| NAC3 [Solanum lycopersicum]
Length=329

 Score =   216 bits (550),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 114/140 (81%), Gaps = 2/140 (1%)
 Frame = -1

Query  414  SVQKMMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELP  235
            S     G      LPPGFRFHPTDEEL+++YL+ +  S+P PVSII EVD+YKFDPWELP
Sbjct  3    STDSSTGSHHQPQLPPGFRFHPTDEELVVHYLKKRVASVPLPVSIIAEVDLYKFDPWELP  62

Query  234  EKAEFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALV  61
             KA FGE+EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALV
Sbjct  63   AKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALV  122

Query  60   FYKGRPPKGIKTDWIMHEYR  1
            FY G+PPKG+KT+WIMHEYR
Sbjct  123  FYGGKPPKGVKTNWIMHEYR  142



>ref|XP_007161811.1| hypothetical protein PHAVU_001G100200g [Phaseolus vulgaris]
 gb|ESW33805.1| hypothetical protein PHAVU_001G100200g [Phaseolus vulgaris]
Length=345

 Score =   216 bits (551),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 114/139 (82%), Gaps = 7/139 (5%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            MG  Q S+LPPGFRFHPTD+ELI++YL  +  S+P PVSII EVDIYK DPW+LP KA F
Sbjct  1    MGSPQ-SNLPPGFRFHPTDQELILHYLSKKVASIPLPVSIIAEVDIYKLDPWDLPAKATF  59

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS------GSKYVGVKKALVF  58
            GEKEWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +        + VGVKKALVF
Sbjct  60   GEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVTSLQGGAAQENVGVKKALVF  119

Query  57   YKGRPPKGIKTDWIMHEYR  1
            Y+GRPPKG+KT+WIMHEYR
Sbjct  120  YEGRPPKGVKTNWIMHEYR  138



>sp|A2YMR0.1|NAC10_ORYSI RecName: Full=NAC transcription factor ONAC010 [Oryza sativa 
Indica Group]
 gb|EAZ04371.1| hypothetical protein OsI_26514 [Oryza sativa Indica Group]
Length=425

 Score =   219 bits (557),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 116/129 (90%), Gaps = 3/129 (2%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEEL+++YL+ +A S+P PV+II EVD+YKFDPWELPEKA FGE+EWYF
Sbjct  28   ELPPGFRFHPTDEELVVHYLKKKAASVPLPVTIIAEVDLYKFDPWELPEKANFGEQEWYF  87

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIY-SGS--KYVGVKKALVFYKGRPPKGIK  28
            F+PRDRKYPNG RPNRAA SGYWKATGTDK I  SGS  + VGVKKALVFY+G+PPKG+K
Sbjct  88   FSPRDRKYPNGARPNRAATSGYWKATGTDKPIMASGSTREKVGVKKALVFYRGKPPKGVK  147

Query  27   TDWIMHEYR  1
            T+WIMHEYR
Sbjct  148  TNWIMHEYR  156



>ref|XP_010939827.1| PREDICTED: NAC transcription factor 29-like isoform X1 [Elaeis 
guineensis]
Length=270

 Score =   214 bits (545),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEELI+YYLRN    +PCP+SIIPEV+I KFDPWELP K+   E  WYF
Sbjct  4    ELPPGFRFHPTDEELIIYYLRNHGMLVPCPISIIPEVNICKFDPWELPGKSFLREGVWYF  63

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGRPPKGIKTDW  19
            F+PRD KYPNG RPNRA  SGYWKATGTDKAIYS SK+VGVKKALVFY+GRPPKG KT+W
Sbjct  64   FSPRDLKYPNGGRPNRATASGYWKATGTDKAIYSNSKHVGVKKALVFYRGRPPKGSKTEW  123

Query  18   IMHEYR  1
            IMHEYR
Sbjct  124  IMHEYR  129



>gb|AGL39682.1| NAC transcription factor 026 [Jatropha curcas]
 gb|KDP20283.1| hypothetical protein JCGZ_06869 [Jatropha curcas]
Length=382

 Score =   218 bits (554),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 114/137 (83%), Gaps = 10/137 (7%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            S+LPPGFRFHPTDEELI++YL+ + +S P PVSII +VDIYKFDPW+LP+KA FGEKEWY
Sbjct  6    SNLPPGFRFHPTDEELILHYLKKKISSAPFPVSIIADVDIYKFDPWDLPDKAAFGEKEWY  65

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS----------KYVGVKKALVFYK  52
            FF+PRDRKYPNG RPNRAA SGYWKATGTDK I + S            +GVKKALVFYK
Sbjct  66   FFSPRDRKYPNGARPNRAAASGYWKATGTDKLIVASSIAGSSIGVQENNIGVKKALVFYK  125

Query  51   GRPPKGIKTDWIMHEYR  1
            GRPPKGIKT+WIMHEYR
Sbjct  126  GRPPKGIKTNWIMHEYR  142



>gb|AGS08767.1| NAC domain protein [Malus hupehensis]
Length=393

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 115/142 (81%), Gaps = 2/142 (1%)
 Frame = -1

Query  420  LISVQKMMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWE  241
            L+       G Q   LPPGFRFHPTDEEL+++YL+ +A S+P PV+II EVD+YKFDPWE
Sbjct  44   LMESTNSSSGSQHPQLPPGFRFHPTDEELVVHYLKKKAASIPLPVTIIAEVDLYKFDPWE  103

Query  240  LPEKAEFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKA  67
            LP KA FGE+EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + S  G+  VGVKKA
Sbjct  104  LPSKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLSSIGNHKVGVKKA  163

Query  66   LVFYKGRPPKGIKTDWIMHEYR  1
            LVFY G+PPKG KT+WIMHEYR
Sbjct  164  LVFYGGKPPKGTKTNWIMHEYR  185



>ref|NP_001280970.1| NAC transcription factor 25-like [Malus domestica]
 gb|ADL36800.1| NAC domain class transcription factor [Malus domestica]
Length=366

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q   LPPGFRFHPTDEEL+++YL+ +A S+P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSQHPQLPPGFRFHPTDEELVVHYLKKKAASIPLPVTIIAEVDLYKFDPWELPSKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + S  G+  VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLSSIGNHKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KG KT+WIMHEYR
Sbjct  129  KGTKTNWIMHEYR  141



>ref|XP_004984512.1| PREDICTED: NAC transcription factor NAM-B1-like [Setaria italica]
Length=363

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M+     + LPPGFRFHPTDEELI++YLRN+A +  CPV II +VDIYKFDPW+LP +A 
Sbjct  1    MIMANPATMLPPGFRFHPTDEELILHYLRNRAGNAGCPVDIIADVDIYKFDPWDLPSRAA  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS--KYVGVKKALVFYKG  49
            +G+KEWYFF+PRDRKYPNG+RPNRAA SGYWKATGTDK I+S +  + VGVKKALVFYKG
Sbjct  61   YGDKEWYFFSPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHSSATGESVGVKKALVFYKG  120

Query  48   RPPKGIKTDWIMHEYR  1
            RPPKG KT+WIMHEYR
Sbjct  121  RPPKGTKTNWIMHEYR  136



>ref|XP_007025712.1| NAC domain containing protein 25 [Theobroma cacao]
 gb|EOY28334.1| NAC domain containing protein 25 [Theobroma cacao]
Length=351

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 112/127 (88%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A S P PV+II EVD+YKFDPWELP KA FGE+EWYFF
Sbjct  15   LPPGFRFHPTDEELVVHYLKRKAASAPLPVTIIAEVDLYKFDPWELPSKATFGEQEWYFF  74

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALVFY G+PPKGIKT+
Sbjct  75   SPRDRKYPNGARPNRAATSGYWKATGTDKPIVTSNGNQKVGVKKALVFYGGKPPKGIKTN  134

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  135  WIMHEYR  141



>ref|XP_009379434.1| PREDICTED: NAC transcription factor 25 [Pyrus x bretschneideri]
Length=374

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 112/127 (88%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A S+P PV+II EVD+YKFDPWELP KA FGE+EWYFF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKAASIPLPVTIIAEVDLYKFDPWELPSKATFGEQEWYFF  74

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            TPRDRKYPNG RPNRAA SGYWKATGTDK I +  G+  VGVKKALVFY G+PPKGIKT+
Sbjct  75   TPRDRKYPNGARPNRAATSGYWKATGTDKPILTSIGNHNVGVKKALVFYGGKPPKGIKTN  134

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  135  WIMHEYR  141



>gb|AIW49540.1| NAC transcription factor NAM-A2 [Triticum turgidum subsp. durum]
Length=397

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 114/129 (88%), Gaps = 3/129 (2%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            DLPPGFRFHPTDEEL+++YL+ +A  +P PV+II EVD+YKFDPWELPEKA FGE+EWYF
Sbjct  28   DLPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYF  87

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS---GSKYVGVKKALVFYKGRPPKGIK  28
            F+PRDRKYPNG RPNRAA SGYWKATGTDK I +   G + VGVKKALVFY+G+PPKG+K
Sbjct  88   FSPRDRKYPNGARPNRAATSGYWKATGTDKPILASGCGREKVGVKKALVFYRGKPPKGLK  147

Query  27   TDWIMHEYR  1
            T+WIMHEYR
Sbjct  148  TNWIMHEYR  156



>ref|XP_007159283.1| hypothetical protein PHAVU_002G224900g [Phaseolus vulgaris]
 gb|ESW31277.1| hypothetical protein PHAVU_002G224900g [Phaseolus vulgaris]
Length=350

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
              Q   LPPGFRFHPTDEEL+++YL+ +A+S P PV+II +VD+YKFDPWELP KA FGE
Sbjct  9    ASQHPHLPPGFRFHPTDEELVVHYLKRKASSTPLPVAIIADVDLYKFDPWELPSKATFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNGVRPNRAA SGYWKATGTDK I +  G + VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGVRPNRAATSGYWKATGTDKPILTSDGHQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KG+KT+WIMHEYR
Sbjct  129  KGVKTNWIMHEYR  141



>ref|XP_006657850.1| PREDICTED: NAC transcription factor ONAC010-like [Oryza brachyantha]
Length=437

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%), Gaps = 3/134 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G    +LPPGFRFHPTDEEL+++YL+ +A S+P PV+II EVD+YKFDPWELPEKA FGE
Sbjct  23   GGSAPELPPGFRFHPTDEELVVHYLKKKAASVPLPVTIIAEVDLYKFDPWELPEKASFGE  82

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIY-SGS--KYVGVKKALVFYKGRP  43
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I  SGS  + VGVKKALVFY+G+P
Sbjct  83   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPIMASGSSREKVGVKKALVFYRGKP  142

Query  42   PKGIKTDWIMHEYR  1
            PKGIKT+WIMHEYR
Sbjct  143  PKGIKTNWIMHEYR  156



>gb|EYU33415.1| hypothetical protein MIMGU_mgv1a009589mg [Erythranthe guttata]
Length=337

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q   LPPGFRFHPTDEEL+++YL+ +A S P PVSII EVD+YKFDPWELP K+ FGE
Sbjct  9    GSQKPQLPPGFRFHPTDEELVVHYLKKKAASAPLPVSIIAEVDLYKFDPWELPAKSIFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVMTAGGTQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  129  KGIKTNWIMHEYR  141



>ref|XP_002284654.2| PREDICTED: NAC transcription factor 25 isoform X1 [Vitis vinifera]
Length=353

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A+S P PV+II EVD+YKFDPWELP KA FGE+EWYFF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFF  74

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PPKGIKT+
Sbjct  75   SPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTN  134

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  135  WIMHEYR  141



>ref|XP_007030229.1| NAC domain containing protein 47, putative isoform 1 [Theobroma 
cacao]
 gb|EOY10731.1| NAC domain containing protein 47, putative isoform 1 [Theobroma 
cacao]
Length=422

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 113/134 (84%), Gaps = 9/134 (7%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YL+ + +S P PVSII +VDIYKFDPWELP KA FGEKEWYFF
Sbjct  74   LPPGFRFHPTDEELILHYLKKKLSSSPFPVSIIADVDIYKFDPWELPAKAAFGEKEWYFF  133

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS---------KYVGVKKALVFYKGRP  43
            +PRDRKYPNG RPNRAA SGYWKATGTDK I++ S         + +GVKKALVFYKGRP
Sbjct  134  SPRDRKYPNGARPNRAAASGYWKATGTDKVIFTSSMVAGGGGVQENIGVKKALVFYKGRP  193

Query  42   PKGIKTDWIMHEYR  1
            PKGIKT+WIMHEYR
Sbjct  194  PKGIKTNWIMHEYR  207



>ref|XP_006449287.1| hypothetical protein CICLE_v10015688mg [Citrus clementina]
 gb|ESR62527.1| hypothetical protein CICLE_v10015688mg [Citrus clementina]
Length=365

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -1

Query  387  QTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKE  208
            Q   LPPGFRFHPTDEEL+++YL+ +A S P PV+II EVD+YKFDPWELP KA FGE+E
Sbjct  11   QHPQLPPGFRFHPTDEELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPSKATFGEQE  70

Query  207  WYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKG  34
            WYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALVFY G+PPKG
Sbjct  71   WYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTSKGNQKVGVKKALVFYGGKPPKG  130

Query  33   IKTDWIMHEYR  1
            IKT+WIMHEYR
Sbjct  131  IKTNWIMHEYR  141



>gb|KFK42926.1| hypothetical protein AALP_AA1G056200 [Arabis alpina]
Length=324

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 1/126 (1%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A S+  PVSII E+D+YKFDPWELP KA FGE EWYFF
Sbjct  16   LPPGFRFHPTDEELVVHYLKKKAASIQLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFF  75

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS-GSKYVGVKKALVFYKGRPPKGIKTDW  19
            +PRDRKYPNGVRPNRAA SGYWKATGTDK I++  S  VGVKKALVFY G+PPKGIKTDW
Sbjct  76   SPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKTDW  135

Query  18   IMHEYR  1
            IMHEYR
Sbjct  136  IMHEYR  141



>ref|XP_006663768.1| PREDICTED: NAC transcription factor 25-like [Oryza brachyantha]
Length=388

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YL NQA SM CPV II EV+IYK +PW+LP KA FGEKEWYFF
Sbjct  6    LPPGFRFHPTDEELIVHYLMNQAASMACPVPIIAEVNIYKCNPWDLPAKALFGEKEWYFF  65

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG RPNRAA SGYWKATGTDKAI +   S  + VKKALVFYKG+PPKG+KTD
Sbjct  66   SPRDRKYPNGARPNRAAGSGYWKATGTDKAILATPTSHSIAVKKALVFYKGKPPKGLKTD  125

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  126  WIMHEYR  132



>ref|XP_009420951.1| PREDICTED: NAC transcription factor 29-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 113/130 (87%), Gaps = 3/130 (2%)
 Frame = -1

Query  381  SDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWY  202
            + LPPGFRFHPTDEELI++YL N+ +S PCPV ++ EVDIYK DPW+LP KA +G++EWY
Sbjct  5    ASLPPGFRFHPTDEELIVHYLINRVSSSPCPVPVVAEVDIYKHDPWDLPAKATYGDREWY  64

Query  201  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS---KYVGVKKALVFYKGRPPKGI  31
            FF+PRDRKYPNG RPNRAA SGYWKATGTDKAI++ S     +GVKKALVFYKGRPP+G+
Sbjct  65   FFSPRDRKYPNGRRPNRAAASGYWKATGTDKAIHTSSGKNHSIGVKKALVFYKGRPPRGL  124

Query  30   KTDWIMHEYR  1
            KT+WIMHEYR
Sbjct  125  KTNWIMHEYR  134



>ref|XP_006467845.1| PREDICTED: NAC transcription factor 25-like [Citrus sinensis]
 gb|KDO75851.1| hypothetical protein CISIN_1g017854mg [Citrus sinensis]
Length=365

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -1

Query  387  QTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKE  208
            Q   LPPGFRFHPTDEEL+++YL+ +A S P PV+II EVD+YKFDPWELP KA FGE+E
Sbjct  11   QHPQLPPGFRFHPTDEELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPSKATFGEQE  70

Query  207  WYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKG  34
            WYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALVFY G+PPKG
Sbjct  71   WYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTSKGNQKVGVKKALVFYGGKPPKG  130

Query  33   IKTDWIMHEYR  1
            IKT+WIMHEYR
Sbjct  131  IKTNWIMHEYR  141



>ref|XP_008224995.1| PREDICTED: NAC transcription factor 25 [Prunus mume]
Length=371

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 115/140 (82%), Gaps = 2/140 (1%)
 Frame = -1

Query  414  SVQKMMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELP  235
            S     G +    LPPGFRFHPTDEEL+++YL+ +A S P PV+II EVD+YKFDPWELP
Sbjct  3    STDSSSGSQVHPQLPPGFRFHPTDEELVVHYLKKKAASAPLPVTIIAEVDLYKFDPWELP  62

Query  234  EKAEFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALV  61
             KA FGE+EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALV
Sbjct  63   SKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTSIGNQKVGVKKALV  122

Query  60   FYKGRPPKGIKTDWIMHEYR  1
            FY G+PPKGIK++WIMHEYR
Sbjct  123  FYGGKPPKGIKSNWIMHEYR  142



>ref|XP_011042501.1| PREDICTED: NAC domain-containing protein 18-like [Populus euphratica]
Length=358

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = -1

Query  387  QTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKE  208
            Q  +LPPGFRFHPTDEEL+++YL+ + TS P PV+II EVD+YKFDPWELP KA FGE+E
Sbjct  22   QQPNLPPGFRFHPTDEELVVHYLKKKTTSAPLPVAIIAEVDLYKFDPWELPAKATFGEQE  81

Query  207  WYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKG  34
            WYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + S  G++ VGVKKALVFY G+PPKG
Sbjct  82   WYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLSSGGTQKVGVKKALVFYGGKPPKG  141

Query  33   IKTDWIMHEYR  1
            IKT+WIMHEYR
Sbjct  142  IKTNWIMHEYR  152



>ref|XP_006370307.1| no apical meristem family protein [Populus trichocarpa]
 gb|ERP66876.1| no apical meristem family protein [Populus trichocarpa]
Length=360

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = -1

Query  387  QTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKE  208
            Q  +LPPGFRFHPTDEEL+++YL+ + TS P PV+II EVD+YKFDPWELP KA FGE+E
Sbjct  24   QQPNLPPGFRFHPTDEELVVHYLKKKTTSAPLPVAIIAEVDLYKFDPWELPAKATFGEQE  83

Query  207  WYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKG  34
            WYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + S  G++ VGVKKALVFY G+PPKG
Sbjct  84   WYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLSSGGTQKVGVKKALVFYGGKPPKG  143

Query  33   IKTDWIMHEYR  1
            IKT+WIMHEYR
Sbjct  144  IKTNWIMHEYR  154



>emb|CBI20351.3| unnamed protein product [Vitis vinifera]
Length=331

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G     LPPGFRFHPTDEEL+++YL+ +A+S P PV+II EVD+YKFDPWELP KA FGE
Sbjct  9    GSPQPQLPPGFRFHPTDEELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKASFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KGIKT+WIMHEYR
Sbjct  129  KGIKTNWIMHEYR  141



>gb|AHC54052.1| transcriptional factor NAC11 [Ammopiptanthus mongolicus]
Length=351

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 112/139 (81%), Gaps = 7/139 (5%)
 Frame = -1

Query  399  MGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            MG  Q S+LPPGFRFHPTDEELI +YL  +  S+P PVSII EVDIYK DPWELP KA F
Sbjct  1    MGTPQ-SNLPPGFRFHPTDEELIHHYLMKKVASIPLPVSIIAEVDIYKLDPWELPAKAAF  59

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIY------SGSKYVGVKKALVF  58
            GEKEWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I          + +GVKKALVF
Sbjct  60   GEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVKSLPRGGAPENIGVKKALVF  119

Query  57   YKGRPPKGIKTDWIMHEYR  1
            YKGRPPKG+KT+WIMHEYR
Sbjct  120  YKGRPPKGVKTNWIMHEYR  138



>gb|KHN46799.1| NAC domain-containing protein 29 [Glycine soja]
Length=353

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 111/136 (82%), Gaps = 5/136 (4%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G   S+LPPGFRFHPTDEELI++YL  +  S+P  VSII EVDIYK DPW+LP KA FGE
Sbjct  2    GSPESNLPPGFRFHPTDEELILHYLSKKVASIPLTVSIIAEVDIYKLDPWDLPAKATFGE  61

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS-----GSKYVGVKKALVFYKG  49
            KEWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I +       + VGVKKALVFYKG
Sbjct  62   KEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVTSLQGGAQESVGVKKALVFYKG  121

Query  48   RPPKGIKTDWIMHEYR  1
            RPPKG+KT+WIMHEYR
Sbjct  122  RPPKGVKTNWIMHEYR  137



>ref|XP_010060527.1| PREDICTED: NAC domain-containing protein 18-like [Eucalyptus 
grandis]
 gb|KCW67303.1| hypothetical protein EUGRSUZ_F01091 [Eucalyptus grandis]
Length=366

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 113/140 (81%), Gaps = 2/140 (1%)
 Frame = -1

Query  414  SVQKMMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELP  235
            S     G      LPPGFRFHPTDEEL+++YL+ +A S P PVS+I EVDIYKFDPWELP
Sbjct  3    STDSSAGSAAQPHLPPGFRFHPTDEELVVHYLKKKAASSPLPVSVIAEVDIYKFDPWELP  62

Query  234  EKAEFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALV  61
             KA +GE+EWYFFTPRDRKYPNG RPNRAA SGYWKATGTDK + S  G + VGVKKALV
Sbjct  63   AKATYGEQEWYFFTPRDRKYPNGARPNRAATSGYWKATGTDKPVLSAVGHQKVGVKKALV  122

Query  60   FYKGRPPKGIKTDWIMHEYR  1
            FY G+PPKG+KT+WIMHEYR
Sbjct  123  FYGGKPPKGVKTNWIMHEYR  142



>ref|XP_003553546.1| PREDICTED: NAC transcription factor 25-like [Glycine max]
Length=335

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHP+DEELI++YLRN+ TS P P S I E+D+YK++PWELP KA FGE EWYFF
Sbjct  11   LPPGFRFHPSDEELIVHYLRNKVTSSPLPASFIAEIDLYKYNPWELPSKALFGEDEWYFF  70

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            TPRDRKYPNGVRPNRAA SGYWKATGTDK I++  G K + VKKALVFYKGRPPKG KTD
Sbjct  71   TPRDRKYPNGVRPNRAAASGYWKATGTDKPIFTSCGMKSIAVKKALVFYKGRPPKGSKTD  130

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  131  WIMHEYR  137



>ref|NP_001060017.1| Os07g0566500 [Oryza sativa Japonica Group]
 sp|Q8H4S4.1|NAC10_ORYSJ RecName: Full=NAC transcription factor ONAC010 [Oryza sativa 
Japonica Group]
 dbj|BAC22555.1| putative OsNAC5 protein [Oryza sativa Japonica Group]
 dbj|BAC55651.1| putative OsNAC5 protein [Oryza sativa Japonica Group]
 dbj|BAF21931.1| Os07g0566500 [Oryza sativa Japonica Group]
 gb|EAZ40329.1| hypothetical protein OsJ_24777 [Oryza sativa Japonica Group]
Length=425

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 113/129 (88%), Gaps = 3/129 (2%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEEL+++YL+ +A S+P PV+II EVD+YKFDPW+LPEKA FGE+EWYF
Sbjct  28   ELPPGFRFHPTDEELVVHYLKKKAASVPLPVTIIAEVDLYKFDPWDLPEKANFGEQEWYF  87

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKY---VGVKKALVFYKGRPPKGIK  28
            F+PRDRKYPNG RPNRAA SGYWKATGTDK I S       VGVKKALVFY+G+PPKG+K
Sbjct  88   FSPRDRKYPNGARPNRAATSGYWKATGTDKPIMSSGSTREKVGVKKALVFYRGKPPKGVK  147

Query  27   TDWIMHEYR  1
            T+WIMHEYR
Sbjct  148  TNWIMHEYR  156



>gb|KHN02351.1| NAC domain-containing protein 29 [Glycine soja]
Length=337

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHP+DEELI++YLRN+ TS P P S I E+D+YK++PWELP KA FGE EWYFF
Sbjct  13   LPPGFRFHPSDEELIVHYLRNKVTSSPLPASFIAEIDLYKYNPWELPSKALFGEDEWYFF  72

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            TPRDRKYPNGVRPNRAA SGYWKATGTDK I++  G K + VKKALVFYKGRPPKG KTD
Sbjct  73   TPRDRKYPNGVRPNRAAASGYWKATGTDKPIFTSCGMKSIAVKKALVFYKGRPPKGSKTD  132

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  133  WIMHEYR  139



>gb|ABI94356.1| NAC transcription factor NAM-D2 [Aegilops tauschii]
Length=383

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 114/129 (88%), Gaps = 3/129 (2%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEEL+++YL+ +A  +P PV+II EVD+YKFDPWELPEKA FGE+EWYF
Sbjct  27   ELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYF  86

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS---GSKYVGVKKALVFYKGRPPKGIK  28
            F+PRDRKYPNG RPNRAA SGYWKATGTDK I +   G + VGVKKALVFY+G+PPKG+K
Sbjct  87   FSPRDRKYPNGARPNRAATSGYWKATGTDKPIMASGCGREKVGVKKALVFYRGKPPKGLK  146

Query  27   TDWIMHEYR  1
            T+WIMHEYR
Sbjct  147  TNWIMHEYR  155



>ref|XP_010054307.1| PREDICTED: NAC transcription factor 25-like [Eucalyptus grandis]
 gb|KCW89830.1| hypothetical protein EUGRSUZ_A02070 [Eucalyptus grandis]
Length=385

 Score =   216 bits (551),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 113/143 (79%), Gaps = 9/143 (6%)
 Frame = -1

Query  402  MMGGKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAE  223
            M+     S LPPGFRFHPTDEELI++YLR + TS P PVSII EVDIYK +PWELP KA 
Sbjct  1    MIMKNPQSSLPPGFRFHPTDEELILHYLRRKVTSSPLPVSIIAEVDIYKLNPWELPAKAA  60

Query  222  FGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAI---------YSGSKYVGVKK  70
            FGEKEWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I         +   + +GVKK
Sbjct  61   FGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKVIVTSSSSASAHQHHEKLGVKK  120

Query  69   ALVFYKGRPPKGIKTDWIMHEYR  1
            ALVFYKG+PPKGIKT+WIMHEYR
Sbjct  121  ALVFYKGKPPKGIKTNWIMHEYR  143



>ref|XP_004958056.1| PREDICTED: NAC transcription factor NAM-2-like [Setaria italica]
Length=413

 Score =   217 bits (552),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 117/136 (86%), Gaps = 6/136 (4%)
 Frame = -1

Query  390  KQTS---DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEF  220
            KQTS   DLPPGFRFHPTDEEL+++YL+ +A S P PV+II EVD+YKFDPWELP+KA F
Sbjct  20   KQTSSAPDLPPGFRFHPTDEELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPDKASF  79

Query  219  GEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS---KYVGVKKALVFYKG  49
            GE EWYFF+PRDRKYPNG RPNRAA SGYWKATGTDK I + +   + VGVKKALVFY+G
Sbjct  80   GEHEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILASTGNREKVGVKKALVFYRG  139

Query  48   RPPKGIKTDWIMHEYR  1
            +PPKG+KT+WIMHEYR
Sbjct  140  KPPKGLKTNWIMHEYR  155



>gb|AEH68228.1| NAC transcription factor [Triticum aestivum]
Length=383

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 114/129 (88%), Gaps = 3/129 (2%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEEL+++YL+ +A  +P PV+II EVD+YKFDPWELPEKA FGE+EWYF
Sbjct  27   ELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYF  86

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS---GSKYVGVKKALVFYKGRPPKGIK  28
            F+PRDRKYPNG RPNRAA SGYWKATGTDK I +   G + VGVKKALVFY+G+PPKG+K
Sbjct  87   FSPRDRKYPNGARPNRAATSGYWKATGTDKPIMASGCGREKVGVKKALVFYRGKPPKGLK  146

Query  27   TDWIMHEYR  1
            T+WIMHEYR
Sbjct  147  TNWIMHEYR  155



>gb|AID55350.1| NAC protein 3 [Actinidia arguta]
Length=319

 Score =   214 bits (545),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = -1

Query  393  GKQTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGE  214
            G Q   LPPGFRFHPTDEEL+++YL+ +  S P PV+II E+D+YKFDPWELP KA FGE
Sbjct  9    GSQQPILPPGFRFHPTDEELVVHYLKKKVASAPLPVTIIAEIDLYKFDPWELPAKAMFGE  68

Query  213  KEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIY--SGSKYVGVKKALVFYKGRPP  40
            +EWYFF+PRDRKYPNG RPNRAA SGYWKATG DK +   SG++ VGVKKALVFY+G+PP
Sbjct  69   QEWYFFSPRDRKYPNGARPNRAATSGYWKATGIDKPVLTSSGTQKVGVKKALVFYRGKPP  128

Query  39   KGIKTDWIMHEYR  1
            KG+KTDWIMHEYR
Sbjct  129  KGVKTDWIMHEYR  141



>gb|AIZ97668.1| NAC transcription factor NAM-D2 [Triticum aestivum]
Length=396

 Score =   216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 114/129 (88%), Gaps = 3/129 (2%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEEL+++YL+ +A  +P PV+II EVD+YKFDPWELPEKA FGE+EWYF
Sbjct  27   ELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYF  86

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS---GSKYVGVKKALVFYKGRPPKGIK  28
            F+PRDRKYPNG RPNRAA SGYWKATGTDK I +   G + VGVKKALVFY+G+PPKG+K
Sbjct  87   FSPRDRKYPNGARPNRAATSGYWKATGTDKPIMASGCGREKVGVKKALVFYRGKPPKGLK  146

Query  27   TDWIMHEYR  1
            T+WIMHEYR
Sbjct  147  TNWIMHEYR  155



>dbj|BAK04712.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=405

 Score =   216 bits (551),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 114/129 (88%), Gaps = 3/129 (2%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEEL+++YL+ +A  +P PV+II EVD+YKFDPWELPEKA FGE+EWYF
Sbjct  30   ELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYF  89

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS---GSKYVGVKKALVFYKGRPPKGIK  28
            F+PRDRKYPNG RPNRAA SGYWKATGTDK I +   G + VGVKKALVFY+G+PPKG+K
Sbjct  90   FSPRDRKYPNGARPNRAATSGYWKATGTDKPILASGCGREKVGVKKALVFYRGKPPKGLK  149

Query  27   TDWIMHEYR  1
            T+WIMHEYR
Sbjct  150  TNWIMHEYR  158



>ref|XP_003562891.1| PREDICTED: NAC transcription factor NAM-B2-like [Brachypodium 
distachyon]
Length=435

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 112/129 (87%), Gaps = 3/129 (2%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEEL+++YL+ +A   P PV+II EVD+YKFDPWELPEKA FGE+EWYF
Sbjct  29   ELPPGFRFHPTDEELVVHYLKKKAAKAPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYF  88

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGS---KYVGVKKALVFYKGRPPKGIK  28
            F+PRDRKYPNG RPNRAA SGYWKATGTDK I +     + VGVKKALVFY+G+PPKG+K
Sbjct  89   FSPRDRKYPNGARPNRAATSGYWKATGTDKPIMASGCAREKVGVKKALVFYRGKPPKGLK  148

Query  27   TDWIMHEYR  1
            T+WIMHEYR
Sbjct  149  TNWIMHEYR  157



>ref|XP_004147807.1| PREDICTED: NAC transcription factor ONAC010-like [Cucumis sativus]
 gb|KGN59897.1| hypothetical protein Csa_3G852460 [Cucumis sativus]
Length=318

 Score =   214 bits (544),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 115/129 (89%), Gaps = 3/129 (2%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEEL+++YL+ +ATS+P PV+II EVD+YK+DPWELP KA +GE+EWYF
Sbjct  16   NLPPGFRFHPTDEELVVHYLKKKATSLPLPVAIIAEVDLYKYDPWELPAKASYGEQEWYF  75

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS---GSKYVGVKKALVFYKGRPPKGIK  28
            F+PRDRKYPNG RPNRAA SGYWKATGTDK + +   G++ VGVKKALVFY G+PPKGIK
Sbjct  76   FSPRDRKYPNGARPNRAATSGYWKATGTDKPVIASSEGNRKVGVKKALVFYGGKPPKGIK  135

Query  27   TDWIMHEYR  1
            T+WIMHEYR
Sbjct  136  TNWIMHEYR  144



>gb|KEH31125.1| NAC transcription factor-like protein [Medicago truncatula]
Length=344

 Score =   214 bits (546),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 112/127 (88%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +A S P PV+II E+D+YKFDPWELP KA FGE+EWYFF
Sbjct  15   LPPGFRFHPTDEELVVHYLKRKAASAPLPVAIIAEIDLYKFDPWELPSKASFGEQEWYFF  74

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG RPNRAA SGYWKATGTDK I +  G++ VGVKKALVFY G+PPKG+KT+
Sbjct  75   SPRDRKYPNGARPNRAATSGYWKATGTDKPILTSDGNQKVGVKKALVFYGGKPPKGVKTN  134

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  135  WIMHEYR  141



>ref|XP_011098344.1| PREDICTED: NAC domain-containing protein 18 [Sesamum indicum]
Length=338

 Score =   214 bits (546),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -1

Query  387  QTSDLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKE  208
            Q   LPPGFRFHPTDEEL+++YL+ +A S P PVSII EVD+YK+DPWELP KA FGE+E
Sbjct  11   QQPQLPPGFRFHPTDEELVVHYLKKKAASAPLPVSIIAEVDLYKYDPWELPAKAIFGEQE  70

Query  207  WYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKG  34
            WYFF+PRDRKYPNG RPNRAA SGYWKATGTDK + +  G++ VGVKKALVFY G+PPKG
Sbjct  71   WYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKG  130

Query  33   IKTDWIMHEYR  1
            IKT+WIMHEYR
Sbjct  131  IKTNWIMHEYR  141



>gb|EAY82108.1| hypothetical protein OsI_37306 [Oryza sativa Indica Group]
Length=386

 Score =   216 bits (549),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YL NQA S+ CPV II EV+IYK +PW+LP KA FGE EWYFF
Sbjct  4    LPPGFRFHPTDEELIVHYLMNQAASIKCPVPIIAEVNIYKCNPWDLPGKALFGENEWYFF  63

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG RPNRAA SGYWKATGTDK+I S   S  +GVKKALVFYKG+PPKG+KTD
Sbjct  64   SPRDRKYPNGARPNRAAGSGYWKATGTDKSILSTPTSDNIGVKKALVFYKGKPPKGVKTD  123

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  124  WIMHEYR  130



>gb|EAZ17264.1| hypothetical protein OsJ_32784 [Oryza sativa Japonica Group]
Length=386

 Score =   216 bits (549),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEELI++YL NQA S+ CPV II EV+IYK +PW+LP KA FGE EWYFF
Sbjct  4    LPPGFRFHPTDEELIVHYLMNQAASIKCPVPIIAEVNIYKCNPWDLPGKALFGENEWYFF  63

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG RPNRAA SGYWKATGTDK+I S   S  +GVKKALVFYKG+PPKG+KTD
Sbjct  64   SPRDRKYPNGARPNRAAGSGYWKATGTDKSILSTPTSDNIGVKKALVFYKGKPPKGVKTD  123

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  124  WIMHEYR  130



>ref|XP_004977420.1| PREDICTED: NAC transcription factor 25-like [Setaria italica]
Length=367

 Score =   215 bits (547),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 111/128 (87%), Gaps = 2/128 (2%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LP GFRFHPTDEELI++YL NQA+S+PCPV II EV+IY+ +PW+LP KA FGE EWYF
Sbjct  10   NLPAGFRFHPTDEELIVHYLMNQASSLPCPVPIIAEVNIYQCNPWDLPAKALFGENEWYF  69

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYKGRPPKGIKT  25
            F+PRDRKYPNG RPNRAA SGYWKATGTDKAI S   S+ +GVKKALVFY G+PPKG KT
Sbjct  70   FSPRDRKYPNGARPNRAAGSGYWKATGTDKAILSTPTSENIGVKKALVFYGGKPPKGTKT  129

Query  24   DWIMHEYR  1
            DWIMHEYR
Sbjct  130  DWIMHEYR  137



>ref|XP_002519550.1| transcription factor, putative [Ricinus communis]
 gb|EEF42964.1| transcription factor, putative [Ricinus communis]
Length=308

 Score =   213 bits (543),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 115/137 (84%), Gaps = 4/137 (3%)
 Frame = -1

Query  399  MGGKQTSD--LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKA  226
            M  K TSD  LPPGFRFHP+DEELI+YYL+N+ TS P P S++ ++D+YK++PWELP+KA
Sbjct  1    METKTTSDIHLPPGFRFHPSDEELIVYYLKNKVTSNPLPASVVADLDLYKYNPWELPKKA  60

Query  225  EFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS--GSKYVGVKKALVFYK  52
             FGE EWYFFTPRDRKYPNG RPNRA  SGYWKATGTDK I +  G+  +GVKKALVFY 
Sbjct  61   SFGEDEWYFFTPRDRKYPNGARPNRATASGYWKATGTDKPILTSCGTTSIGVKKALVFYG  120

Query  51   GRPPKGIKTDWIMHEYR  1
            GRPPKGIKTDWIMHEYR
Sbjct  121  GRPPKGIKTDWIMHEYR  137



>gb|AEI00651.1| NAC3 [Triticum aestivum]
Length=396

 Score =   216 bits (550),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 114/129 (88%), Gaps = 3/129 (2%)
 Frame = -1

Query  378  DLPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYF  199
            +LPPGFRFHPTDEEL+++YL+ +A  +P PV+II EVD+YKFDPWELPEKA FGE+EWYF
Sbjct  27   ELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYF  86

Query  198  FTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS---GSKYVGVKKALVFYKGRPPKGIK  28
            F+PRDRKYPNG RPNRAA SGYWKATGTDK I +   G + VGVKKALVFY+G+PPKG+K
Sbjct  87   FSPRDRKYPNGARPNRAATSGYWKATGTDKPIMASGCGREKVGVKKALVFYRGKPPKGLK  146

Query  27   TDWIMHEYR  1
            T+WIMHEYR
Sbjct  147  TNWIMHEYR  155



>ref|XP_010533896.1| PREDICTED: NAC transcription factor 25 isoform X2 [Tarenaya hassleriana]
Length=286

 Score =   213 bits (541),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 111/127 (87%), Gaps = 2/127 (2%)
 Frame = -1

Query  375  LPPGFRFHPTDEELIMYYLRNQATSMPCPVSIIPEVDIYKFDPWELPEKAEFGEKEWYFF  196
            LPPGFRFHPTDEEL+++YL+ +  S+P PVSII EVD+YKFDPWELP KA FGE+EWYFF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKVASIPLPVSIIAEVDLYKFDPWELPCKATFGEQEWYFF  74

Query  195  TPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKY--VGVKKALVFYKGRPPKGIKTD  22
            +PRDRKYPNG RPNRAA SGYWKATGTDK I + + +  VGVKKALVFY G+PPKGIKT+
Sbjct  75   SPRDRKYPNGARPNRAATSGYWKATGTDKPILTSNSHHKVGVKKALVFYGGKPPKGIKTN  134

Query  21   WIMHEYR  1
            WIMHEYR
Sbjct  135  WIMHEYR  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 571442019030