BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14479_g1_i1 len=1495 path=[41:0-253 @40@!:254-1070 1110:1071-1494]

Length=1495
                                                                      Score     E

ref|XP_009769381.1|  PREDICTED: glucose and ribitol dehydrogenase...    485   7e-167   
ref|XP_004230182.1|  PREDICTED: glucose and ribitol dehydrogenase...    481   2e-164   
ref|XP_006361858.1|  PREDICTED: glucose and ribitol dehydrogenase...    479   7e-164   
gb|EPS61688.1|  hypothetical protein M569_13104                         477   2e-163   
ref|XP_009629944.1|  PREDICTED: glucose and ribitol dehydrogenase...    473   1e-161   
ref|XP_009772647.1|  PREDICTED: glucose and ribitol dehydrogenase...    470   6e-161   
ref|XP_004148135.1|  PREDICTED: glucose and ribitol dehydrogenase...    469   3e-160   
ref|XP_010278084.1|  PREDICTED: glucose and ribitol dehydrogenase       467   2e-159   
ref|XP_004495735.1|  PREDICTED: glucose and ribitol dehydrogenase...    464   2e-158   
ref|XP_002319022.2|  hypothetical protein POPTR_0013s02480g             466   3e-158   Populus trichocarpa [western balsam poplar]
ref|XP_002512366.1|  short chain dehydrogenase, putative                464   3e-158   Ricinus communis
ref|XP_003591094.1|  Glucose and ribitol dehydrogenase                  462   6e-158   
gb|AFK39537.1|  unknown                                                 462   8e-158   
gb|EYU34848.1|  hypothetical protein MIMGU_mgv1a011082mg                461   2e-157   
ref|XP_008439102.1|  PREDICTED: glucose and ribitol dehydrogenase...    463   3e-157   
ref|XP_009119565.1|  PREDICTED: glucose and ribitol dehydrogenase...    460   6e-157   
ref|XP_006392477.1|  hypothetical protein EUTSA_v10023627mg             460   6e-157   
ref|XP_010025176.1|  PREDICTED: glucose and ribitol dehydrogenase...    459   1e-156   
ref|NP_001238285.1|  seed maturation protein PM34                       459   1e-156   
ref|NP_001291332.1|  glucose and ribitol dehydrogenase homolog 1-...    461   2e-156   
ref|XP_006433300.1|  hypothetical protein CICLE_v10002055mg             459   2e-156   
gb|KDP23528.1|  hypothetical protein JCGZ_23361                         459   2e-156   
emb|CDY43488.1|  BnaA01g21430D                                          459   2e-156   
gb|KFK35607.1|  hypothetical protein AALP_AA4G013100                    458   3e-156   
gb|KGN57282.1|  hypothetical protein Csa_3G176290                       459   5e-156   
gb|KHN20212.1|  Glucose and ribitol dehydrogenase                       458   5e-156   
ref|XP_010511227.1|  PREDICTED: glucose and ribitol dehydrogenase...    459   7e-156   
ref|XP_010528871.1|  PREDICTED: glucose and ribitol dehydrogenase...    458   1e-155   
gb|AFK45385.1|  unknown                                                 456   3e-155   
emb|CDP20122.1|  unnamed protein product                                455   5e-155   
emb|CDY17559.1|  BnaC01g26830D                                          454   8e-155   
gb|ACU18973.1|  unknown                                                 455   9e-155   Glycine max [soybeans]
ref|XP_010674766.1|  PREDICTED: glucose and ribitol dehydrogenase...    456   2e-154   
gb|KHN16133.1|  Glucose and ribitol dehydrogenase like 1                454   3e-154   
ref|XP_010528870.1|  PREDICTED: glucose and ribitol dehydrogenase...    456   3e-154   
ref|NP_001242815.1|  uncharacterized protein LOC100807147               453   3e-154   
ref|XP_006301375.1|  hypothetical protein CARUB_v10021787mg             455   3e-154   
ref|XP_010480201.1|  PREDICTED: glucose and ribitol dehydrogenase...    455   4e-154   
emb|CAN77025.1|  hypothetical protein VITISV_015336                     451   3e-153   Vitis vinifera
ref|XP_002284803.3|  PREDICTED: glucose and ribitol dehydrogenase...    450   5e-153   Vitis vinifera
sp|Q9FZ42.1|GRDH1_ARATH  RecName: Full=Glucose and ribitol dehydr...    449   1e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007144740.1|  hypothetical protein PHAVU_007G180800g             451   1e-152   
sp|Q5KTS5.1|GRDH_DAUCA  RecName: Full=Glucose and ribitol dehydro...    449   2e-152   Daucus carota [carrots]
ref|NP_564670.2|  glucose and ribitol dehydrogenase homolog 1           450   3e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010418919.1|  PREDICTED: glucose and ribitol dehydrogenase...    449   4e-152   
ref|XP_003626301.1|  Glucose and ribitol dehydrogenase-like protein     445   6e-151   
ref|XP_008388967.1|  PREDICTED: glucose and ribitol dehydrogenase...    447   7e-151   
ref|XP_008450654.1|  PREDICTED: glucose and ribitol dehydrogenase...    444   1e-150   
ref|XP_009349395.1|  PREDICTED: glucose and ribitol dehydrogenase...    443   2e-150   
ref|XP_004302438.1|  PREDICTED: LOW QUALITY PROTEIN: glucose and ...    442   1e-149   
ref|XP_004494625.1|  PREDICTED: glucose and ribitol dehydrogenase...    441   2e-149   
gb|AAG51119.1|AC069144_16  dormancy related protein, putative           441   2e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011023588.1|  PREDICTED: LOW QUALITY PROTEIN: glucose and ...    443   3e-149   
ref|XP_004135622.1|  PREDICTED: glucose and ribitol dehydrogenase...    440   7e-149   
ref|XP_004302437.1|  PREDICTED: glucose and ribitol dehydrogenase...    439   1e-148   
ref|XP_008246487.1|  PREDICTED: glucose and ribitol dehydrogenase...    439   2e-148   
ref|XP_008246486.1|  PREDICTED: glucose and ribitol dehydrogenase...    438   3e-148   
gb|AAN15136.1|  putative TAG factor protein                             438   3e-148   Lupinus angustifolius
ref|XP_004166035.1|  PREDICTED: glucose and ribitol dehydrogenase...    437   5e-148   
ref|XP_010043092.1|  PREDICTED: glucose and ribitol dehydrogenase...    434   2e-146   
ref|XP_003521711.1|  PREDICTED: glucose and ribitol dehydrogenase...    433   3e-146   
ref|XP_007205659.1|  hypothetical protein PRUPE_ppa009407mg             432   5e-146   
ref|XP_007030862.1|  NAD(P)-binding Rossmann-fold superfamily pro...    432   6e-146   
ref|XP_010674769.1|  PREDICTED: glucose and ribitol dehydrogenase...    432   9e-146   
gb|KGN66084.1|  hypothetical protein Csa_1G570090                       430   4e-145   
gb|ACU23676.1|  unknown                                                 427   5e-144   Glycine max [soybeans]
ref|XP_010105844.1|  Glucose and ribitol dehydrogenase-1-like pro...    427   6e-144   
gb|KHN04002.1|  Glucose and ribitol dehydrogenase like 1                426   2e-143   
ref|XP_007147059.1|  hypothetical protein PHAVU_006G092800g             423   2e-142   
ref|XP_009397642.1|  PREDICTED: glucose and ribitol dehydrogenase...    422   7e-142   
ref|XP_010105843.1|  Glucose and ribitol dehydrogenase-1-like pro...    422   1e-140   
ref|XP_002891915.1|  oxidoreductase                                     419   2e-140   
ref|XP_010906880.1|  PREDICTED: glucose and ribitol dehydrogenase...    420   3e-140   
ref|XP_008790990.1|  PREDICTED: glucose and ribitol dehydrogenase...    420   3e-140   
gb|KFK37931.1|  hypothetical protein AALP_AA3G048700                    410   1e-137   
ref|XP_003553739.1|  PREDICTED: glucose and ribitol dehydrogenase...    410   2e-137   
ref|NP_187177.1|  NAD(P)-binding Rossmann-fold superfamily protein      407   3e-136   Arabidopsis thaliana [mouse-ear cress]
gb|AAL16204.1|AF428435_1  AT3g05260/T12H1_23                            407   4e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007147090.1|  hypothetical protein PHAVU_006G095500g             405   3e-135   
ref|XP_009147260.1|  PREDICTED: glucose and ribitol dehydrogenase...    404   3e-135   
ref|XP_006433301.1|  hypothetical protein CICLE_v10003201mg             404   7e-135   
ref|XP_010464044.1|  PREDICTED: glucose and ribitol dehydrogenase...    403   1e-134   
ref|XP_010546674.1|  PREDICTED: glucose and ribitol dehydrogenase...    403   2e-134   
ref|XP_006298247.1|  hypothetical protein CARUB_v10014308mg             403   2e-134   
ref|XP_002884497.1|  short-chain dehydrogenase/reductase family p...    402   3e-134   
ref|XP_010424987.1|  PREDICTED: glucose and ribitol dehydrogenase...    400   2e-133   
ref|XP_010485956.1|  PREDICTED: glucose and ribitol dehydrogenase...    396   7e-132   
ref|XP_003568968.1|  PREDICTED: glucose and ribitol dehydrogenase...    398   1e-131   
ref|XP_007154111.1|  hypothetical protein PHAVU_003G091300g             394   4e-131   
gb|KDO59502.1|  hypothetical protein CISIN_1g039897mg                   393   7e-131   
ref|XP_004960440.1|  PREDICTED: glucose and ribitol dehydrogenase...    396   8e-131   
ref|XP_009398932.1|  PREDICTED: glucose and ribitol dehydrogenase...    393   2e-130   
ref|XP_006408096.1|  hypothetical protein EUTSA_v10022134mg             391   8e-130   
gb|EMT30749.1|  Glucose and ribitol dehydrogenase-like protein          389   4e-129   
sp|Q75KH3.2|GRDH_ORYSJ  RecName: Full=Glucose and ribitol dehydro...    389   7e-129   Oryza sativa Japonica Group [Japonica rice]
gb|EAY96497.1|  hypothetical protein OsI_18399                          389   8e-129   Oryza sativa Indica Group [Indian rice]
pir||T06212  glucose and ribitol dehydrogenase homolog - barley         389   8e-129
ref|XP_003610393.1|  Glucose and ribitol dehydrogenase-like protein     388   2e-128   
ref|XP_011090772.1|  PREDICTED: glucose and ribitol dehydrogenase...    387   2e-128   
dbj|BAJ85825.1|  predicted protein                                      389   4e-128   
ref|NP_001241158.1|  uncharacterized protein LOC100809384               386   8e-128   
ref|NP_001054600.1|  Os05g0140800                                       389   9e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011021590.1|  PREDICTED: glucose and ribitol dehydrogenase...    384   3e-127   
gb|KDP40130.1|  hypothetical protein JCGZ_02128                         377   2e-124   
ref|XP_002517191.1|  short chain dehydrogenase, putative                376   5e-124   Ricinus communis
ref|XP_002517192.1|  short chain dehydrogenase, putative                375   2e-123   Ricinus communis
ref|NP_001140439.1|  uncharacterized protein LOC100272498               375   3e-123   Zea mays [maize]
ref|XP_006654977.1|  PREDICTED: LOW QUALITY PROTEIN: glucose and ...    374   2e-122   
tpg|DAA41374.1|  TPA: general stress protein 39Short-chain dehydr...    374   3e-122   
ref|XP_004507706.1|  PREDICTED: glucose and ribitol dehydrogenase...    371   6e-122   
ref|XP_002439250.1|  hypothetical protein SORBIDRAFT_09g003150          370   4e-121   Sorghum bicolor [broomcorn]
ref|XP_002311602.2|  hypothetical protein POPTR_0008s14850g             367   2e-120   Populus trichocarpa [western balsam poplar]
ref|XP_011025991.1|  PREDICTED: glucose and ribitol dehydrogenase...    366   4e-120   
ref|XP_001752356.1|  predicted protein                                  365   1e-119   
tpg|DAA41375.1|  TPA: hypothetical protein ZEAMMB73_293728              366   2e-119   
gb|EYU41520.1|  hypothetical protein MIMGU_mgv1a0189502mg               359   4e-118   
ref|XP_008363981.1|  PREDICTED: LOW QUALITY PROTEIN: glucose and ...    352   8e-115   
ref|XP_002517190.1|  short chain dehydrogenase, putative                351   3e-114   Ricinus communis
ref|XP_002961003.1|  hypothetical protein SELMODRAFT_402549             333   2e-107   
ref|XP_001752921.1|  predicted protein                                  333   4e-107   
gb|ADE76781.1|  unknown                                                 331   2e-106   
ref|XP_002967005.1|  hypothetical protein SELMODRAFT_230991             330   4e-106   
ref|WP_019491234.1|  short-chain dehydrogenase                          326   1e-104   
ref|XP_001773923.1|  predicted protein                                  326   2e-104   
ref|WP_015204565.1|  3-oxoacyl-(acyl-carrier-protein) reductase         325   2e-104   
ref|WP_016859210.1|  short-chain dehydrogenase                          325   2e-104   
ref|WP_017318827.1|  short-chain dehydrogenase                          324   7e-104   
ref|WP_015217262.1|  3-oxoacyl-(acyl-carrier-protein) reductase         324   8e-104   
ref|WP_026964919.1|  short-chain dehydrogenase                          324   9e-104   
ref|WP_017310770.1|  short-chain dehydrogenase                          323   2e-103   
ref|WP_015138394.1|  dehydrogenase                                      322   4e-103   
ref|WP_016877040.1|  short-chain dehydrogenase                          322   4e-103   
ref|WP_026733559.1|  short-chain dehydrogenase                          322   5e-103   
ref|WP_040549836.1|  short-chain dehydrogenase                          322   7e-103   
ref|WP_036011125.1|  short-chain dehydrogenase                          322   7e-103   
ref|WP_010999306.1|  short-chain dehydrogenase                          321   1e-102   
ref|WP_026722248.1|  short-chain dehydrogenase                          321   1e-102   
gb|KIJ82733.1|  short-chain dehydrogenase                               320   2e-102   
emb|CBI36759.3|  unnamed protein product                                318   3e-102   
ref|WP_041037605.1|  short-chain dehydrogenase                          320   4e-102   
ref|WP_009674322.1|  MULTISPECIES: short-chain dehydrogenase            320   5e-102   
ref|WP_015152646.1|  short-chain dehydrogenase/reductase SDR            319   9e-102   
ref|WP_011319210.1|  short-chain dehydrogenase                          318   1e-101   
gb|EEF58697.1|  short-chain dehydrogenase/reductase SDR                 317   2e-101   Pedosphaera parvula Ellin514
ref|WP_039713375.1|  short-chain dehydrogenase                          317   4e-101   
ref|WP_016865637.1|  short-chain dehydrogenase                          317   7e-101   
ref|WP_007222970.1|  short-chain dehydrogenase                          316   1e-100   
ref|WP_009630815.1|  dehydrogenase of unknown specificity               315   2e-100   
ref|WP_009459400.1|  MULTISPECIES: short-chain dehydrogenase            315   2e-100   
ref|WP_012409849.1|  short-chain dehydrogenase                          316   3e-100   
ref|WP_006634949.1|  short-chain dehydrogenase                          314   4e-100   
gb|KIE07269.1|  short-chain dehydrogenase                               314   8e-100   
ref|WP_017291127.1|  short-chain dehydrogenase                          314   8e-100   
ref|WP_007358209.1|  MULTISPECIES: short-chain dehydrogenase            314   9e-100   
ref|WP_015176884.1|  3-oxoacyl-(acyl-carrier-protein) reductase         313   9e-100   
ref|WP_012528577.1|  short-chain dehydrogenase                          313   1e-99    
ref|WP_026100139.1|  short-chain dehydrogenase                          313   1e-99    
ref|WP_026841337.1|  short-chain dehydrogenase                          313   1e-99    
ref|WP_006198195.1|  short-chain dehydrogenase                          313   2e-99    
ref|WP_015188665.1|  3-oxoacyl-(acyl-carrier-protein) reductase         313   2e-99    
ref|WP_015205745.1|  dehydrogenase of unknown specificity, short-...    312   3e-99    
ref|WP_012773835.1|  short-chain dehydrogenase                          312   3e-99    
ref|WP_029007658.1|  short-chain dehydrogenase                          312   4e-99    
ref|WP_038088120.1|  short-chain dehydrogenase                          312   5e-99    
ref|WP_015182467.1|  dehydrogenase                                      312   5e-99    
ref|WP_026567649.1|  short-chain dehydrogenase                          311   6e-99    
ref|WP_015148322.1|  dehydrogenase                                      311   7e-99    
ref|WP_027892061.1|  short-chain dehydrogenase                          311   1e-98    
ref|WP_039747436.1|  short-chain dehydrogenase                          311   1e-98    
ref|WP_035153476.1|  short-chain dehydrogenase                          309   5e-98    
ref|WP_026235740.1|  short-chain dehydrogenase                          309   6e-98    
ref|WP_026236114.1|  short-chain dehydrogenase                          309   7e-98    
ref|WP_028558398.1|  short-chain dehydrogenase                          309   8e-98    
ref|WP_018987439.1|  hypothetical protein                               309   1e-97    
ref|WP_029282714.1|  short-chain dehydrogenase                          308   1e-97    
gb|AHL75688.1|  short-chain dehydrogenase                               308   1e-97    
ref|WP_029565118.1|  short-chain dehydrogenase                          308   1e-97    
ref|WP_004433959.1|  short-chain dehydrogenase                          308   2e-97    
ref|WP_014095754.1|  short-chain dehydrogenase                          308   2e-97    
ref|WP_029193233.1|  short-chain dehydrogenase                          308   2e-97    
emb|CDZ80776.1|  General stress protein 39                              307   2e-97    
dbj|BAP79673.1|  general stress protein 39                              307   3e-97    
ref|WP_028554445.1|  short-chain dehydrogenase                          307   3e-97    
ref|WP_006528898.1|  dehydrogenase of unknown specificity               307   3e-97    
ref|WP_013322819.1|  short-chain dehydrogenase                          306   5e-97    
ref|WP_015126919.1|  3-oxoacyl-(acyl-carrier-protein) reductase         306   5e-97    
ref|WP_007960687.1|  short-chain dehydrogenase                          306   7e-97    
ref|WP_033099303.1|  short-chain dehydrogenase                          306   7e-97    
gb|KIL17971.1|  hypothetical protein B4127_1052                         306   7e-97    
ref|WP_034663528.1|  short-chain dehydrogenase                          306   8e-97    
ref|WP_019339147.1|  short-chain dehydrogenase                          306   1e-96    
ref|WP_011140423.1|  short-chain dehydrogenase                          306   1e-96    
ref|XP_004356989.1|  seed maturation protein PM34, putative             306   1e-96    
ref|WP_003211351.1|  short-chain dehydrogenase                          305   1e-96    
ref|WP_014820194.1|  short-chain dehydrogenase                          305   2e-96    
ref|WP_023172258.1|  short-chain dehydrogenase/reductase SDR            305   2e-96    
ref|WP_007937306.1|  MULTISPECIES: short-chain dehydrogenase            305   2e-96    
ref|WP_012372871.1|  short-chain dehydrogenase                          305   2e-96    
ref|WP_028394424.1|  short-chain dehydrogenase                          305   2e-96    
ref|WP_025847183.1|  short-chain dehydrogenase                          305   2e-96    
gb|ESA23769.1|  hypothetical protein GLOINDRAFT_15099                   305   3e-96    
ref|WP_014247477.1|  short-chain dehydrogenase                          305   3e-96    
ref|WP_034131758.1|  short-chain dehydrogenase                          305   3e-96    
ref|WP_025911875.1|  short-chain dehydrogenase                          305   4e-96    
ref|WP_008578832.1|  short-chain dehydrogenase                          304   4e-96    
ref|WP_038668342.1|  short-chain dehydrogenase                          304   4e-96    
ref|WP_023445357.1|  MULTISPECIES: short-chain dehydrogenase            304   5e-96    
ref|WP_028989030.1|  short-chain dehydrogenase                          304   5e-96    
ref|WP_035189366.1|  short-chain dehydrogenase                          304   6e-96    
ref|WP_015436274.1|  short-chain dehydrogenase family protein           303   8e-96    
ref|WP_021169740.1|  short chain dehydrogenase/reductase family o...    303   9e-96    
ref|WP_038660057.1|  short-chain dehydrogenase                          303   1e-95    
ref|WP_010283432.1|  short-chain dehydrogenase                          303   1e-95    
ref|WP_040214279.1|  short-chain dehydrogenase                          303   1e-95    
gb|KGK84870.1|  short-chain dehydrogenase                               303   1e-95    
ref|WP_012628858.1|  short-chain dehydrogenase                          303   2e-95    
ref|WP_023959633.1|  oxidoreductase, short chain dehydrogenase/re...    303   2e-95    
ref|WP_015235209.1|  dehydrogenase                                      303   2e-95    
ref|WP_019988102.1|  short-chain dehydrogenase                          303   2e-95    
ref|WP_041063022.1|  short-chain dehydrogenase                          303   2e-95    
ref|XP_002517193.1|  short chain dehydrogenase, putative                301   2e-95    Ricinus communis
ref|WP_013916625.1|  short-chain dehydrogenase                          302   3e-95    
ref|WP_014370097.1|  short-chain dehydrogenase                          302   3e-95    
ref|WP_018756071.1|  hypothetical protein                               302   4e-95    
ref|WP_034386148.1|  short-chain dehydrogenase                          302   4e-95    
ref|WP_035069901.1|  short-chain dehydrogenase                          301   4e-95    
ref|WP_034323647.1|  short-chain dehydrogenase                          301   4e-95    
ref|WP_006212031.1|  MULTISPECIES: short-chain dehydrogenase            301   4e-95    
ref|WP_027482598.1|  short-chain dehydrogenase                          301   5e-95    
ref|WP_003291252.1|  short-chain dehydrogenase                          301   5e-95    
ref|WP_035348378.1|  short-chain dehydrogenase                          301   5e-95    
ref|WP_012009478.1|  short-chain dehydrogenase                          301   7e-95    
ref|WP_034301457.1|  dehydrogenase                                      301   7e-95    
ref|WP_003300330.1|  short-chain dehydrogenase                          301   7e-95    
ref|WP_040040170.1|  short-chain dehydrogenase                          301   1e-94    
ref|WP_019393868.1|  hypothetical protein                               300   1e-94    
ref|WP_015736983.1|  MULTISPECIES: short-chain dehydrogenase            300   1e-94    
ref|WP_017715928.1|  short-chain dehydrogenase                          300   2e-94    
ref|WP_003292953.1|  short-chain dehydrogenase                          300   2e-94    
ref|WP_040204499.1|  short-chain dehydrogenase                          300   2e-94    
ref|WP_038091998.1|  short-chain dehydrogenase                          300   2e-94    
ref|WP_026136235.1|  short-chain dehydrogenase                          300   2e-94    
ref|WP_035410692.1|  short-chain dehydrogenase                          300   2e-94    
ref|WP_034282185.1|  MULTISPECIES: short-chain dehydrogenase            300   3e-94    
ref|WP_008567791.1|  short-chain dehydrogenase                          299   3e-94    
ref|WP_015276966.1|  dehydrogenase                                      299   3e-94    
ref|WP_026899363.1|  short-chain dehydrogenase                          299   3e-94    
ref|WP_003285036.1|  short-chain dehydrogenase                          299   4e-94    
ref|WP_015192834.1|  3-oxoacyl-(acyl-carrier-protein) reductase         299   4e-94    
ref|WP_024425480.1|  MULTISPECIES: short-chain dehydrogenase            299   4e-94    
ref|WP_012749398.1|  short-chain dehydrogenase                          299   4e-94    
ref|WP_002203375.1|  short-chain dehydrogenase                          299   5e-94    
ref|WP_006838474.1|  short-chain dehydrogenase                          299   5e-94    
emb|CEA02082.1|  short-chain dehydrogenase/reductase SDR                299   5e-94    
ref|WP_025691949.1|  short-chain dehydrogenase                          299   6e-94    
ref|WP_035392508.1|  short-chain dehydrogenase                          298   8e-94    
ref|WP_014720967.1|  short-chain dehydrogenase                          298   8e-94    
ref|WP_026630266.1|  dehydrogenase                                      298   9e-94    
ref|WP_040057163.1|  short-chain dehydrogenase                          298   1e-93    
ref|WP_040399989.1|  short-chain dehydrogenase                          298   1e-93    
ref|WP_012974033.1|  short-chain dehydrogenase                          298   1e-93    
ref|WP_034965029.1|  short-chain dehydrogenase                          298   1e-93    
ref|WP_012695369.1|  short-chain dehydrogenase                          298   1e-93    
ref|WP_027408970.1|  short-chain dehydrogenase                          298   1e-93    
ref|WP_026964750.1|  dehydrogenase                                      298   1e-93    
gb|AIQ51864.1|  short-chain dehydrogenase                               298   1e-93    
ref|WP_007127411.1|  short-chain dehydrogenase                          298   1e-93    
ref|WP_026973700.1|  short-chain dehydrogenase                          298   1e-93    
ref|WP_026586302.1|  short-chain dehydrogenase                          298   1e-93    
ref|WP_024308204.1|  short-chain dehydrogenase                          297   2e-93    
ref|WP_024426544.1|  short-chain dehydrogenase                          298   2e-93    
ref|WP_017366957.1|  short-chain dehydrogenase                          298   2e-93    
ref|WP_026566106.1|  short-chain dehydrogenase                          297   2e-93    
ref|WP_041089704.1|  short-chain dehydrogenase                          297   2e-93    
ref|WP_002201708.1|  short-chain dehydrogenase                          297   2e-93    
ref|WP_025150211.1|  dehydrogenase                                      297   2e-93    
ref|WP_025701360.1|  short-chain dehydrogenase                          297   3e-93    
ref|WP_011913295.1|  short-chain dehydrogenase                          297   3e-93    
ref|WP_039962782.1|  short-chain dehydrogenase                          297   3e-93    
ref|WP_016763019.1|  MULTISPECIES: short-chain dehydrogenase            297   3e-93    
ref|WP_013055375.1|  MULTISPECIES: short-chain dehydrogenase            297   3e-93    
ref|WP_026561286.1|  short-chain dehydrogenase                          297   3e-93    
ref|WP_019713867.1|  short-chain dehydrogenase                          296   4e-93    
ref|WP_035700162.1|  short-chain dehydrogenase                          296   4e-93    
ref|WP_039073469.1|  short-chain dehydrogenase                          296   4e-93    
gb|AHV96657.1|  short-chain dehydrogenase/reductase SDR                 296   4e-93    
ref|WP_017244544.1|  short-chain dehydrogenase                          296   4e-93    
ref|WP_013715546.1|  short-chain dehydrogenase                          296   4e-93    
ref|WP_012958329.1|  short-chain dehydrogenase                          296   4e-93    
ref|WP_022626999.1|  short-chain dehydrogenase                          296   5e-93    
ref|WP_013351742.1|  MULTISPECIES: short-chain dehydrogenase            296   5e-93    
ref|WP_034647789.1|  short-chain dehydrogenase                          296   5e-93    
ref|WP_013982835.1|  short-chain dehydrogenase                          296   5e-93    
ref|WP_012189908.1|  short-chain dehydrogenase                          296   5e-93    
ref|WP_013401480.1|  short-chain dehydrogenase                          296   5e-93    
ref|WP_002166350.1|  short-chain dehydrogenase                          296   5e-93    
gb|AIE86768.1|  oxidoreductase                                          295   5e-93    
ref|WP_012598459.1|  short-chain dehydrogenase                          296   5e-93    
gb|EEK74747.1|  Short-chain dehydrogenase/reductase SDR                 296   6e-93    
ref|WP_040238324.1|  short-chain dehydrogenase                          296   6e-93    
ref|WP_017436521.1|  short-chain dehydrogenase                          296   6e-93    
ref|WP_003460153.1|  short-chain dehydrogenase                          296   6e-93    
ref|WP_032871127.1|  short-chain dehydrogenase                          296   7e-93    
ref|WP_013081725.1|  short-chain dehydrogenase                          296   7e-93    
gb|EWH21556.1|  short-chain dehydrogenase                               296   7e-93    
ref|WP_007610477.1|  MULTISPECIES: short-chain dehydrogenase            296   7e-93    
ref|WP_028403875.1|  short-chain dehydrogenase                          296   7e-93    
ref|WP_002116343.1|  short-chain dehydrogenase                          296   7e-93    
ref|WP_008348806.1|  short-chain dehydrogenase                          296   7e-93    
ref|WP_010233702.1|  short-chain dehydrogenase                          296   7e-93    
ref|WP_015239527.1|  oxidoreductase                                     296   8e-93    
ref|WP_007084309.1|  short-chain dehydrogenase/reductase SDR            296   8e-93    
ref|WP_039871773.1|  short-chain dehydrogenase                          296   9e-93    
ref|WP_012566081.1|  short-chain dehydrogenase                          296   9e-93    
ref|WP_036587399.1|  short-chain dehydrogenase                          296   9e-93    
ref|WP_003155182.1|  short-chain dehydrogenase                          295   9e-93    
ref|WP_016103773.1|  short chain dehydrogenase                          296   1e-92    
dbj|GAJ39603.1|  putative oxidoreductase                                295   1e-92    
ref|WP_020307459.1|  short-chain dehydrogenase                          295   1e-92    
ref|WP_026961297.1|  short-chain dehydrogenase                          295   1e-92    
ref|WP_027367583.1|  short-chain dehydrogenase                          295   1e-92    
ref|WP_003252430.1|  short-chain dehydrogenase                          295   1e-92    
ref|WP_021208172.1|  short-chain dehydrogenase                          295   1e-92    
ref|WP_003246982.1|  short-chain dehydrogenase                          295   1e-92    
ref|WP_011479648.1|  short-chain dehydrogenase                          296   1e-92    
dbj|GAK38744.1|  putative general stress protein                        295   1e-92    
ref|WP_003180352.1|  MULTISPECIES: short-chain dehydrogenase            295   1e-92    
gb|EMI14713.1|  oxidoreductase                                          294   1e-92    
ref|WP_038457531.1|  MULTISPECIES: short-chain dehydrogenase            295   2e-92    
ref|WP_032874380.1|  short-chain dehydrogenase                          295   2e-92    
ref|WP_020450827.1|  MULTISPECIES: putative oxidoreductase YhxC         295   2e-92    
ref|WP_041093030.1|  short-chain dehydrogenase                          295   2e-92    
ref|WP_039358140.1|  short-chain dehydrogenase                          295   2e-92    
ref|WP_027460601.1|  short-chain dehydrogenase                          295   2e-92    
gb|EKE03176.1|  hypothetical protein ACD_20C00235G0001                  295   2e-92    
ref|WP_011201605.1|  short-chain dehydrogenase                          295   2e-92    
gb|KIC72077.1|  putative oxidoreductase YhdF                            295   2e-92    
ref|WP_027382327.1|  short-chain dehydrogenase                          295   2e-92    
ref|WP_006636724.1|  oxidoreductase YhxC                                295   2e-92    
ref|WP_009494038.1|  short-chain dehydrogenase                          295   2e-92    
ref|WP_010192071.1|  short-chain dehydrogenase                          295   2e-92    
ref|WP_027448119.1|  short-chain dehydrogenase                          295   2e-92    
ref|WP_034639282.1|  dehydrogenase                                      295   2e-92    
ref|WP_002159217.1|  short-chain dehydrogenase                          295   2e-92    
ref|WP_024085092.1|  short-chain dehydrogenase                          295   2e-92    
ref|WP_040303171.1|  short-chain dehydrogenase                          294   2e-92    
ref|WP_010329285.1|  short-chain dehydrogenase                          295   2e-92    
ref|WP_009787886.1|  short-chain dehydrogenase                          295   2e-92    
ref|WP_012018650.1|  short-chain dehydrogenase                          294   2e-92    
ref|WP_037022257.1|  short-chain dehydrogenase                          294   3e-92    
ref|WP_002170466.1|  short-chain dehydrogenase                          294   3e-92    
ref|WP_007409190.1|  MULTISPECIES: short-chain dehydrogenase            294   3e-92    
ref|WP_010810657.1|  MULTISPECIES: short-chain dehydrogenase            294   3e-92    
gb|AIU76499.1|  short-chain dehydrogenase                               294   3e-92    
ref|WP_016836613.1|  hypothetical protein                               294   3e-92    
ref|WP_015615769.1|  dehydrogenase of unknown specificity, short-...    294   3e-92    
ref|WP_020427960.1|  MULTISPECIES: short-chain dehydrogenase            294   3e-92    
ref|WP_011175502.1|  short-chain dehydrogenase                          294   3e-92    
ref|WP_034405367.1|  short-chain dehydrogenase                          295   3e-92    
ref|WP_039011187.1|  short-chain dehydrogenase                          294   4e-92    
ref|WP_017360894.1|  short-chain dehydrogenase                          294   4e-92    
gb|ERI08202.1|  oxidoreductase, short chain dehydrogenase/reducta...    295   4e-92    
ref|WP_025761228.1|  hypothetical protein                               294   4e-92    
ref|WP_039237543.1|  short-chain dehydrogenase                          294   4e-92    
gb|EOQ05052.1|  hypothetical protein KOY_02838                          293   5e-92    
gb|EZP78751.1|  short-chain dehydrogenase/reductase SDR                 294   5e-92    
ref|WP_024028192.1|  short-chain dehydrogenase/reductase sdr            294   5e-92    
ref|WP_036988667.1|  short-chain dehydrogenase                          293   5e-92    
ref|WP_023063907.1|  short chain dehydrogenase family protein           293   5e-92    
ref|WP_041105467.1|  short-chain dehydrogenase                          293   5e-92    
gb|KGX92660.1|  short-chain dehydrogenase                               293   6e-92    
ref|WP_012646298.1|  short-chain dehydrogenase                          293   6e-92    
gb|AIQ12191.1|  short-chain dehydrogenase                               293   7e-92    
ref|WP_033671319.1|  dehydrogenase                                      293   7e-92    
ref|WP_036769516.1|  short-chain dehydrogenase                          294   7e-92    
ref|WP_040036721.1|  short-chain dehydrogenase                          293   8e-92    
ref|WP_025707783.1|  short-chain dehydrogenase                          293   8e-92    
ref|WP_013953926.1|  short-chain dehydrogenase                          293   8e-92    
ref|XP_006378405.1|  hypothetical protein POPTR_0010s10250g             290   9e-92    
ref|WP_039749229.1|  short-chain dehydrogenase                          293   9e-92    
ref|WP_019140396.1|  hypothetical protein                               293   9e-92    
ref|WP_022539629.1|  short-chain dehydrogenase                          293   9e-92    
ref|WP_018315257.1|  short-chain dehydrogenase                          293   9e-92    
ref|WP_014852777.1|  short-chain dehydrogenase                          293   9e-92    
ref|WP_019743335.1|  short-chain dehydrogenase                          293   9e-92    
ref|WP_028412395.1|  MULTISPECIES: short-chain dehydrogenase            293   1e-91    
ref|WP_014663440.1|  short-chain dehydrogenase                          293   1e-91    
ref|WP_018396081.1|  short-chain dehydrogenase                          293   1e-91    
ref|WP_001136288.1|  short-chain dehydrogenase                          293   1e-91    
ref|WP_011531402.1|  short-chain dehydrogenase                          293   1e-91    
gb|KES25820.1|  short-chain dehydrogenase                               293   1e-91    
ref|WP_032120104.1|  dehydrogenase                                      293   1e-91    
ref|WP_028533057.1|  short-chain dehydrogenase                          293   1e-91    
ref|WP_008359049.1|  short-chain dehydrogenase                          293   1e-91    
gb|ERK28311.1|  alcohol dehydrogenase                                   293   1e-91    
ref|WP_019587992.1|  short-chain dehydrogenase                          293   1e-91    
ref|WP_034857182.1|  hypothetical protein                               293   1e-91    
ref|WP_035826078.1|  short-chain dehydrogenase                          292   1e-91    
gb|AJE15300.1|  short-chain dehydrogenase                               292   1e-91    
ref|WP_024535461.1|  short-chain dehydrogenase                          293   2e-91    
ref|WP_011983735.1|  short-chain dehydrogenase                          292   2e-91    
pdb|3I3O|A  Chain A, 2.06 Angstrom Resolution Crystal Structure O...    293   2e-91    
ref|WP_039606879.1|  short-chain dehydrogenase                          292   2e-91    
ref|WP_011732520.1|  short-chain dehydrogenase                          293   2e-91    
ref|WP_028237945.1|  short-chain dehydrogenase                          292   2e-91    
ref|WP_023112425.1|  short-chain dehydrogenase                          292   2e-91    
ref|WP_001136280.1|  MULTISPECIES: short-chain dehydrogenase            292   2e-91    
ref|WP_018766793.1|  MULTISPECIES: dehydrogenase                        292   2e-91    
ref|WP_020465182.1|  oxidoreductase                                     293   2e-91    
ref|WP_026585065.1|  short-chain dehydrogenase                          292   2e-91    
ref|WP_014461619.1|  short-chain dehydrogenase                          292   2e-91    
ref|WP_021657496.1|  oxidoreductase, short chain dehydrogenase/re...    292   2e-91    
ref|WP_027091724.1|  short-chain dehydrogenase                          292   2e-91    
ref|WP_016101768.1|  short chain dehydrogenase                          292   2e-91    
gb|AIQ23017.1|  short-chain dehydrogenase                               292   2e-91    
ref|WP_041099189.1|  short-chain dehydrogenase                          292   2e-91    
ref|WP_011765465.1|  short-chain dehydrogenase                          292   2e-91    
ref|WP_039307699.1|  short-chain dehydrogenase                          292   2e-91    
ref|WP_040950629.1|  short-chain dehydrogenase                          292   2e-91    
ref|WP_024916226.1|  short-chain dehydrogenase                          292   2e-91    
ref|WP_001136276.1|  short-chain dehydrogenase                          292   2e-91    
ref|WP_028356171.1|  short-chain dehydrogenase                          292   2e-91    
ref|WP_039787471.1|  short-chain dehydrogenase                          292   3e-91    
ref|WP_017689483.1|  short-chain dehydrogenase                          292   3e-91    
ref|WP_010333636.1|  short-chain dehydrogenase                          292   3e-91    
ref|WP_017452317.1|  MULTISPECIES: short-chain dehydrogenase            292   3e-91    
ref|WP_009619814.1|  putative short-chain dehydrogenase                 291   3e-91    
ref|WP_010897676.1|  short-chain dehydrogenase                          292   3e-91    
ref|WP_002175059.1|  MULTISPECIES: dehydrogenase                        291   3e-91    
ref|WP_032124020.1|  short-chain dehydrogenase                          291   3e-91    
ref|WP_029045306.1|  short-chain dehydrogenase                          291   3e-91    
ref|WP_014260908.1|  short-chain dehydrogenase                          291   3e-91    
gb|AAT50995.1|  PA2142                                                  291   3e-91    
ref|WP_003203415.1|  dehydrogenase                                      291   3e-91    
ref|WP_036609825.1|  short-chain dehydrogenase                          292   3e-91    
ref|WP_034043736.1|  short-chain dehydrogenase                          291   3e-91    
ref|WP_001136271.1|  short-chain dehydrogenase                          291   3e-91    
ref|WP_034012350.1|  short-chain dehydrogenase                          291   3e-91    
ref|WP_003113640.1|  short-chain dehydrogenase                          291   3e-91    
ref|WP_017676854.1|  short-chain dehydrogenase                          291   3e-91    
ref|WP_023112985.1|  short-chain dehydrogenase                          291   3e-91    
dbj|GAM15766.1|  oxidoreductase, short chain dehydrogenase/reduct...    292   3e-91    
ref|WP_001136267.1|  short-chain dehydrogenase                          291   3e-91    
ref|WP_002087502.1|  MULTISPECIES: short-chain dehydrogenase            291   4e-91    
ref|WP_003224364.1|  short-chain dehydrogenase                          291   4e-91    
ref|WP_023464705.1|  short-chain dehydrogenase                          291   4e-91    
ref|WP_024028476.1|  short-chain dehydrogenase/reductase SDR            291   4e-91    
ref|WP_008276799.1|  short-chain dehydrogenase                          291   4e-91    
ref|WP_003100806.1|  MULTISPECIES: short-chain dehydrogenase            291   4e-91    
ref|XP_005853344.1|  short-chain dehydrogenase reductase sdr            291   4e-91    
ref|WP_031600344.1|  hypothetical protein                               291   4e-91    
ref|WP_034009837.1|  short-chain dehydrogenase                          291   4e-91    
ref|WP_021479616.1|  MULTISPECIES: short-chain dehydrogenase            291   4e-91    
ref|WP_001136287.1|  short-chain dehydrogenase                          291   4e-91    
gb|AIQ57520.1|  short-chain dehydrogenase                               291   4e-91    
ref|WP_021489020.1|  short-chain dehydrogenase                          291   4e-91    
ref|WP_036485899.1|  short-chain dehydrogenase                          291   4e-91    
ref|WP_019120507.1|  hypothetical protein                               291   4e-91    
ref|WP_014479371.1|  hypothetical protein                               291   4e-91    
ref|WP_001136289.1|  short-chain dehydrogenase                          291   5e-91    
ref|WP_038588950.1|  short-chain dehydrogenase                          291   5e-91    
ref|WP_039167533.1|  short-chain dehydrogenase                          291   5e-91    
ref|WP_011300494.1|  short-chain dehydrogenase                          291   5e-91    
ref|WP_036653976.1|  short-chain dehydrogenase                          291   5e-91    
ref|WP_036352953.1|  short-chain dehydrogenase                          291   5e-91    
ref|WP_003442302.1|  hypothetical protein                               291   5e-91    
ref|WP_015483049.1|  oxidoreductase                                     291   5e-91    
ref|WP_016094745.1|  short chain dehydrogenase                          291   5e-91    
ref|WP_001136281.1|  short chain dehydrogenase                          291   5e-91    
ref|WP_004343454.1|  short-chain dehydrogenase                          291   5e-91    
ref|WP_039560275.1|  short-chain dehydrogenase                          291   6e-91    
ref|WP_003245662.1|  MULTISPECIES: short-chain dehydrogenase            291   6e-91    
ref|WP_034336900.1|  short-chain dehydrogenase                          291   6e-91    
gb|EEL83636.1|  Short-chain dehydrogenase/reductase SDR                 291   6e-91    
ref|WP_015842620.1|  short-chain dehydrogenase                          291   6e-91    
emb|CEI20604.1|  putative oxidoreductase yhxC                           291   6e-91    
ref|WP_001136278.1|  short-chain dehydrogenase                          291   6e-91    
ref|WP_003233144.1|  short-chain dehydrogenase                          291   6e-91    
ref|WP_013179236.1|  short-chain dehydrogenase                          291   6e-91    
ref|WP_024712926.1|  short-chain dehydrogenase                          291   6e-91    
ref|WP_012356893.1|  short-chain dehydrogenase                          291   6e-91    
ref|WP_033729805.1|  dehydrogenase                                      291   6e-91    
ref|WP_018705440.1|  hypothetical protein                               291   6e-91    
ref|WP_029514976.1|  short-chain dehydrogenase                          291   6e-91    
ref|WP_034030196.1|  short-chain dehydrogenase                          291   6e-91    
ref|WP_031628920.1|  short-chain dehydrogenase                          291   6e-91    
ref|WP_015171841.1|  short-chain dehydrogenase/reductase SDR            291   6e-91    
gb|EEK63592.1|  Short-chain dehydrogenase/reductase SDR                 291   6e-91    
ref|WP_036669971.1|  short-chain dehydrogenase                          291   6e-91    
ref|WP_003109865.1|  MULTISPECIES: short-chain dehydrogenase            291   7e-91    
ref|WP_016208106.1|  short-chain dehydrogenase/reductase SDR            291   7e-91    
ref|WP_034054946.1|  short-chain dehydrogenase                          291   7e-91    
ref|WP_002134507.1|  short-chain dehydrogenase                          291   7e-91    
ref|WP_001136294.1|  short chain dehydrogenase                          291   7e-91    
gb|EEM00846.1|  Short-chain dehydrogenase/reductase SDR                 291   7e-91    
gb|AIQ40491.1|  short-chain dehydrogenase                               291   8e-91    
gb|EPY13250.1|  short-chain dehydrogenase/reductase SDR                 291   8e-91    
ref|WP_034000201.1|  short-chain dehydrogenase                          291   8e-91    
ref|WP_003239442.1|  general stress protein 39                          290   8e-91    
ref|WP_006095418.1|  MULTISPECIES: dehydrogenase                        290   8e-91    



>ref|XP_009769381.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Nicotiana 
sylvestris]
Length=293

 Score =   485 bits (1249),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 224/275 (81%), Positives = 258/275 (94%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDP P++SS +YKP+NKL+GK+ALVTGGDSGIGRAVC CFALEGATVAFTYVK Q
Sbjct  18    GKEHAMDPTPRHSSQDYKPANKLRGKVALVTGGDSGIGRAVCHCFALEGATVAFTYVKSQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA+ET+G++++AK+ DAKDP+A+  DLGFD+NCKKVVDEVV +YGRIDILVNNAAEQ
Sbjct  78    EEKDAQETLGLLRQAKAADAKDPMAVPTDLGFDDNCKKVVDEVVNSYGRIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YEA+S+EEI+E+RL RV RTNI SYFF+TRHALK+MKEGSSIINTTS+NAYKG+AKLLDY
Sbjct  138   YEATSIEEINEERLERVFRTNIFSYFFVTRHALKHMKEGSSIINTTSVNAYKGNAKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQLV +GIRVNGVAPGPIWTPLIPASFT+EECA+FGK VPM+RA 
Sbjct  198   TATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFTEEECANFGKQVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              PIEVAPSYVFLA+SP+SSYI+GQV+HPNGG IVN
Sbjct  258   QPIEVAPSYVFLASSPESSYITGQVIHPNGGTIVN  292



>ref|XP_004230182.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Solanum 
lycopersicum]
Length=340

 Score =   481 bits (1238),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 237/313 (76%), Positives = 276/313 (88%), Gaps = 3/313 (1%)
 Frame = -1

Query  1246  FLNPIKKGSL---VCVFIKMASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKL  1076
             F N  K+G     V +  +  ++ GQ FPPQ+Q +QPGKEH MDP P YSS +YKP+NKL
Sbjct  28    FTNTTKRGRSYPPVNIIARSMASGGQTFPPQKQQTQPGKEHAMDPTPHYSSQDYKPANKL  87

Query  1075  QGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDP  896
             +GKIALVTGGDSGIGRAVC CFALEGATVAFTYVK QE+KDA++T+ ++ +AK+ DAKDP
Sbjct  88    RGKIALVTGGDSGIGRAVCHCFALEGATVAFTYVKSQEEKDAQDTLKLLMQAKAADAKDP  147

Query  895   IAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNIC  716
             +A+  DLGFD+NCK+VVDEVV +YGRIDILVNNAAEQYEASSVEEI+E+RL RV RTNI 
Sbjct  148   MAVPTDLGFDDNCKRVVDEVVSSYGRIDILVNNAAEQYEASSVEEINEERLERVFRTNIF  207

Query  715   SYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGI  536
             SYFF+TRHALK+MKEGSSIINTTS+NAYKG+AKLLDYTATKGAIVAFTRGLALQLV +GI
Sbjct  208   SYFFVTRHALKHMKEGSSIINTTSVNAYKGNAKLLDYTATKGAIVAFTRGLALQLVERGI  267

Query  535   RVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISG  356
             RVNGVAPGP+WTPLIPASF++EECA+FGK VPM+RAA PIEVAPSYVFLA+ P+SSYI+G
Sbjct  268   RVNGVAPGPVWTPLIPASFSEEECANFGKQVPMKRAAQPIEVAPSYVFLASCPESSYITG  327

Query  355   QVLHPNGGAIVNG  317
             QV+HPNGG IVN 
Sbjct  328   QVIHPNGGTIVNA  340



>ref|XP_006361858.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Solanum 
tuberosum]
Length=341

 Score =   479 bits (1234),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 232/300 (77%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -1

Query  1216  VCVFIKMASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSG  1037
             V + ++  ++ GQ FPPQ+Q++QPGKEH MDP P YSS +YKP+NKL+GKIALVTGGDSG
Sbjct  42    VNIIVRSMASGGQTFPPQKQETQPGKEHAMDPTPHYSSQDYKPANKLRGKIALVTGGDSG  101

Query  1036  IGRAVCQCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENC  857
             IGRAVC CFALEGATVAFTYVK QE+KDA++T+ ++ +AK+ DAKDP+A+  DLGFD+NC
Sbjct  102   IGRAVCHCFALEGATVAFTYVKSQEEKDAQDTLKLLMQAKAADAKDPMAVPTDLGFDDNC  161

Query  856   KKVVDEVVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYM  677
             K+VVDEVV +YGRIDILVNNAAEQYEASSVEEI+E+RL RV RTNI SYFF+TRHALK+M
Sbjct  162   KRVVDEVVNSYGRIDILVNNAAEQYEASSVEEINEERLERVFRTNIFSYFFVTRHALKHM  221

Query  676   KEGSSIINTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTP  497
             KEGSSIINTTS+NAYKG+AKLLDYTATKGAIV+FTRGLALQLV +GIRVNGVAPGP+WTP
Sbjct  222   KEGSSIINTTSVNAYKGNAKLLDYTATKGAIVSFTRGLALQLVERGIRVNGVAPGPVWTP  281

Query  496   LIPASFTKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
             LIPASF++EECA+FGK VPM+RAA PIEVAPSYVFLA+ P+SSYI+GQV+HPNGG IVN 
Sbjct  282   LIPASFSEEECANFGKQVPMKRAAQPIEVAPSYVFLASCPESSYITGQVIHPNGGTIVNA  341



>gb|EPS61688.1| hypothetical protein M569_13104, partial [Genlisea aurea]
Length=296

 Score =   477 bits (1227),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 225/276 (82%), Positives = 255/276 (92%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+M+P P++SS +YKP+NKLQGK+ALVTGGDSGIGRAV  CFALEGATVAFTYVK Q
Sbjct  21    GKEHLMEPSPRHSSDDYKPANKLQGKVALVTGGDSGIGRAVAHCFALEGATVAFTYVKGQ  80

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+ ++K+AKSG+AK+PIAIAADLG+D+NCK+VV EVV +YGRID++VNNAAEQ
Sbjct  81    EDKDASDTLRLLKEAKSGEAKEPIAIAADLGYDDNCKRVVQEVVNSYGRIDVVVNNAAEQ  140

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YEASSVEEIDE RL RV RTNI SYFF+TRHALK+MKEGSSIINTTS+NAYKG+AKLLDY
Sbjct  141   YEASSVEEIDEPRLERVFRTNIFSYFFITRHALKHMKEGSSIINTTSVNAYKGNAKLLDY  200

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVAFTRGLALQL  KGIRVNGVAPGPIWTPLIPASFT+EE ASFGK VPMQRA 
Sbjct  201   TSTKGAIVAFTRGLALQLAGKGIRVNGVAPGPIWTPLIPASFTEEETASFGKQVPMQRAG  260

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPSYVFLA++ DSSYI+GQV+HPNGG IVNG
Sbjct  261   QPIEVAPSYVFLASNVDSSYITGQVIHPNGGTIVNG  296



>ref|XP_009629944.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Nicotiana 
tomentosiformis]
Length=293

 Score =   473 bits (1216),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 220/276 (80%), Positives = 254/276 (92%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDP P +SS +YKP+NKL+ K+ALVTGGDSGIGRAVC CFALEGATVAFTYVK Q
Sbjct  18    GKEHAMDPTPHHSSQDYKPANKLRDKVALVTGGDSGIGRAVCHCFALEGATVAFTYVKSQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA++T+ ++++AK+ DAKDP+A+  DLGFD+NCKKVVDEVV +YGRIDILVNNAAEQ
Sbjct  78    EEKDAQDTLELLRQAKAADAKDPMAVPIDLGFDDNCKKVVDEVVNSYGRIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YEA+SVEEI+E+RL RV RTNI SYFF+TRHA+K+MKEGSSIINTTS+ AYKG+AKLLDY
Sbjct  138   YEATSVEEINEERLERVFRTNIFSYFFVTRHAVKHMKEGSSIINTTSVTAYKGNAKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQLV +GIRVNGVAPGPIWTPLIPASFT+EE A+FGK VPM+RA 
Sbjct  198   TATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFTEEESANFGKQVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPSYVFLA+SP+SSYI+GQV+HPNGG IVNG
Sbjct  258   QPIEVAPSYVFLASSPESSYITGQVIHPNGGTIVNG  293



>ref|XP_009772647.1| PREDICTED: glucose and ribitol dehydrogenase-like [Nicotiana 
sylvestris]
Length=293

 Score =   470 bits (1210),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 218/275 (79%), Positives = 252/275 (92%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+M+P PQ+SS EYKP+NKLQGKIALV GGDSGIGRAVC CFALEGATVAFTYVK Q
Sbjct  18    GKEHVMEPTPQHSSMEYKPANKLQGKIALVAGGDSGIGRAVCHCFALEGATVAFTYVKSQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA++T+ I++KAK+ DA +P+A+A DLGFD+NCKKVVDEVV +YGRIDILVNNAAEQ
Sbjct  78    EEKDAQDTLEILRKAKAADAMEPMAVATDLGFDDNCKKVVDEVVNSYGRIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y+ +SVEEIDE+RL RV RTNI SYFFLTRH+LK+MKEGSSIIN+TS+ AYKG+ KLLDY
Sbjct  138   YKTTSVEEIDEERLERVFRTNIFSYFFLTRHSLKHMKEGSSIINSTSVVAYKGNPKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIV+FTRGLALQLV KGIRVN VAPGP+WTPLIPASF++EE A+FGKDVPM+RA 
Sbjct  198   TATKGAIVSFTRGLALQLVEKGIRVNAVAPGPVWTPLIPASFSEEESANFGKDVPMRRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              PIE APSYVFLA++PDSSYI+GQV+HPNGG IVN
Sbjct  258   QPIEAAPSYVFLASTPDSSYITGQVIHPNGGVIVN  292



>ref|XP_004148135.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cucumis 
sativus]
 ref|XP_004160870.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cucumis 
sativus]
Length=295

 Score =   469 bits (1206),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 223/276 (81%), Positives = 250/276 (91%), Gaps = 1/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GK+H MDP PQ++S +Y P+NKLQGK+ALVTGGDSGIGRAVC CFALEGA VAFTYVK Q
Sbjct  19    GKQHAMDPTPQFTSPDYNPANKLQGKVALVTGGDSGIGRAVCYCFALEGAIVAFTYVKGQ  78

Query  964   EDKDAEETVGIIKKA-KSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAE  788
             EDKDA++T+ +IKKA KS   KDP+AI ADLGFDENCK+VVDEVV+AYGRIDIL+NNAAE
Sbjct  79    EDKDAKDTIEMIKKATKSSAVKDPLAIPADLGFDENCKRVVDEVVKAYGRIDILINNAAE  138

Query  787   QYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLD  608
             QY++SSVE+IDE+RLLRV RTNI SYFF TRHALK+MKEGSSIINTTS+NAYKG+AKLLD
Sbjct  139   QYKSSSVEDIDEERLLRVFRTNIFSYFFTTRHALKHMKEGSSIINTTSVNAYKGNAKLLD  198

Query  607   YTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRA  428
             YT+TKGAIVAFTRGLALQL NKGIRVNGVAPGPIWTPLIPASF +EE ASFG  VPM+RA
Sbjct  199   YTSTKGAIVAFTRGLALQLANKGIRVNGVAPGPIWTPLIPASFDEEETASFGSQVPMKRA  258

Query  427   AHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
               PIEVAPSYVFLA + DSSYI+GQVLHPNGG +VN
Sbjct  259   GQPIEVAPSYVFLACNADSSYITGQVLHPNGGTVVN  294



>ref|XP_010278084.1| PREDICTED: glucose and ribitol dehydrogenase [Nelumbo nucifera]
Length=293

 Score =   467 bits (1201),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 222/276 (80%), Positives = 246/276 (89%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEHIM+P P  +S EYKP+NKL GK+ALVTGGDSGIGRAVC CFA EGATVAFTYVK Q
Sbjct  18    GKEHIMNPTPHAASCEYKPANKLHGKVALVTGGDSGIGRAVCYCFAREGATVAFTYVKGQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA++T+ +I KAK+G+ KDPIAIAADLGFDENCK+VVD VV A+GRIDILVNNAAEQ
Sbjct  78    EDKDAQDTLQMITKAKTGEVKDPIAIAADLGFDENCKRVVDRVVNAFGRIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YEA SVEEIDE RL RV RTNI SYFF+TRH LK+MKEGSSIINTTS+NAYKGHAKLLDY
Sbjct  138   YEAGSVEEIDEQRLERVFRTNIFSYFFMTRHCLKHMKEGSSIINTTSVNAYKGHAKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQLV KGIRVNGVAPGP+WTPLIPASFT+EEC+ FG +VPM RA 
Sbjct  198   TATKGAIVAFTRGLALQLVQKGIRVNGVAPGPVWTPLIPASFTEEECSKFGSEVPMGRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+AP+YVFLA+   SSYI+GQVLHPNGG +VNG
Sbjct  258   QPHEIAPAYVFLASPTCSSYITGQVLHPNGGTVVNG  293



>ref|XP_004495735.1| PREDICTED: glucose and ribitol dehydrogenase-like [Cicer arietinum]
Length=293

 Score =   464 bits (1193),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 221/276 (80%), Positives = 245/276 (89%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ++S +Y PSNKLQGKIA++TGGDSGIGRAVC  F+LEGATVAFTYVK  
Sbjct  18    GKEHVMDPLPQFTSPDYMPSNKLQGKIAVITGGDSGIGRAVCNLFSLEGATVAFTYVKGD  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKD  +T+ IIK  KS DAKDP+A+AADLGFDENCK+VVDEVV AYGRIDILVNNAAEQ
Sbjct  78    EDKDTRDTLEIIKNGKSTDAKDPMAVAADLGFDENCKRVVDEVVNAYGRIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE SSVEEIDE RL RV RTNI SYFF+TRHALK+MKEGSSIINTTS+NAYKG+AKLLDY
Sbjct  138   YECSSVEEIDEPRLERVFRTNIFSYFFMTRHALKHMKEGSSIINTTSVNAYKGNAKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVAFTRGL+LQLV+KGIRVNGVAPGPIWTPLIPASF +EE A FG  VPM RA 
Sbjct  198   TSTKGAIVAFTRGLSLQLVSKGIRVNGVAPGPIWTPLIPASFQEEETAQFGGQVPMNRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPSYVFLA++  SSY +GQVLHPNGG +VNG
Sbjct  258   QPIEVAPSYVFLASNQCSSYFTGQVLHPNGGTVVNG  293



>ref|XP_002319022.2| hypothetical protein POPTR_0013s02480g [Populus trichocarpa]
 gb|EEE94945.2| hypothetical protein POPTR_0013s02480g [Populus trichocarpa]
Length=343

 Score =   466 bits (1198),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 234/298 (79%), Positives = 267/298 (90%), Gaps = 1/298 (0%)
 Frame = -1

Query  1210  VFIKMASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIG  1031
             VF+ MAS  GQ+FPPQ+Q+SQPGKEH+MDP PQY++ +YKPSNKLQGK+A+VTGGDSGIG
Sbjct  47    VFVGMASG-GQKFPPQKQNSQPGKEHVMDPTPQYTNPDYKPSNKLQGKVAVVTGGDSGIG  105

Query  1030  RAVCQCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKK  851
             RAVC+ F +EGATVAFTYVK QEDKDA++T+ ++KK K+ DAKDPIAI  DLGFDENCK+
Sbjct  106   RAVCRSFVIEGATVAFTYVKAQEDKDADDTLQMLKKHKTADAKDPIAIPVDLGFDENCKR  165

Query  850   VVDEVVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKE  671
             VVDEVV AYGRIDILVNNAAEQYE SSVEEIDE RL +V RTNI SYFF+TRHALK+MKE
Sbjct  166   VVDEVVNAYGRIDILVNNAAEQYECSSVEEIDEQRLEKVFRTNIFSYFFMTRHALKHMKE  225

Query  670   GSSIINTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLI  491
             GSSIINTTS+NAY G+++LLDYT+TKGAIVAF RGLALQLV++GIRVNGVAPGPIWTPLI
Sbjct  226   GSSIINTTSVNAYMGNSQLLDYTSTKGAIVAFIRGLALQLVSRGIRVNGVAPGPIWTPLI  285

Query  490   PASFTKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
             PASF +EE A+FGK VPMQRA  P EVAPSYVFLA +  SSYI+GQVLHPNGG IVNG
Sbjct  286   PASFKEEEVANFGKQVPMQRAGQPAEVAPSYVFLACNHCSSYITGQVLHPNGGVIVNG  343



>ref|XP_002512366.1| short chain dehydrogenase, putative [Ricinus communis]
 gb|EEF49818.1| short chain dehydrogenase, putative [Ricinus communis]
Length=293

 Score =   464 bits (1193),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 221/276 (80%), Positives = 252/276 (91%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDP PQY+  +YKPS+KL+GK+ALVTGGDSGIGRAVC  F LEGATVAFTYVK Q
Sbjct  18    GKEHQMDPIPQYARSDYKPSDKLRGKVALVTGGDSGIGRAVCHSFVLEGATVAFTYVKKQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED+DAE+T+ ++KK+K+ DAK+PIAIAADLG+DENCKKV+DEVV A+GRIDILVNNAAEQ
Sbjct  78    EDRDAEDTIQLLKKSKTVDAKEPIAIAADLGYDENCKKVIDEVVNAFGRIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             ++A SV+EIDE+RL RV RTN+ SYFF TRHALK+MKEGSSIINTTSINAYKG+AKLLDY
Sbjct  138   HKAGSVQEIDEERLERVFRTNMFSYFFATRHALKHMKEGSSIINTTSINAYKGNAKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLAL+LVNKGIRVNGVAPGPIWTPLIPASF +EE A+FGK+VPMQRA 
Sbjct  198   TATKGAIVAFTRGLALELVNKGIRVNGVAPGPIWTPLIPASFDEEEVANFGKEVPMQRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+EVAP YVFLA +  SSYI+GQVLHPNGGAI+NG
Sbjct  258   QPVEVAPCYVFLACNHCSSYITGQVLHPNGGAIING  293



>ref|XP_003591094.1| Glucose and ribitol dehydrogenase [Medicago truncatula]
 gb|AES61345.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=293

 Score =   462 bits (1190),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 218/276 (79%), Positives = 248/276 (90%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ++  +YKPSNKLQGK+A++TGGDSGIGRAVC  F+LEGATVAFTYVK  
Sbjct  18    GKEHVMDPLPQFTCPDYKPSNKLQGKVAVITGGDSGIGRAVCNLFSLEGATVAFTYVKGD  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA++T+ +++ AKS DAKDP+A+AADLGFDENCKKVVDE+V AYG IDILVNNAAEQ
Sbjct  78    EDKDAKDTLEMLRNAKSADAKDPMAVAADLGFDENCKKVVDEIVNAYGHIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE SSVEEIDE RL RV RTNI SYFF+TRHALK+MKEGSSIINTTS+NAYKG+AKLLDY
Sbjct  138   YECSSVEEIDESRLERVFRTNIFSYFFMTRHALKHMKEGSSIINTTSVNAYKGNAKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVAFTRGL+LQLV+KGIRVNGVAPGPIWTPLIPASF +EE A FG  VPM+RA 
Sbjct  198   TSTKGAIVAFTRGLSLQLVSKGIRVNGVAPGPIWTPLIPASFKEEETAQFGGQVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPSYVFLA++  SSY +GQVLHPNGG +VNG
Sbjct  258   QPIEVAPSYVFLASNQCSSYFTGQVLHPNGGTVVNG  293



>gb|AFK39537.1| unknown [Lotus japonicus]
Length=293

 Score =   462 bits (1190),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 221/276 (80%), Positives = 244/276 (88%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH ++P PQ++S EYKPSNKLQGKIAL+TGGDSGIGRAVC  FALEGATV FTYV+ Q
Sbjct  18    GKEHALNPAPQFASPEYKPSNKLQGKIALITGGDSGIGRAVCNLFALEGATVIFTYVEGQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+ +IK+AK+ DAKDP+AI AD GFDENCK+VVDE V AYGRIDILVNNAAEQ
Sbjct  78    EDKDARDTIEMIKRAKTADAKDPLAIPADFGFDENCKRVVDEAVNAYGRIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE  SVEEIDE RL RV RTNI SYFFLTRHALK+MKEGSSIINTTS+NAYKGH  LLDY
Sbjct  138   YECGSVEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKGHPTLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGL+LQLV+KGIRVNGVAPGPIWTPLIPASF +EE A FG DVPM+RA 
Sbjct  198   TATKGAIVAFTRGLSLQLVSKGIRVNGVAPGPIWTPLIPASFKEEETAQFGADVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+EVAPSYVFLA +  SSYI+GQVLHPNGG +VNG
Sbjct  258   QPVEVAPSYVFLACNQCSSYITGQVLHPNGGNVVNG  293



>gb|EYU34848.1| hypothetical protein MIMGU_mgv1a011082mg [Erythranthe guttata]
Length=293

 Score =   461 bits (1187),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 220/276 (80%), Positives = 244/276 (88%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GK+H+MDP P  ++ EYKPSNKL GK+ALVTGGDSGIGRAV  CFALEGATVAFTYVK Q
Sbjct  18    GKQHLMDPTPHSTTPEYKPSNKLLGKVALVTGGDSGIGRAVGHCFALEGATVAFTYVKGQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA + +G++ KAK  DAKDP+AI  DLGFDENCK+VVDEVV ++GRIDILVNNAAEQ
Sbjct  78    EDKDANDALGMLMKAKHPDAKDPVAIPTDLGFDENCKRVVDEVVNSFGRIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YEA S+EEID DRL RV RTNI SYFF TRHALK+MKEGSSIINTTS+NAYKG+AKLLDY
Sbjct  138   YEAGSIEEIDSDRLERVFRTNIFSYFFTTRHALKHMKEGSSIINTTSVNAYKGNAKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQLV KGIRVNGVAPGP+WTPLIPASFT++E ASFG  VPM+RA 
Sbjct  198   TATKGAIVAFTRGLALQLVEKGIRVNGVAPGPVWTPLIPASFTEDESASFGAQVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP YVFLA++ DSSYI+GQVLHPNGG IVNG
Sbjct  258   QPTEVAPCYVFLASNVDSSYITGQVLHPNGGTIVNG  293



>ref|XP_008439102.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cucumis 
melo]
Length=349

 Score =   463 bits (1192),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 235/299 (79%), Positives = 264/299 (88%), Gaps = 1/299 (0%)
 Frame = -1

Query  1213  CVFIKMASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGI  1034
             C    MAS   QQFPPQ+Q +QPGKEH MDP PQ++S +Y P+NKLQGK+ALVTGGDSGI
Sbjct  50    CWVRSMASEGQQQFPPQKQQAQPGKEHAMDPTPQFTSPDYNPANKLQGKVALVTGGDSGI  109

Query  1033  GRAVCQCFALEGATVAFTYVKPQEDKDAEETVGIIKKA-KSGDAKDPIAIAADLGFDENC  857
             GRAVC CFALEGATVAFTYVK QEDKDA++T+ +IKKA KS   KDP+AI ADLGFDENC
Sbjct  110   GRAVCYCFALEGATVAFTYVKGQEDKDAKDTIEMIKKATKSSAVKDPLAIPADLGFDENC  169

Query  856   KKVVDEVVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYM  677
             K+VVDEVV+AYGRIDIL+NNAA QY++S VE+IDE+RLLRV RTNI SYFF TRHALK+M
Sbjct  170   KRVVDEVVKAYGRIDILINNAAVQYKSSFVEDIDEERLLRVFRTNIFSYFFTTRHALKHM  229

Query  676   KEGSSIINTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTP  497
             KEGSSIINTTS+NAYKG+AKLLDYT+TKGAIVAFTRGLALQL +KGIRVNGVAPGPIWTP
Sbjct  230   KEGSSIINTTSVNAYKGNAKLLDYTSTKGAIVAFTRGLALQLADKGIRVNGVAPGPIWTP  289

Query  496   LIPASFTKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             LIPASF +EE ASFG  VPM+RA  PIEVAPSYVFLA + DSSYI+GQVLHPNGG +VN
Sbjct  290   LIPASFEEEETASFGSQVPMKRAGQPIEVAPSYVFLACNADSSYITGQVLHPNGGTVVN  348



>ref|XP_009119565.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Brassica 
rapa]
Length=289

 Score =   460 bits (1183),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 215/275 (78%), Positives = 248/275 (90%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ+SS +Y+PSNKL+GK+AL+TGGDSGIGRAV  CFA+EGATVAFTYVK Q
Sbjct  14    GKEHVMDPTPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVSYCFAVEGATVAFTYVKGQ  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA+ET+ ++K+AK+ +AKDPIAI  DLGFDENCK+VVDEVV A+GRID+L+NNAAEQ
Sbjct  74    EEKDAQETLQMLKEAKTSEAKDPIAIPTDLGFDENCKRVVDEVVNAFGRIDVLINNAAEQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE++S+EEIDE RL RV RTNI SYFFLTRHALK+MKEGSSIINTTS+NAYKGHA LLDY
Sbjct  134   YESNSIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKGHASLLDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQL  KGIRVNGVAPGPIWTPLIPASF +E+  +FG +VPM+RA 
Sbjct  194   TATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGTEVPMKRAG  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              PIEVAPSYVFLA +  SSY +GQVLHPNGGA+VN
Sbjct  254   QPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVN  288



>ref|XP_006392477.1| hypothetical protein EUTSA_v10023627mg [Eutrema salsugineum]
 gb|ESQ29763.1| hypothetical protein EUTSA_v10023627mg [Eutrema salsugineum]
Length=289

 Score =   460 bits (1183),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 215/275 (78%), Positives = 248/275 (90%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ+SS +Y+PSNKL+GK+AL+TGGDSGIGRAV  CFALEGATVAFTYVK Q
Sbjct  14    GKEHVMDPTPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVSYCFALEGATVAFTYVKGQ  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA+ET+ ++K+AK+ +AK+P+AI  DLGFDENCK+VVDEVV A+GRID+L+NNAAEQ
Sbjct  74    EDKDAQETLQMLKEAKTSEAKEPMAIPTDLGFDENCKRVVDEVVNAFGRIDVLINNAAEQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE+SS+EEIDE RL RV RTNI SYFFLTRHALK+MKEGSSIINTTS+NAYKG+A LLDY
Sbjct  134   YESSSIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKGNASLLDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGL+LQL  KGIRVNGVAPGPIWTPLIPASF +E+  SFG +VPM+RA 
Sbjct  194   TATKGAIVAFTRGLSLQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKSFGSEVPMKRAG  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              PIEVAPSYVFLA +  SSY +GQVLHPNGGA+VN
Sbjct  254   QPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVN  288



>ref|XP_010025176.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Eucalyptus 
grandis]
 gb|KCW61772.1| hypothetical protein EUGRSUZ_H04480 [Eucalyptus grandis]
Length=293

 Score =   459 bits (1182),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 217/276 (79%), Positives = 248/276 (90%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDP PQ+SS +YKPSNKLQG++ALVTGGDSGIGRAVC CFA EGATVAFTYVK +
Sbjct  18    GKEHAMDPTPQFSSTDYKPSNKLQGRVALVTGGDSGIGRAVCHCFAREGATVAFTYVKGR  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA++ + ++K+AK+ DAKDP+A+AADLGFDENC++VV+EV  AYGRIDILVNNAAEQ
Sbjct  78    EDKDAQDALQMLKQAKAPDAKDPMAVAADLGFDENCRRVVNEVANAYGRIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +E S+VEEIDE RL RV RTNI SYFF  RHALK+MKEG SIINTTS+NAYKG+AKLLDY
Sbjct  138   HECSTVEEIDESRLERVFRTNIFSYFFTVRHALKHMKEGGSIINTTSVNAYKGNAKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVAFTRGLALQLV++GIRVNGVAPGPIWTPLIPASFT+EE  +FGK VPM+RA 
Sbjct  198   TSTKGAIVAFTRGLALQLVDRGIRVNGVAPGPIWTPLIPASFTEEETRNFGKQVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPS+VFLA +  SSYI+GQVLHPNGG IVNG
Sbjct  258   QPIEVAPSFVFLACNHCSSYITGQVLHPNGGTIVNG  293



>ref|NP_001238285.1| seed maturation protein PM34 [Glycine max]
 gb|AAF89645.1|AF169018_1 seed maturation protein PM34 [Glycine max]
Length=293

 Score =   459 bits (1182),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 220/276 (80%), Positives = 246/276 (89%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH M P PQ++S +YKPSNKLQGKIALVTGGDSGIGRAVC  FALEGATVAFTYVK  
Sbjct  18    GKEHAMTPVPQFTSPDYKPSNKLQGKIALVTGGDSGIGRAVCNLFALEGATVAFTYVKGH  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+ +IK+AK+ DAKDP+AIA+DLG+DENCK+VVDEVV AYG IDILVNNAAEQ
Sbjct  78    EDKDARDTLEMIKRAKTSDAKDPMAIASDLGYDENCKRVVDEVVSAYGCIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE  +VE+IDE RL RV RTNI SYFF+ RHALK+MKEGSSIINTTS+NAYKGHAKLLDY
Sbjct  138   YECGTVEDIDEPRLERVFRTNIFSYFFMARHALKHMKEGSSIINTTSVNAYKGHAKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVA+TRGLALQLV+KGIRVNGVAPGPIWTPLIPASF +EE A FG  VPM+RA 
Sbjct  198   TSTKGAIVAYTRGLALQLVSKGIRVNGVAPGPIWTPLIPASFKEEETAQFGAQVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPSYVFLA++  SSYI+GQVLHPNGG +VNG
Sbjct  258   QPIEVAPSYVFLASNQCSSYITGQVLHPNGGTVVNG  293



>ref|NP_001291332.1| glucose and ribitol dehydrogenase homolog 1-like precursor [Sesamum 
indicum]
 gb|ACB55491.1| seed maturation-like protein precursor [Sesamum indicum]
Length=345

 Score =   461 bits (1186),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 221/276 (80%), Positives = 245/276 (89%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEHIMDP PQ ++ EYKP+NKL GK+ALVTGGDSGIGRAV  CFALEGATVAFTYVK Q
Sbjct  70    GKEHIMDPTPQATTPEYKPANKLVGKVALVTGGDSGIGRAVGHCFALEGATVAFTYVKGQ  129

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+G++ KAK  DAKDPIAI  DLG+DENC++VV+EVV  YGRIDILVNNAAEQ
Sbjct  130   EDKDANDTLGMLMKAKHADAKDPIAIPTDLGYDENCRRVVEEVVNNYGRIDILVNNAAEQ  189

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YEAS+VEEIDE RL RV RTNI SYFF +RHALK+MKEGSSIINTTS+NAYKG+AKLLDY
Sbjct  190   YEASTVEEIDEPRLERVFRTNIFSYFFTSRHALKHMKEGSSIINTTSVNAYKGNAKLLDY  249

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQ+V KGIRVNGVAPGPIWTPLIPASFT++E A FG   PM+RA 
Sbjct  250   TATKGAIVAFTRGLALQMVEKGIRVNGVAPGPIWTPLIPASFTEDENAKFGSQTPMKRAG  309

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFLA++ DSSYI+GQVLHPNGG IVNG
Sbjct  310   QPHEVAPSYVFLASNIDSSYITGQVLHPNGGTIVNG  345



>ref|XP_006433300.1| hypothetical protein CICLE_v10002055mg [Citrus clementina]
 ref|XP_006471972.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Citrus 
sinensis]
 gb|ESR46540.1| hypothetical protein CICLE_v10002055mg [Citrus clementina]
Length=291

 Score =   459 bits (1181),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 229/294 (78%), Positives = 260/294 (88%), Gaps = 3/294 (1%)
 Frame = -1

Query  1198  MASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVC  1019
             MASNN    PPQ+QD+QPGKEH+M+P PQ++S +Y PSNKL+G +ALVTGGDSGIGRAVC
Sbjct  1     MASNN---QPPQKQDTQPGKEHVMNPIPQFTSPDYTPSNKLRGMVALVTGGDSGIGRAVC  57

Query  1018  QCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDE  839
              CFA EGATVAFTYVKPQEDKDA+ET+ +++KAK+ DAKDP+AI+ADLGFDENCK+VVDE
Sbjct  58    HCFAQEGATVAFTYVKPQEDKDAKETLEMLRKAKTPDAKDPMAISADLGFDENCKRVVDE  117

Query  838   VVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSI  659
             VV AYG+IDILVNNAAEQYE  SVE+IDE RL RV RTNI SYFF+ RHALK+MK GSSI
Sbjct  118   VVNAYGKIDILVNNAAEQYECGSVEDIDESRLERVFRTNIFSYFFMARHALKHMKAGSSI  177

Query  658   INTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASF  479
             INTTS+NAYKG+AKLLDYT+TKGAIVAFTRGLALQ V +GIRVNGVAPGPIWTPLIPASF
Sbjct  178   INTTSVNAYKGNAKLLDYTSTKGAIVAFTRGLALQQVERGIRVNGVAPGPIWTPLIPASF  237

Query  478   TKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
             T+EE A FG  VPM+RA  PIEVAP +VFLA +  SSYI+GQVLHPNGG IVNG
Sbjct  238   TEEETAQFGNQVPMKRAGQPIEVAPCFVFLACNHCSSYITGQVLHPNGGTIVNG  291



>gb|KDP23528.1| hypothetical protein JCGZ_23361 [Jatropha curcas]
Length=293

 Score =   459 bits (1180),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 221/276 (80%), Positives = 247/276 (89%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP P Y+  + KPS+KL+GK+ALVTGGDSGIGRAVC  FALEGATVAFTYV+ Q
Sbjct  18    GKEHVMDPIPHYAMSDSKPSDKLRGKVALVTGGDSGIGRAVCYSFALEGATVAFTYVRKQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA++T+ I+KK K+ DAK+PIAIAADLGFD+NCKKVVDEVV AYGRIDILVNNAAEQ
Sbjct  78    EDKDAQDTIEILKKNKTPDAKEPIAIAADLGFDDNCKKVVDEVVNAYGRIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y++SSVEEIDE+RL RV RTNI SYFF TRH LK+MKEGSSIINTTS+NAYKG+ KLLDY
Sbjct  138   YKSSSVEEIDEERLERVFRTNIFSYFFTTRHCLKHMKEGSSIINTTSVNAYKGNKKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQLV KGIRVNGVAPGPIWTPLIP+SF++EE A+FGK  PMQRA 
Sbjct  198   TATKGAIVAFTRGLALQLVKKGIRVNGVAPGPIWTPLIPSSFSEEEVANFGKQTPMQRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFLA +  SSYI+GQVLHPNGG IVNG
Sbjct  258   QPSEVAPSYVFLACNHCSSYITGQVLHPNGGVIVNG  293



>emb|CDY43488.1| BnaA01g21430D [Brassica napus]
Length=289

 Score =   459 bits (1180),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 214/275 (78%), Positives = 247/275 (90%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ+SS +Y+PSNKL+GK+AL+TGGDSGIGRAV  CFA+EGATVAFTYVK Q
Sbjct  14    GKEHVMDPTPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVSYCFAVEGATVAFTYVKGQ  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KD +ET+ ++K+AK+ +AKDPIAI  DLGFDENCK+VVDEVV A+GRID+L+NNAAEQ
Sbjct  74    EEKDTQETLQMLKEAKTSEAKDPIAIPTDLGFDENCKRVVDEVVNAFGRIDVLINNAAEQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE++S+EEIDE RL RV RTNI SYFFLTRHALK+MKEGSSIINTTS+NAYKGHA LLDY
Sbjct  134   YESNSIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKGHASLLDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQL  KGIRVNGVAPGPIWTPLIPASF +E+  +FG +VPM+RA 
Sbjct  194   TATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGTEVPMKRAG  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              PIEVAPSYVFLA +  SSY +GQVLHPNGGA+VN
Sbjct  254   QPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVN  288



>gb|KFK35607.1| hypothetical protein AALP_AA4G013100 [Arabis alpina]
Length=288

 Score =   458 bits (1179),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 218/275 (79%), Positives = 247/275 (90%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ+SS +YKPS+KL+GK+AL+TGGDSGIGRAV  CFALEGATVAFTYVK Q
Sbjct  13    GKEHVMDPTPQFSSPDYKPSDKLRGKVALITGGDSGIGRAVGYCFALEGATVAFTYVKGQ  72

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA+ET+ ++K+AK  +AKDPIAI  DLGFDENCK+VVDEVV A+GRID+L+NNAAEQ
Sbjct  73    EEKDAQETLQMLKEAKVSEAKDPIAIPTDLGFDENCKRVVDEVVNAFGRIDVLINNAAEQ  132

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE+SSVEEIDE RL RV RTNI SYFFLTRHALK+MKEGSSIINTTS+NAYKG+A LLDY
Sbjct  133   YESSSVEEIDESRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKGNASLLDY  192

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQL  KGIRVNGVAPGPIWTPLIPASF +E+  +FG +VPM+RA 
Sbjct  193   TATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGSEVPMKRAG  252

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              PIEVAPSYVFLA +  SSY +GQVLHPNGGAIVN
Sbjct  253   QPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAIVN  287



>gb|KGN57282.1| hypothetical protein Csa_3G176290 [Cucumis sativus]
Length=310

 Score =   459 bits (1180),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 223/291 (77%), Positives = 250/291 (86%), Gaps = 16/291 (5%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQ---------------GKIALVTGGDSGIGRAVCQCF  1010
             GK+H MDP PQ++S +Y P+NKLQ               GK+ALVTGGDSGIGRAVC CF
Sbjct  19    GKQHAMDPTPQFTSPDYNPANKLQALNFSFLSYLYFFFLGKVALVTGGDSGIGRAVCYCF  78

Query  1009  ALEGATVAFTYVKPQEDKDAEETVGIIKKA-KSGDAKDPIAIAADLGFDENCKKVVDEVV  833
             ALEGA VAFTYVK QEDKDA++T+ +IKKA KS   KDP+AI ADLGFDENCK+VVDEVV
Sbjct  79    ALEGAIVAFTYVKGQEDKDAKDTIEMIKKATKSSAVKDPLAIPADLGFDENCKRVVDEVV  138

Query  832   RAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIIN  653
             +AYGRIDIL+NNAAEQY++SSVE+IDE+RLLRV RTNI SYFF TRHALK+MKEGSSIIN
Sbjct  139   KAYGRIDILINNAAEQYKSSSVEDIDEERLLRVFRTNIFSYFFTTRHALKHMKEGSSIIN  198

Query  652   TTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTK  473
             TTS+NAYKG+AKLLDYT+TKGAIVAFTRGLALQL NKGIRVNGVAPGPIWTPLIPASF +
Sbjct  199   TTSVNAYKGNAKLLDYTSTKGAIVAFTRGLALQLANKGIRVNGVAPGPIWTPLIPASFDE  258

Query  472   EECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             EE ASFG  VPM+RA  PIEVAPSYVFLA + DSSYI+GQVLHPNGG +VN
Sbjct  259   EETASFGSQVPMKRAGQPIEVAPSYVFLACNADSSYITGQVLHPNGGTVVN  309



>gb|KHN20212.1| Glucose and ribitol dehydrogenase [Glycine soja]
Length=293

 Score =   458 bits (1178),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 220/276 (80%), Positives = 245/276 (89%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH M P PQ++S +YKPSNKLQGKIALVTGGDSGIGRAVC  FALEGATVAFTYVK  
Sbjct  18    GKEHAMTPVPQFTSPDYKPSNKLQGKIALVTGGDSGIGRAVCNLFALEGATVAFTYVKGH  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+ +IK+AK+ DAKDP+AIA+DLG+DENCK+VVDEVV AYG IDILVNNAAEQ
Sbjct  78    EDKDARDTLEMIKRAKTSDAKDPMAIASDLGYDENCKRVVDEVVSAYGCIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE  +VE+IDE RL RV RTNI SYFF  RHALK+MKEGSSIINTTS+NAYKGHAKLLDY
Sbjct  138   YECGTVEDIDEPRLERVFRTNIFSYFFTARHALKHMKEGSSIINTTSVNAYKGHAKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVA+TRGLALQLV+KGIRVNGVAPGPIWTPLIPASF +EE A FG  VPM+RA 
Sbjct  198   TSTKGAIVAYTRGLALQLVSKGIRVNGVAPGPIWTPLIPASFKEEETAQFGAQVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPSYVFLA++  SSYI+GQVLHPNGG +VNG
Sbjct  258   QPIEVAPSYVFLASNQCSSYITGQVLHPNGGTVVNG  293



>ref|XP_010511227.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Camelina 
sativa]
 ref|XP_010414929.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Camelina 
sativa]
Length=337

 Score =   459 bits (1181),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 215/276 (78%), Positives = 247/276 (89%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+M+  PQ+SS +Y+PSNKL+GK+AL+TGGDSGIGRAV  CFALEGATVAFTYVK Q
Sbjct  62    GKEHVMETTPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVGYCFALEGATVAFTYVKGQ  121

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA+ET+ ++KKAK+ DAK+PIAI  DLGFDENCK+VVDEVV A+GRID+L+NNAAEQ
Sbjct  122   EEKDAQETLQMLKKAKTSDAKEPIAIPTDLGFDENCKRVVDEVVNAFGRIDVLINNAAEQ  181

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE+SS+EEIDE RL RV RTNI SYFFLTRHALKYMKEGSSIINTTS+NAYKG+A LLDY
Sbjct  182   YESSSIEEIDEPRLERVFRTNIFSYFFLTRHALKYMKEGSSIINTTSVNAYKGNASLLDY  241

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQL  KGIRVNGVAPGPIWTPLIPASF +E+  +FG +VPM+RA 
Sbjct  242   TATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGSEVPMKRAG  301

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+EVAPSYVFLA +  SSY +GQVLHPNGGA+VN 
Sbjct  302   QPVEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVNA  337



>ref|XP_010528871.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 isoform 
X2 [Tarenaya hassleriana]
Length=335

 Score =   458 bits (1179),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 214/275 (78%), Positives = 248/275 (90%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP P+++S +YKPSNK +GK+AL+ GGDSGIGRAVC CFALEGATVAFTYVK Q
Sbjct  60    GKEHVMDPIPKFASSDYKPSNKFRGKVALIAGGDSGIGRAVCHCFALEGATVAFTYVKGQ  119

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA++T+ ++K+AK+ +AKDPI+IA DLGFDENCK+VVDEVV AYGRID+L+NNAAEQ
Sbjct  120   EEKDAQDTLQMLKEAKTDEAKDPISIATDLGFDENCKRVVDEVVNAYGRIDVLINNAAEQ  179

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE+S++EEIDE RL RV RTNI SYFFLTRHALK+MKEGSSIINTTS+NAYKG+A LLDY
Sbjct  180   YESSTIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKGNASLLDY  239

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQL  KGIRVNGVAPGPIWTPLIPASF +E+   FG++VPM+RA 
Sbjct  240   TATKGAIVAFTRGLALQLAQKGIRVNGVAPGPIWTPLIPASFHEEKTQKFGEEVPMKRAG  299

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              PIEVAPSYVFLA +  SSY +GQVLHPNGGAIVN
Sbjct  300   QPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAIVN  334



>gb|AFK45385.1| unknown [Lotus japonicus]
Length=293

 Score =   456 bits (1172),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 218/275 (79%), Positives = 246/275 (89%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ+++ +YKPSNKLQGKIA++TGGDSGIGRAVC  FALEGATVAFTYVK  
Sbjct  18    GKEHVMDPVPQFTNPDYKPSNKLQGKIAVITGGDSGIGRAVCNLFALEGATVAFTYVKGS  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+ +IKKAK+  AKDP+AI ADLGFDENCKKVVDEVV+AYG+IDIL+NNAAEQ
Sbjct  78    EDKDARDTLEMIKKAKTAGAKDPLAIPADLGFDENCKKVVDEVVKAYGQIDILINNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE +SVEEIDE RL RV RTNI SYFF+TRHALK+MKEGSSIINTTS+NAYKG+AKLLDY
Sbjct  138   YECASVEEIDEKRLERVFRTNIFSYFFMTRHALKHMKEGSSIINTTSVNAYKGNAKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVAFTRGL+LQLV+KGIRVNGVAPGPIWTPLIPASF +EE + FG  VPM+RA 
Sbjct  198   TSTKGAIVAFTRGLSLQLVSKGIRVNGVAPGPIWTPLIPASFKEEETSQFGGQVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              PIEVAPSYVFLA +    YISGQVLHPNGG +VN
Sbjct  258   QPIEVAPSYVFLACNACFFYISGQVLHPNGGNVVN  292



>emb|CDP20122.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   455 bits (1171),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 215/275 (78%), Positives = 246/275 (89%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GK+H+MDP P+ + HEYKPSNKLQGKIALVTGGDSGIGRAV  CFALEGATVAFTYVK  
Sbjct  18    GKQHVMDPTPKATCHEYKPSNKLQGKIALVTGGDSGIGRAVSHCFALEGATVAFTYVKGS  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+G++ KAK+ DAKDP+A+ ADLG+DENCK+VVDEVV  YGRIDILVNNAAEQ
Sbjct  78    EDKDATDTLGMLMKAKAPDAKDPMALPADLGYDENCKRVVDEVVNNYGRIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y+A++VEEIDE+RL RV RTNI +YFF+TRHALK+MKEGS+IIN+TSINAYKG+AKLLDY
Sbjct  138   YKAAAVEEIDEERLERVFRTNIFAYFFMTRHALKHMKEGSAIINSTSINAYKGNAKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVAFTRGLALQL+++GIRVNGVAPGPIWTPLIPASF+ EE   FG +VPM R  
Sbjct  198   TSTKGAIVAFTRGLALQLISRGIRVNGVAPGPIWTPLIPASFSDEEVQKFGSEVPMHRPG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              PIEVAPSYVFLA +  SSYI+GQVLHPNGG IVN
Sbjct  258   QPIEVAPSYVFLACNECSSYITGQVLHPNGGTIVN  292



>emb|CDY17559.1| BnaC01g26830D [Brassica napus]
Length=287

 Score =   454 bits (1169),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 213/273 (78%), Positives = 245/273 (90%), Gaps = 0/273 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ+SS +Y+PSNKL+GK+AL+TGGDSGIGRAV  CFALEGATVAFTYVK Q
Sbjct  14    GKEHVMDPTPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVSYCFALEGATVAFTYVKGQ  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA+ET+ ++K+AK+ +AKDPIAI  DLGFDENCK+VVDEVV A+GRID+L+NNAAEQ
Sbjct  74    EEKDAQETLQMLKEAKTSEAKDPIAIPTDLGFDENCKRVVDEVVNAFGRIDVLINNAAEQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE++S+EEIDE RL RV RTNI SYFFLTRHALK+MKEGSSIINTTS+NAYKGHA LLDY
Sbjct  134   YESNSIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKGHASLLDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQL  KGIRVNGVAPGPIWTPLIPASF +E+  +FG +VPM+RA 
Sbjct  194   TATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGTEVPMKRAG  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAI  326
              PIEVAPSYVFLA +  SSY +GQVLHPNG +I
Sbjct  254   QPIEVAPSYVFLACNHCSSYFTGQVLHPNGNSI  286



>gb|ACU18973.1| unknown [Glycine max]
Length=293

 Score =   455 bits (1170),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 218/276 (79%), Positives = 244/276 (88%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH M P PQ++S +YKPSNKLQGKIALVTGGDSGIGRAVC  FALEGATVAFTYVK  
Sbjct  18    GKEHAMTPVPQFTSPDYKPSNKLQGKIALVTGGDSGIGRAVCNLFALEGATVAFTYVKGH  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+ +IK+AK+ DAKDP+AIA+DLG+DENCK+VVDEVV AYG IDILVNNAAEQ
Sbjct  78    EDKDARDTLEMIKRAKTSDAKDPMAIASDLGYDENCKRVVDEVVSAYGCIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE  +V +IDE RL RV RTNI SYFF+ RHALK+MKEGSSIINTTS+NAYKGHAKLLDY
Sbjct  138   YECGTVGDIDEPRLERVFRTNIFSYFFMARHALKHMKEGSSIINTTSVNAYKGHAKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVA+TRG ALQLV+KGIRVNGVAPGPIWTPLIPASF +EE A FG  VPM+RA 
Sbjct  198   TSTKGAIVAYTRGFALQLVSKGIRVNGVAPGPIWTPLIPASFKEEETAQFGAQVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPSYVFLA++  SSYI+GQVLHPNGG +VNG
Sbjct  258   QPIEVAPSYVFLASNQCSSYITGQVLHPNGGTVVNG  293



>ref|XP_010674766.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Beta 
vulgaris subsp. vulgaris]
Length=356

 Score =   456 bits (1174),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 227/295 (77%), Positives = 256/295 (87%), Gaps = 1/295 (0%)
 Frame = -1

Query  1204  IKMASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRA  1025
             I+MAS  G +FP Q+Q +QPGKEH MDP PQ    +Y+P+NKLQGK+ALVTGGDSGIGRA
Sbjct  62    IRMASG-GDKFPAQRQQAQPGKEHAMDPIPQALRQDYRPANKLQGKVALVTGGDSGIGRA  120

Query  1024  VCQCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVV  845
             VCQCFALEGATVAFTYVK QEDKDA +T+ +IK  KS DAKDPIAI ADLG+DENCK+V+
Sbjct  121   VCQCFALEGATVAFTYVKGQEDKDAHDTLQMIKSNKSSDAKDPIAIPADLGYDENCKRVI  180

Query  844   DEVVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGS  665
             DEV  A+GRIDILVNN AEQYE ++VEEIDE RL RV RTNI SYFF+TRHALK+M+EG+
Sbjct  181   DEVANAFGRIDILVNNCAEQYECTTVEEIDEPRLDRVFRTNIYSYFFMTRHALKHMREGA  240

Query  664   SIINTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPA  485
             SIINTTS+NAYKG+AKLLDYT+TKGAIVAFTRGLALQLV KGIRVNGVAPGPIWTPLIPA
Sbjct  241   SIINTTSVNAYKGNAKLLDYTSTKGAIVAFTRGLALQLVQKGIRVNGVAPGPIWTPLIPA  300

Query  484   SFTKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             SF ++E  SFG  VPM RA  P EVAPS+VFLA + DSSYI+GQVLHPNGG IVN
Sbjct  301   SFKEDEVKSFGGQVPMNRAGQPSEVAPSFVFLACNADSSYITGQVLHPNGGTIVN  355



>gb|KHN16133.1| Glucose and ribitol dehydrogenase like 1 [Glycine soja]
Length=293

 Score =   454 bits (1167),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 217/276 (79%), Positives = 245/276 (89%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH M+P PQ++S +YKPSNKLQGKIALVTGGDSGIGRAVC  FALEGATV FTYVK  
Sbjct  18    GKEHAMNPVPQFTSPDYKPSNKLQGKIALVTGGDSGIGRAVCNLFALEGATVGFTYVKGH  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+ +IK+AK+ DAKDP+A+ ADLG+DENCK+VVDEVV AYG IDILVNNAAEQ
Sbjct  78    EDKDARDTLEMIKRAKTSDAKDPMAVPADLGYDENCKRVVDEVVNAYGCIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE  +VE+IDE RL RV RTNI SYFF+TRHALK+MKEGSSIINTTS+NAYKG+AKLLDY
Sbjct  138   YECGTVEDIDEPRLERVFRTNIFSYFFMTRHALKHMKEGSSIINTTSVNAYKGNAKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVA+TRGLALQLV+KGIRVNGVAPGPIWTPLIP+SF +EE A FG  VPM+RA 
Sbjct  198   TSTKGAIVAYTRGLALQLVSKGIRVNGVAPGPIWTPLIPSSFKEEETAQFGAQVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPSYVFLA +  SSYI+GQVLHPNGG +VNG
Sbjct  258   QPIEVAPSYVFLACNQCSSYITGQVLHPNGGTVVNG  293



>ref|XP_010528870.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 isoform 
X1 [Tarenaya hassleriana]
Length=349

 Score =   456 bits (1172),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 214/275 (78%), Positives = 248/275 (90%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP P+++S +YKPSNK +GK+AL+ GGDSGIGRAVC CFALEGATVAFTYVK Q
Sbjct  74    GKEHVMDPIPKFASSDYKPSNKFRGKVALIAGGDSGIGRAVCHCFALEGATVAFTYVKGQ  133

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA++T+ ++K+AK+ +AKDPI+IA DLGFDENCK+VVDEVV AYGRID+L+NNAAEQ
Sbjct  134   EEKDAQDTLQMLKEAKTDEAKDPISIATDLGFDENCKRVVDEVVNAYGRIDVLINNAAEQ  193

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE+S++EEIDE RL RV RTNI SYFFLTRHALK+MKEGSSIINTTS+NAYKG+A LLDY
Sbjct  194   YESSTIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKGNASLLDY  253

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQL  KGIRVNGVAPGPIWTPLIPASF +E+   FG++VPM+RA 
Sbjct  254   TATKGAIVAFTRGLALQLAQKGIRVNGVAPGPIWTPLIPASFHEEKTQKFGEEVPMKRAG  313

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              PIEVAPSYVFLA +  SSY +GQVLHPNGGAIVN
Sbjct  314   QPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAIVN  348



>ref|NP_001242815.1| uncharacterized protein LOC100807147 [Glycine max]
 gb|ACU18271.1| unknown [Glycine max]
Length=293

 Score =   453 bits (1166),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 217/276 (79%), Positives = 245/276 (89%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH M+P PQ++S +YKPSNKLQGKIALVTGGDSGIGRAVC  FALEGATV FTYVK  
Sbjct  18    GKEHAMNPVPQFASPDYKPSNKLQGKIALVTGGDSGIGRAVCNLFALEGATVGFTYVKGH  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+ +IK+AK+ DAKDP+A+ ADLG+DENCK+VVDEVV AYG IDILVNNAAEQ
Sbjct  78    EDKDARDTLEMIKRAKTSDAKDPMAVPADLGYDENCKRVVDEVVNAYGCIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE  +VE+IDE RL RV RTNI SYFF+TRHALK+MKEGSSIINTTS+NAYKG+AKLLDY
Sbjct  138   YECGTVEDIDEPRLERVFRTNIFSYFFMTRHALKHMKEGSSIINTTSVNAYKGNAKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVA+TRGLALQLV+KGIRVNGVAPGPIWTPLIP+SF +EE A FG  VPM+RA 
Sbjct  198   TSTKGAIVAYTRGLALQLVSKGIRVNGVAPGPIWTPLIPSSFKEEETAQFGAQVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPSYVFLA +  SSYI+GQVLHPNGG +VNG
Sbjct  258   QPIEVAPSYVFLACNQCSSYITGQVLHPNGGTVVNG  293



>ref|XP_006301375.1| hypothetical protein CARUB_v10021787mg [Capsella rubella]
 gb|EOA34273.1| hypothetical protein CARUB_v10021787mg [Capsella rubella]
Length=336

 Score =   455 bits (1170),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 213/276 (77%), Positives = 247/276 (89%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+M+  PQ+SS +Y+PSNKL+GK+AL+TGGDSGIGRAV  C+ALEGATVAFTYVK Q
Sbjct  61    GKEHVMETTPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVGYCYALEGATVAFTYVKGQ  120

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA+ET+ ++KKAK+ DAK+PIAI  DLGFDENCK+VVDEVV A+GRID+L+NNAAEQ
Sbjct  121   EEKDAQETLQMLKKAKTSDAKEPIAIPTDLGFDENCKRVVDEVVNAFGRIDVLINNAAEQ  180

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE+S++EEIDE RL RV RTNI SYFFLTRHALK+MKEGSSIINTTS+NAYKG+A LLDY
Sbjct  181   YESSTIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKGNASLLDY  240

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQL  KGIRVNGVAPGPIWTPLIPASF +E+  +FG +VPM+RA 
Sbjct  241   TATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGSEVPMKRAG  300

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPSYVFLA +  SSY +GQVLHPNGGA+VN 
Sbjct  301   QPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVNA  336



>ref|XP_010480201.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Camelina 
sativa]
Length=337

 Score =   455 bits (1170),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 213/276 (77%), Positives = 247/276 (89%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+M+  PQ+SS +Y+PSNKL+GK+AL+TGGDSGIGRAV  CFALEGATVAFTYVK Q
Sbjct  62    GKEHVMETTPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVGYCFALEGATVAFTYVKGQ  121

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA+ET+ ++KKAK+ DAK+PIAI  DLGFDENCK+VVDEVV A+GRID+L+NNAAEQ
Sbjct  122   EEKDAQETLQMLKKAKTSDAKEPIAIPTDLGFDENCKRVVDEVVNAFGRIDVLINNAAEQ  181

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE+SS+EEIDE RL RV RTNI SYFFLTR+ALK+MKEGSSIINTTS+NAYKG+A LLDY
Sbjct  182   YESSSIEEIDEPRLERVFRTNIFSYFFLTRYALKHMKEGSSIINTTSVNAYKGNASLLDY  241

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQL  KGIRVNGVAPGPIWTPLIPASF +E+  +FG +VPM+RA 
Sbjct  242   TATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGSEVPMKRAG  301

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+EVAPSYVFLA +  SSY +GQVLHPNGGA+VN 
Sbjct  302   QPVEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVNA  337



>emb|CAN77025.1| hypothetical protein VITISV_015336 [Vitis vinifera]
Length=294

 Score =   451 bits (1159),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 225/293 (77%), Positives = 260/293 (89%), Gaps = 0/293 (0%)
 Frame = -1

Query  1198  MASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVC  1019
             MAS  GQQFPPQ+Q+ QPGKEH+M P PQ+ + +Y+P++KLQGK+ALVTGGDSGIGRAVC
Sbjct  1     MASGGGQQFPPQRQERQPGKEHVMTPTPQFINPDYRPAHKLQGKVALVTGGDSGIGRAVC  60

Query  1018  QCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDE  839
               +ALEGATVAFTYVK QED+DA+ET+ +I+KAK  DAK+PIAIAADLG+D+NC++VV+E
Sbjct  61    YLYALEGATVAFTYVKAQEDRDAQETLQMIRKAKRDDAKEPIAIAADLGYDDNCRRVVEE  120

Query  838   VVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSI  659
             VV AYGRIDILVNNAAEQY++ SVEEIDE+RL RV RTNI SYF LTRHALKYM+EGSSI
Sbjct  121   VVAAYGRIDILVNNAAEQYKSCSVEEIDEERLERVFRTNIFSYFLLTRHALKYMQEGSSI  180

Query  658   INTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASF  479
             INTTSINAYKG+ KL++YT+TKGAIVAF R LALQL  KGIRVNGVAPGPIWTPLIPASF
Sbjct  181   INTTSINAYKGNNKLIEYTSTKGAIVAFIRSLALQLAPKGIRVNGVAPGPIWTPLIPASF  240

Query  478   TKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             ++EECA FG +VPM RA  P EVAPSYVFLA+  DSSYISGQVLHPNGG +VN
Sbjct  241   SEEECARFGSEVPMGRAGQPCEVAPSYVFLASHADSSYISGQVLHPNGGVVVN  293



>ref|XP_002284803.3| PREDICTED: glucose and ribitol dehydrogenase-like [Vitis vinifera]
Length=294

 Score =   450 bits (1158),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 225/293 (77%), Positives = 260/293 (89%), Gaps = 0/293 (0%)
 Frame = -1

Query  1198  MASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVC  1019
             MAS  GQQFPPQ+Q+ QPGKEH+M P PQ+ + +Y+P++KLQGK+ALVTGGDSGIGRAVC
Sbjct  1     MASGGGQQFPPQRQERQPGKEHVMTPTPQFINPDYRPAHKLQGKVALVTGGDSGIGRAVC  60

Query  1018  QCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDE  839
               +ALEGATVAFTYVK QED+DA+ET+ +I+KAK  DAK+PIAIAADLG+D+NC++VV+E
Sbjct  61    YLYALEGATVAFTYVKVQEDRDAQETLQMIRKAKRDDAKEPIAIAADLGYDDNCRRVVEE  120

Query  838   VVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSI  659
             VV AYGRIDILVNNAAEQY++ SVEEIDE+RL RV RTNI SYF LTRHALKYM+EGSSI
Sbjct  121   VVAAYGRIDILVNNAAEQYKSCSVEEIDEERLERVFRTNIFSYFLLTRHALKYMQEGSSI  180

Query  658   INTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASF  479
             INTTSINAYKG+ KL++YT+TKGAIVAF R LALQL  KGIRVNGVAPGPIWTPLIPASF
Sbjct  181   INTTSINAYKGNNKLIEYTSTKGAIVAFIRSLALQLAPKGIRVNGVAPGPIWTPLIPASF  240

Query  478   TKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             ++EECA FG +VPM RA  P EVAPSYVFLA+  DSSYISGQVLHPNGG +VN
Sbjct  241   SEEECARFGSEVPMGRAGQPCEVAPSYVFLASHADSSYISGQVLHPNGGVVVN  293



>sp|Q9FZ42.1|GRDH1_ARATH RecName: Full=Glucose and ribitol dehydrogenase homolog 1 [Arabidopsis 
thaliana]
 gb|AAG00870.1|AC064840_1 Highly similar to dehydrogenase/reductases [Arabidopsis thaliana]
 gb|AAK50071.1|AF372931_1 At1g54870/F14C21_16 [Arabidopsis thaliana]
 gb|AAM70561.1| At1g54870/F14C21_16 [Arabidopsis thaliana]
Length=288

 Score =   449 bits (1155),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 210/275 (76%), Positives = 245/275 (89%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+M+  PQ+SS +Y+PSNKL+GK+AL+TGGDSGIGRAV  CFA EGATVAFTYVK Q
Sbjct  13    GKEHVMESSPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVGYCFASEGATVAFTYVKGQ  72

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA+ET+ ++K+ K+ D+K+PIAI  DLGFDENCK+VVDEVV A+GRID+L+NNAAEQ
Sbjct  73    EEKDAQETLQMLKEVKTSDSKEPIAIPTDLGFDENCKRVVDEVVNAFGRIDVLINNAAEQ  132

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE+S++EEIDE RL RV RTNI SYFFLTRHALK+MKEGSSIINTTS+NAYKG+A LLDY
Sbjct  133   YESSTIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKGNASLLDY  192

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQL  KGIRVNGVAPGPIWTPLIPASF +E+  +FG +VPM+RA 
Sbjct  193   TATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGSEVPMKRAG  252

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              PIEVAPSYVFLA +  SSY +GQVLHPNGGA+VN
Sbjct  253   QPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVN  287



>ref|XP_007144740.1| hypothetical protein PHAVU_007G180800g [Phaseolus vulgaris]
 gb|ESW16734.1| hypothetical protein PHAVU_007G180800g [Phaseolus vulgaris]
Length=354

 Score =   451 bits (1161),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 213/276 (77%), Positives = 247/276 (89%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+M P PQ++S +YKPSNKLQGKIAL+TGGDSGIGRAV   F+LEGATVAFT+VK  
Sbjct  79    GKEHLMTPPPQFTSPDYKPSNKLQGKIALITGGDSGIGRAVSNLFSLEGATVAFTFVKGS  138

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA+ET+ IIK+AK+ +AKDP+AI  DLG+DENCKKVV+EVV A+GRIDIL+NNAAEQ
Sbjct  139   EEKDAKETLEIIKRAKTAEAKDPMAIPTDLGYDENCKKVVEEVVSAFGRIDILINNAAEQ  198

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE  +VE+IDE RL RV RTNI +YFF+ RHALK+MKEGS+IINTTS+NAYKGHAKLLDY
Sbjct  199   YECGTVEDIDEPRLERVFRTNIFAYFFMARHALKHMKEGSNIINTTSVNAYKGHAKLLDY  258

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVAFTRGL+LQLV+KGIRVNGVAPGPIWTPLIPASF +EE A FG  VPM+RA 
Sbjct  259   TSTKGAIVAFTRGLSLQLVSKGIRVNGVAPGPIWTPLIPASFKEEETAEFGGHVPMKRAG  318

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
             HPIEVAPS+VFLA++  SSYI+GQVLHPNGG IVNG
Sbjct  319   HPIEVAPSFVFLASNSCSSYITGQVLHPNGGTIVNG  354



>sp|Q5KTS5.1|GRDH_DAUCA RecName: Full=Glucose and ribitol dehydrogenase; AltName: Full=Carrot 
ABA-induced in somatic embryos 5 protein [Daucus carota]
 dbj|BAD86648.1| glucose and ribitol dehydrogenase protein [Daucus carota]
Length=291

 Score =   449 bits (1154),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 213/276 (77%), Positives = 248/276 (90%), Gaps = 1/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ++S  YKP+NKLQGK+ALVTGGDSGIGR+VC  FALEGATVAFT+VK  
Sbjct  17    GKEHLMDPSPQHASPHYKPANKLQGKVALVTGGDSGIGRSVCYHFALEGATVAFTFVKGH  76

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA ET+ +++KAKS DAKDPIAIAADLGFD+NCKKVVD+VV A+G ID+LVNNAAEQ
Sbjct  77    EDKDANETLELLRKAKSSDAKDPIAIAADLGFDDNCKKVVDQVVNAFGSIDVLVNNAAEQ  136

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y+AS+VE+IDE+RL RV RTNI +YFF+ RHALK+M+EGS+IINTTSINAYKG+AKLLDY
Sbjct  137   YKASTVEDIDEERLERVFRTNIFAYFFMARHALKHMREGSTIINTTSINAYKGNAKLLDY  196

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGL+LQL++KGIRVNGVAPGP+WTPLIP+SF +EE   FG +VPM+RA 
Sbjct  197   TATKGAIVAFTRGLSLQLISKGIRVNGVAPGPVWTPLIPSSFDEEEVKQFGSEVPMKRAG  256

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+A +YVFL AS DSSY SGQVLHPNGGAIVNG
Sbjct  257   QPYEIATAYVFL-ASCDSSYYSGQVLHPNGGAIVNG  291



>ref|NP_564670.2| glucose and ribitol dehydrogenase homolog 1 [Arabidopsis thaliana]
 gb|AEE33158.1| aldehyde reductase [Arabidopsis thaliana]
Length=335

 Score =   450 bits (1157),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 210/276 (76%), Positives = 245/276 (89%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+M+  PQ+SS +Y+PSNKL+GK+AL+TGGDSGIGRAV  CFA EGATVAFTYVK Q
Sbjct  60    GKEHVMESSPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVGYCFASEGATVAFTYVKGQ  119

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA+ET+ ++K+ K+ D+K+PIAI  DLGFDENCK+VVDEVV A+GRID+L+NNAAEQ
Sbjct  120   EEKDAQETLQMLKEVKTSDSKEPIAIPTDLGFDENCKRVVDEVVNAFGRIDVLINNAAEQ  179

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE+S++EEIDE RL RV RTNI SYFFLTRHALK+MKEGSSIINTTS+NAYKG+A LLDY
Sbjct  180   YESSTIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKGNASLLDY  239

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQL  KGIRVNGVAPGPIWTPLIPASF +E+  +FG +VPM+RA 
Sbjct  240   TATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGSEVPMKRAG  299

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPSYVFLA +  SSY +GQVLHPNGGA+VN 
Sbjct  300   QPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVNA  335



>ref|XP_010418919.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like, 
partial [Camelina sativa]
Length=334

 Score =   449 bits (1156),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 211/270 (78%), Positives = 242/270 (90%), Gaps = 0/270 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+M+  PQ+SS +Y+PSNKL+GK+AL+TGGDSGIGRAV  CFALEGATVAFTYVK Q
Sbjct  62    GKEHVMETTPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVGYCFALEGATVAFTYVKGQ  121

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA+ET+ ++KKAK+ DAK+PIAI  DLGFDENCK+VVDEVV A+GRID+L+NNAAEQ
Sbjct  122   EEKDAQETLQMLKKAKTSDAKEPIAIPTDLGFDENCKRVVDEVVNAFGRIDVLINNAAEQ  181

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE+SS+EEIDE RL RV RTNI SYFFLTRHALKYMKEGSSIINTTS+NAYKG+A LLDY
Sbjct  182   YESSSIEEIDEPRLERVFRTNIFSYFFLTRHALKYMKEGSSIINTTSVNAYKGNASLLDY  241

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQL  KGIRVNGVAPGPIWTPLIPASF +E+  +FG +VPM+RA 
Sbjct  242   TATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGSEVPMKRAG  301

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNG  335
              P+EVAPSYVFLA +  SSY +GQVLHPNG
Sbjct  302   QPVEVAPSYVFLACNHCSSYFTGQVLHPNG  331



>ref|XP_003626301.1| Glucose and ribitol dehydrogenase-like protein [Medicago truncatula]
 gb|ABD32398.1| Short-chain dehydrogenase/reductase SDR [Medicago truncatula]
 gb|AES82519.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=293

 Score =   445 bits (1144),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 207/275 (75%), Positives = 243/275 (88%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH M+P PQ++  +YKP+NKLQGKIA+VTGGDSGIGRAVC  FALEGATV FTYVK  
Sbjct  18    GKEHAMNPTPQFTCPDYKPANKLQGKIAVVTGGDSGIGRAVCNLFALEGATVIFTYVKGH  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+ ++K AK+ +AKDP+AI ADLGFDENCK+V+DE++ AYGRIDILVNNAAEQ
Sbjct  78    EDKDARDTLDMLKMAKTANAKDPMAIPADLGFDENCKRVIDEIINAYGRIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE  SVEEIDE RL RV RTNI SYFF+TRHALK+MKEGS+IINTTS+NAYKG++ L+DY
Sbjct  138   YECGSVEEIDEPRLERVFRTNIFSYFFMTRHALKHMKEGSNIINTTSVNAYKGNSTLIDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVAFTR L+LQLV+KGIRVNGVAPGPIWTPLIPASF +E+ A FG DVPM+RA 
Sbjct  198   TSTKGAIVAFTRALSLQLVSKGIRVNGVAPGPIWTPLIPASFNEEKTAQFGSDVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P+EVAPS+VFLA++  SSYI+GQVLHPNGG +VN
Sbjct  258   QPVEVAPSFVFLASNQCSSYITGQVLHPNGGTVVN  292



>ref|XP_008388967.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Malus 
domestica]
Length=358

 Score =   447 bits (1150),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 211/275 (77%), Positives = 241/275 (88%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDP PQ+++ +Y PSNKLQGK+ALVTGGDSGIGR+VC  FA EGATVAFTY K Q
Sbjct  19    GKEHAMDPTPQFTNPDYXPSNKLQGKVALVTGGDSGIGRSVCHLFAQEGATVAFTYXKEQ  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA++T+ +IK+AK+ DAK+P+A+AADLG+DENCK VV++V  AYGRIDILVNNAAEQ
Sbjct  79    EDKDAQDTIQMIKQAKTSDAKEPMALAADLGYDENCKNVVEKVADAYGRIDILVNNAAEQ  138

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y+ASSVEEIDE RL RV RTNI SYFF TRHALK+MKEGSSII TTS+NAYKG+AKLLDY
Sbjct  139   YKASSVEEIDEPRLERVFRTNIFSYFFTTRHALKHMKEGSSIICTTSVNAYKGNAKLLDY  198

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVAF RGLALQLVN+GIRVNGVAPGPIWTPLIPASF +EE + FG  VPMQRA 
Sbjct  199   TSTKGAIVAFIRGLALQLVNRGIRVNGVAPGPIWTPLIPASFDEEEVSQFGNQVPMQRAG  258

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P EV PSYVFLA++  SSY +GQVLHPNGG +VN
Sbjct  259   QPCEVGPSYVFLASNAFSSYYTGQVLHPNGGTVVN  293



>ref|XP_008450654.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Cucumis 
melo]
Length=293

 Score =   444 bits (1143),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 210/276 (76%), Positives = 242/276 (88%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ++S +YKPSNKL GK+ALVTGGDSGIGRAVC CFALEGATVAFTYVK Q
Sbjct  18    GKEHVMDPSPQFTSSQYKPSNKLLGKVALVTGGDSGIGRAVCHCFALEGATVAFTYVKKQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA++ + I+++ ++ DAK PIA+ ADLGFDE CK VVDEVV+AYGRIDILVN+AAEQ
Sbjct  78    EDKDAKDVLEILRECQAADAKQPIAVGADLGFDEECKHVVDEVVKAYGRIDILVNSAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             ++ +SVEEIDE R+ RV RTNI S FF+ RHALK+MKEGSSIINTTS+ AYKG+ KLLDY
Sbjct  138   HKTNSVEEIDEKRIERVFRTNIFSQFFMVRHALKHMKEGSSIINTTSVVAYKGNPKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQL N+GIRVNGVAPGPIWTPLIPASF  E+  SFG +VPM+RA 
Sbjct  198   TATKGAIVAFTRGLALQLANRGIRVNGVAPGPIWTPLIPASFDNEDIESFGSEVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPSYVFLA +  SSY +GQ+LHPNGG+IVNG
Sbjct  258   QPIEVAPSYVFLACNHCSSYFTGQILHPNGGSIVNG  293



>ref|XP_009349395.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Pyrus 
x bretschneideri]
Length=294

 Score =   443 bits (1140),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 209/275 (76%), Positives = 242/275 (88%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDP PQ+++ +YKPSNKLQGK+ALVTGGDSGIGR+VC  F+ EGATVAFTYVK Q
Sbjct  19    GKEHAMDPTPQFTNPDYKPSNKLQGKVALVTGGDSGIGRSVCHLFSQEGATVAFTYVKEQ  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA++T+ +IK+AK+ DAK+P+A+AADLG+DENCK VV++V  AYGRIDILVNNAAEQ
Sbjct  79    EDKDAQDTIQMIKQAKTSDAKEPMALAADLGYDENCKNVVEKVAAAYGRIDILVNNAAEQ  138

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y+ASSVEEIDE RL RV RTNI SYFF TRHALK+MKEGSSII TTS+NAYKG+A+LLDY
Sbjct  139   YKASSVEEIDEPRLERVFRTNIFSYFFTTRHALKHMKEGSSIICTTSVNAYKGNAELLDY  198

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVAF RGLALQLVN+GIRVNGVAPGP+WTPLIPASF + E + FG  VPMQRA 
Sbjct  199   TSTKGAIVAFIRGLALQLVNRGIRVNGVAPGPVWTPLIPASFDEVEVSQFGNQVPMQRAG  258

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P EV PSYVFLA++  SSY +GQVLHPNGG +VN
Sbjct  259   QPCEVGPSYVFLASNAFSSYYTGQVLHPNGGTVVN  293



>ref|XP_004302438.1| PREDICTED: LOW QUALITY PROTEIN: glucose and ribitol dehydrogenase 
homolog 1-like [Fragaria vesca subsp. vesca]
Length=296

 Score =   442 bits (1136),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 225/295 (76%), Positives = 256/295 (87%), Gaps = 2/295 (1%)
 Frame = -1

Query  1198  MASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVC  1019
             MAS   Q FPPQ+Q SQPGKEH M+P PQYS+ +YKPSNK QGK+ALVTGGDSGIGRAVC
Sbjct  1     MASGGNQNFPPQKQASQPGKEHAMNPNPQYSNPDYKPSNKFQGKVALVTGGDSGIGRAVC  60

Query  1018  QCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDE  839
              CFA EGATVAFTYV+ QEDKDA +T+ +IK+ K+ D+KDPIA+AADLGFDENCK+VVDE
Sbjct  61    YCFAQEGATVAFTYVEGQEDKDARDTLEMIKQVKTPDSKDPIAVAADLGFDENCKRVVDE  120

Query  838   VVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSI  659
             V +AYG IDILVNNAAEQY+ SSV EIDE RL RV RTNI SYFF+TRHALK+MKEGSSI
Sbjct  121   VTKAYGCIDILVNNAAEQYKDSSVAEIDEPRLERVFRTNIFSYFFVTRHALKHMKEGSSI  180

Query  658   INTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPI--WTPLIPA  485
             I TTS+NAYKG+ KLLDYT+TKGAIVAF RGL+L+LV+KGIRVNGVAPGPI  WTPLIPA
Sbjct  181   ICTTSVNAYKGNQKLLDYTSTKGAIVAFVRGLSLELVSKGIRVNGVAPGPIELWTPLIPA  240

Query  484   SFTKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             SF +EE A FG +VPMQRA  P EVAPSYVFLA++  SSYI+GQV+HPNGG +VN
Sbjct  241   SFDEEETAKFGSEVPMQRAGQPCEVAPSYVFLASNAFSSYITGQVIHPNGGVVVN  295



>ref|XP_004494625.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cicer 
arietinum]
Length=293

 Score =   441 bits (1134),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 206/275 (75%), Positives = 238/275 (87%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH M+P PQ++  +YKPSNKLQGKIA+VTGGDSGIGR+VC  FALEGATV FTYVK  
Sbjct  18    GKEHAMNPTPQFTCPDYKPSNKLQGKIAVVTGGDSGIGRSVCNLFALEGATVIFTYVKGH  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+ +IK AK+ DAKDP+AI ADLGFDENCK+VVDE++  YGRIDILVNNAAEQ
Sbjct  78    EDKDARDTLDMIKMAKTADAKDPMAIPADLGFDENCKRVVDEIINTYGRIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE  S+EEIDE RL+RV +TN  SY F+TRHALK+MKEGSSIINTTS+NAYKGH  LLDY
Sbjct  138   YECGSIEEIDEPRLIRVFQTNFFSYVFMTRHALKHMKEGSSIINTTSVNAYKGHPTLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVAFTR L+LQLV+KGIRVNGVAPGPIWTPLIP+SF +++   FG DVPM+RA 
Sbjct  198   TSTKGAIVAFTRALSLQLVSKGIRVNGVAPGPIWTPLIPSSFKEDKTTQFGSDVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P+EVAPS+VFLA +  SSYI+GQVLHPNGG IVN
Sbjct  258   QPVEVAPSFVFLACNQCSSYITGQVLHPNGGTIVN  292



>gb|AAG51119.1|AC069144_16 dormancy related protein, putative [Arabidopsis thaliana]
Length=286

 Score =   441 bits (1133),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 208/275 (76%), Positives = 243/275 (88%), Gaps = 2/275 (1%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+M+  PQ+SS +Y+PSNKL  ++AL+TGGDSGIGRAV  CFA EGATVAFTYVK Q
Sbjct  13    GKEHVMESSPQFSSSDYQPSNKL--RVALITGGDSGIGRAVGYCFASEGATVAFTYVKGQ  70

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA+ET+ ++K+ K+ D+K+PIAI  DLGFDENCK+VVDEVV A+GRID+L+NNAAEQ
Sbjct  71    EEKDAQETLQMLKEVKTSDSKEPIAIPTDLGFDENCKRVVDEVVNAFGRIDVLINNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE+S++EEIDE RL RV RTNI SYFFLTRHALK+MKEGSSIINTTS+NAYKG+A LLDY
Sbjct  131   YESSTIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKGNASLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGLALQL  KGIRVNGVAPGPIWTPLIPASF +E+  +FG +VPM+RA 
Sbjct  191   TATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGSEVPMKRAG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              PIEVAPSYVFLA +  SSY +GQVLHPNGGA+VN
Sbjct  251   QPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVN  285



>ref|XP_011023588.1| PREDICTED: LOW QUALITY PROTEIN: glucose and ribitol dehydrogenase 
homolog 1 [Populus euphratica]
Length=365

 Score =   443 bits (1140),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 225/297 (76%), Positives = 260/297 (88%), Gaps = 1/297 (0%)
 Frame = -1

Query  1210  VFIKMASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIG  1031
             VF+ MAS  GQ+FPPQ+Q+SQPGKEH+MDP PQ+++ +YKPSNKLQGK+A+VTGGDSGIG
Sbjct  47    VFVGMASG-GQKFPPQKQNSQPGKEHVMDPTPQHTNPDYKPSNKLQGKVAVVTGGDSGIG  105

Query  1030  RAVCQCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKK  851
             RAVC  F +EGATVAFTYVK QEDKDA++T+ ++K  K+ DAKDPIAI  DLGFDENCK+
Sbjct  106   RAVCYSFVIEGATVAFTYVKAQEDKDADDTLQMLKXHKTADAKDPIAIPVDLGFDENCKR  165

Query  850   VVDEVVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKE  671
             VVDEVV AYGRIDILVNNAAE YE SSVEEIDE R  RV RTNI SYFF+TRHALK+MKE
Sbjct  166   VVDEVVNAYGRIDILVNNAAEXYECSSVEEIDEQRPERVFRTNIFSYFFMTRHALKHMKE  225

Query  670   GSSIINTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLI  491
             GSSIINTTS+NAYKG++KLLDYT+TKGAIVAF RGLALQLV++GIRVNG+APGPIWTPLI
Sbjct  226   GSSIINTTSVNAYKGNSKLLDYTSTKGAIVAFIRGLALQLVSRGIRVNGIAPGPIWTPLI  285

Query  490   PASFTKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             PASF +EE A+FGK VPM RA    EVAPSYVFLA +  SSYI+GQVLHPNG  +++
Sbjct  286   PASFKEEEVANFGKQVPMHRAGQLTEVAPSYVFLACNHCSSYITGQVLHPNGKFVLH  342



>ref|XP_004135622.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cucumis 
sativus]
Length=293

 Score =   440 bits (1131),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 208/276 (75%), Positives = 240/276 (87%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ++S +YKPSNKL GK+ALVTGGDSGIGRAVC CFALEGATVAFTYVK Q
Sbjct  18    GKEHVMDPSPQFTSSQYKPSNKLLGKVALVTGGDSGIGRAVCHCFALEGATVAFTYVKKQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA++ + I+++ ++ DAK PIA+ ADLGFDE+CK+VVDEVV+AYGRIDILVN AAEQ
Sbjct  78    EDKDAKDMLEILRECQAPDAKQPIAVGADLGFDEDCKRVVDEVVKAYGRIDILVNAAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             ++ +SVEEIDE R+ RV RTNI S FF+ RHALK+MKEGSSIINTTS+ AYKG  +LLDY
Sbjct  138   HKTNSVEEIDEQRIERVFRTNIFSQFFMVRHALKHMKEGSSIINTTSVVAYKGCPQLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIVAFTRGLALQL  +GIRVNGVAPGPIWTPLIPASF  EE  SFG +VPM+RA 
Sbjct  198   SATKGAIVAFTRGLALQLATRGIRVNGVAPGPIWTPLIPASFDNEEIESFGSEVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPSYVFLA +  SSY +GQ+LHPNGG IVNG
Sbjct  258   QPIEVAPSYVFLACNHCSSYFTGQILHPNGGTIVNG  293



>ref|XP_004302437.1| PREDICTED: glucose and ribitol dehydrogenase-like [Fragaria vesca 
subsp. vesca]
Length=293

 Score =   439 bits (1129),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 209/275 (76%), Positives = 240/275 (87%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDP PQ+S+ +Y PSNKLQGK+ALVTGGDSGIGR+VC  FA EGATVAFTYVK Q
Sbjct  18    GKEHAMDPNPQFSNPDYMPSNKLQGKVALVTGGDSGIGRSVCHYFAQEGATVAFTYVKGQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA ET+ +IK+ K+ DAKDPIA+AADLGFDENCK+VV+EVV+AY RIDILVNNAAEQ
Sbjct  78    EDKDARETLEMIKQVKTSDAKDPIAVAADLGFDENCKRVVEEVVKAYNRIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y+  SV++IDE R+ RV RTNI +YFF+ RHALK+MKEGS+II TTS+ AYKG+ KLLDY
Sbjct  138   YKTGSVQDIDEARIERVFRTNIFAYFFMARHALKHMKEGSNIICTTSVVAYKGNPKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAF RGLAL+LVNKGIRVNGVAPGPIWTPLIPASF +EE A FG +VPMQR  
Sbjct  198   TATKGAIVAFVRGLALELVNKGIRVNGVAPGPIWTPLIPASFDEEETAKFGSEVPMQRPG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P EVAP+YVFLA++  SSYI+GQV+HPNGG IVN
Sbjct  258   QPCEVAPAYVFLASNAFSSYITGQVIHPNGGVIVN  292



>ref|XP_008246487.1| PREDICTED: glucose and ribitol dehydrogenase-like [Prunus mume]
Length=294

 Score =   439 bits (1128),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 205/275 (75%), Positives = 240/275 (87%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ+ + +YKPSNKLQGK+AL+TGGDSGIGRAVC  F+ EGATVAFTYVK Q
Sbjct  19    GKEHVMDPNPQFKNPDYKPSNKLQGKVALITGGDSGIGRAVCYLFSQEGATVAFTYVKEQ  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+ +IKK K+ DAKDP A+AADLG+DENCKKVV+EV +AYGRIDIL+NNAAEQ
Sbjct  79    EDKDANDTIQMIKKVKTSDAKDPKALAADLGYDENCKKVVEEVTKAYGRIDILINNAAEQ  138

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y+A SVEEIDE RL R  RTNI S+F++TRHALK+MKEGSSII TTS+ AYKGHA+LL+Y
Sbjct  139   YKAGSVEEIDEPRLERFFRTNIFSHFYMTRHALKHMKEGSSIICTTSVKAYKGHAQLLEY  198

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVAF R L+LQLV+KGIRVNGVAPGPIWTPLIPASF +E+   FG +VPMQRA 
Sbjct  199   TSTKGAIVAFIRALSLQLVSKGIRVNGVAPGPIWTPLIPASFDEEKITQFGSEVPMQRAG  258

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P EVAP+Y+FLA +  SSY +GQVLHPNGGA+VN
Sbjct  259   QPYEVAPAYIFLADNAFSSYYTGQVLHPNGGAVVN  293



>ref|XP_008246486.1| PREDICTED: glucose and ribitol dehydrogenase-like [Prunus mume]
Length=294

 Score =   438 bits (1127),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 210/275 (76%), Positives = 237/275 (86%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDP PQ+++ +YKPSNKLQGKIALVTGGDSGIGRAVC  FA EGATVAFTYVK Q
Sbjct  19    GKEHAMDPTPQFTNPDYKPSNKLQGKIALVTGGDSGIGRAVCHLFAQEGATVAFTYVKEQ  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+ +IK+AK+ DAKDP+A+AAD+G+DENCKKVVDEV +AYG IDILVNNAAEQ
Sbjct  79    EDKDARDTMQMIKQAKTSDAKDPMALAADVGYDENCKKVVDEVAKAYGSIDILVNNAAEQ  138

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y+ASSVE+IDE RL RV RTNI SYFF+TRH LK+MKEG SII TTS+ AYKG+ KLLDY
Sbjct  139   YKASSVEDIDEPRLERVFRTNIFSYFFMTRHILKHMKEGGSIICTTSVVAYKGNDKLLDY  198

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIV+F RGLAL LV KGIRVNGVAPGPIWTPLIP+ F +EE A FG +VPMQRA 
Sbjct  199   TATKGAIVSFIRGLALHLVGKGIRVNGVAPGPIWTPLIPSCFDEEETAQFGSEVPMQRAG  258

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P EV PSYVFLA++  SSY +GQV HPNGG IVN
Sbjct  259   QPFEVGPSYVFLASNAFSSYYTGQVFHPNGGVIVN  293



>gb|AAN15136.1| putative TAG factor protein [Lupinus angustifolius]
 gb|AAN75426.1| putative TAG-associated factor [Lupinus angustifolius]
Length=294

 Score =   438 bits (1126),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 211/277 (76%), Positives = 239/277 (86%), Gaps = 1/277 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSS-HEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKP  968
             GKEH+M P PQ++   EYKPS+KL+GKIA+VTGGDSGIGRAVC  FALEGATV FTYVK 
Sbjct  18    GKEHLMYPTPQFTCPDEYKPSDKLKGKIAVVTGGDSGIGRAVCNLFALEGATVIFTYVKG  77

Query  967   QEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAE  788
              EDKDA++T+ +I++ K+ D+K+P AIA DLGFDENCKKV+DEV+ AYG IDILVNNAAE
Sbjct  78    HEDKDAKDTLELIRRVKTSDSKEPKAIAVDLGFDENCKKVIDEVINAYGSIDILVNNAAE  137

Query  787   QYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLD  608
             QYE  SVEEIDE RL RV RTNI SYFF+TRHALK+MKEGSSIINTTS+NAYKGH  LLD
Sbjct  138   QYECGSVEEIDEPRLERVFRTNIFSYFFMTRHALKHMKEGSSIINTTSVNAYKGHPSLLD  197

Query  607   YTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRA  428
             YT+TKGAIVAFTR LALQLVNKGIRVNGVAPGPIWTPLIP+SF +EE A FG DVPM+R 
Sbjct  198   YTSTKGAIVAFTRALALQLVNKGIRVNGVAPGPIWTPLIPSSFKEEETAQFGSDVPMKRP  257

Query  427   AHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
               P EVAPS+VFLA +  SSYI+GQVLHPNGG +VNG
Sbjct  258   GQPSEVAPSFVFLACNICSSYITGQVLHPNGGNVVNG  294



>ref|XP_004166035.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cucumis 
sativus]
Length=293

 Score =   437 bits (1125),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 207/276 (75%), Positives = 238/276 (86%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ++S +YKPSNKL GK+ALVTGGDSGIGRAVC CFALEG TVAFTYVK Q
Sbjct  18    GKEHVMDPSPQFTSSQYKPSNKLLGKVALVTGGDSGIGRAVCHCFALEGVTVAFTYVKKQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA++ + I+++ ++ DAK PIA+ ADLGFDE CK+VVDEVV+AYGRIDILVN AAEQ
Sbjct  78    EDKDAKDMLEILRECQAPDAKQPIAVGADLGFDEECKRVVDEVVKAYGRIDILVNAAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             ++ +SVEEIDE R+ RV RTNI S FF+ RHALK+MKEGSSIINTTS+ AYKG  +LLDY
Sbjct  138   HKTNSVEEIDEQRIERVFRTNIFSQFFMVRHALKHMKEGSSIINTTSVVAYKGCPQLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIVAFTRGLALQL  +GIRVNGVAPGPIWTPLIPASF  EE  SFG +VPM+RA 
Sbjct  198   SATKGAIVAFTRGLALQLATRGIRVNGVAPGPIWTPLIPASFDNEEIESFGSEVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPSYVFLA +  SSY +GQ+LHPNGG IVNG
Sbjct  258   QPIEVAPSYVFLACNHCSSYFTGQILHPNGGTIVNG  293



>ref|XP_010043092.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Eucalyptus 
grandis]
 gb|KCW85151.1| hypothetical protein EUGRSUZ_B01992 [Eucalyptus grandis]
Length=295

 Score =   434 bits (1115),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 220/295 (75%), Positives = 256/295 (87%), Gaps = 1/295 (0%)
 Frame = -1

Query  1198  MASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVC  1019
             MAS  G+QFPPQ+Q+ QPGKEH M+P PQ++SH+YKPS KLQGK+ALVTGGDSGIGRAVC
Sbjct  1     MASGGGEQFPPQRQERQPGKEHEMEPTPQFTSHDYKPSGKLQGKVALVTGGDSGIGRAVC  60

Query  1018  QCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPIAIAA-DLGFDENCKKVVD  842
              C+  EGATVAFT+VK +E KDA + + I+ +AK+ + KDPIAIA  DLG+DE CKKVVD
Sbjct  61    HCYVQEGATVAFTFVKDREHKDANDLLQILMQAKASNVKDPIAIAVPDLGYDETCKKVVD  120

Query  841   EVVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSS  662
             EVV ++GRIDILVNNAAEQY+ S++EEIDE RL RV RTNI + FF+TRHALK+MKEGS+
Sbjct  121   EVVNSFGRIDILVNNAAEQYKCSTIEEIDEARLERVFRTNIFAQFFITRHALKHMKEGSA  180

Query  661   IINTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPAS  482
             IINTTSI AYKG+ +LLDYTATKGAIVAFTRGLALQLV+KGIRVNGVAPGPIWTPLIPAS
Sbjct  181   IINTTSIVAYKGNPELLDYTATKGAIVAFTRGLALQLVSKGIRVNGVAPGPIWTPLIPAS  240

Query  481   FTKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
             F++EE   FG +VPM+RA  PIEVAP YVFLA +  SSYI+GQVLHPNGGAIVNG
Sbjct  241   FSEEEVKKFGSEVPMKRAGQPIEVAPCYVFLACNHCSSYITGQVLHPNGGAIVNG  295



>ref|XP_003521711.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Glycine 
max]
Length=294

 Score =   433 bits (1113),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 205/275 (75%), Positives = 240/275 (87%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE++M+P PQY+S +YKPSNKLQGKIA+VTGGDSGIGRAVC  F+LEGATV FTYVK Q
Sbjct  19    GKEYLMNPPPQYNSSQYKPSNKLQGKIAVVTGGDSGIGRAVCNLFSLEGATVIFTYVKGQ  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED+DA +T+ IIKKAK+ DAKDP+AI  D+G++ENCKKVVDEV+ AYGRIDILVNNAAEQ
Sbjct  79    EDRDASDTLEIIKKAKTEDAKDPLAIPVDVGYEENCKKVVDEVINAYGRIDILVNNAAEQ  138

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE+ S+E+ID+ RL RV RTNI S+FF+T+HALK+MKEGSSIINTTS+NAY+G   L+DY
Sbjct  139   YESDSLEDIDDARLERVFRTNIFSHFFMTKHALKHMKEGSSIINTTSVNAYQGDGTLVDY  198

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIV FTR LALQLV+KGIRVNGVAPGPIWTPLI A+  +E    FG DVPM+RA 
Sbjct  199   TSTKGAIVGFTRALALQLVSKGIRVNGVAPGPIWTPLIVATMNEETIVRFGSDVPMKRAG  258

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              PIEVAPSYVFLA++  SSYI+GQVLHPNGG IVN
Sbjct  259   QPIEVAPSYVFLASNICSSYITGQVLHPNGGIIVN  293



>ref|XP_007205659.1| hypothetical protein PRUPE_ppa009407mg [Prunus persica]
 gb|EMJ06858.1| hypothetical protein PRUPE_ppa009407mg [Prunus persica]
Length=294

 Score =   432 bits (1112),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 206/270 (76%), Positives = 234/270 (87%), Gaps = 0/270 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDP PQ+++ +YKPSNKLQGK+ALVTGGDSGIGRAVC  FA EGATVAFTYVK Q
Sbjct  19    GKEHAMDPTPQFTNPDYKPSNKLQGKVALVTGGDSGIGRAVCHLFAQEGATVAFTYVKEQ  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+ +IK+AK+ DAKDP+A+AADLG+DENCKKVVDEV +AYGRIDILVNNAAEQ
Sbjct  79    EDKDARDTMQMIKQAKTSDAKDPMALAADLGYDENCKKVVDEVAKAYGRIDILVNNAAEQ  138

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y+ASSVE+IDE RL RV RTNI SYFF+TRH LK+MKEG S+I TTS+ AYKG+ KLLDY
Sbjct  139   YKASSVEDIDEPRLERVFRTNIFSYFFVTRHVLKHMKEGGSLICTTSVVAYKGNDKLLDY  198

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIV+F RGLAL LV KGIRVNGVAPGPIWTPLIP+ F +EE A FG +VPMQRA 
Sbjct  199   TATKGAIVSFIRGLALHLVGKGIRVNGVAPGPIWTPLIPSCFDEEETAQFGSEVPMQRAG  258

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNG  335
              P EV PSYVFLA++  SSY +GQV HPNG
Sbjct  259   QPFEVGPSYVFLASNAFSSYYTGQVFHPNG  288



>ref|XP_007030862.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY11364.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=287

 Score =   432 bits (1110),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 210/276 (76%), Positives = 238/276 (86%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+M+P PQ++S +YKPSNK Q    +       +G A+C CF  EGATVAFTYVK Q
Sbjct  19    GKEHVMNPIPQFTSPDYKPSNKFQLLEVI-------LGLAICHCFIREGATVAFTYVKSQ  71

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA++T+ ++KK K+ D+KDP+AIAADLGFDENCKKVVDEVV AYGRI+ILVNNAAEQ
Sbjct  72    EDKDAQDTLQMLKKEKTPDSKDPMAIAADLGFDENCKKVVDEVVNAYGRINILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y+ASSVE+IDE+RL RV RTNI SYFFLTRHALK+MKEGSSIINTTSINAYKG+ KLLDY
Sbjct  132   YKASSVEDIDEERLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSINAYKGNDKLLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIVAFTRGL+LQLV +GIRVNGVAPGPIWTPLIPASF +EE + FG +VPMQRA 
Sbjct  192   TATKGAIVAFTRGLSLQLVKRGIRVNGVAPGPIWTPLIPASFDEEETSKFGSEVPMQRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPSYVFLA +  SSYISGQVLHPNGGAIVN 
Sbjct  252   QPIEVAPSYVFLACNHCSSYISGQVLHPNGGAIVNA  287



>ref|XP_010674769.1| PREDICTED: glucose and ribitol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=293

 Score =   432 bits (1110),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 213/292 (73%), Positives = 250/292 (86%), Gaps = 0/292 (0%)
 Frame = -1

Query  1192  SNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQC  1013
             + NG+ FP Q+Q++QPGK+H+MDP P+ +  +YKP+NKLQGK+ALVTGGDSGIGRAVC  
Sbjct  2     ATNGRNFPAQRQETQPGKQHVMDPIPETARSQYKPANKLQGKVALVTGGDSGIGRAVCHH  61

Query  1012  FALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVV  833
             FALEGATVAFTYVK  EDKDA +T+ +IK AK   AKDPIA+AADLG+DE+CK+VVDEVV
Sbjct  62    FALEGATVAFTYVKGHEDKDAVDTLQLIKSAKGTGAKDPIAVAADLGYDEHCKRVVDEVV  121

Query  832   RAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIIN  653
              A+GRIDILVNN AEQYE S++EE+ E +L RV RTNI S+F +TRHALK+M+EGSSIIN
Sbjct  122   NAFGRIDILVNNCAEQYERSTIEEVSEQKLERVFRTNIFSHFLVTRHALKHMREGSSIIN  181

Query  652   TTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTK  473
             TTSI A+KG   LLDYT+TKGAIVAFTRGLALQLV KGIRVN VAPGPIWTPLIPASF +
Sbjct  182   TTSIVAFKGSPSLLDYTSTKGAIVAFTRGLALQLVQKGIRVNAVAPGPIWTPLIPASFKE  241

Query  472   EECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
             +E  SFG +VPM+RA  P EVAPSYVFLA + DSSYI+GQ +HPNGGAIVNG
Sbjct  242   DEVESFGSEVPMKRAGQPSEVAPSYVFLACNADSSYITGQTIHPNGGAIVNG  293



>gb|KGN66084.1| hypothetical protein Csa_1G570090 [Cucumis sativus]
Length=287

 Score =   430 bits (1105),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 203/270 (75%), Positives = 235/270 (87%), Gaps = 0/270 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ++S +YKPSNKL GK+ALVTGGDSGIGRAVC CFALEGATVAFTYVK Q
Sbjct  18    GKEHVMDPSPQFTSSQYKPSNKLLGKVALVTGGDSGIGRAVCHCFALEGATVAFTYVKKQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA++ + I+++ ++ DAK PIA+ ADLGFDE+CK+VVDEVV+AYGRIDILVN AAEQ
Sbjct  78    EDKDAKDMLEILRECQAPDAKQPIAVGADLGFDEDCKRVVDEVVKAYGRIDILVNAAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             ++ +SVEEIDE R+ RV RTNI S FF+ RHALK+MKEGSSIINTTS+ AYKG  +LLDY
Sbjct  138   HKTNSVEEIDEQRIERVFRTNIFSQFFMVRHALKHMKEGSSIINTTSVVAYKGCPQLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIVAFTRGLALQL  +GIRVNGVAPGPIWTPLIPASF  EE  SFG +VPM+RA 
Sbjct  198   SATKGAIVAFTRGLALQLATRGIRVNGVAPGPIWTPLIPASFDNEEIESFGSEVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNG  335
              PIEVAPSYVFLA +  SSY +GQ+LHPNG
Sbjct  258   QPIEVAPSYVFLACNHCSSYFTGQILHPNG  287



>gb|ACU23676.1| unknown [Glycine max]
Length=294

 Score =   427 bits (1098),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 202/275 (73%), Positives = 237/275 (86%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE++M+P PQY+S +YKPSNKLQGKIA+VTGGDSGIGRAVC  F+LEGATV FTYVK Q
Sbjct  19    GKEYLMNPPPQYNSSQYKPSNKLQGKIAVVTGGDSGIGRAVCNLFSLEGATVIFTYVKGQ  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED+D  +T+ IIKKAK+ DAKDP+AI  D+G++ENCKKVVDEV+ AYGRIDILVNNAAEQ
Sbjct  79    EDRDVSDTLEIIKKAKTEDAKDPLAIPVDVGYEENCKKVVDEVINAYGRIDILVNNAAEQ  138

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE+ S+E+ID+ RL RV RTNI S+FF+T+HALK+MKEGSSIINTTS+NAY+G   L+DY
Sbjct  139   YESDSLEDIDDARLERVFRTNIFSHFFMTKHALKHMKEGSSIINTTSVNAYQGDGTLVDY  198

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIV FTR LALQLV+KGIRVNGVAPGPIWTPLI A+  +E    FG DVPM+RA 
Sbjct  199   TSTKGAIVGFTRALALQLVSKGIRVNGVAPGPIWTPLIVATMNEETIVRFGSDVPMKRAG  258

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              PIEVAPSYVFL ++  SSYI+ QVLHPNGG IVN
Sbjct  259   QPIEVAPSYVFLGSNICSSYITDQVLHPNGGIIVN  293



>ref|XP_010105844.1| Glucose and ribitol dehydrogenase-1-like protein [Morus notabilis]
 gb|EXC06578.1| Glucose and ribitol dehydrogenase-1-like protein [Morus notabilis]
Length=280

 Score =   427 bits (1097),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 207/275 (75%), Positives = 238/275 (87%), Gaps = 13/275 (5%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ+S+ EYKPSNKLQGKIALVTGGDSGIGRAVC CFALEGATVAFTYVK +
Sbjct  18    GKEHVMDPNPQFSAPEYKPSNKLQGKIALVTGGDSGIGRAVCNCFALEGATVAFTYVKGE  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+ I++++K+ DAKDP+A+AADLG+D NC KVVDEVV AYGRIDILVNNAAEQ
Sbjct  78    EDKDAMDTLRILRESKTPDAKDPMAVAADLGYDRNCMKVVDEVVNAYGRIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y+A+SVE+IDE+RL RV             HALK+MKEGSSIINTTS+NAYKG+AK LDY
Sbjct  138   YKAASVEDIDEERLERV-------------HALKHMKEGSSIINTTSVNAYKGNAKWLDY  184

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIV++TRGLAL LV++GIRVNGVAPGPIWTPL PASF++EE A FG  VPM+RA 
Sbjct  185   TATKGAIVSYTRGLALHLVDRGIRVNGVAPGPIWTPLTPASFSEEETAKFGSQVPMKRAG  244

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              PIEVAPS+VFLA +  SSYI+GQVLHPNGG IVN
Sbjct  245   QPIEVAPSFVFLACNHCSSYITGQVLHPNGGTIVN  279



>gb|KHN04002.1| Glucose and ribitol dehydrogenase like 1 [Glycine soja]
Length=300

 Score =   426 bits (1095),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 201/270 (74%), Positives = 236/270 (87%), Gaps = 0/270 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE++M+P PQY+S +YKPSNKLQGKIA+VTGGDSGIGRAVC  F+LEGATV FTYVK Q
Sbjct  19    GKEYLMNPPPQYNSSQYKPSNKLQGKIAVVTGGDSGIGRAVCNLFSLEGATVIFTYVKGQ  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED+DA +T+ IIKKAK+ DAKDP+AI  D+G++ENCKKVVDEV+ AYGRIDILVNNAAEQ
Sbjct  79    EDRDASDTLEIIKKAKTEDAKDPLAIPVDVGYEENCKKVVDEVINAYGRIDILVNNAAEQ  138

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE+ S+E+ID+ RL RV RTNI S+FF+T+HALK+MKEGSSIINTTS+NAY+G   L+DY
Sbjct  139   YESDSLEDIDDARLERVFRTNIFSHFFMTKHALKHMKEGSSIINTTSVNAYQGDGTLVDY  198

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIV FTR LALQLV+KGIRVNGVAPGPIWTPLI A+  +E    FG DVPM+RA 
Sbjct  199   TSTKGAIVGFTRALALQLVSKGIRVNGVAPGPIWTPLIVATMNEETIVRFGSDVPMKRAG  258

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNG  335
              PIEVAPSYVFLA++  SSYI+GQVLHPNG
Sbjct  259   QPIEVAPSYVFLASNICSSYITGQVLHPNG  288



>ref|XP_007147059.1| hypothetical protein PHAVU_006G092800g [Phaseolus vulgaris]
 gb|ESW19053.1| hypothetical protein PHAVU_006G092800g [Phaseolus vulgaris]
Length=292

 Score =   423 bits (1088),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 206/277 (74%), Positives = 238/277 (86%), Gaps = 3/277 (1%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE+IM+P PQYSS +YKPSNKLQ  IALVTGGDSGIGRAVC  F+LEGAT+ FTYVK Q
Sbjct  18    GKEYIMNPPPQYSSPDYKPSNKLQ--IALVTGGDSGIGRAVCNLFSLEGATIIFTYVKGQ  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED DA +T+ II+K K+ DAKDP+AI  D+GF+ NC++VVDEVV AYGRIDILVNNAAEQ
Sbjct  76    EDIDARDTLEIIRKGKTADAKDPMAIPVDVGFEVNCRRVVDEVVDAYGRIDILVNNAAEQ  135

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE+ S+EEIDE RL RV RTNI S+FF+T+HA+K+MKEGS+IINTTS+NAYKG A L+DY
Sbjct  136   YESESLEEIDETRLERVFRTNIFSHFFMTKHAVKHMKEGSNIINTTSVNAYKGDATLVDY  195

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKD-VPMQRA  428
             T+TKGAIVAFTR LALQLV+KGIRVNGVAPGPIWTPLI A+  +EE   FG D  PM+RA
Sbjct  196   TSTKGAIVAFTRALALQLVSKGIRVNGVAPGPIWTPLIVATMKEEEIVKFGSDSTPMKRA  255

Query  427   AHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
               PIEVAPSYVFLA++  SSYI+GQVLHPNGG IVNG
Sbjct  256   GQPIEVAPSYVFLASNQCSSYITGQVLHPNGGTIVNG  292



>ref|XP_009397642.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Musa 
acuminata subsp. malaccensis]
Length=293

 Score =   422 bits (1084),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 200/276 (72%), Positives = 234/276 (85%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEHIM+P PQ  S EYKP+NKLQGK+ALVTGGDSGIGRAVC CFA EGATVAFTYVK Q
Sbjct  18    GKEHIMEPTPQPISDEYKPANKLQGKVALVTGGDSGIGRAVCYCFAQEGATVAFTYVKSQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E KDA +T+ ++++ K  DAKDPIAI A+LG++ENC+KVV+EVV AYGRIDILVNNAAEQ
Sbjct  78    EFKDANDTLQMLRQIKKHDAKDPIAIPAELGYEENCRKVVEEVVNAYGRIDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             YE S + +I E++L RV RTNI SY  +++  +K MK G  IINTTS+NAYKGH  LLDY
Sbjct  138   YERSCITDITEEQLERVFRTNIFSYMHVSKFVVKQMKAGGCIINTTSVNAYKGHKTLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVAFTR LALQL +KGIRVNGVAPGP+WTPLIPASF +E  A+FGK+VPM RA 
Sbjct  198   TSTKGAIVAFTRALALQLADKGIRVNGVAPGPVWTPLIPASFPEEAVANFGKEVPMGRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFLA++PDSSYI+GQV+HPNGG IVNG
Sbjct  258   QPYEIAPSYVFLASTPDSSYITGQVIHPNGGTIVNG  293



>ref|XP_010105843.1| Glucose and ribitol dehydrogenase-1-like protein [Morus notabilis]
 gb|EXC06577.1| Glucose and ribitol dehydrogenase-1-like protein [Morus notabilis]
Length=368

 Score =   422 bits (1084),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 212/296 (72%), Positives = 259/296 (88%), Gaps = 3/296 (1%)
 Frame = -1

Query  1201  KMASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAV  1022
             +MAS+ GQQFPPQ+Q++QPGKEH+M+P PQ++S  YKPS+KL+ K+ALVTGGDSGIGRAV
Sbjct  42    RMASD-GQQFPPQRQETQPGKEHVMEPTPQFTSPHYKPSDKLREKVALVTGGDSGIGRAV  100

Query  1021  CQCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVD  842
             C CFALEGATVAFTYVK  EDKDA++T+ I++++K+ +AKDPI IAADLGFD NCKKVVD
Sbjct  101   CHCFALEGATVAFTYVKGHEDKDAQDTLRILRESKTPEAKDPIGIAADLGFDINCKKVVD  160

Query  841   EVVRAYGRIDILVNNAAEQYEASS--VEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEG  668
             EVV  +GRIDILVNNAAEQY+ ++  ++EI EDRL RV RTNI ++FF+ +HALK+M++G
Sbjct  161   EVVEIFGRIDILVNNAAEQYKTTTPTLDEITEDRLERVFRTNIFAHFFMVKHALKHMRQG  220

Query  667   SSIINTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIP  488
             SSIINTT+I AYKG  +LLDYTATKGAIVAFTRGLAL LV +GIRVNGVAPGP+WTPLIP
Sbjct  221   SSIINTTTIVAYKGSPELLDYTATKGAIVAFTRGLALHLVERGIRVNGVAPGPVWTPLIP  280

Query  487   ASFTKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             ASF++EE A FG +VPM+RA  PIEVAPSYVFLA +  SSYI+GQV+HPNGG + +
Sbjct  281   ASFSEEETAKFGSEVPMKRAGQPIEVAPSYVFLACNHCSSYITGQVIHPNGGLLFS  336



>ref|XP_002891915.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68174.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=334

 Score =   419 bits (1078),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 224/252 (89%), Gaps = 0/252 (0%)
 Frame = -1

Query  1072  GKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPI  893
             GK+AL+TGGDSGIGRAV  CFALEGATVAFTYVK QE+KDA ET+ ++KK K+ DAK+PI
Sbjct  83    GKVALITGGDSGIGRAVGYCFALEGATVAFTYVKGQEEKDAHETLQMLKKVKTSDAKEPI  142

Query  892   AIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICS  713
             AI  DLGFDENCK+VVDEVV A+GRID+L+NNAAEQYE+SSVEEIDE RL RV RTNI S
Sbjct  143   AIPTDLGFDENCKRVVDEVVNAFGRIDVLINNAAEQYESSSVEEIDEPRLERVFRTNIFS  202

Query  712   YFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIR  533
             YFFLTRHALK+MKEGSSIINTTS+NAYKG+A LLDYTATKGAIVAFTRGLALQL  KGIR
Sbjct  203   YFFLTRHALKHMKEGSSIINTTSVNAYKGNASLLDYTATKGAIVAFTRGLALQLAEKGIR  262

Query  532   VNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQ  353
             VNGVAPGPIWTPLIPASF +E+  +FG +VPM+RA  PIEVAPSYVFLA +  SSY +GQ
Sbjct  263   VNGVAPGPIWTPLIPASFNEEKIKNFGSEVPMKRAGQPIEVAPSYVFLACNHCSSYFTGQ  322

Query  352   VLHPNGGAIVNG  317
             VLHPNGGA+VN 
Sbjct  323   VLHPNGGAVVNA  334



>ref|XP_010906880.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Elaeis 
guineensis]
Length=354

 Score =   420 bits (1080),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 212/298 (71%), Positives = 247/298 (83%), Gaps = 2/298 (1%)
 Frame = -1

Query  1207  FIKMASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGR  1028
             F  MAS  GQQFPPQ Q  QPGKEH+M+P PQ   H+YK +NKLQGK+ALVTGGDSGIGR
Sbjct  58    FATMASG-GQQFPPQTQKRQPGKEHVMEPTPQAVLHDYKAANKLQGKVALVTGGDSGIGR  116

Query  1027  AVCQCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSG-DAKDPIAIAADLGFDENCKK  851
             AVC C A+EGATVAFTYVK QE KDAE+T+ ++++ K G D KDPIAI ADLGF++NC+K
Sbjct  117   AVCYCLAMEGATVAFTYVKSQEGKDAEDTLQMLREIKKGADVKDPIAIPADLGFEDNCRK  176

Query  850   VVDEVVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKE  671
             VV+EV   YGRIDILVNNAAEQY  + +  I E++L RV RTNI SYF  T+HA+KYMKE
Sbjct  177   VVEEVAGTYGRIDILVNNAAEQYVKTCITNITEEQLERVFRTNIFSYFLTTKHAVKYMKE  236

Query  670   GSSIINTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLI  491
             GSSIINTTS+NAYKG+A LLDYTATKGAIV FTRGLALQL  KGIRVNGVAPGP+WTPLI
Sbjct  237   GSSIINTTSVNAYKGNAMLLDYTATKGAIVGFTRGLALQLAGKGIRVNGVAPGPVWTPLI  296

Query  490   PASFTKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
             PAS ++E  A+FGK+VP+ RA  P E+APSYVFLA   DSSY++GQV+HPNGG +VNG
Sbjct  297   PASMSEEMVANFGKEVPLGRAGQPHEIAPSYVFLACCQDSSYVTGQVIHPNGGTVVNG  354



>ref|XP_008790990.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Phoenix 
dactylifera]
Length=350

 Score =   420 bits (1079),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 218/313 (70%), Positives = 254/313 (81%), Gaps = 3/313 (1%)
 Frame = -1

Query  1252  ISFLNPIKKGSLVCVFIKMASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQ  1073
             +S   P ++ S    F  MAS  GQQFPPQ Q+ QPGKEHIM+P PQ   H+YK +NKLQ
Sbjct  40    VSAFKP-RRRSFRPSFATMASG-GQQFPPQTQERQPGKEHIMEPTPQAVRHDYKAANKLQ  97

Query  1072  GKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSG-DAKDP  896
             GK+ALVTGGDSGIGRAVC CFA+EGATVAFTYVK QE KDAE+T+ +++  K G DAKDP
Sbjct  98    GKVALVTGGDSGIGRAVCYCFAMEGATVAFTYVKSQEVKDAEDTLQMLRGIKKGTDAKDP  157

Query  895   IAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNIC  716
             IAI ADLGF++NC+KVV+EV   YGRIDILVNNAAEQ   + + EI E++L RV RTNI 
Sbjct  158   IAIPADLGFEQNCRKVVEEVAGTYGRIDILVNNAAEQSIKTCITEISEEQLERVFRTNIF  217

Query  715   SYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGI  536
             SYF  T+ A+KYMKEGS IINTTS+NAYKG+A LLDYTATKGAIV FTRGLALQL  KGI
Sbjct  218   SYFLTTKCAVKYMKEGSCIINTTSVNAYKGNAMLLDYTATKGAIVGFTRGLALQLAEKGI  277

Query  535   RVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISG  356
             RVNGVAPGP+WTPLIPAS ++E  A+FGK+VP+ RA  P E+APSYVFLA S DSSYI+G
Sbjct  278   RVNGVAPGPVWTPLIPASMSEEMVANFGKEVPLGRAGQPHEIAPSYVFLACSQDSSYITG  337

Query  355   QVLHPNGGAIVNG  317
             QV+HPNGG +VNG
Sbjct  338   QVIHPNGGTVVNG  350



>gb|KFK37931.1| hypothetical protein AALP_AA3G048700 [Arabis alpina]
Length=289

 Score =   410 bits (1055),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 195/275 (71%), Positives = 232/275 (84%), Gaps = 1/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ+SS  YKPSNKL GK+ALVTGGDSGIG+AVC C+ LEGATVAFTYVK Q
Sbjct  15    GKEHVMDPTPQFSSPNYKPSNKLHGKVALVTGGDSGIGKAVCHCYGLEGATVAFTYVKGQ  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA ET+ ++ + K+ +AK+PI IA DLGF+ENCK+VVDEVV A+GRID+LVN AAEQ
Sbjct  75    EDKDANETLRLLHQVKTKEAKEPIMIATDLGFEENCKRVVDEVVNAFGRIDVLVNCAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +E S +E+IDE RL RV RTNI S FFL ++ALK+MKEGSSIINTTS+ AY G+  LLDY
Sbjct  135   HEGS-IEDIDEPRLERVFRTNIFSQFFLVKYALKHMKEGSSIINTTSVVAYAGNPNLLDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAI++FTRGLALQL  KGIRVNGVAPGP+WTPLI ASF+++    FG + PM+RAA
Sbjct  194   TATKGAILSFTRGLALQLAPKGIRVNGVAPGPVWTPLITASFSEDMIKQFGSETPMKRAA  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P+EVAPSYVFLA +  SSY +GQ+LHPNGG +VN
Sbjct  254   QPVEVAPSYVFLACNHCSSYFTGQILHPNGGLVVN  288



>ref|XP_003553739.1| PREDICTED: glucose and ribitol dehydrogenase-like [Glycine max]
 gb|KHN43251.1| Glucose and ribitol dehydrogenase [Glycine soja]
Length=295

 Score =   410 bits (1054),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/277 (73%), Positives = 236/277 (85%), Gaps = 2/277 (1%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE++M+P PQY+S +YKPSNKL GK+A+VTGGDSGIGRAVC  F+LEGATV FTYVK Q
Sbjct  18    GKEYLMNPPPQYNSPDYKPSNKLHGKVAVVTGGDSGIGRAVCNLFSLEGATVIFTYVKGQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAAD-LGFDENCKKVVDEVVRAYGRIDILVNNAAE  788
             E+ DA +T+ II+KAK+ DAKDP+A+A D LG++ENCK+VVD+VV AYG I ILVNNAA 
Sbjct  78    EEIDARDTLEIIRKAKTEDAKDPMAVAVDHLGYEENCKRVVDQVVNAYGSIHILVNNAAV  137

Query  787   QYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLD  608
             QYE+ S+EEID+ RL  V RTNI SYFF+T+HALK+MKEGSSIINTTS+ AY+G AKL+D
Sbjct  138   QYESDSLEEIDDKRLEMVFRTNIFSYFFMTKHALKHMKEGSSIINTTSVTAYEGFAKLVD  197

Query  607   YTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDV-PMQR  431
             Y++TKGAIV FTR LALQLV+KGIRVNGVAPGPIWTPL  AS T EE   FG DV PM+R
Sbjct  198   YSSTKGAIVGFTRSLALQLVSKGIRVNGVAPGPIWTPLEVASLTVEEIVRFGSDVTPMKR  257

Query  430   AAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             A  PIEVAPSYVFLA++  SSYI+GQVLHPNGG IVN
Sbjct  258   AGQPIEVAPSYVFLASNICSSYITGQVLHPNGGIIVN  294



>ref|NP_187177.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 sp|Q9MA93.1|GRDH2_ARATH RecName: Full=Glucose and ribitol dehydrogenase homolog 2 [Arabidopsis 
thaliana]
 gb|AAF27032.1|AC009177_22 putative glucose and ribitol dehydrogenase homolog [Arabidopsis 
thaliana]
 gb|AEE74212.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=289

 Score =   407 bits (1047),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 192/275 (70%), Positives = 235/275 (85%), Gaps = 1/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G +H+M+P P++SS  YKPSNKL GK+ALVTGGDSGIG+AVC C+ALEGA+VAFTYVK +
Sbjct  15    GIQHVMEPTPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGASVAFTYVKGR  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDAEET+ ++ + K+ +AK+PI IA DLGF+ENCK+VV+EVV ++GRID+LVN AAEQ
Sbjct  75    EDKDAEETLRLLHEVKTREAKEPIMIATDLGFEENCKRVVEEVVNSFGRIDVLVNCAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +E S +E+IDE RL RV RTNI S FFL ++ALK+MKEGSSIINTTS+ AY G++ LL+Y
Sbjct  135   HEVS-IEDIDEARLERVFRTNIFSQFFLVKYALKHMKEGSSIINTTSVVAYAGNSSLLEY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIV+FTRGLALQL  KGIRVNGVAPGP+WTPLIPASF++E    FG + PM+RAA
Sbjct  194   TATKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLIPASFSEEAIKQFGSETPMKRAA  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P+EVAPSYVFLA +  SSY +GQ+LHPNGG IVN
Sbjct  254   QPVEVAPSYVFLACNHCSSYYTGQILHPNGGLIVN  288



>gb|AAL16204.1|AF428435_1 AT3g05260/T12H1_23 [Arabidopsis thaliana]
Length=289

 Score =   407 bits (1046),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 192/275 (70%), Positives = 235/275 (85%), Gaps = 1/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G +H+M+P P++SS  YKPSNKL GK+ALVTGGDSGIG+AVC C+ALEGA+VAFTYVK +
Sbjct  15    GIQHVMEPTPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGASVAFTYVKGR  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDAEET+ ++ + K+ +AK+PI IA DLGF+ENCK+VV+EVV ++GRID+LVN AAEQ
Sbjct  75    EDKDAEETLRLLHEVKTREAKEPIMIATDLGFEENCKRVVEEVVNSFGRIDVLVNCAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +E S +E+IDE RL RV RTNI S FFL ++ALK+MKEGSSIINTTS+ AY G++ LL+Y
Sbjct  135   HEVS-IEDIDEARLERVFRTNIFSQFFLVKYALKHMKEGSSIINTTSVVAYAGNSSLLEY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAIV+FTRGLALQL  KGIRVNGVAPGP+WTPLIPASF++E    FG + PM+RAA
Sbjct  194   TATKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLIPASFSEEAIKQFGSETPMKRAA  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P+EVAPSYVFLA +  SSY +GQ+LHPNGG IVN
Sbjct  254   QPVEVAPSYVFLACNHCSSYYTGQILHPNGGLIVN  288



>ref|XP_007147090.1| hypothetical protein PHAVU_006G095500g [Phaseolus vulgaris]
 gb|ESW19084.1| hypothetical protein PHAVU_006G095500g [Phaseolus vulgaris]
Length=298

 Score =   405 bits (1041),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 193/270 (71%), Positives = 230/270 (85%), Gaps = 0/270 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE++M+P PQYS+ +YKPSNKLQGKIA++TGGDSGIGRAVC  F+LEGATV FTYV+ Q
Sbjct  18    GKEYLMNPPPQYSTPDYKPSNKLQGKIAVITGGDSGIGRAVCNLFSLEGATVIFTYVEGQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED DA+ET+ II+ AK+ DAKDP+AI  +LG++ENCK+VVDEVV AYG IDILVNNAA Q
Sbjct  78    EDIDAKETLEIIRNAKTADAKDPMAIPVNLGYEENCKRVVDEVVSAYGCIDILVNNAAVQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +++ S+EEID+ RL  V RTNI SYFF+T++ALK+MKEGS IINTTS+ AY+GHA L+DY
Sbjct  138   FQSDSLEEIDDKRLHMVFRTNIFSYFFMTKYALKHMKEGSGIINTTSVVAYEGHATLVDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
              +TKGAIV FTR LALQLV KGIRVNGVAPGPIWTPL  ASFT+E+   FG D  M+RA 
Sbjct  198   ASTKGAIVGFTRSLALQLVRKGIRVNGVAPGPIWTPLQVASFTEEQIVVFGSDTTMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNG  335
              PIEVAPSYVFLA++  SSYI+GQVLHPNG
Sbjct  258   QPIEVAPSYVFLASNQCSSYITGQVLHPNG  287



>ref|XP_009147260.1| PREDICTED: glucose and ribitol dehydrogenase homolog 2 [Brassica 
rapa]
 emb|CDY27781.1| BnaA05g31900D [Brassica napus]
Length=289

 Score =   404 bits (1039),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 192/275 (70%), Positives = 230/275 (84%), Gaps = 1/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G +H MDP PQ+SS  YKPSNKL GK+ALVTGGDSGIGRAVC C+ LEGA+VAFTYVK +
Sbjct  15    GVQHAMDPSPQFSSPNYKPSNKLHGKVALVTGGDSGIGRAVCHCYVLEGASVAFTYVKGR  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA+ET+ ++ +AK+ DAKDPI IA DLGF+ENCK+ VDEVV A+GRID+LVN AAEQ
Sbjct  75    EDKDADETLRLLHEAKTKDAKDPIMIATDLGFEENCKRTVDEVVNAFGRIDVLVNCAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +E S ++EI+E RL RV RTNI S FFL ++ALK+MKEGSSIINTTS+ AY G + LL+Y
Sbjct  135   HEVS-IDEIEEARLERVFRTNIFSQFFLAKYALKHMKEGSSIINTTSVVAYAGSSSLLEY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
              +TKGAIV+FTR LALQL +KGIRVNGVAPGP+WTPLI ASF++E    FG + PM+RAA
Sbjct  194   ASTKGAIVSFTRALALQLASKGIRVNGVAPGPVWTPLITASFSEEAIKQFGSETPMKRAA  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P+EVAPSYVFLA    SSY +GQ+LHPNGG+IVN
Sbjct  254   QPVEVAPSYVFLACEHCSSYYTGQILHPNGGSIVN  288



>ref|XP_006433301.1| hypothetical protein CICLE_v10003201mg, partial [Citrus clementina]
 gb|ESR46541.1| hypothetical protein CICLE_v10003201mg, partial [Citrus clementina]
Length=283

 Score =   404 bits (1037),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 192/275 (70%), Positives = 228/275 (83%), Gaps = 22/275 (8%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+M+P PQ++SH+YKPSNKL+GK+ALVTGGDSGIGRAV  C+ALEGATVAFTYVK Q
Sbjct  30    GKEHVMEPTPQFTSHDYKPSNKLRGKVALVTGGDSGIGRAVAHCYALEGATVAFTYVKSQ  89

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA+ET+ I+++AK+ DAKDP+AI+ADLGFDENCK+VVDEVV AYG+IDILVNNAA Q
Sbjct  90    EEKDAQETLEILREAKTSDAKDPMAISADLGFDENCKRVVDEVVNAYGKIDILVNNAAVQ  149

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y+A SVEEIDE+RL RV RTNI S+FF+TRH+L++M EGS+IINTTS+            
Sbjct  150   YKAGSVEEIDEERLERVFRTNIFSHFFMTRHSLRHMNEGSAIINTTSV------------  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
                        RGLALQLV +GIRVNGVAPGPIWTPLIP+SF++EE A FG +VPM+RA 
Sbjct  198   ----------ARGLALQLVERGIRVNGVAPGPIWTPLIPSSFSEEESAQFGSEVPMKRAG  247

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              PIEVAP YVFLA +  SSYI+GQVLHPNGG IVN
Sbjct  248   QPIEVAPCYVFLACNHCSSYITGQVLHPNGGVIVN  282



>ref|XP_010464044.1| PREDICTED: glucose and ribitol dehydrogenase homolog 2-like [Camelina 
sativa]
Length=289

 Score =   403 bits (1036),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/275 (69%), Positives = 233/275 (85%), Gaps = 1/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G +H+M+P P++SS  YKPSNKL GK+ALVTGGDSGIG+AVC C+ALEGA+VAFTYVK +
Sbjct  15    GIQHVMEPTPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGASVAFTYVKGR  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA+ET+ ++ + K+ +AK+PI IA DLGF+ENCK+VV+EVV A+GRID+LVN AAEQ
Sbjct  75    EDKDADETLRLLHEVKTSEAKEPIMIATDLGFEENCKRVVEEVVNAFGRIDVLVNCAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +E S +E+IDE RL RV RTNI S FFL ++ALK+MKEGSSIINTTS+ AY G++ LL+Y
Sbjct  135   HEVS-IEDIDEARLERVFRTNIFSQFFLVKYALKHMKEGSSIINTTSVVAYGGNSSLLEY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIV+FTRGLALQL  KGIRVNGVAPGP+WTPLI ASF+ E    FG + PM+RAA
Sbjct  194   TSTKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLITASFSDEAIKQFGSETPMKRAA  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P+EVAPSYVFLA +  SSY +GQVLHPNGG IVN
Sbjct  254   QPVEVAPSYVFLACNHCSSYYTGQVLHPNGGLIVN  288



>ref|XP_010546674.1| PREDICTED: glucose and ribitol dehydrogenase homolog 2 [Tarenaya 
hassleriana]
Length=286

 Score =   403 bits (1035),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 190/276 (69%), Positives = 231/276 (84%), Gaps = 1/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+M+P PQ++S  YK  NKLQGK+ALVTGGDSGIGRAVC  FALEGATVAFTYVK +
Sbjct  12    GKEHVMEPSPQFTSSHYKACNKLQGKVALVTGGDSGIGRAVCHTFALEGATVAFTYVKGR  71

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED+DAE+T+  +++AK+ DAKDPI I  DLGF+ENCK+V+DEVV A+G ID+LVN AAEQ
Sbjct  72    EDRDAEDTMRALQEAKTRDAKDPIMIPTDLGFEENCKRVIDEVVNAFGAIDVLVNTAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +E S +E+I+E +L RV RTNI S FFL ++ALK+MKEGSSIINTTS+ AY G+  LL+Y
Sbjct  132   HEVS-IEDIEEAKLERVFRTNIFSQFFLAKYALKHMKEGSSIINTTSVVAYSGNPVLLEY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
              ATKGAIV+FTRGLALQLV KGIRVN VAPGP+WTPL+ ASF++E    FG++ PM+RAA
Sbjct  191   AATKGAIVSFTRGLALQLVQKGIRVNAVAPGPVWTPLVTASFSEETIKKFGEETPMKRAA  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+E+APSYVFLA +  SSY +GQVLHPNGG IVN 
Sbjct  251   QPVEIAPSYVFLACNHCSSYFTGQVLHPNGGMIVNA  286



>ref|XP_006298247.1| hypothetical protein CARUB_v10014308mg [Capsella rubella]
 gb|EOA31145.1| hypothetical protein CARUB_v10014308mg [Capsella rubella]
Length=289

 Score =   403 bits (1035),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 191/275 (69%), Positives = 233/275 (85%), Gaps = 1/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G +H+MDP P++SS  YKPSNKL GK+ALVTGGDSGIG+AVC C+ALEGA+VAFTYVK +
Sbjct  15    GIQHVMDPTPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGASVAFTYVKGR  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA+ET+ ++ + K+ +AK+PI IA DLGF+ENCK+VV+EVV A+GRID+LVN AAEQ
Sbjct  75    EDKDADETLRLLHEVKTREAKEPIMIATDLGFEENCKRVVEEVVNAFGRIDVLVNCAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +E S +E+IDE RL RV RTNI S FFL ++ALK+MKEGSSIINTTS+ AY G++ LL+Y
Sbjct  135   HEVS-IEDIDEARLERVFRTNIFSQFFLVKYALKHMKEGSSIINTTSVVAYGGNSSLLEY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIV+FTRGLALQL  KGIRVNGVAPGP+WTPLI ASF+ E    FG + PM+RAA
Sbjct  194   TSTKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLITASFSDEAIKQFGSETPMKRAA  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P+EVAPSYVFLA +  SSY +GQ+LHPNGG IVN
Sbjct  254   QPVEVAPSYVFLACNHCSSYYTGQILHPNGGLIVN  288



>ref|XP_002884497.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH60756.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=291

 Score =   402 bits (1033),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 192/277 (69%), Positives = 234/277 (84%), Gaps = 3/277 (1%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G +H+M+P P++SS  YKPSNKL GK+ALVTGGDSGIG+AVC C+ALEGA+VAFTYVK +
Sbjct  15    GIQHVMEPTPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGASVAFTYVKGR  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA+ET+ ++ + K+ +AK+PI IA DLGF+ENCK+VV+EVV ++GRID+LVN AAEQ
Sbjct  75    EDKDADETLRLLHEVKTREAKEPIMIATDLGFEENCKRVVEEVVNSFGRIDVLVNCAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLT--RHALKYMKEGSSIINTTSINAYKGHAKLL  611
             +E S +E+IDE RL RV RTNI S FFL   R+ALK+MKEGSSIINTTS+ AY GH+ LL
Sbjct  135   HEVS-IEDIDEARLERVFRTNIFSQFFLVNYRYALKHMKEGSSIINTTSVVAYAGHSSLL  193

Query  610   DYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQR  431
             +YTATKGAIV+FTRGLALQL  KGIRVNGVAPGP+WTPLI ASF++E    FG + PM+R
Sbjct  194   EYTATKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLITASFSEEAIKQFGSETPMKR  253

Query  430   AAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             AA P+EVAPSYVFLA +  SSY +GQ+LHPNGG IVN
Sbjct  254   AAQPVEVAPSYVFLACNHCSSYYTGQILHPNGGLIVN  290



>ref|XP_010424987.1| PREDICTED: glucose and ribitol dehydrogenase homolog 2 [Camelina 
sativa]
Length=289

 Score =   400 bits (1027),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 190/275 (69%), Positives = 232/275 (84%), Gaps = 1/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G +H+M+P P++SS  YKPSNKL GK+ALVTGGDSGIG+AVC C+ALEGA+VAFTYVK +
Sbjct  15    GIQHVMEPTPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGASVAFTYVKGR  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA+ET+ ++ + K+ +A +PI IA DLGF+ENCK+VV+EVV A+GRID+LVN AAEQ
Sbjct  75    EDKDADETLRLLHEVKTREANEPIMIATDLGFEENCKRVVEEVVNAFGRIDVLVNCAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +E S +E+IDE RL RV RTNI S FFL ++ALK+MKEGSSIINTTS+ AY G++ LL+Y
Sbjct  135   HEVS-IEDIDEARLERVFRTNIFSQFFLVKYALKHMKEGSSIINTTSVVAYGGNSSLLEY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIV+FTRGLALQL  KGIRVNGVAPGP+WTPLI ASF+ E    FG + PM+RAA
Sbjct  194   TSTKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLITASFSDEAIKQFGSETPMKRAA  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P+EVAPSYVFLA +  SSY +GQVLHPNGG IVN
Sbjct  254   QPVEVAPSYVFLACNHCSSYYTGQVLHPNGGLIVN  288



>ref|XP_010485956.1| PREDICTED: glucose and ribitol dehydrogenase homolog 2-like [Camelina 
sativa]
Length=290

 Score =   396 bits (1018),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 191/276 (69%), Positives = 232/276 (84%), Gaps = 2/276 (1%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G +H+MDP P++SS  YKPSNKL GK+ALVTGGDSGIG+AVC C+ALEGA+VAFTYVK +
Sbjct  15    GIQHVMDPPPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGASVAFTYVKGR  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPI-AIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAE  788
             EDKDA+ET+ ++ + K+ +A +PI  IA DLGF+ENCK+VV+EVV A+GRID+LVN AAE
Sbjct  75    EDKDADETLRLLHEVKTREASEPIIMIATDLGFEENCKRVVEEVVNAFGRIDVLVNCAAE  134

Query  787   QYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLD  608
             Q+E S +E+IDE RL RV RTNI S FFL ++ALK+MKEGSSIINTTS+ AY G++ LL+
Sbjct  135   QHEVS-IEDIDEARLERVFRTNIFSQFFLVKYALKHMKEGSSIINTTSVVAYGGNSSLLE  193

Query  607   YTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRA  428
             YT+TKGAIV+FTRGLALQL  KGIRVNGVAPGP+WTPLI ASF+ E    FG + PM+RA
Sbjct  194   YTSTKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLITASFSDEAIKQFGSETPMKRA  253

Query  427   AHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             A P+EVAPSYVFLA +  SSY +GQVLHPNGG IVN
Sbjct  254   AQPVEVAPSYVFLACNHCSSYYTGQVLHPNGGLIVN  289



>ref|XP_003568968.1| PREDICTED: glucose and ribitol dehydrogenase homolog [Brachypodium 
distachyon]
Length=352

 Score =   398 bits (1022),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 197/282 (70%), Positives = 226/282 (80%), Gaps = 6/282 (2%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDPRP+     YKP+NKLQGK+ALVTGGDSGIGRAVC C+ALEGA+VAFTYVK  
Sbjct  71    GKEHAMDPRPESLIKHYKPANKLQGKVALVTGGDSGIGRAVCLCYALEGASVAFTYVKGH  130

Query  964   EDKDAEETVGIIKKAK-----SGDAKDPIAIAADLGFDENCKKVVDEVVRAYG-RIDILV  803
             EDKDAEET+  ++  K     + +A DPIAI ADLG++ENC+KVV++V +A+G RIDILV
Sbjct  131   EDKDAEETLNALRDIKKSHGHNNNAGDPIAIPADLGYEENCRKVVEQVAKAHGGRIDILV  190

Query  802   NNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGH  623
             NNAAEQY   S+ +I E  L RV RTNI SYF  T+HAL  M  G SIINT+SINAYKG+
Sbjct  191   NNAAEQYVRPSLADIGEQDLDRVFRTNIFSYFLTTKHALNQMPRGGSIINTSSINAYKGN  250

Query  622   AKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDV  443
             A LLDYTATKGAIVAFTR LALQL  KGIRVNGVAPGPIWTPLIP+SF +E+   FG +V
Sbjct  251   ATLLDYTATKGAIVAFTRALALQLAEKGIRVNGVAPGPIWTPLIPSSFPEEKVKQFGSEV  310

Query  442   PMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
             PM+RA  P EVAPSYVFLA+  DSSY+SGQ LH NGGAIVNG
Sbjct  311   PMKRAGQPGEVAPSYVFLASEQDSSYMSGQFLHVNGGAIVNG  352



>ref|XP_007154111.1| hypothetical protein PHAVU_003G091300g [Phaseolus vulgaris]
 gb|ESW26105.1| hypothetical protein PHAVU_003G091300g [Phaseolus vulgaris]
Length=294

 Score =   394 bits (1013),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 194/293 (66%), Positives = 241/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1198  MASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVC  1019
             MA+N   +FPPQ Q +QPGKEH+MDP PQ    +YKP+NKLQGK+ALVTGGDSGIGRAVC
Sbjct  1     MATNKDSKFPPQSQKTQPGKEHVMDPLPQTIHKDYKPANKLQGKVALVTGGDSGIGRAVC  60

Query  1018  QCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDE  839
              CFA EGATVAFTYVK  ED+D ++T+ ++ +AK+G A DP+AIAAD+GFDENCK+V+D 
Sbjct  61    LCFAKEGATVAFTYVKGHEDRDKDDTLKMLLEAKTGGADDPLAIAADIGFDENCKQVIDL  120

Query  838   VVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSI  659
             VV+ YGR+D+LVNNAAEQ+  +SVEEI + ++ RV  TNI S FFL +HALK+M++GSSI
Sbjct  121   VVKEYGRVDVLVNNAAEQHLTNSVEEITQQQIERVFGTNIFSQFFLVKHALKHMRKGSSI  180

Query  658   INTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASF  479
             IN+TS+NAY G+ + LDYTATKGAIVAFTRGL+ QLV++GIRVN VAPGP+WTP+ PAS 
Sbjct  181   INSTSVNAYNGNPEALDYTATKGAIVAFTRGLSQQLVSRGIRVNAVAPGPVWTPIQPASK  240

Query  478   TKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             + E   + G +VPM+RAA P E+AP Y+FLA   DSSY +GQVLHPNGG IVN
Sbjct  241   SGELVQNLGCEVPMKRAAQPSEIAPCYLFLATCQDSSYYTGQVLHPNGGEIVN  293



>gb|KDO59502.1| hypothetical protein CISIN_1g039897mg, partial [Citrus sinensis]
Length=272

 Score =   393 bits (1009),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 187/269 (70%), Positives = 224/269 (83%), Gaps = 14/269 (5%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+M+P PQ++SH+YKPSNKL+GK+ALVTGGDSGIGRAV  C+ALEGATVAFTYVK Q
Sbjct  18    GKEHVMEPTPQFTSHDYKPSNKLRGKVALVTGGDSGIGRAVAHCYALEGATVAFTYVKSQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA+ET+ I+++AK+ DAKDP+AI+ADLGFDENCK+VVDEVV AYG+IDILVNNAA Q
Sbjct  78    EEKDAQETLEILREAKTSDAKDPMAISADLGFDENCKRVVDEVVNAYGKIDILVNNAAVQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y+A SVEEIDE+RL RV RTNI S+FF+TRH+L++M EGS+IINTTS+       +    
Sbjct  138   YKAGSVEEIDEERLERVFRTNIFSHFFMTRHSLRHMNEGSAIINTTSVEPLWHSPE----  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
                        RGLALQLV +GIRVNGVAPGPIWTPLIP+SF++EE A FG +VPM+RA 
Sbjct  194   ----------ARGLALQLVERGIRVNGVAPGPIWTPLIPSSFSEEESAQFGSEVPMKRAG  243

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPN  338
              PIEVAP YVFLA +  SSYI+GQVLHPN
Sbjct  244   QPIEVAPCYVFLACNHCSSYITGQVLHPN  272



>ref|XP_004960440.1| PREDICTED: glucose and ribitol dehydrogenase homolog [Setaria 
italica]
Length=357

 Score =   396 bits (1017),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 191/278 (69%), Positives = 228/278 (82%), Gaps = 3/278 (1%)
 Frame = -1

Query  1141  KEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQE  962
             KEH MDPRP+     YK + KL+ K+ALVTGGDSGIGRAVC CFALEGATVAFTYVK  E
Sbjct  80    KEHAMDPRPEAIIKSYKAAGKLKDKVALVTGGDSGIGRAVCLCFALEGATVAFTYVKGHE  139

Query  961   DKDAEETVGIIK--KAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYG-RIDILVNNAA  791
             +KDAEET+  ++  K+++G A+DP+A+ ADLG++ENC++VV+EV  AYG RID+LVNNAA
Sbjct  140   EKDAEETLHALRGIKSRTGAARDPMAVPADLGYEENCRRVVEEVAGAYGGRIDVLVNNAA  199

Query  790   EQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLL  611
             EQYE  S+ +I E  L RV RTNI SYF +T+HAL +M+EGSS+INT+S+NAYKG+  L 
Sbjct  200   EQYERPSLSDITEANLDRVFRTNIYSYFLVTKHALPHMREGSSVINTSSVNAYKGNKTLT  259

Query  610   DYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQR  431
             DYTATKGAIVAFTR LALQL +KGIRVNGVAPGPIWTPLIPASF KE+   FG +VPM+R
Sbjct  260   DYTATKGAIVAFTRALALQLADKGIRVNGVAPGPIWTPLIPASFGKEKVEQFGSEVPMKR  319

Query  430   AAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
             A  P EVAPS+VFLA+  DSSY+SGQ LH NGG IVNG
Sbjct  320   AGQPAEVAPSFVFLASEQDSSYMSGQFLHVNGGVIVNG  357



>ref|XP_009398932.1| PREDICTED: glucose and ribitol dehydrogenase-like [Musa acuminata 
subsp. malaccensis]
Length=298

 Score =   393 bits (1009),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/281 (69%), Positives = 229/281 (81%), Gaps = 5/281 (2%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH M+  P+ +S EYKP+NKLQGK+ALVTGGDSGIGRAVC CFALEGATVAFTYVK Q
Sbjct  18    GKEHAMEAVPRATSEEYKPANKLQGKVALVTGGDSGIGRAVCYCFALEGATVAFTYVKSQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA +T+ ++++ K  +AKDPIAI ADLG++ENC+KVV+EV+  YG IDILVNN AEQ
Sbjct  78    EDKDANDTLQMLRQNKRSNAKDPIAIPADLGYEENCRKVVEEVMNTYGCIDILVNNDAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y    + EI E +L RV RTNI SYFF+++  +KYMK GSSIINTT +NAYKG+AKLLDY
Sbjct  138   YVRPLITEITEQQLERVFRTNIFSYFFVSKFVVKYMKAGSSIINTTWVNAYKGNAKLLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKGAIVAFTR LALQLV +GIRVNGVAPGP+WTPLIPASF +E+ A+FGK VPM RA 
Sbjct  198   TSTKGAIVAFTRALALQLVERGIRVNGVAPGPVWTPLIPASFPQEQVANFGKQVPMGRAG  257

Query  424   HPIEVAPSYVFLAASPDS-SYISGQVLHPN----GGAIVNG  317
              PIE+APS+VFLAA+PDS  +IS   L       GG +VNG
Sbjct  258   QPIEIAPSFVFLAATPDSWPWISYSSLASLLLCAGGTVVNG  298



>ref|XP_006408096.1| hypothetical protein EUTSA_v10022134mg [Eutrema salsugineum]
 gb|ESQ49549.1| hypothetical protein EUTSA_v10022134mg [Eutrema salsugineum]
Length=289

 Score =   391 bits (1004),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 187/276 (68%), Positives = 226/276 (82%), Gaps = 1/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ    +YKPSNKL G +ALVTGGDSGIG+AVC C+ALEGA+VAFTYVK +
Sbjct  15    GKEHVMDPTPQSCCPDYKPSNKLHGIVALVTGGDSGIGKAVCHCYALEGASVAFTYVKGR  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA+ET+ ++ + K+ +AK+PI IA DLGF+ENCK+VV+EVV A+GRID+LVN AAEQ
Sbjct  75    EDKDADETLRLLHEVKTREAKEPIMIATDLGFEENCKRVVEEVVNAFGRIDVLVNCAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +E S +++IDE RL RV RTNI S FFL ++ALK+MKEGSSIINTTS+ AY GH+ LL+Y
Sbjct  135   HEVS-IDDIDEARLERVFRTNIFSQFFLAKYALKHMKEGSSIINTTSVVAYAGHSNLLEY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
              +TKGAIV+FTR LALQL  K IRVNGVAPGP+WTPL+ ASF+ E    FG + PM+RAA
Sbjct  194   ASTKGAIVSFTRALALQLAPKNIRVNGVAPGPVWTPLVTASFSDEAIKKFGSETPMKRAA  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFLA    SSY +GQ+LHPNGG IVN 
Sbjct  254   QPGEVAPSYVFLACDHCSSYYTGQILHPNGGLIVNA  289



>gb|EMT30749.1| Glucose and ribitol dehydrogenase-like protein [Aegilops tauschii]
Length=293

 Score =   389 bits (1000),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 191/277 (69%), Positives = 222/277 (80%), Gaps = 2/277 (1%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDPRP+     YK +NKLQGK+ALVTGGDSGIGRAVC CFALEGATV FTYVK  
Sbjct  16    GKEHAMDPRPETLIKNYKSANKLQGKVALVTGGDSGIGRAVCLCFALEGATVNFTYVKGH  75

Query  964   EDKDAEETVGIIKKAKS-GDAKDPIAIAADLGFDENCKKVVDEVVRAYG-RIDILVNNAA  791
             EDKDAEET+  ++  KS   A +P A+A DLG++ENC++VV+EV  A+G R+DILVNNAA
Sbjct  76    EDKDAEETLQALRDIKSRTGAGEPKALAGDLGYEENCRRVVEEVASAHGGRVDILVNNAA  135

Query  790   EQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLL  611
             EQY    + EI E  L RV RTNI SYF + + A+K+M  GSSIINTTS+NAYKG+A LL
Sbjct  136   EQYVRPCITEISEQDLERVFRTNIFSYFLMAKFAVKHMGPGSSIINTTSVNAYKGNATLL  195

Query  610   DYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQR  431
             DYTATKGAIVAFTR L++QL  KGIRVNGVAPGPIWTPLIPASF +E+   FG +VPM+R
Sbjct  196   DYTATKGAIVAFTRALSMQLAEKGIRVNGVAPGPIWTPLIPASFPEEKVKQFGSEVPMKR  255

Query  430   AAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             A  P EVAPS+VFLA+  DSSYISGQV+HPNGG IVN
Sbjct  256   AGQPSEVAPSFVFLASEQDSSYISGQVIHPNGGTIVN  292



>sp|Q75KH3.2|GRDH_ORYSJ RecName: Full=Glucose and ribitol dehydrogenase homolog [Oryza 
sativa Japonica Group]
 gb|EEE62275.1| hypothetical protein OsJ_17062 [Oryza sativa Japonica Group]
Length=300

 Score =   389 bits (998),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 197/287 (69%), Positives = 230/287 (80%), Gaps = 13/287 (5%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDPRP+     YKP+NKL+ K+A+VTGGDSGIGRAVC CFALEGATVAFTYVK Q
Sbjct  16    GKEHAMDPRPEAIIQSYKPANKLKDKVAIVTGGDSGIGRAVCLCFALEGATVAFTYVKGQ  75

Query  964   EDKDAEETVGIIK--KAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYG-RIDILVNNA  794
             E+KDAEET+  ++  +A++G AKDP+AI ADLG+D+NC+KVVDEV  AYG  IDILVNNA
Sbjct  76    EEKDAEETLRALRDIRARTG-AKDPMAIPADLGYDDNCRKVVDEVAGAYGGAIDILVNNA  134

Query  793   AEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGS--------SIINTTSIN  638
             AEQYE  S+ +I ED L RV RTNI SYFF+++HA+K M++          SIINT+SIN
Sbjct  135   AEQYERPSITDITEDDLERVFRTNIFSYFFMSKHAVKRMRDRRGGAGAGGCSIINTSSIN  194

Query  637   AYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECAS  458
             AYKG+  LLDYTATKGAIVAFTR LALQL  +GIRVNGVAPGPIWTPLIPASF +E+   
Sbjct  195   AYKGNKTLLDYTATKGAIVAFTRALALQLAEEGIRVNGVAPGPIWTPLIPASFAEEKVRQ  254

Query  457   FGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
             FG  VPM RA  P EVAPS+VFL AS D+SY+SGQ+LH NGG IVNG
Sbjct  255   FGSQVPMGRAGQPSEVAPSFVFL-ASDDASYMSGQMLHVNGGVIVNG  300



>gb|EAY96497.1| hypothetical protein OsI_18399 [Oryza sativa Indica Group]
Length=300

 Score =   389 bits (998),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 197/287 (69%), Positives = 230/287 (80%), Gaps = 13/287 (5%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDPRP+     YKP+NKL+ K+A+VTGGDSGIGRAVC CFALEGATVAFTYVK Q
Sbjct  16    GKEHAMDPRPEAIIQSYKPANKLKDKVAIVTGGDSGIGRAVCLCFALEGATVAFTYVKGQ  75

Query  964   EDKDAEETVGIIK--KAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYG-RIDILVNNA  794
             E+KDAEET+  ++  +A++G AKDP+AI ADLG+D+NC+KVVDEV  AYG  IDILVNNA
Sbjct  76    EEKDAEETLRALRDIRARTG-AKDPMAIPADLGYDDNCRKVVDEVAGAYGGAIDILVNNA  134

Query  793   AEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGS--------SIINTTSIN  638
             AEQYE  S+ +I ED L RV RTNI SYFF+++HA+K M++          SIINT+SIN
Sbjct  135   AEQYERPSITDITEDDLERVFRTNIFSYFFMSKHAVKRMRDRRGGAGAGGCSIINTSSIN  194

Query  637   AYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECAS  458
             AYKG+  LLDYTATKGAIVAFTR LALQL  +GIRVNGVAPGPIWTPLIPASF +E+   
Sbjct  195   AYKGNKTLLDYTATKGAIVAFTRALALQLAEEGIRVNGVAPGPIWTPLIPASFAEEKVRQ  254

Query  457   FGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
             FG  VPM RA  P EVAPS+VFL AS D+SY+SGQ+LH NGG IVNG
Sbjct  255   FGSQVPMGRAGQPSEVAPSFVFL-ASDDASYMSGQMLHVNGGVIVNG  300



>pir||T06212 glucose and ribitol dehydrogenase homolog - barley
Length=293

 Score =   389 bits (998),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 190/277 (69%), Positives = 222/277 (80%), Gaps = 2/277 (1%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDPRP+     YK +NKLQGK+ALVTGGDSGIGRAVC C ALEGATV FTYVK  
Sbjct  16    GKEHAMDPRPEAIIKNYKSANKLQGKVALVTGGDSGIGRAVCLCLALEGATVNFTYVKGH  75

Query  964   EDKDAEETVGIIKKAKS-GDAKDPIAIAADLGFDENCKKVVDEVVRAYG-RIDILVNNAA  791
             EDKDAEET+  ++  KS   A +P A++ DLG++ENC++VV+EV  A+G R+DILVNNAA
Sbjct  76    EDKDAEETLQALRDIKSRTGAGEPKALSGDLGYEENCRRVVEEVANAHGGRVDILVNNAA  135

Query  790   EQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLL  611
             EQY    + EI E  L RV RTNI SYF +T+ A+K+M  GSSIINTTS+NAYKG+A LL
Sbjct  136   EQYVRPCITEITEQDLERVFRTNIFSYFLMTKFAVKHMGPGSSIINTTSVNAYKGNATLL  195

Query  610   DYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQR  431
             DYTATKGAIVAFTR L++QL  KGIRVNGVAPGPIWTPLIPASF +E+   FG +VPM+R
Sbjct  196   DYTATKGAIVAFTRALSMQLAEKGIRVNGVAPGPIWTPLIPASFPEEKVKQFGSEVPMKR  255

Query  430   AAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             A  P EVAPS+VFLA+  DSSYISGQ+LHPNGG IVN
Sbjct  256   AGQPSEVAPSFVFLASEQDSSYISGQILHPNGGTIVN  292



>ref|XP_003610393.1| Glucose and ribitol dehydrogenase-like protein [Medicago truncatula]
 gb|AES92590.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=294

 Score =   388 bits (996),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/276 (67%), Positives = 229/276 (83%), Gaps = 1/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+M+P PQ  + ++ P+NKL+GK+ALVTGGDSGIGRAVC  FA EGATVAFTYVK  
Sbjct  18    GKEHVMEPLPQTINPDHNPTNKLRGKVALVTGGDSGIGRAVCLIFAKEGATVAFTYVKGV  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGR-IDILVNNAAE  788
             ED+D ++T+ ++ +AK+ DA++P+AIAAD+G+DENCK+VV+ VV+ YG  ID+LVNNAAE
Sbjct  78    EDRDKDDTLKMLLEAKTSDAQEPLAIAADIGYDENCKQVVELVVKEYGSSIDVLVNNAAE  137

Query  787   QYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLD  608
             Q+  +S+EEI E +L RV RTNI S+FFL RHALK+MKEGSSIIN+TS+NAY G A+ LD
Sbjct  138   QHLRNSIEEITEQQLERVFRTNIFSHFFLVRHALKHMKEGSSIINSTSVNAYTGKAETLD  197

Query  607   YTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRA  428
             YT+TKGAIVAFTRGLA QLV+KGIRVN VAPGPIWTP+ PA+   E+  + G DVPM+RA
Sbjct  198   YTSTKGAIVAFTRGLAQQLVSKGIRVNAVAPGPIWTPVQPATMPYEKIQNLGSDVPMKRA  257

Query  427   AHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
               P E+AP Y+FLA+  DSSY +GQVLHPNGG IVN
Sbjct  258   GQPCEIAPCYLFLASLQDSSYFTGQVLHPNGGVIVN  293



>ref|XP_011090772.1| PREDICTED: glucose and ribitol dehydrogenase-like [Sesamum indicum]
Length=282

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/275 (69%), Positives = 224/275 (81%), Gaps = 1/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+MDP PQ  + +Y+ +NKL GK+ALVTGGDSGIGR+VC  FALEGATVAFTYV  Q
Sbjct  8     GKEHLMDPIPQALNPDYRQANKLHGKVALVTGGDSGIGRSVCYLFALEGATVAFTYVPGQ  67

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDA +T+  I++ KS DAKDPIA+ ADLGFDENCKKVVDEVV  +GRIDILVNNAAEQ
Sbjct  68    EEKDAHDTLKKIQELKSADAKDPIALPADLGFDENCKKVVDEVVNNFGRIDILVNNAAEQ  127

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +  S++EEIDE+RL RV RTNI S+FF+TRHALK+MKEGSS+IN+TS+ AY G   LLDY
Sbjct  128   HMTSTIEEIDENRLERVFRTNIFSHFFMTRHALKHMKEGSSVINSTSVVAYCGSDILLDY  187

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
              +TKGAIV+FTRGLALQLV KGIRVN VA GP+WTPL  ++  +E     G + PM RAA
Sbjct  188   CSTKGAIVSFTRGLALQLVEKGIRVNAVAAGPVWTPLQVSTKPEELIKKIGSETPMGRAA  247

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P E+APSYVFL AS +SSY +GQ LHPNGG IVN
Sbjct  248   QPHEIAPSYVFL-ASDESSYFTGQALHPNGGMIVN  281



>dbj|BAJ85825.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=347

 Score =   389 bits (998),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 190/277 (69%), Positives = 222/277 (80%), Gaps = 2/277 (1%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDPRP+     YK +NKLQGK+ALVTGGDSGIGRAVC C ALEGATV FTYVK  
Sbjct  70    GKEHAMDPRPEAIIKNYKSANKLQGKVALVTGGDSGIGRAVCLCLALEGATVNFTYVKGH  129

Query  964   EDKDAEETVGIIKKAKS-GDAKDPIAIAADLGFDENCKKVVDEVVRAYG-RIDILVNNAA  791
             EDKDAEET+  ++  KS   A +P A++ DLG++ENC++VV+EV  A+G R+DILVNNAA
Sbjct  130   EDKDAEETLQALRDIKSRTGAGEPKALSGDLGYEENCRRVVEEVANAHGGRVDILVNNAA  189

Query  790   EQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLL  611
             EQY    + EI E  L RV RTNI SYF +T+ A+K+M  GSSIINTTS+NAYKG+A LL
Sbjct  190   EQYVRPCITEITEQDLERVFRTNIFSYFLMTKFAVKHMGPGSSIINTTSVNAYKGNATLL  249

Query  610   DYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQR  431
             DYTATKGAIVAFTR L++QL  KGIRVNGVAPGPIWTPLIPASF +E+   FG +VPM+R
Sbjct  250   DYTATKGAIVAFTRALSMQLAEKGIRVNGVAPGPIWTPLIPASFPEEKVKQFGSEVPMKR  309

Query  430   AAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             A  P EVAPS+VFLA+  DSSYISGQ+LHPNGG IVN
Sbjct  310   AGQPSEVAPSFVFLASEQDSSYISGQILHPNGGTIVN  346



>ref|NP_001241158.1| uncharacterized protein LOC100809384 [Glycine max]
 gb|ACU23410.1| unknown [Glycine max]
 gb|KHN03060.1| Glucose and ribitol dehydrogenase [Glycine soja]
Length=294

 Score =   386 bits (991),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 189/293 (65%), Positives = 236/293 (81%), Gaps = 0/293 (0%)
 Frame = -1

Query  1198  MASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVC  1019
             MASN   +FP Q Q +QPGKEH+M+P PQ ++ ++K +NKLQGK+ALVTGGDSGIGRAVC
Sbjct  1     MASNKESKFPAQSQKTQPGKEHVMNPLPQATNPDHKAANKLQGKVALVTGGDSGIGRAVC  60

Query  1018  QCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDE  839
              CFA EGATVAFTYVK  ED+D ++T+ ++ +AK+  A +P+AIAAD+GFDENCK+V+D 
Sbjct  61    LCFAKEGATVAFTYVKGHEDRDKDDTLKMLLEAKTSGADNPLAIAADIGFDENCKQVIDL  120

Query  838   VVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSI  659
             VV+ YGR+D+LVNNAAEQ+  +SVEEI + +L RV  TNI S FFL +HALK+MKEGS I
Sbjct  121   VVKEYGRLDVLVNNAAEQHLTNSVEEITQQQLERVFGTNIFSQFFLVKHALKHMKEGSCI  180

Query  658   INTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASF  479
             IN+TS+NAY G+ + LDYTATKGAIVAFTRGL+ QL ++GIRVNGVAPGP+WTP+ PAS 
Sbjct  181   INSTSVNAYNGNPEALDYTATKGAIVAFTRGLSQQLASRGIRVNGVAPGPVWTPIQPASK  240

Query  478   TKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
               E   + G +VPM R A P E+AP Y+FLA   DSSY +GQVLHPNGG +VN
Sbjct  241   PAEMIQNLGCEVPMNRVAQPCEIAPCYLFLATCQDSSYFTGQVLHPNGGMVVN  293



>ref|NP_001054600.1| Os05g0140800 [Oryza sativa Japonica Group]
 gb|AAS90638.1| putative NAD-/NADP-dependent oxidoreductase [Oryza sativa Japonica 
Group]
 gb|AAU10779.1| putative NAD-/NADP-dependent oxidoreductase [Oryza sativa Japonica 
Group]
 dbj|BAF16514.1| Os05g0140800 [Oryza sativa Japonica Group]
Length=365

 Score =   389 bits (998),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 197/287 (69%), Positives = 230/287 (80%), Gaps = 13/287 (5%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDPRP+     YKP+NKL+ K+A+VTGGDSGIGRAVC CFALEGATVAFTYVK Q
Sbjct  81    GKEHAMDPRPEAIIQSYKPANKLKDKVAIVTGGDSGIGRAVCLCFALEGATVAFTYVKGQ  140

Query  964   EDKDAEETVGIIK--KAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYG-RIDILVNNA  794
             E+KDAEET+  ++  +A++G AKDP+AI ADLG+D+NC+KVVDEV  AYG  IDILVNNA
Sbjct  141   EEKDAEETLRALRDIRARTG-AKDPMAIPADLGYDDNCRKVVDEVAGAYGGAIDILVNNA  199

Query  793   AEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGS--------SIINTTSIN  638
             AEQYE  S+ +I ED L RV RTNI SYFF+++HA+K M++          SIINT+SIN
Sbjct  200   AEQYERPSITDITEDDLERVFRTNIFSYFFMSKHAVKRMRDRRGGAGAGGCSIINTSSIN  259

Query  637   AYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECAS  458
             AYKG+  LLDYTATKGAIVAFTR LALQL  +GIRVNGVAPGPIWTPLIPASF +E+   
Sbjct  260   AYKGNKTLLDYTATKGAIVAFTRALALQLAEEGIRVNGVAPGPIWTPLIPASFAEEKVRQ  319

Query  457   FGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
             FG  VPM RA  P EVAPS+VFL AS D+SY+SGQ+LH NGG IVNG
Sbjct  320   FGSQVPMGRAGQPSEVAPSFVFL-ASDDASYMSGQMLHVNGGVIVNG  365



>ref|XP_011021590.1| PREDICTED: glucose and ribitol dehydrogenase-like [Populus euphratica]
Length=295

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/276 (66%), Positives = 223/276 (81%), Gaps = 0/276 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE++M P PQ  + +Y+PSNKL GK+ALVTGGDSGIGR+VC  FALEGATVAFTYV+  
Sbjct  20    GKEYLMHPLPQAINPKYQPSNKLHGKVALVTGGDSGIGRSVCYHFALEGATVAFTYVEGI  79

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED+D +ET+ ++ KAKS  AK+PIAIA D+ F+ENCKKVVD+VV  +G+IDILVNNAAEQ
Sbjct  80    EDRDKDETLQMLLKAKSNVAKEPIAIATDVKFEENCKKVVDQVVSEFGQIDILVNNAAEQ  139

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y  +++EEI E RL R+ RTNI S FF+ RH+LKYMKEGS IINT S NAY G ++ LDY
Sbjct  140   YYVTAIEEITESRLERIFRTNIFSQFFMARHSLKYMKEGSCIINTASANAYTGGSQFLDY  199

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIV FTRGL+  L++KGIRVN V+PGP+WTP+ PAS   E+ AS G DVPM RAA
Sbjct  200   SSTKGAIVTFTRGLSQLLISKGIRVNAVSPGPVWTPIQPASLPAEKVASLGSDVPMDRAA  259

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFLA++  SSY +GQVLHPNGG IVN 
Sbjct  260   QPYEIAPSYVFLASNECSSYFNGQVLHPNGGLIVNA  295



>gb|KDP40130.1| hypothetical protein JCGZ_02128 [Jatropha curcas]
Length=295

 Score =   377 bits (968),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/275 (65%), Positives = 221/275 (80%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E++M P P+  +  YKPSNKL GK+AL+TGGDSGIGRAV   F LEGATVAFTYVKP+
Sbjct  20    GLEYVMHPLPESINPHYKPSNKLHGKVALITGGDSGIGRAVAYYFTLEGATVAFTYVKPR  79

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKD + T+ I+ + K+  +KDPIAI  D+GF+ENCKKVVD+V+  YG+IDILVN  A Q
Sbjct  80    EDKDKDHTLKILHEIKTEGSKDPIAIPTDVGFEENCKKVVDQVMSEYGQIDILVNCTAVQ  139

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             + + S+++I E RL RV RTNI SYFF+ + ALKYMKEGS IINTTS+ AY+G+A+LLDY
Sbjct  140   FYSHSIQDITEARLERVFRTNIFSYFFMAKEALKYMKEGSCIINTTSLVAYRGYAELLDY  199

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIV+FTR LAL L+ +GIRVNGVAPGP+WTPL PAS   E  AS G +VPM RA 
Sbjct  200   SSTKGAIVSFTRSLALHLIERGIRVNGVAPGPVWTPLQPASLPAEVVASLGSEVPMDRAG  259

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P E+APS+VFLAA+  SSYI+GQV+HPNGGAI+N
Sbjct  260   QPFEIAPSFVFLAANECSSYITGQVVHPNGGAIIN  294



>ref|XP_002517191.1| short chain dehydrogenase, putative [Ricinus communis]
 gb|EEF45354.1| short chain dehydrogenase, putative [Ricinus communis]
Length=295

 Score =   376 bits (966),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 182/275 (66%), Positives = 217/275 (79%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GK+++M P P   + +YKPSNKL GK+ALVTGGDSGIGRAVC  F+LEGATVAFTYVK  
Sbjct  20    GKQYVMHPLPHSINPDYKPSNKLHGKVALVTGGDSGIGRAVCYYFSLEGATVAFTYVKGI  79

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKD ++ + ++++ K  DAKDPIAIA D+ ++ENCKKVVDEVV  YGRID+LVNNAA +
Sbjct  80    EDKDKDDALEMVRRVKVKDAKDPIAIATDIRYEENCKKVVDEVVNGYGRIDVLVNNAALE  139

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+EEI E  L  + RTNI S FFL RHALK+MKEGSSIINTTS+ AY G   LLDY
Sbjct  140   HYTCSIEEITEADLESLFRTNIFSQFFLVRHALKHMKEGSSIINTTSVLAYTGDPNLLDY  199

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
              +TKGAI++FTRGL+ QL+ KGIRVNGVAPGPIWTPL PAS   EE A  G D PM RA 
Sbjct  200   CSTKGAILSFTRGLSTQLIGKGIRVNGVAPGPIWTPLQPASLPAEEVAILGSDTPMDRAG  259

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P EVAP+YVFLA++  SSYI+GQV+HPNGG I+N
Sbjct  260   QPYEVAPAYVFLASNECSSYITGQVIHPNGGMIIN  294



>ref|XP_002517192.1| short chain dehydrogenase, putative [Ricinus communis]
 gb|EEF45355.1| short chain dehydrogenase, putative [Ricinus communis]
Length=295

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 181/275 (66%), Positives = 217/275 (79%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GK+++M P PQ  + +YKPSNKL GK+ALVTGGDSGIGRAVC  F+LEGATVAFTYVK  
Sbjct  20    GKQYVMHPLPQSINPDYKPSNKLHGKVALVTGGDSGIGRAVCYYFSLEGATVAFTYVKGI  79

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKD ++ + + ++ K+ DAKDPIAIA D+ ++ENCKKV+DEVV  YGRID+LVNNA  Q
Sbjct  80    EDKDKDDALEMFQEVKAKDAKDPIAIATDIRYEENCKKVIDEVVNEYGRIDVLVNNAGLQ  139

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+EEI E  L  + RTNI S FFL RHALK+MKEGSSIINTTS+ AY GH  LLDY
Sbjct  140   HYTYSIEEITEVDLESLFRTNIFSQFFLVRHALKHMKEGSSIINTTSVLAYTGHPNLLDY  199

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
              +TKGAI++FTRGL+ QL+ KGIRVNGVAPGP WTPL PAS   EE A  G D PM RA 
Sbjct  200   CSTKGAILSFTRGLSAQLIGKGIRVNGVAPGPTWTPLQPASLPAEEVAILGSDTPMDRAG  259

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P E+AP+YVFLA++  SS+I+GQV+HPNGG IVN
Sbjct  260   QPHEIAPAYVFLASNECSSFITGQVIHPNGGIIVN  294



>ref|NP_001140439.1| uncharacterized protein LOC100272498 [Zea mays]
 gb|ACF83842.1| unknown [Zea mays]
 gb|ACG49026.1| general stress protein 39 [Zea mays]
 gb|ACZ54904.1| short-chain dehydrogenase/reductase SDR family protein [Zea mays]
Length=304

 Score =   375 bits (962),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/277 (64%), Positives = 224/277 (81%), Gaps = 2/277 (1%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDPRP+    +YK +NKL+ K+ALVTGGDSGIGRAVC CFA EGATVAFT+V+ Q
Sbjct  27    GKEHAMDPRPEAIVQDYKAANKLKDKVALVTGGDSGIGRAVCLCFAKEGATVAFTFVRGQ  86

Query  964   EDKDAEETVGIIKKAKS-GDAKDPIAIAADLGFDENCKKVVDEVVRAYG-RIDILVNNAA  791
             E+KDAEET+  ++   S   A++P+A+ ADLG++ NC++VV+ V  AYG RID++VNNAA
Sbjct  87    EEKDAEETLRALRDIGSETGAREPMALPADLGYEANCREVVERVASAYGGRIDVVVNNAA  146

Query  790   EQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLL  611
             EQYE  S+ ++ E  L RV RTNI SYF +++HA+  M+ G+ IINT+S+NAYKG+  LL
Sbjct  147   EQYERESIGDVTEADLERVFRTNIFSYFLVSKHAVPRMEPGACIINTSSVNAYKGNKTLL  206

Query  610   DYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQR  431
             DYTATKGAIVAFTR L+LQL ++GIRVNGVAPGP+WTPLIPASF KE+   FG  VPM+R
Sbjct  207   DYTATKGAIVAFTRALSLQLADRGIRVNGVAPGPVWTPLIPASFGKEKVEQFGSQVPMKR  266

Query  430   AAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             AA P E+APS+VFLA++ DSSY+SGQ+LH NGG IVN
Sbjct  267   AAQPAEIAPSFVFLASNQDSSYMSGQILHVNGGVIVN  303



>ref|XP_006654977.1| PREDICTED: LOW QUALITY PROTEIN: glucose and ribitol dehydrogenase 
homolog [Oryza brachyantha]
Length=351

 Score =   374 bits (961),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 186/280 (66%), Positives = 218/280 (78%), Gaps = 16/280 (6%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDPRP+     YKP+ KLQ K+A+VTGGDSGIGRAVC CFALEGATVAFTYVK Q
Sbjct  84    GKEHAMDPRPEAIIQNYKPAKKLQDKVAIVTGGDSGIGRAVCLCFALEGATVAFTYVKGQ  143

Query  964   EDKDAEETVGIIK--KAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAA  791
             E+KDAEET+  ++  + ++G A++P+AI ADLG++EN ++             ILVNNAA
Sbjct  144   EEKDAEETLRALRDIRVRTGGAREPMAIPADLGYEENWRRX------------ILVNNAA  191

Query  790   EQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGS--SIINTTSINAYKGHAK  617
             EQYE   + +I ED L RV RTNI SYFF+++HA+K M  G   SIINT+SINAYKG+  
Sbjct  192   EQYERPCITDITEDDLERVFRTNIFSYFFMSKHAVKRMPAGGGGSIINTSSINAYKGNKT  251

Query  616   LLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPM  437
             LLDYTATKGAIVAFTR LALQLV+KGIRVNGVAPGPIWTPLIPASF  E+   FG  VPM
Sbjct  252   LLDYTATKGAIVAFTRALALQLVDKGIRVNGVAPGPIWTPLIPASFPPEKVKQFGSQVPM  311

Query  436   QRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
             QRA  P EVAPSYVFLA+  DSSY+SGQ+LH NGGA+VNG
Sbjct  312   QRAGQPSEVAPSYVFLASEQDSSYMSGQMLHVNGGAVVNG  351



>tpg|DAA41374.1| TPA: general stress protein 39Short-chain dehydrogenase/reductase 
SDR family protein [Zea mays]
Length=358

 Score =   374 bits (961),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 178/277 (64%), Positives = 224/277 (81%), Gaps = 2/277 (1%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDPRP+    +YK +NKL+ K+ALVTGGDSGIGRAVC CFA EGATVAFT+V+ Q
Sbjct  81    GKEHAMDPRPEAIVQDYKAANKLKDKVALVTGGDSGIGRAVCLCFAKEGATVAFTFVRGQ  140

Query  964   EDKDAEETVGIIKKAKS-GDAKDPIAIAADLGFDENCKKVVDEVVRAYG-RIDILVNNAA  791
             E+KDAEET+  ++   S   A++P+A+ ADLG++ NC++VV+ V  AYG RID++VNNAA
Sbjct  141   EEKDAEETLRALRDIGSETGAREPMALPADLGYEANCREVVERVASAYGGRIDVVVNNAA  200

Query  790   EQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLL  611
             EQYE  S+ ++ E  L RV RTNI SYF +++HA+  M+ G+ IINT+S+NAYKG+  LL
Sbjct  201   EQYERESIGDVTEADLERVFRTNIFSYFLVSKHAVPRMEPGACIINTSSVNAYKGNKTLL  260

Query  610   DYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQR  431
             DYTATKGAIVAFTR L+LQL ++GIRVNGVAPGP+WTPLIPASF KE+   FG  VPM+R
Sbjct  261   DYTATKGAIVAFTRALSLQLADRGIRVNGVAPGPVWTPLIPASFGKEKVEQFGSQVPMKR  320

Query  430   AAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             AA P E+APS+VFLA++ DSSY+SGQ+LH NGG IVN
Sbjct  321   AAQPAEIAPSFVFLASNQDSSYMSGQILHVNGGVIVN  357



>ref|XP_004507706.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cicer 
arietinum]
Length=293

 Score =   371 bits (952),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 182/275 (66%), Positives = 228/275 (83%), Gaps = 0/275 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH+M+P PQ    ++KP+NKL+GK+ALVTGGDSGIGRAVC  FA EGATVAFTYVK Q
Sbjct  18    GKEHLMEPLPQAIHPDHKPANKLRGKVALVTGGDSGIGRAVCVIFAKEGATVAFTYVKGQ  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED+D ++T+ ++ +AK+ DA++P+AIAAD+G+DENCK+VV+ VV+ YGRID+LVNNAAEQ
Sbjct  78    EDRDKDDTLKMLLEAKTSDAQEPLAIAADIGYDENCKQVVELVVKEYGRIDVLVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +  +S+EEI E +L RV RTNI S FFL RHALK+MKEGSSIIN++S+NAY G A+ LDY
Sbjct  138   HLKNSIEEITEPQLERVFRTNIFSQFFLVRHALKHMKEGSSIINSSSVNAYIGKAETLDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             T+TKG IVAFTRGLA QLV +GIRVN VAPGP+WTP+ PA+   E+  + G +VPM+RA 
Sbjct  198   TSTKGGIVAFTRGLAQQLVKRGIRVNAVAPGPVWTPVQPATMPSEKIQNLGSEVPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P E+AP Y+FLA+  DSSY +GQVLHPNGG IVN
Sbjct  258   QPCEIAPCYLFLASLQDSSYFTGQVLHPNGGVIVN  292



>ref|XP_002439250.1| hypothetical protein SORBIDRAFT_09g003150 [Sorghum bicolor]
 gb|EES17680.1| hypothetical protein SORBIDRAFT_09g003150 [Sorghum bicolor]
Length=327

 Score =   370 bits (950),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 183/280 (65%), Positives = 218/280 (78%), Gaps = 4/280 (1%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDPRP+     YK +NKL+ K+ALVTGGDSGIGRAVC  FA EGA+VAFTYVK  
Sbjct  48    GKEHAMDPRPEAILQNYKAANKLKNKVALVTGGDSGIGRAVCLLFAAEGASVAFTYVKGH  107

Query  964   EDKDAEETVGIIKKAKS-GDAKDPIAIAADLGFDENCKKVVDEVVRAYG-RIDILVNNAA  791
             EDKDAEET+  ++   S   A+ P+A+AADLG++++C+ VV+EV  A+G RID+LVNNAA
Sbjct  108   EDKDAEETLRALRDISSRTGARPPMALAADLGYEDSCRSVVEEVASAHGGRIDVLVNNAA  167

Query  790   EQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKE--GSSIINTTSINAYKGHAK  617
             EQ+E  S+ E+ E  L RV RTNI SYF  T+HA+  M    G S+INT S+NAYKGH  
Sbjct  168   EQHERRSITEVAEPDLDRVFRTNIFSYFLTTKHAVARMAPHGGGSVINTASVNAYKGHKT  227

Query  616   LLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPM  437
             LLDYT+TKGAIV+FTR LALQL +KGIRVNGVAPGPIWTPLIPASF +E+   FG +VPM
Sbjct  228   LLDYTSTKGAIVSFTRALALQLADKGIRVNGVAPGPIWTPLIPASFGEEKVEQFGSEVPM  287

Query  436   QRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
             +RA  P EVAPSYVFLA+  DSSYI+GQ LH NGG IVNG
Sbjct  288   KRAGQPAEVAPSYVFLASEQDSSYITGQFLHVNGGVIVNG  327



>ref|XP_002311602.2| hypothetical protein POPTR_0008s14850g [Populus trichocarpa]
 gb|EEE88969.2| hypothetical protein POPTR_0008s14850g [Populus trichocarpa]
Length=295

 Score =   367 bits (942),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/277 (64%), Positives = 221/277 (80%), Gaps = 1/277 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE++M P P   + +YKPS KL GK+ALVTGGDSGIGR+VC  FALEGATVAFTYV+  
Sbjct  19    GKEYVMCPLPLAINPDYKPSEKLNGKVALVTGGDSGIGRSVCYHFALEGATVAFTYVQGI  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED+D ++T+ ++ KAKS DA+DPIAIA D+  +E+CK+VV++V   YGRIDILVNNA  Q
Sbjct  79    EDRDKDDTLKMLLKAKSSDAEDPIAIATDVSSEEDCKRVVEQVASKYGRIDILVNNAGVQ  138

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHA-KLLD  608
             +  + VEEI E+ L+R+ RTNI  YFF+T+H+LK+MKEGS IINT S+ AY G   +LLD
Sbjct  139   HYTNLVEEITEEWLVRMFRTNIFGYFFMTKHSLKHMKEGSCIINTASVTAYAGSPHQLLD  198

Query  607   YTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRA  428
             Y +TKG+IV+FTRGLAL+LV+KGIRVNGVAPGPIWTPL PAS    E    G DVPM+RA
Sbjct  199   YLSTKGSIVSFTRGLALRLVDKGIRVNGVAPGPIWTPLQPASLPAYEVEYLGSDVPMRRA  258

Query  427   AHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
               P E+APSYVFLA++  SSY++GQVLHPNGG I+NG
Sbjct  259   GQPYEMAPSYVFLASNQCSSYMTGQVLHPNGGTIING  295



>ref|XP_011025991.1| PREDICTED: glucose and ribitol dehydrogenase-like [Populus euphratica]
Length=295

 Score =   366 bits (940),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/277 (65%), Positives = 220/277 (79%), Gaps = 1/277 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE++M P P   + +YKPS KL GK+ALVTGGDSGIGR+VC  FALEGATVAFTYV+  
Sbjct  19    GKEYVMCPLPLAINPDYKPSEKLNGKVALVTGGDSGIGRSVCYHFALEGATVAFTYVQGI  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED+D ++T+ ++ KAKS DA DPIAIA D+  +E+CK+VV++V   YGRIDILVNNA  Q
Sbjct  79    EDRDKDDTLKMLLKAKSSDADDPIAIATDVSSEEDCKRVVEQVASKYGRIDILVNNAGVQ  138

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHA-KLLD  608
             +  + VEEI ED L+R+ RTNI   FF+T+H+LK+MKEGS IINTTS+ AY G   +LLD
Sbjct  139   HYTNLVEEITEDWLVRLFRTNIFGCFFMTKHSLKHMKEGSCIINTTSVTAYAGSPHQLLD  198

Query  607   YTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRA  428
             Y +TKG+IV+FTRGLAL+LV+KGIRVNGVAPGPIWTPL PAS    E    G DVPM+RA
Sbjct  199   YLSTKGSIVSFTRGLALRLVDKGIRVNGVAPGPIWTPLQPASLPAYEVEYLGSDVPMRRA  258

Query  427   AHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
               P E+APSYVFLA++  SSY++GQVLHPNGG I+NG
Sbjct  259   GQPYEMAPSYVFLASNQCSSYMTGQVLHPNGGTIING  295



>ref|XP_001752356.1| predicted protein [Physcomitrella patens]
 gb|EDQ83089.1| predicted protein [Physcomitrella patens]
Length=302

 Score =   365 bits (937),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/270 (64%), Positives = 213/270 (79%), Gaps = 1/270 (0%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE  MDP P +    YKP+ KL+GK+ALVTGGDSGIGR+V   FA+EGATVAFTY+   
Sbjct  15    GKEFEMDPLPNHMRPVYKPAGKLEGKVALVTGGDSGIGRSVGHHFAMEGATVAFTYLPGP  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA+ET+ I+KK++  + KDP+ I  DL +DENCKKV+DEVV+ YGRIDILVNNA EQ
Sbjct  75    EDKDADETIDILKKSQGPNGKDPLKIPVDLRYDENCKKVIDEVVKKYGRIDILVNNAGEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   ++E+++ +++ R  R+NI S F+L RH L +MKEGS+IIN+TS+NA+KG+A LLDY
Sbjct  135   HTVQNIEDLEPEQIERTFRSNIFSMFYLVRHVLPHMKEGSAIINSTSVNAFKGNATLLDY  194

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             TATKGAI AFTRGLALQLV +GIRVN VAPGP+WTPLIP+SF  E+   FG  VPM RA 
Sbjct  195   TATKGAITAFTRGLALQLVKRGIRVNSVAPGPVWTPLIPSSFPAEKTEKFGSQVPMGRAG  254

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNG  335
              P E+A SYVFL AS DSSY +GQ LHPNG
Sbjct  255   EPAEIATSYVFL-ASEDSSYFTGQTLHPNG  283



>tpg|DAA41375.1| TPA: hypothetical protein ZEAMMB73_293728 [Zea mays]
Length=353

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/272 (64%), Positives = 220/272 (81%), Gaps = 2/272 (1%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH MDPRP+    +YK +NKL+ K+ALVTGGDSGIGRAVC CFA EGATVAFT+V+ Q
Sbjct  81    GKEHAMDPRPEAIVQDYKAANKLKDKVALVTGGDSGIGRAVCLCFAKEGATVAFTFVRGQ  140

Query  964   EDKDAEETVGIIKKAKS-GDAKDPIAIAADLGFDENCKKVVDEVVRAYG-RIDILVNNAA  791
             E+KDAEET+  ++   S   A++P+A+ ADLG++ NC++VV+ V  AYG RID++VNNAA
Sbjct  141   EEKDAEETLRALRDIGSETGAREPMALPADLGYEANCREVVERVASAYGGRIDVVVNNAA  200

Query  790   EQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLL  611
             EQYE  S+ ++ E  L RV RTNI SYF +++HA+  M+ G+ IINT+S+NAYKG+  LL
Sbjct  201   EQYERESIGDVTEADLERVFRTNIFSYFLVSKHAVPRMEPGACIINTSSVNAYKGNKTLL  260

Query  610   DYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQR  431
             DYTATKGAIVAFTR L+LQL ++GIRVNGVAPGP+WTPLIPASF KE+   FG  VPM+R
Sbjct  261   DYTATKGAIVAFTRALSLQLADRGIRVNGVAPGPVWTPLIPASFGKEKVEQFGSQVPMKR  320

Query  430   AAHPIEVAPSYVFLAASPDSSYISGQVLHPNG  335
             AA P E+APS+VFLA++ DSSY+SGQ+LH NG
Sbjct  321   AAQPAEIAPSFVFLASNQDSSYMSGQILHVNG  352



>gb|EYU41520.1| hypothetical protein MIMGU_mgv1a0189502mg, partial [Erythranthe 
guttata]
Length=252

 Score =   359 bits (922),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/251 (70%), Positives = 204/251 (81%), Gaps = 0/251 (0%)
 Frame = -1

Query  1072  GKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPI  893
             GK+ LV GGD+GIGRAVC  FALEGATVAFTYV+ QE+KDAE+T+  I++ K+ DAKDPI
Sbjct  1     GKVCLVIGGDTGIGRAVCYHFALEGATVAFTYVQGQEEKDAEDTLKKIQELKTPDAKDPI  60

Query  892   AIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICS  713
             A+AAD+GFDENCK VVD VV  +GRIDILVNNAAEQ+   +VEEIDE+RL R  RTNI S
Sbjct  61    ALAADVGFDENCKMVVDGVVNKFGRIDILVNNAAEQHMTHTVEEIDENRLERTFRTNIFS  120

Query  712   YFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIR  533
             +FF+TRHALK+MKEGS+IIN+TS+ AY G   LLDY ATKGAIV+FTR LALQLV KGIR
Sbjct  121   HFFMTRHALKHMKEGSTIINSTSVAAYCGSPMLLDYCATKGAIVSFTRALALQLVEKGIR  180

Query  532   VNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQ  353
             VN VAPGP+WTPL  A+  +E  A  G + PM RAA P E+APSYVFLA+   SSY +GQ
Sbjct  181   VNAVAPGPVWTPLQVATMPEEAAAKVGAETPMGRAAQPHEIAPSYVFLASDESSSYFTGQ  240

Query  352   VLHPNGGAIVN  320
             VLHPNGG IVN
Sbjct  241   VLHPNGGMIVN  251



>ref|XP_008363981.1| PREDICTED: LOW QUALITY PROTEIN: glucose and ribitol dehydrogenase-like 
[Malus domestica]
Length=279

 Score =   352 bits (903),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 179/276 (65%), Positives = 207/276 (75%), Gaps = 17/276 (6%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQ-GKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKP  968
             GKEH MDP PQ+++ +YKPSNKLQ   I L++            C         F Y + 
Sbjct  19    GKEHAMDPTPQFTNPDYKPSNKLQVHHIVLLS------------CLTXHN----FHYHRF  62

Query  967   QEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAE  788
             ++DKDA+ET+  IK+ K+ DAK+P+A+AADLGFDENCKKVVDEV  AYGRIDILVNNAAE
Sbjct  63    KQDKDAKETLQAIKQVKASDAKEPMALAADLGFDENCKKVVDEVANAYGRIDILVNNAAE  122

Query  787   QYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLD  608
             QY+A SVE+IDE RL RV RTNI S FF+T HALK+MKEG S+I TTSI AYKG   LLD
Sbjct  123   QYKAGSVEDIDEARLERVFRTNIFSCFFMTGHALKHMKEGGSVICTTSIVAYKGSDSLLD  182

Query  607   YTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRA  428
             Y ATKGAIVAF RGLALQ V +GIRVNGVAPGPIWTPLIPASF +EE   FG +VPMQRA
Sbjct  183   YCATKGAIVAFIRGLALQQVKRGIRVNGVAPGPIWTPLIPASFDEEEVQRFGNEVPMQRA  242

Query  427   AHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
               P EV P+YVFLA+   SSY +GQV HP+GG IVN
Sbjct  243   GQPYEVGPTYVFLASEAFSSYYTGQVFHPBGGVIVN  278



>ref|XP_002517190.1| short chain dehydrogenase, putative [Ricinus communis]
 gb|EEF45353.1| short chain dehydrogenase, putative [Ricinus communis]
Length=290

 Score =   351 bits (900),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/288 (60%), Positives = 225/288 (78%), Gaps = 0/288 (0%)
 Frame = -1

Query  1198  MASNNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVC  1019
             MA+  G +FPPQ QD QPGKE++M P P++ +  YKPSNKLQ K+ALVTGGDSGIGRAV 
Sbjct  1     MATRRGYRFPPQSQDKQPGKEYLMHPLPEFINPHYKPSNKLQDKVALVTGGDSGIGRAVS  60

Query  1018  QCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDE  839
               F LEGATVAFTYVK +EDKD +  + I+ + K+  AKDPIAI  D+GF+ENC+KV+D+
Sbjct  61    YYFTLEGATVAFTYVKGREDKDKDHILKILHEVKAEGAKDPIAIPTDVGFEENCRKVIDQ  120

Query  838   VVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSI  659
             ++  YG+IDILVNNA E + ++++E+I +  L RV RTNI  +FF++RHALK+MKEG  I
Sbjct  121   IMSEYGKIDILVNNAGEAHYSTTIEDITDPMLERVFRTNIFGHFFMSRHALKHMKEGGCI  180

Query  658   INTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASF  479
             INT S+ AY G + ++DY++TKGA+VAFTR LALQL+++GIRVN VAPG +WTP  P++ 
Sbjct  181   INTASVAAYAGFSFMVDYSSTKGAVVAFTRSLALQLIDRGIRVNAVAPGSVWTPFQPSTL  240

Query  478   TKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNG  335
             + E+ A  G  VPM RAA P E+APS+VFLA++  SSY +GQVLHPNG
Sbjct  241   SAEQVAQVGSGVPMDRAAQPYEIAPSFVFLASNDCSSYFTGQVLHPNG  288



>ref|XP_002961003.1| hypothetical protein SELMODRAFT_402549 [Selaginella moellendorffii]
 gb|EFJ38542.1| hypothetical protein SELMODRAFT_402549 [Selaginella moellendorffii]
Length=278

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/277 (60%), Positives = 212/277 (77%), Gaps = 15/277 (5%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G +H+MDP P+    +YKPS+KL+ K+AL+TGGDSGIGRAV   ++LEGA+VA TYV  +
Sbjct  14    GVQHVMDPHPRTKRSDYKPSDKLKNKVALITGGDSGIGRAVAYFYSLEGASVAITYVPGK  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDAEE + +IK+AK+  AKDPI I AD+            VV+AYGRIDILVNNAAEQ
Sbjct  74    EEKDAEEAIHMIKEAKTAHAKDPIMIPADI------------VVKAYGRIDILVNNAAEQ  121

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSS-IINTTSINAYKGHAKLLD  608
             Y    +E++  ++L RV RTNI S+F+L+R+A+ +MKEG   IINTTS+NAYKG+  L+D
Sbjct  122   YRVQKIEDLKPEQLERVFRTNIFSHFYLSRYAVPHMKEGEGCIINTTSVNAYKGNKTLID  181

Query  607   YTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTK-EECASFGKDVPMQR  431
             YT+TKGAIV FTR LAL LV++GIRVNGVAPGP+W PLIPAS  + E+   FG+  PM +
Sbjct  182   YTSTKGAIVGFTRSLALNLVDRGIRVNGVAPGPVWAPLIPASSPEPEQTEHFGEQCPMGK  241

Query  430   AAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             AA P ++APSYVFL AS D+++ +GQVLHPNGG IVN
Sbjct  242   AAQPDDIAPSYVFL-ASEDAAFFTGQVLHPNGGMIVN  277



>ref|XP_001752921.1| predicted protein [Physcomitrella patens]
 gb|EDQ82425.1| predicted protein [Physcomitrella patens]
Length=289

 Score =   333 bits (853),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 211/275 (77%), Gaps = 8/275 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G+EH+MDP P++    YK + KL  KIALVTGGDSGIGRAV   F  EGATVAFTYVK  
Sbjct  15    GEEHLMDPVPRHHGTNYKAAGKL--KIALVTGGDSGIGRAVGVLFTREGATVAFTYVKGA  72

Query  964   EDKDAEETVGIIK--KAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAA  791
             E+KDA +T+ ++K  KA+ G   +P+AI  DLGFDE CKKVVD+VV  YGRIDILVNNAA
Sbjct  73    EEKDAVDTINLLKQYKAEGGGEGEPLAIPCDLGFDEQCKKVVDKVVEKYGRIDILVNNAA  132

Query  790   EQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLL  611
             EQ+   ++E++  ++L R  RTNI S F+L RHALK+MKEGS IINTTS+NA+KG+  LL
Sbjct  133   EQHVVENIEDLQPEQLERTFRTNIFSQFYLVRHALKHMKEGSCIINTTSVNAFKGNTTLL  192

Query  610   DYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASF---TKEECASFGKDVP  440
             DYT+TKGAI+AFTRGLALQLV +GIRVN VAPGPIWTPLIPAS    + E+  SFG   P
Sbjct  193   DYTSTKGAILAFTRGLALQLVKRGIRVNAVAPGPIWTPLIPASMGQGSPEKMKSFGSQCP  252

Query  439   MQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNG  335
             M RA  P E+A +YVFL AS DSSY +GQ LHPNG
Sbjct  253   MGRAGEPEEIATAYVFL-ASEDSSYFTGQTLHPNG  286



>gb|ADE76781.1| unknown [Picea sitchensis]
Length=288

 Score =   331 bits (848),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/272 (60%), Positives = 204/272 (75%), Gaps = 2/272 (1%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E++M+PRP   +  YKP++KL+GK+A+VTGGDSGIGRAVC  FALEGATVAF Y+ P 
Sbjct  13    GLEYLMEPRPLSVAPHYKPADKLKGKVAVVTGGDSGIGRAVCYHFALEGATVAFVYLSPA  72

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAI-AADLGFDENCKKVVDEVVRAYGRIDILVNNAAE  788
             E+ DAEET+  +++ K+ DAKDP+ I  ADLG+DE CKKVV++VV  YG IDILVN AAE
Sbjct  73    EEVDAEETLQRLREYKTADAKDPMKIPVADLGYDEACKKVVNDVVVTYGGIDILVNCAAE  132

Query  787   QYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLD  608
              +   ++E++  ++L R  RTN+ S FF+  HA+K+M EGS+IINT S  AY G    LD
Sbjct  133   IHVVDNIEDMKAEQLERTFRTNVFSQFFMVSHAVKFMGEGSNIINTLSRQAYLGAPSTLD  192

Query  607   YTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRA  428
             Y +TKGAI+ FTRGLA QLV +GIRVNGVAPGPIWTP+   +    E A  G+D PM RA
Sbjct  193   YASTKGAILTFTRGLAKQLVKRGIRVNGVAPGPIWTPINAVALNPNEIAHLGEDTPMGRA  252

Query  427   AHPIEVAPSYVFLAASPDSSYISGQVLHPNGG  332
               P EVAPSYVFL AS D+SY+ GQVLHPNGG
Sbjct  253   GQPCEVAPSYVFL-ASQDASYMIGQVLHPNGG  283



>ref|XP_002967005.1| hypothetical protein SELMODRAFT_230991 [Selaginella moellendorffii]
 gb|EFJ31604.1| hypothetical protein SELMODRAFT_230991 [Selaginella moellendorffii]
Length=278

 Score =   330 bits (845),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 163/277 (59%), Positives = 211/277 (76%), Gaps = 15/277 (5%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G +H+MDP P+    +YKPS+KL+ K+AL+TGGDSGIGRAV   ++LEGA+VA TYV  +
Sbjct  14    GVQHVMDPHPRTRRSDYKPSDKLKNKVALITGGDSGIGRAVAYFYSLEGASVAITYVPGK  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDAEE + +IK+AK+  AKDPI I  D+            VV+AYGRIDILVNNAAEQ
Sbjct  74    EEKDAEEAIHMIKEAKTAHAKDPIMIPGDI------------VVKAYGRIDILVNNAAEQ  121

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSS-IINTTSINAYKGHAKLLD  608
             Y    +E++  ++L RV RTNI S+F+L+R+A+ +MKEG   IINTTS+NAYKG+  L+D
Sbjct  122   YRVQKIEDLKPEQLERVFRTNIFSHFYLSRYAVPHMKEGEGCIINTTSVNAYKGNKTLID  181

Query  607   YTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTK-EECASFGKDVPMQR  431
             YT+TKGAIV FTR LAL LV++GIRVNGVAPGP+W PLIPAS  + ++   FG+  PM +
Sbjct  182   YTSTKGAIVGFTRSLALNLVDRGIRVNGVAPGPVWAPLIPASSPEPQQTEHFGEQCPMGK  241

Query  430   AAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             AA P ++APSYVFL AS D+++ +GQVLHPNGG IVN
Sbjct  242   AAQPDDIAPSYVFL-ASEDAAFFTGQVLHPNGGMIVN  277



>ref|WP_019491234.1| short-chain dehydrogenase [Calothrix sp. PCC 7103]
Length=284

 Score =   326 bits (835),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 207/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+PQ    +Y+ S KL+ K+AL+TG DSGIGRAV   +A EGA VA  Y+   
Sbjct  16    GSEAQMTPKPQADDSKYRGSGKLENKVALITGADSGIGRAVAIAYAKEGANVAILYLS--  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA+ET  +++K   G A   + IA D+G +  C++ V + V  +G++DILVNNAAEQ
Sbjct  74    EHEDAKETKHLVEK-YGGRA---VTIAGDIGSESFCQQAVQQTVDEFGKLDILVNNAAEQ  129

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I E++L +  RTNI S FF+T+ A+K++ EGS+IINTTS+ AYKG  +LLDY
Sbjct  130   HPQESIEDITEEQLEKTFRTNIFSMFFMTKAAMKHLHEGSAIINTTSVTAYKGSPELLDY  189

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV KGIRVNGVAPGPIWTPLIPA+F +E+ ASFGK VPMQR  
Sbjct  190   SSTKGAIVAFTRSLSQNLVEKGIRVNGVAPGPIWTPLIPATFPEEKVASFGKQVPMQRPG  249

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFL AS DSSYI+GQVLHPNGGA+VNG
Sbjct  250   QPEEVAPSYVFL-ASDDSSYITGQVLHPNGGAVVNG  284



>ref|XP_001773923.1| predicted protein [Physcomitrella patens]
 gb|EDQ61271.1| predicted protein [Physcomitrella patens]
Length=297

 Score =   326 bits (836),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/276 (61%), Positives = 203/276 (74%), Gaps = 6/276 (2%)
 Frame = -1

Query  1135  HIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGA-TVAFTYVKPQED  959
              I  P+PQY S +Y P+ KL+GK+A+VTGGDSGIGR+V   FA EGA  V   Y  P+ED
Sbjct  23    EIQGPKPQYYSDKYVPAGKLEGKVAIVTGGDSGIGRSVSVLFAAEGAEAVVIVYKAPEED  82

Query  958   KDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQYE  779
              D E TV  I++   G  K  + I  DLG D+NCK  +D VV+ +GRID+LVNNA+EQ+ 
Sbjct  83    IDGEHTVKDIERVSLGKCKARV-IRTDLGHDDNCKLTIDAVVKEFGRIDVLVNNASEQFY  141

Query  778   ASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDYTA  599
               S+EEI+ ++L R  R+NI S F++TRHA+K+MKEG+ IINTTSI AY+G   LLDY+A
Sbjct  142   KESIEEIEPEQLERTFRSNIFSMFYMTRHAVKHMKEGACIINTTSITAYQGAPMLLDYSA  201

Query  598   TKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKE--ECASFGKD-VPMQRA  428
             TKGAI+AFTRGLALQLV +GIRVNGVAPGPIWTP IPASF  E  E A +G   VPM RA
Sbjct  202   TKGAILAFTRGLALQLVKRGIRVNGVAPGPIWTPFIPASFPAEQTEGAKWGTSTVPMARA  261

Query  427   AHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
               P E   +YVFL AS DSSY +GQVLHPNGGA+VN
Sbjct  262   GQPFECGTAYVFL-ASEDSSYYTGQVLHPNGGAVVN  296



>ref|WP_015204565.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Crinalium epipsammum]
 ref|YP_007143970.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Crinalium epipsammum 
PCC 9333]
 gb|AFZ14460.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Crinalium epipsammum 
PCC 9333]
Length=285

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/276 (58%), Positives = 206/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+PQ    +Y+ S KL+GK+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  17    GIESEMTPKPQADDDKYRGSGKLEGKVALITGGDSGIGRAVAIAFAKEGANVAIAYLN--  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+E   ++++      +    IA D+G +  C++ V + V A G++DILVNNAAEQ
Sbjct  75    EHDDAKEAKQLVEQ----QGRKCFTIAGDIGDESFCQQAVQQTVDALGQLDILVNNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I  ++L R  RTNI + F+LT+ A+K++KEGS+IINTTS+ AYKG+ +LLDY
Sbjct  131   HPQESIEDITAEQLERTFRTNIFAMFYLTKAAMKHLKEGSAIINTTSVTAYKGNQQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIV FTR L+  L+ KGIRVNGVAPGPIWTPLIPA+F +E+ ASFGK+VPMQRA 
Sbjct  191   SSTKGAIVTFTRSLSQSLIEKGIRVNGVAPGPIWTPLIPATFPEEKVASFGKEVPMQRAG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFL AS DSSYISGQ+LHPNGG +VNG
Sbjct  251   QPEEIAPSYVFL-ASDDSSYISGQILHPNGGVVVNG  285



>ref|WP_016859210.1| short-chain dehydrogenase [Fischerella muscicola]
Length=286

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/276 (58%), Positives = 204/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+PQ    +Y+ S KL+ K+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GIESEMTPKPQADDSQYQGSGKLKNKVALITGGDSGIGRAVAIAFAKEGADVAIVYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  +++       +    I+ D+G +  C++ + + +  +G++DILVNNAAEQ
Sbjct  76    EHDDAKETKHLVE----AQGRKAFTISGDVGDENFCQQAIQQTIDEFGKLDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I +++L R  RTNI S FFLT+ ALKY+KEGS+IINTTS+ AYKG  +LLDY
Sbjct  132   HPQKSIEDISQEQLERTFRTNIFSMFFLTKAALKYLKEGSNIINTTSVTAYKGSQELLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV KGIRVN VAPGPIWTPLIPA+F +E+ A+FGK VPMQRA 
Sbjct  192   SSTKGAIVAFTRSLSQNLVEKGIRVNAVAPGPIWTPLIPATFPEEKVANFGKQVPMQRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFL AS D+SYI+GQVLHPNGG +VNG
Sbjct  252   QPEEIAPSYVFL-ASDDASYITGQVLHPNGGTVVNG  286



>ref|WP_017318827.1| short-chain dehydrogenase [Mastigocladopsis repens]
Length=284

 Score =   324 bits (831),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 159/276 (58%), Positives = 208/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P+    +Y+ S+KL+ K+AL+TGGDSGIGRAV   FA EGA VA +Y+   
Sbjct  16    GVESQMTPKPKADDPQYQGSDKLKDKVALITGGDSGIGRAVAIAFAKEGADVAISYLN--  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  +++       +  +AIA D+G +  C++V+ + V  +G++DILVNNAAEQ
Sbjct  74    EHDDAKETKHLVESL----GRRAVAIAGDIGDEAFCQQVIQQTVDEFGKLDILVNNAAEQ  129

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I +++L R  RTNI S FF+T+ A+K+++EGSSIINTTS+ AYKG+ +LLDY
Sbjct  130   HPQKSIEDISKEQLERTFRTNIFSMFFMTKAAMKHLREGSSIINTTSVTAYKGNPQLLDY  189

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV KGIRVN VAPGPIWTPLIP++F +E+  +FGK VPMQRA 
Sbjct  190   SSTKGAIVAFTRALSQSLVEKGIRVNAVAPGPIWTPLIPSTFPEEKVETFGKQVPMQRAG  249

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFL AS DSSY SGQVLHPNGG +VNG
Sbjct  250   QPEEVAPSYVFL-ASDDSSYFSGQVLHPNGGTVVNG  284



>ref|WP_015217262.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Anabaena cylindrica]
 ref|YP_007159559.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Anabaena cylindrica 
PCC 7122]
 gb|AFZ60649.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Anabaena cylindrica 
PCC 7122]
Length=285

 Score =   324 bits (830),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 158/276 (57%), Positives = 209/276 (76%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M+P+P+  + EY+ S KL+ KIAL+TGGDSGIGRAV   FA EGA VA  Y+  Q
Sbjct  17    GVESKMEPKPKADNAEYRGSGKLKDKIALITGGDSGIGRAVAIAFAKEGADVAIVYL--Q  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA ET  +++K      +  + I  D+  ++ C++ +++ V  +G++DILVNNAAEQ
Sbjct  75    EHGDATETKNLVEK----HGRKAVTITGDITHEDFCQQAIEQTVDEFGKLDILVNNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +  +S+E+I +++L R  RTNI S FFLT+ A+K++++GSSIINTTS+ AYKG A+LLDY
Sbjct  131   HPQNSIEDISQEQLERTFRTNIFSMFFLTKAAMKHLRQGSSIINTTSVTAYKGSAQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV+KGIRVN VAPGPIWTPLIP++F +E+  +FG  VPM+RA 
Sbjct  191   SSTKGAIVAFTRSLSQNLVSKGIRVNAVAPGPIWTPLIPSTFPEEKVENFGAQVPMERAG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPS+VFL AS DSSY+SGQVLHPNGG IVNG
Sbjct  251   QPEEVAPSFVFL-ASDDSSYMSGQVLHPNGGEIVNG  285



>ref|WP_026964919.1| short-chain dehydrogenase [Alicyclobacillus pomorum]
Length=288

 Score =   324 bits (830),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 161/276 (58%), Positives = 208/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M+PRP Y + +   S KLQGK A+VTGGDSGIGRAV   FA EGA VA  ++   
Sbjct  20    GLEIEMNPRPFYDNPQAHGSGKLQGKTAIVTGGDSGIGRAVAVAFAKEGADVAIVFLD--  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DAEET   +++      +  ++IAAD+G +E+CK VV +V+  +GRID+LVNNAAEQ
Sbjct  78    EHQDAEETARAVQQY----GRMCLSIAADIGVEEHCKNVVRDVMNTFGRIDVLVNNAAEQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +  +S+E I  +++ +  RTN+ S+F++T+ AL +M+ GSSI+NTTSI AYKGH +L+DY
Sbjct  134   HPQNSLEYITAEQIEKTFRTNVFSFFYMTKAALPHMQSGSSIVNTTSITAYKGHEQLIDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIVAFTR L+ QLV +GIRVN VAPGPIWTPLIP++F  E+ A FG D PM+RA 
Sbjct  194   SATKGAIVAFTRSLSQQLVGRGIRVNAVAPGPIWTPLIPSTFPAEQVAKFGSDTPMKRAG  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              PIEVAPSYVFL AS D+SY+SGQVLH NGG +VNG
Sbjct  254   QPIEVAPSYVFL-ASDDASYMSGQVLHVNGGTVVNG  288



>ref|WP_017310770.1| short-chain dehydrogenase [Fischerella sp. PCC 9339]
Length=286

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/276 (58%), Positives = 204/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+PQ    +Y+ S KL+ K+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GIESEMTPKPQADDPQYQGSGKLKNKVALITGGDSGIGRAVAIAFAKEGADVAIAYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  +++       +    I+ D+G +  C++ + + V  +G++DILVNNAAEQ
Sbjct  76    EHDDAKETKHLVE----AQGRKAFTISGDVGDENFCQQAIQQTVDEFGKLDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I +++L +  RTNI S FFLT+ ALKY+KEGS+IINTTS+ AYKG  +LLDY
Sbjct  132   HPQKSIEDISKEQLEKTFRTNIFSMFFLTKAALKYLKEGSNIINTTSVTAYKGSQELLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV KGIRVN VAPGPIWTPLIPA+F +E+ A+FGK VPMQRA 
Sbjct  192   SSTKGAIVAFTRSLSQNLVEKGIRVNAVAPGPIWTPLIPATFPEEKVANFGKQVPMQRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFL AS D+SYI+GQVLHPNGG +VNG
Sbjct  252   QPEEIAPSYVFL-ASDDASYITGQVLHPNGGTVVNG  286



>ref|WP_015138394.1| dehydrogenase [Nostoc sp. PCC 7524]
 ref|YP_007075545.1| dehydrogenase [Nostoc sp. PCC 7524]
 gb|AFY47948.1| dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase 
like protein [Nostoc sp. PCC 7524]
Length=285

 Score =   322 bits (826),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 160/276 (58%), Positives = 208/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M PRP+    +Y+ S KLQ K+AL+TGGDSGIGRAV   FA EGA VAF Y+K  
Sbjct  17    GVESKMQPRPKAEDAQYRGSGKLQDKVALITGGDSGIGRAVAIAFAKEGADVAFVYLK--  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DAEET   +++      +  ++IA D+  +  C++VV + V  +G++DIL+NNAAEQ
Sbjct  75    EHSDAEETKNRVEE----HGRRALSIAGDITDEGFCQRVVQQTVDEFGKLDILINNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +  +S+E+I  ++L R  RTNI S F+LT+ A+K++++GS+IINTTS+ AYKG+ +LLDY
Sbjct  131   HPQNSIEDITSEQLERTFRTNIFSMFYLTKAAIKHLQKGSAIINTTSVTAYKGNQQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  L++KGIRVN VAPGPIWTPLIPA+F  ++ A+FGK VPM RA 
Sbjct  191   SSTKGAIVAFTRSLSQNLISKGIRVNAVAPGPIWTPLIPATFPADKVANFGKQVPMGRAG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFLAA  DSSY+SGQVLHPNGG IVNG
Sbjct  251   QPEEVAPSYVFLAAD-DSSYMSGQVLHPNGGEIVNG  285



>ref|WP_016877040.1| short-chain dehydrogenase [Chlorogloeopsis fritschii]
Length=286

 Score =   322 bits (825),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/276 (57%), Positives = 206/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P+    +Y+ S KL+ K+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GIESEMTPKPKAEDSQYQGSGKLKNKVALITGGDSGIGRAVAIAFAKEGADVAIAYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  +++       +  + +A D+G +  C+++V + V  +G++DILVNNAAEQ
Sbjct  76    EHDDAKETKHLVE----AQGRRAVTVAGDIGDETFCQQLVQQTVDEFGKLDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I +D+L R  RTNI S FFLT+ A+K++KEGS+IINTTS+ AYKG  +LLDY
Sbjct  132   HPQKSIEDISKDQLERTFRTNIFSMFFLTKAAIKHLKEGSAIINTTSVTAYKGSPQLLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV KGIRVN VAPGPIWTPLIPA+F +++ A+FGK VPMQRA 
Sbjct  192   SSTKGAIVAFTRSLSESLVEKGIRVNAVAPGPIWTPLIPATFPEDKVANFGKQVPMQRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFL AS D+SY+SGQVLHPNGG +VNG
Sbjct  252   QPEEIAPSYVFL-ASDDASYMSGQVLHPNGGVVVNG  286



>ref|WP_026733559.1| short-chain dehydrogenase [Fischerella sp. PCC 9605]
Length=286

 Score =   322 bits (825),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 158/276 (57%), Positives = 206/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P+    +Y+ S+KL+ KIAL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GIESEMTPKPKADDSQYQGSSKLKNKIALITGGDSGIGRAVAIAFAKEGADVAIVYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  +++       +  + I+ D+G +  C++ V + V  +G++DIL+NNAAEQ
Sbjct  76    EHDDAKETKHLVE----AQGRRAVTISGDIGDESFCQQAVQQTVDEFGKLDILINNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I +++L R  RTNI S FFLT+ A+K++KEGS+IINTTS+ AYKG  +LLDY
Sbjct  132   HPQKSIEDISKEQLERTFRTNIFSMFFLTKAAMKHLKEGSAIINTTSVTAYKGSPELLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV KGIRVN VAPGPIWTPLIPA+F +E+ ASFG+ VPM+RA 
Sbjct  192   SSTKGAIVAFTRSLSQSLVEKGIRVNAVAPGPIWTPLIPATFPEEKVASFGEQVPMKRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFL AS DSSY+SGQVLHPNGG +VNG
Sbjct  252   QPEEIAPSYVFL-ASDDSSYMSGQVLHPNGGVVVNG  286



>ref|WP_040549836.1| short-chain dehydrogenase [Pedosphaera parvula]
Length=288

 Score =   322 bits (824),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 159/275 (58%), Positives = 205/275 (75%), Gaps = 7/275 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G+E+ M P+P+ +S EY+ S KLQGKIAL+TGGDSGIGRA    FA EGA VA  Y+   
Sbjct  20    GRENKMSPKPRDASPEYRGSGKLQGKIALITGGDSGIGRATAVLFAREGADVAIAYL--N  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E KDA ETV +++K    + +  IAIA D+G +++C+KVV   V+ +G+++ILVNNAAEQ
Sbjct  78    EHKDARETVRLVEK----EGRKCIAIADDVGNEKHCQKVVQTAVKQFGKLNILVNNAAEQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +  I   +L R  RTNI S+FF+ +  LKY+KEGS+IINTTS+ AY+G ++LLDY
Sbjct  134   HPQPDITRISSKQLERTFRTNIFSHFFMVKATLKYLKEGSAIINTTSVTAYRGSSQLLDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  L  K IRVNGVAPGPIWTPLIP++F  E+   FG DVP+ R  
Sbjct  194   SSTKGAIVAFTRSLSENLAAKKIRVNGVAPGPIWTPLIPSTFPAEKVKKFGTDVPLGRPG  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P+EVAPSYVFL AS DSSY++GQVLHPNGG +VN
Sbjct  254   QPMEVAPSYVFL-ASGDSSYMTGQVLHPNGGEVVN  287



>ref|WP_036011125.1| short-chain dehydrogenase [Leptolyngbya sp. JSC-1]
Length=287

 Score =   322 bits (824),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 158/276 (57%), Positives = 206/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M PRP+    +YK S+KL+ K+AL+TGGDSGIGRAV   +A EGA VA  Y+   
Sbjct  19    GVEAEMTPRPKSQDKQYKGSDKLRNKVALITGGDSGIGRAVAIAYAKEGADVAIVYLN--  76

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA+ET  ++++    + +  +AIA D+G +  C++ V + V+  G++DILVNNAAEQ
Sbjct  77    EHEDAKETQRLVEQ----EGRKCVAIAGDIGVESFCQQAVQKTVQELGKLDILVNNAAEQ  132

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E I  ++L R  RTNI S F+LT+ AL ++KEGS+IIN+TS+ AYKG+ +LLDY
Sbjct  133   HPQESIENISAEQLERTFRTNIFSMFYLTKAALPHLKEGSAIINSTSVTAYKGNPQLLDY  192

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             + TKGAIVAFTR L+  LV KGIRVNGVAPGPIWTPLIP++F +E+  SFG  VPMQRA 
Sbjct  193   STTKGAIVAFTRSLSQALVGKGIRVNGVAPGPIWTPLIPSTFPEEKVESFGAQVPMQRAG  252

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFL AS DSSY+SGQ+LHPNGG +VNG
Sbjct  253   QPEEIAPSYVFL-ASDDSSYMSGQILHPNGGEVVNG  287



>ref|WP_010999306.1| short-chain dehydrogenase [Nostoc sp. PCC 7120]
 ref|NP_489222.1| oxidoreductase [Nostoc sp. PCC 7120]
 dbj|BAB76881.1| oxidoreductase [Nostoc sp. PCC 7120]
Length=285

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 206/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+PQ    +Y+ S KL+ K+AL+TGGDSGIGRAV   +A EGA VAF Y+   
Sbjct  17    GTESKMQPKPQADDAQYRGSGKLKDKVALITGGDSGIGRAVAIAYAKEGADVAFVYLS--  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DAEET  ++++      +  ++IA D+  +  C++ + + V  +G++DIL+NNAAEQ
Sbjct  75    EHDDAEETKNLVEE----QGRRAVSIAGDITDEAFCQRAIQQTVDEFGKLDILINNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I +++L R  RTNI S F+LT+ A+K++K+GS+IINTTS+ AYKG  +LLDY
Sbjct  131   HPQESIEDITKEQLERTFRTNIFSMFYLTKAAIKHLKKGSAIINTTSVTAYKGSPQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  L++KGIRVN VAPGPIWTPLIP++F  E+  +FGK VPMQRA 
Sbjct  191   SSTKGAIVAFTRSLSQNLISKGIRVNAVAPGPIWTPLIPSTFPAEKVETFGKQVPMQRAG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFL AS DSSY+SGQVLHPNGG +VNG
Sbjct  251   QPEEVAPSYVFL-ASDDSSYMSGQVLHPNGGEVVNG  285



>ref|WP_026722248.1| short-chain dehydrogenase [Fischerella sp. PCC 9431]
Length=286

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/276 (57%), Positives = 203/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+PQ    +Y+ S KL+ KIAL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GIESEMTPKPQADDRQYQGSGKLKNKIALITGGDSGIGRAVAIAFAKEGADVAIVYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  +++       +    IA D+G +  C++ + + V  +G++DILVNNAAEQ
Sbjct  76    EHDDAKETKHLVE----AQGRKAFTIAGDVGDENFCQQAIQQTVDEFGKLDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   ++E+I +++L R  RTNI S FFLT+ AL+++KEGSSI+NTTS+ AYKG  +LLDY
Sbjct  132   HPQKNIEDISKEQLERTFRTNIFSMFFLTKAALQHLKEGSSIVNTTSVTAYKGSQELLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV KGIRVN VAPGPIWTPLIPA+F +E+ A+FGK VPMQR  
Sbjct  192   SSTKGAIVAFTRSLSQNLVEKGIRVNAVAPGPIWTPLIPATFPEEKVANFGKQVPMQRPG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFL AS D+SYI+GQVLHPNGG +VNG
Sbjct  252   QPEEIAPSYVFL-ASDDASYITGQVLHPNGGTVVNG  286



>gb|KIJ82733.1| short-chain dehydrogenase [Scytonema tolypothrichoides VB-61278]
Length=284

 Score =   320 bits (820),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/275 (57%), Positives = 205/275 (75%), Gaps = 7/275 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P+    +YK S+KL+ K+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  16    GVESEMTPKPKADDPQYKGSDKLKDKVALITGGDSGIGRAVAIAFAKEGADVAIVYLN--  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET   ++       +  +AIA D+G +  C++ V + V  +G++DILVNNAAEQ
Sbjct  74    EHDDAKETKQFVESL----GRRAVAIAGDIGDETFCQQAVQQTVDEFGKLDILVNNAAEQ  129

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I +++L R  RTNI S F+LT+ ALK++KEGS+IIN+TS+ AYKG  +LLDY
Sbjct  130   HPQESIEDISKEQLERTFRTNIFSMFYLTKAALKHLKEGSTIINSTSVTAYKGSPELLDY  189

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+L L+ KGIRVN VAPGPIWTPLIP++F +E+  +FGK VPMQRA 
Sbjct  190   SSTKGAIVAFTRSLSLSLIEKGIRVNAVAPGPIWTPLIPSTFPEEKVKTFGKQVPMQRAG  249

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P EVAPS+VFL AS DSSY SGQVLHPNGG++VN
Sbjct  250   QPEEVAPSFVFL-ASDDSSYFSGQVLHPNGGSVVN  283



>emb|CBI36759.3| unnamed protein product [Vitis vinifera]
Length=218

 Score =   318 bits (814),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -1

Query  889  IAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSY  710
            + ADLG+D+NC++VV+EVV AYGRIDILVNNAAEQY++ SVEEIDE+RL RV RTNI SY
Sbjct  28   VPADLGYDDNCRRVVEEVVAAYGRIDILVNNAAEQYKSCSVEEIDEERLERVFRTNIFSY  87

Query  709  FFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRV  530
            F LTRHALKYM+EGSSIINTTSINAYKG+ KL++YT+TKGAIVAF R LALQL  KGIRV
Sbjct  88   FLLTRHALKYMQEGSSIINTTSINAYKGNNKLIEYTSTKGAIVAFIRSLALQLAPKGIRV  147

Query  529  NGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQV  350
            NGVAPGPIWTPLIPASF++EECA FG +VPM RA  P EVAPSYVFLA+  DSSYISGQV
Sbjct  148  NGVAPGPIWTPLIPASFSEEECARFGSEVPMGRAGQPCEVAPSYVFLASHADSSYISGQV  207

Query  349  LHPNGGAIVNG  317
            LHPNGG +VN 
Sbjct  208  LHPNGGVVVNA  218



>ref|WP_041037605.1| short-chain dehydrogenase [Tolypothrix campylonemoides]
 gb|KIJ76733.1| short-chain dehydrogenase [Tolypothrix campylonemoides VB511288]
Length=284

 Score =   320 bits (819),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 202/275 (73%), Gaps = 7/275 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P+    +YK S+KL+ K+AL+TG DSGIGRAV   FA EGA VA  Y+   
Sbjct  16    GVESQMTPKPKADDPQYKGSDKLKDKVALITGADSGIGRAVAIAFAKEGADVAILYLS--  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  +++       +  + IA D+G +  C++ V + V  +G++DILVNNAAEQ
Sbjct  74    EHDDAKETKHLVESL----GRRAVTIAGDIGDEAFCQQAVQQTVDEFGKLDILVNNAAEQ  129

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+EEI +++L R  RTNI S FFLT+ ALK++KEGS+IINTTS+ AYKG  +LLDY
Sbjct  130   HPKKSIEEISKEQLERTFRTNIFSMFFLTKAALKHLKEGSAIINTTSVTAYKGSPELLDY  189

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV KGIRVN VAPGPIWTPLIP++F +E+  +FGK VPMQRA 
Sbjct  190   SSTKGAIVAFTRSLSQSLVEKGIRVNAVAPGPIWTPLIPSTFPEEKVETFGKQVPMQRAG  249

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P EVAPSYVFL AS DSSY SGQVLHPNGG +VN
Sbjct  250   QPEEVAPSYVFL-ASDDSSYFSGQVLHPNGGTVVN  283



>ref|WP_009674322.1| MULTISPECIES: short-chain dehydrogenase [Paenibacillus]
 gb|EGL17227.1| oxidoreductase, short chain dehydrogenase/reductase family protein 
[Paenibacillus sp. HGF7]
 gb|EPD81015.1| hypothetical protein HMPREF1207_04772 [Paenibacillus sp. HGH0039]
Length=289

 Score =   320 bits (819),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/276 (56%), Positives = 206/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+PQ+   +Y+P+ KL+GK+AL+TGGDSGIGRAV   +A EGA VA  Y+   
Sbjct  21    GIETQMTPQPQFEDSKYRPAGKLKGKVALITGGDSGIGRAVAVAYAQEGADVAIVYLS--  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DAE+T  ++++    + +  + I  DLG +  CKKV+D+ V   G++DILVNNA EQ
Sbjct  79    EHSDAEKTKSLVEQ----EGRKCLLIPGDLGDESFCKKVIDQTVSGLGKLDILVNNAGEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +  +S+E+I  ++L +  RTNI S FFLT+ AL ++K GS++INT SI AYKG+  L+DY
Sbjct  135   HPQNSLEDITAEQLEKTFRTNIFSMFFLTKAALPHLKRGSAVINTASITAYKGNPTLIDY  194

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIV+FTR L+  ++ KGIRVNGVAPGPIWTPLIP++FTK++ A+FG D PMQRA 
Sbjct  195   SSTKGAIVSFTRSLSQSVIEKGIRVNGVAPGPIWTPLIPSTFTKDKVAAFGSDTPMQRAG  254

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFL AS DSSY+SGQ+LH NGG +VNG
Sbjct  255   QPEELAPSYVFL-ASDDSSYMSGQILHVNGGTVVNG  289



>ref|WP_015152646.1| short-chain dehydrogenase/reductase SDR [Chroococcidiopsis thermalis]
 ref|YP_007089964.1| short-chain dehydrogenase/reductase SDR [Chroococcidiopsis thermalis 
PCC 7203]
 gb|AFY86095.1| short-chain dehydrogenase/reductase SDR [Chroococcidiopsis thermalis 
PCC 7203]
Length=286

 Score =   319 bits (817),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 153/276 (55%), Positives = 206/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE  M P+P+    +Y+ S KLQGK+AL+TGGDSGIGRAV   +A EGA VA  Y+   
Sbjct  18    GKESEMTPQPKADDSKYRGSGKLQGKVALITGGDSGIGRAVAIAYAKEGADVAILYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  ++++      K  +AIA D+G +  CK+ + + +  +G++DILVNNAAEQ
Sbjct  76    EHDDAKETKRLVEE----QGKKAVAIAGDIGDENFCKQAIQQTIDEFGKLDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I  ++L R  RTNI S FF+T+ A+ ++KEGS+I+NTTS+ AY+G+  LLDY
Sbjct  132   HPQESIEQISAEQLERTFRTNIFSMFFMTKAAMPHLKEGSAIVNTTSVTAYQGNPTLLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  L+ KGIRVN VAPGP+WTPLIP++F +++ A+FGK VPMQR  
Sbjct  192   SSTKGAIVAFTRSLSKSLIEKGIRVNAVAPGPVWTPLIPSTFPEDKVANFGKQVPMQRPG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFL AS DSSYI+GQV+HPNGG +VNG
Sbjct  252   QPEEIAPSYVFL-ASDDSSYIAGQVIHPNGGTVVNG  286



>ref|WP_011319210.1| short-chain dehydrogenase [Anabaena variabilis]
 ref|YP_322940.1| short-chain dehydrogenase/reductase SDR [Anabaena variabilis 
ATCC 29413]
 gb|ABA22045.1| Short-chain dehydrogenase/reductase SDR [Anabaena variabilis 
ATCC 29413]
Length=285

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/276 (57%), Positives = 203/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+PQ     Y  S KL+ K+AL+TGGDSGIGRAV   +A EGA VAF Y+   
Sbjct  17    GTESKMQPKPQADDARYLGSGKLKDKVALITGGDSGIGRAVAIAYAKEGADVAFVYLS--  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DAEET  ++++      +  ++IA D+  +  C++ + + V  +G++DIL+NNAAEQ
Sbjct  75    EHGDAEETKNLVEE----QGRRAVSIAGDITDEAFCQRAIQQTVDEFGKLDILINNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I +++L R   TNI S F+LT+ ALK++K+GS+IINTTS+ AYKG + LLDY
Sbjct  131   HPQESIEDITKEQLERTFSTNIFSMFYLTKAALKHLKQGSAIINTTSVTAYKGSSHLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIVAFTR L+  L++KGIRVN VAPGPIWTPLIP++F  E+  +FGK VPMQRA 
Sbjct  191   SATKGAIVAFTRSLSQNLISKGIRVNAVAPGPIWTPLIPSTFPTEKVETFGKQVPMQRAG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFL AS DSSY+SGQVLHPNGG +VNG
Sbjct  251   QPEEVAPSYVFL-ASDDSSYMSGQVLHPNGGEVVNG  285



>gb|EEF58697.1| short-chain dehydrogenase/reductase SDR [bacterium Ellin514]
Length=264

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/270 (58%), Positives = 201/270 (74%), Gaps = 7/270 (3%)
 Frame = -1

Query  1129  MDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQEDKDA  950
             M P+P+ +S EY+ S KLQGKIAL+TGGDSGIGRA    FA EGA VA  Y+   E KDA
Sbjct  1     MSPKPRDASPEYRGSGKLQGKIALITGGDSGIGRATAVLFAREGADVAIAYL--NEHKDA  58

Query  949   EETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQYEASS  770
              ETV +++K    + +  IAIA D+G +++C+KVV   V+ +G+++ILVNNAAEQ+    
Sbjct  59    RETVRLVEK----EGRKCIAIADDVGNEKHCQKVVQTAVKQFGKLNILVNNAAEQHPQPD  114

Query  769   VEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDYTATKG  590
             +  I   +L R  RTNI S+FF+ +  LKY+KEGS+IINTTS+ AY+G ++LLDY++TKG
Sbjct  115   ITRISSKQLERTFRTNIFSHFFMVKATLKYLKEGSAIINTTSVTAYRGSSQLLDYSSTKG  174

Query  589   AIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAAHPIEV  410
             AIVAFTR L+  L  K IRVNGVAPGPIWTPLIP++F  E+   FG DVP+ R   P+EV
Sbjct  175   AIVAFTRSLSENLAAKKIRVNGVAPGPIWTPLIPSTFPAEKVKKFGTDVPLGRPGQPMEV  234

Query  409   APSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             APSYVFL AS DSSY++GQVLHPNGG +VN
Sbjct  235   APSYVFL-ASGDSSYMTGQVLHPNGGEVVN  263



>ref|WP_039713375.1| short-chain dehydrogenase [Scytonema millei]
 gb|KIF21032.1| short-chain dehydrogenase [Scytonema millei VB511283]
Length=286

 Score =   317 bits (813),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/276 (56%), Positives = 205/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE  M P+P+    +Y+ S KLQGK+AL+TGGDSGIGRAV   +A EGA VA  Y+   
Sbjct  18    GKESEMTPQPKADDSKYRGSGKLQGKVALITGGDSGIGRAVAIAYAKEGADVAILYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  ++++      K  +AIA D+G +  CK+ V + V  +G++DILVNNAAEQ
Sbjct  76    EHDDAKETKRLVEE----QGKKAVAIAGDIGDENFCKQAVQQTVDEFGKLDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I  ++L R  RTNI   FFLT+ A+ ++KEGS+I+NTTS+ AY+G+  LLDY
Sbjct  132   HPQESIEQISAEQLERTFRTNIFGMFFLTKAAMPHLKEGSAIVNTTSVTAYQGNPTLLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  L+ KGIRVN VAPGP+WTPLIP++F +++ A+FGK VPM+R  
Sbjct  192   SSTKGAIVAFTRSLSKSLIEKGIRVNAVAPGPVWTPLIPSTFPEDKVANFGKQVPMKRPG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFL AS DSSYI+GQV+HPNGG +VNG
Sbjct  252   QPEEIAPSYVFL-ASDDSSYIAGQVIHPNGGTVVNG  286



>ref|WP_016865637.1| short-chain dehydrogenase [Fischerella muscicola]
Length=286

 Score =   317 bits (811),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 203/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+PQ    +Y+ S KL+ K+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GIESEMSPKPQADDPQYQGSGKLKNKVALITGGDSGIGRAVAIAFAKEGADVAIAYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  +++       +  + I+ D+G +  C++ + + +  +G++DILVNNAAEQ
Sbjct  76    EHDDAKETKHLVE----AQGRKAVTISGDVGDETFCQQAIQQTIDEFGKLDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I +++L +  RTNI S FFLT+ ALK+++EG SIINTTS+ AYKG  +LLDY
Sbjct  132   HPQKSIEDISKEQLEQTFRTNIFSMFFLTKAALKHLQEGGSIINTTSVTAYKGSPELLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV KGIRVN VAPGPIWTPLIPA+F +E+ A+FGK VPMQR  
Sbjct  192   SSTKGAIVAFTRSLSQSLVEKGIRVNAVAPGPIWTPLIPATFPEEKVANFGKQVPMQRPG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFL AS D+SYI+GQVLHPNGG +VNG
Sbjct  252   QPEEIAPSYVFL-ASDDASYITGQVLHPNGGVVVNG  286



>ref|WP_007222970.1| short-chain dehydrogenase [planctomycete KSU-1]
 dbj|GAB63887.1| oxidoreductase [planctomycete KSU-1]
Length=288

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/276 (58%), Positives = 200/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH M P+P+    EY+  +KLQ K+AL+TGGDSGIGRA    FA EGA V+  Y    
Sbjct  20    GKEHQMQPKPKSQMKEYRGCDKLQDKVALITGGDSGIGRAAAIAFAKEGAQVSVVY--HN  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E KDAEET  +I+K    + +  + IA D+G    C + V + V   G++DILVNNAA Q
Sbjct  78    EHKDAEETRRLIEK----EGRRCLLIAGDVGDGVFCSQAVKKTVNELGKLDILVNNAAVQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E I E++L+   RTNI SYFF+TR ALK++ +GS+IINTTS+ AY+G   LLDY
Sbjct  134   FVQESIENITEEQLVTTFRTNIFSYFFMTRAALKHLGKGSTIINTTSVTAYRGSLHLLDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIV+FTR LAL L+ KGIRVN VAPGP+WTPLIPASF +E+  SFG  VPM+RAA
Sbjct  194   SSTKGAIVSFTRSLALSLIKKGIRVNAVAPGPVWTPLIPASFPEEKVESFGAQVPMERAA  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+AP YVFL AS DSSYI+GQVLHPNGG +V G
Sbjct  254   EPDEIAPCYVFL-ASDDSSYITGQVLHPNGGEMVGG  288



>ref|WP_009630815.1| dehydrogenase of unknown specificity [Synechocystis sp. PCC 7509]
Length=284

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/276 (58%), Positives = 206/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P+     Y+ S KL GK+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  16    GIEADMTPKPKSDDPGYRGSGKLAGKVALITGGDSGIGRAVAIAFAKEGADVAIAYLN--  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET    K+      +  +AIA D+G +  C+++V++ V+ +G++DILVNNAAEQ
Sbjct  74    EHDDAKET----KQLVEAQNRRAVAIAGDIGNECFCQQLVEQTVQEFGKLDILVNNAAEQ  129

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I  ++L R  RTNI + FFLT+ ALK++++GS+IINTTS+ AYKG+ +L+DY
Sbjct  130   HPQESIEDISAEQLERTFRTNIFAMFFLTKAALKHLQKGSAIINTTSVTAYKGNEQLIDY  189

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  L+ K IRVN VAPGPIWTPLIPA+F  ++ ASFGK VPM+RA 
Sbjct  190   SSTKGAIVAFTRSLSQSLIAKEIRVNAVAPGPIWTPLIPATFPPDKVASFGKQVPMERAG  249

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFL AS DSSY+SGQVLHPNGGA+VNG
Sbjct  250   QPEEVAPSYVFL-ASDDSSYMSGQVLHPNGGAVVNG  284



>ref|WP_009459400.1| MULTISPECIES: short-chain dehydrogenase [Fischerella]
 gb|EHC09356.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Fischerella sp. JSC-11]
Length=286

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 204/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P+    +Y+ S KL+ K+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GIESEMTPKPKADDSQYQGSGKLKNKVALITGGDSGIGRAVAIAFAKEGADVAIAYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  +++       +  + I+ D+G +  C++ + + +  +G++DILVNNAAEQ
Sbjct  76    EHNDAKETKHLVE----AQGRKAVTISGDIGDETFCQQAIQQTIDEFGKLDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I +++L R  RTNI S FFLT+ AL++++EGSSIINTTS+ AYKG  +LLDY
Sbjct  132   HPQKSIEDISKEQLERTFRTNIFSMFFLTKAALQHLQEGSSIINTTSVTAYKGSPELLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV KGIRVN VAPGPIWTPLIPA+F +++ A+FGK VPMQRA 
Sbjct  192   SSTKGAIVAFTRSLSQGLVEKGIRVNAVAPGPIWTPLIPATFPEDKVANFGKQVPMQRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFL AS D+SYI+GQVLH NGG IVNG
Sbjct  252   QPEEIAPSYVFL-ASDDASYITGQVLHTNGGTIVNG  286



>ref|WP_012409849.1| short-chain dehydrogenase [Nostoc punctiforme]
 ref|YP_001866818.1| short-chain dehydrogenase/reductase SDR [Nostoc punctiforme PCC 
73102]
 gb|ACC81875.1| short-chain dehydrogenase/reductase SDR [Nostoc punctiforme PCC 
73102]
Length=312

 Score =   316 bits (809),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/276 (57%), Positives = 203/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P+    +Y+ S KLQ K+AL+TG DSGIGRAV   FA EGA VA  Y+   
Sbjct  44    GVESEMTPKPKADDAQYRGSGKLQDKVALITGADSGIGRAVAIAFAKEGADVAILYLN--  101

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  +++K      +  + IA D+G +  C++ + + V  +G++DIL+NNAAEQ
Sbjct  102   EHDDAKETKHLVEK----QGRRAVTIAGDIGDETFCQQAIQQTVGEFGKLDILINNAAEQ  157

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+EEI +++L R  RTNI S FF+T+ ALK+++ GS+IINTTS+ AYKG  +LLDY
Sbjct  158   HPKQSIEEITKEQLERTFRTNIFSMFFMTKAALKHLQTGSAIINTTSVTAYKGSPQLLDY  217

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV+KGIRVN VAPGPIWTPLIP++F +E+  SFGK VPMQRA 
Sbjct  218   SSTKGAIVAFTRSLSQNLVSKGIRVNAVAPGPIWTPLIPSTFPEEKVESFGKQVPMQRAG  277

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFL AS D+SY+SGQVLH NGG +VNG
Sbjct  278   QPEEVAPSYVFL-ASDDASYVSGQVLHVNGGEVVNG  312



>ref|WP_006634949.1| short-chain dehydrogenase [Microcoleus vaginatus]
 gb|EGK85165.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Microcoleus vaginatus 
FGP-2]
Length=286

 Score =   314 bits (805),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/276 (57%), Positives = 205/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+PQ  +  Y+ S+KL+ K+AL+TGGDSGIGRAV   FA EGA V  +Y+   
Sbjct  18    GIESQMTPQPQSFAEGYRGSDKLRDKVALITGGDSGIGRAVAIAFAKEGANVVISYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED DA++T    K+A     +  IAIA D+G +  C+ +V++ V+ +G +DILVNNAAEQ
Sbjct  76    EDDDAKKT----KEAIEQQGRRCIAIAGDIGDENLCQNLVEQTVKEFGSLDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I  ++L R  RTNI S F+LT+ ALK++KEGS+IINTTS+ AYKG+ +LLDY
Sbjct  132   HPQESIEDITAEQLERTFRTNIFSMFYLTKAALKHLKEGSAIINTTSVTAYKGNQQLLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  L  KGIRVNGVAPGPIWTPLIPA+F +E+   FG D  + RA 
Sbjct  192   SSTKGAIVAFTRSLSQSLAEKGIRVNGVAPGPIWTPLIPATFPEEKVEKFGADTALGRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPS+VFL AS DSSY++GQ+LHPNGG+++NG
Sbjct  252   QPDEVAPSFVFL-ASKDSSYMTGQILHPNGGSVING  286



>gb|KIE07269.1| short-chain dehydrogenase [Tolypothrix bouteillei VB521301]
Length=285

 Score =   314 bits (804),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 156/275 (57%), Positives = 200/275 (73%), Gaps = 7/275 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G+E  M P+PQ  + +YK S+KL+GK+AL+TG DSGIGRA    FA EGA VA  Y+   
Sbjct  17    GREGEMTPKPQSQNPQYKGSSKLEGKVALITGADSGIGRATAILFAREGADVAVVYLS--  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DAEET    K+    + +  + I  D+G +  C++ V + V   G +DIL+NNAAEQ
Sbjct  75    EQQDAEET----KRLVEAEGRRCLLIKGDVGGEPFCQEAVQQTVNQLGHLDILINNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I  ++L R  RTNI   FF+T+ AL ++KEGS+IINTTS+ AYKG+ +LLDY
Sbjct  131   HPQQSIEDISAEQLERTFRTNIFGMFFITKAALPHLKEGSAIINTTSVTAYKGNPQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIVAFTR L+  LV KGIRVNGVAPGPIWTPLIP++F +++  SFG  VPMQRA 
Sbjct  191   SATKGAIVAFTRSLSQSLVEKGIRVNGVAPGPIWTPLIPSTFPEDKVKSFGAQVPMQRAG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P EVAP YVFL AS DSSY+SGQ+LHPNGG +VN
Sbjct  251   QPEEVAPCYVFL-ASHDSSYMSGQILHPNGGEVVN  284



>ref|WP_017291127.1| short-chain dehydrogenase [Leptolyngbya boryana]
Length=290

 Score =   314 bits (804),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 200/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P PQ     Y+ + KL GK+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  22    GHESQMTPAPQSYGERYQAAGKLSGKVALITGGDSGIGRAVAILFAKEGADVAIAYLN--  79

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  ++++    + +  +A+  D+G +  C+ +V + +  +G +DILVNNAAEQ
Sbjct  80    EHDDAKETARLVEQ----EGRRCLALPGDIGDESLCQSIVKKTIDEFGHLDILVNNAAEQ  135

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E I  ++L R  RTNI S FFLT+ A+ ++KEGSSIINTTS+ AY+G  +LLDY
Sbjct  136   HPQESIENITSEQLERTFRTNIFSMFFLTKAAVPHLKEGSSIINTTSVTAYQGSPQLLDY  195

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  L+ K IRVNGVAPGPIWTPLIP++F +E+  SFGK VPMQR  
Sbjct  196   SSTKGAIVAFTRSLSQSLIEKRIRVNGVAPGPIWTPLIPSTFPEEKVESFGKQVPMQRVG  255

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFLA+S DSSY+SGQ+LHPNGG +VNG
Sbjct  256   QPDEVAPSYVFLASS-DSSYMSGQILHPNGGNVVNG  290



>ref|WP_007358209.1| MULTISPECIES: short-chain dehydrogenase [Kamptonema]
 emb|CBN59038.1| oxidoreductase [ [[Oscillatoria] sp. PCC 6506]
Length=286

 Score =   314 bits (804),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 154/276 (56%), Positives = 207/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P P+  + EY+ S+KL+GK+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GSEAQMTPPPESQAAEYRGSDKLRGKVALITGGDSGIGRAVAIAFAKEGAEVAIAYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA++T  +I++      +  +AIA D+G +  C+K+V++ V+A+G +DIL+NNAAEQ
Sbjct  76    EHEDAKQTQQLIEE----QGRRCLAIAGDVGDESFCQKLVEQTVKAFGHLDILINNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I  ++L R  RTNI S F+LT+ ALK++KEGS+IINTTS+ AYKG+ +LLDY
Sbjct  132   HPQESIEDITAEQLERTFRTNIFSMFYLTKAALKHLKEGSAIINTTSVTAYKGNQQLLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  L  K IRVNGVAPGPIWTPLIP++F +E+   FG + P+ RA 
Sbjct  192   SSTKGAIVAFTRSLSGSLAKKEIRVNGVAPGPIWTPLIPSTFPEEKVEKFGANTPLGRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP YVFL AS DSSY++GQ+LHPNGG ++NG
Sbjct  252   QPDEVAPCYVFL-ASKDSSYMTGQILHPNGGDVING  286



>ref|WP_015176884.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Oscillatoria nigro-viridis]
 ref|YP_007116029.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Oscillatoria nigro-viridis 
PCC 7112]
 gb|AFZ07613.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Oscillatoria nigro-viridis 
PCC 7112]
Length=286

 Score =   313 bits (803),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 157/276 (57%), Positives = 205/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+PQ  +  Y+ S+KL+ KIAL+TGGDSGIGRAV   FA EGA V  +Y+   
Sbjct  18    GIESQMTPQPQSFAEGYRGSDKLRDKIALITGGDSGIGRAVAIAFAKEGANVVISYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+ DA++T    K+A     +  +AIA D+G +  C+ +V++ V+ +G +DILVNNAAEQ
Sbjct  76    ENDDAKKT----KEAIEQQGRRCMAIAGDIGDETVCQNLVEQTVKEFGGLDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E I  ++L R  RTNI S F+LT+ ALK++KEGS+IINTTS+ AYKG+ +LLDY
Sbjct  132   HPQESIENITAEQLERTFRTNIFSMFYLTKAALKHLKEGSAIINTTSVTAYKGNQQLLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  L  KGIRVNGVAPGPIWTPLIPA+F +E+ A FG D  + RA 
Sbjct  192   SSTKGAIVAFTRSLSQSLAEKGIRVNGVAPGPIWTPLIPATFPEEKVAKFGADTALGRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFL AS DSSY++GQ+LHPNGG+++NG
Sbjct  252   QPDEVAPSYVFL-ASKDSSYMTGQILHPNGGSVING  286



>ref|WP_012528577.1| short-chain dehydrogenase [Geobacter bemidjiensis]
 ref|YP_002136965.1| short-chain dehydrogenase/reductase family oxidoreductase [Geobacter 
bemidjiensis Bem]
 gb|ACH37169.1| oxidoreductase, short-chain dehydrogenase/reductase family [Geobacter 
bemidjiensis Bem]
Length=286

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/276 (57%), Positives = 201/276 (73%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE  M PRPQ    EY+ + KLQGK AL+TGGDSGIGRAV   FA EGA +AF Y+  +
Sbjct  18    GKEAEMTPRPQSGEFEYRGAGKLQGKTALITGGDSGIGRAVAIAFAREGANIAFGYL--E  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED+DA+ET  I+++    +    +A   D+G ++ C  +V + + A+GR+DI+VNNAAEQ
Sbjct  76    EDQDAKETRDIVER----EGVRCLAFRGDVGQEQFCLDIVKKTLEAFGRLDIVVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+EEI  ++L R  RTNI SYF+L + ALK+++EGS IINTTS+ AYKG+  LLDY
Sbjct  132   HYRESIEEISSEQLERTFRTNIFSYFYLVKAALKHLQEGSRIINTTSVTAYKGNPNLLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR LAL L  KGI VN VAPGPIWTPLIP +F +E+   FG +V ++RA 
Sbjct  192   SSTKGAIVAFTRSLALSLAGKGILVNAVAPGPIWTPLIPGTFPEEKTEQFGGNVLLKRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+EVA SYVFL AS   SY++GQVLHPNGG IV G
Sbjct  252   QPVEVAHSYVFL-ASEGGSYMTGQVLHPNGGTIVGG  286



>ref|WP_026100139.1| short-chain dehydrogenase [Microchaete sp. PCC 7126]
Length=285

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 207/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P+    +Y+ S+KL+ K+AL+TGGDSGIGRAV   FA EGA V  +Y+   
Sbjct  17    GVESKMTPKPKADDAQYRGSDKLKDKVALITGGDSGIGRAVAIAFAKEGANVVISYLN--  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA+ET  +++K      +  + I  D+  +  C+++V++ V+ +G++DILVNNAAEQ
Sbjct  75    EHEDAKETKQLVEKY----GRQALIIPGDITDESFCQQLVEQTVKEFGKLDILVNNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   ++E+I +++L R  RTNI S F+LT+ A+K++  GS+IINTTS+ AYKG  +LLDY
Sbjct  131   HPQKNIEDISKEQLERTFRTNIFSMFYLTKAAIKHLHGGSAIINTTSVTAYKGSPQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  L+ KGIRVN VAPGPIWTPLIP++F +E+ A+FGK VPMQRA 
Sbjct  191   SSTKGAIVAFTRALSQNLIEKGIRVNAVAPGPIWTPLIPSTFPEEKVATFGKQVPMQRAG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFL AS D+SYISGQVLHPNGG ++NG
Sbjct  251   QPEEVAPSYVFL-ASDDASYISGQVLHPNGGEVING  285



>ref|WP_026841337.1| short-chain dehydrogenase [Geobacter bremensis]
Length=286

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/276 (57%), Positives = 202/276 (73%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE  M PRPQ    EY+ + KLQGK AL+TGGDSGIGRAV   FA EGA +AF Y+  +
Sbjct  18    GKEAEMTPRPQSGEFEYRGAGKLQGKTALITGGDSGIGRAVAIAFAREGAYIAFGYL--E  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED+DA+ET  I+++    +    +A   D+G ++ C  +V + V A+GR+DI+VNNAAEQ
Sbjct  76    EDQDAKETRDIVER----EGVRCLAFRGDVGQEQFCLDIVKKTVEAFGRLDIVVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+EEI  ++L R  RTNI SYF+L + ALK+++EGS IINTTS+ AY+G+  LLDY
Sbjct  132   HYRESIEEISSEQLERTFRTNIFSYFYLVKAALKHLQEGSRIINTTSVTAYRGNPNLLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR LAL L +KGI VN VAPGPIWTPLIP +F +E+   FG +V ++RA 
Sbjct  192   SSTKGAIVAFTRSLALSLADKGILVNAVAPGPIWTPLIPGTFPEEKTEQFGGNVLLKRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+EVA SYVFL AS   SY++GQVLHPNGG IV G
Sbjct  252   QPVEVAHSYVFL-ASEGGSYMTGQVLHPNGGTIVGG  286



>ref|WP_006198195.1| short-chain dehydrogenase [Nodularia spumigena]
 gb|EAW43641.1| oxidoreductase [Nodularia spumigena CCY9414]
 gb|AHJ27233.1| oxidoreductase [Nodularia spumigena CCY9414]
Length=299

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/276 (57%), Positives = 205/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE  M P+P+    +Y+ S KL  K+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  31    GKESEMKPKPKADDPQYQGSGKLNNKVALITGGDSGIGRAVAIAFAKEGADVALVYL--M  88

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  +++       +  +AIA D+  +  C++ V++ V   G++DIL+NNAAEQ
Sbjct  89    EHDDAKETKHLVENL----GRRVVAIAGDITDETFCQQAVEQTVEQLGKLDILINNAAEQ  144

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I +++L R  RTNI S F+LT+ A+K++K GSSIIN+TS+ AYKG+AKLLDY
Sbjct  145   HPQESIEDISKEQLERTFRTNIFSMFYLTKAAMKHLKAGSSIINSTSVTAYKGNAKLLDY  204

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV+K IRVN VAPGPIWTPLIP++F  ++ A+FGK VPM RA 
Sbjct  205   SSTKGAIVAFTRSLSQNLVSKEIRVNAVAPGPIWTPLIPSTFPADQVATFGKQVPMGRAG  264

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFL AS D+SY++GQVLHPNGG+IVNG
Sbjct  265   QPEEVAPSYVFL-ASDDASYMTGQVLHPNGGSIVNG  299



>ref|WP_015188665.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Gloeocapsa sp. PCC 
7428]
 ref|YP_007127953.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Gloeocapsa sp. PCC 
7428]
 gb|AFZ30793.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Gloeocapsa sp. PCC 
7428]
Length=286

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/276 (57%), Positives = 205/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P+    +++ S KL GK+A++TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GLESEMTPKPKADDPQHQGSGKLLGKVAVITGGDSGIGRAVAIAFAKEGADVAIMYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  ++++      +    IA D+G +  CK+ +++VV+ +G++DILVNNAAEQ
Sbjct  76    EHDDAKETKRLVEE----KGRKATTIAGDIGDESFCKQAIEQVVQEFGKLDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I  ++L R  RTNI S F+LT+ ALK+++EGS+IINTTS+ AY+G+ +L+DY
Sbjct  132   HPQESLEDISAEQLERTFRTNIFSMFYLTKAALKHLQEGSTIINTTSVTAYQGNQQLIDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV KGIRVN VAPGPIWTPLIPA+F +E+ A FGK VPM RA 
Sbjct  192   SSTKGAIVAFTRSLSQSLVKKGIRVNAVAPGPIWTPLIPATFPEEKVADFGKQVPMGRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVA  YVFLAA+ DSSYI+GQVLHPNGG IVNG
Sbjct  252   QPEEVASCYVFLAAN-DSSYIAGQVLHPNGGTIVNG  286



>ref|WP_015205745.1| dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase 
like protein [Cylindrospermum stagnale]
 ref|YP_007145166.1| dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase 
like protein [Cylindrospermum stagnale PCC 7417]
 gb|AFZ22486.1| dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase 
like protein [Cylindrospermum stagnale PCC 7417]
Length=285

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 205/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P+    +Y+ S KL+ K+A++TGGDSGIGRAV   FA EGA VA  Y+K  
Sbjct  17    GVESEMQPKPKADDEQYRGSGKLKNKVAVITGGDSGIGRAVAIAFAKEGADVAIVYLK--  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  +++K      +  + IA D+  +  C++V+ + V  +G++DIL+NNAAEQ
Sbjct  75    EHGDAKETQDLVEK----QGRRAVPIAGDITDEGFCQQVIQQTVDEFGKLDILINNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   ++E+I +++L R  RTNI S F+LT+ A+K+++ GSSIINTTS+ AYKG  +LLDY
Sbjct  131   HPQENIEDISKEQLERTFRTNIFSMFYLTKAAVKHLQPGSSIINTTSVTAYKGSPQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  L+ KGIRVN VAPGPIWTPLIP++F +E+ A+FG+  PMQRA 
Sbjct  191   SSTKGAIVAFTRSLSQNLLGKGIRVNAVAPGPIWTPLIPSTFPEEKVATFGQQAPMQRAG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFL AS D+SY+SGQVLHPNGG +VNG
Sbjct  251   QPEEVAPSYVFL-ASDDASYMSGQVLHPNGGEVVNG  285



>ref|WP_012773835.1| short-chain dehydrogenase [Geobacter sp. M21]
 ref|YP_003019965.1| short-chain dehydrogenase/reductase SDR [Geobacter sp. M21]
 gb|ACT16207.1| short-chain dehydrogenase/reductase SDR [Geobacter sp. M21]
Length=286

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/276 (57%), Positives = 202/276 (73%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE  M PRP+    EY+ + KLQGK AL+TGGDSGIGRAV   FA EGA VAF Y+  +
Sbjct  18    GKEAEMTPRPKSGEFEYRGAGKLQGKTALITGGDSGIGRAVAIAFAREGANVAFGYL--E  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED+DA+ET  I+++    +    +A   D+G ++ C  +V + + A+GR+DI+VNNAAEQ
Sbjct  76    EDQDAKETRDIVER----EGGRCLAFRGDVGQEQFCLDIVKKTLEAFGRLDIVVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +EEI  ++L R  RTNI SYF+L + ALK+++EGS IINTTS+ AYKG+  LLDY
Sbjct  132   HYREGIEEISSEQLERTFRTNIFSYFYLVKAALKHLQEGSRIINTTSVTAYKGNPNLLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR LAL L +KGI VN VAPGPIWTPLIP +F +E+   FG++V ++RA 
Sbjct  192   SSTKGAIVAFTRSLALSLADKGILVNAVAPGPIWTPLIPGTFPEEKTEQFGENVLLKRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+EVA SYVFL AS   SY++GQVLHPNGG IV G
Sbjct  252   QPVEVAHSYVFL-ASEGGSYMTGQVLHPNGGTIVGG  286



>ref|WP_029007658.1| short-chain dehydrogenase [Azospirillum halopraeferens]
Length=286

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 202/276 (73%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G+E  M P P  +   Y+ S KL+GK+AL+TGGDSGIGRAV   FA EGA V   Y+  +
Sbjct  18    GREGPMRPHPSETRPGYRGSGKLEGKVALITGGDSGIGRAVAVLFAREGARVGIVYL--E  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED+DA +T  +++     + +    I  D+G ++ C++ V +++  +GR+DILVNNAAEQ
Sbjct  76    EDEDARDTAELVR----AEGQTCTLIRGDVGNEDICRRAVAQMIEEHGRLDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +     E+I  ++L R  RTNI +YF+LTR AL +MKEG++I+NTTS+ AYKG+  L+DY
Sbjct  132   HPQERFEDITAEQLERTFRTNIFAYFYLTRAALPHMKEGATIVNTTSVTAYKGNPTLVDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR LALQL  +GIRVN VAPGPIWTPLIP++F  E+  SFG DVP+ R  
Sbjct  192   SSTKGAIVAFTRSLALQLAERGIRVNAVAPGPIWTPLIPSTFPPEKVESFGTDVPLGRPG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YVFLA + DSSY+SGQVLHPNGG+++NG
Sbjct  252   QPDEVAPAYVFLAGN-DSSYMSGQVLHPNGGSVING  286



>ref|WP_038088120.1| short-chain dehydrogenase [Tumebacillus flagellatus]
 gb|KEO83213.1| short-chain dehydrogenase [Tumebacillus flagellatus]
Length=287

 Score =   312 bits (799),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 200/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E +M+PRP +   +   S KLQGK+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  19    GFETVMEPRPVFEYPDAVGSGKLQGKVALITGGDSGIGRAVALAFAREGADVAIAYL--D  76

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA ETV  ++       +  +AI+ D+G +E C+ +VD V+  +GR+DILVNNA EQ
Sbjct  77    EHEDAAETVARVE----AKGRRCLAISGDIGLEETCRSIVDAVIETFGRLDILVNNAGEQ  132

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I   +L+R   TNI + FFLT+ AL ++K G+SIINT SI AY G+ KL+DY
Sbjct  133   HVQERLEDISAAQLIRTYATNIFAMFFLTKAALPHLKRGASIINTASITAYCGNEKLIDY  192

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGA+VAFTR L++ L  +GIRVN VAPGPIWTPLIPASF+ E+  +FG DVPM R  
Sbjct  193   SSTKGAVVAFTRSLSINLEPRGIRVNAVAPGPIWTPLIPASFSAEDVGNFGDDVPMNRPG  252

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+EVAPSY+FL AS D+SY+SGQVLHPNGG IVNG
Sbjct  253   QPVEVAPSYLFL-ASDDASYMSGQVLHPNGGYIVNG  287



>ref|WP_015182467.1| dehydrogenase [Microcoleus sp. PCC 7113]
 ref|YP_007121724.1| dehydrogenase [Microcoleus sp. PCC 7113]
 gb|AFZ18318.1| dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase 
like protein [Microcoleus sp. PCC 7113]
Length=289

 Score =   312 bits (799),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 153/275 (56%), Positives = 199/275 (72%), Gaps = 7/275 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+PQ     Y+ + KL+GK+AL+TGGDSGIGR+V   +A EGA VA  Y+   
Sbjct  21    GSESKMTPKPQAQGSNYRAAGKLEGKVALITGGDSGIGRSVAILYAKEGADVAIMYLS--  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDAEET    K+    + K  + +  D+G ++ C++ V + V+  G++DIL+NNAAEQ
Sbjct  79    EDKDAEET----KRLVEAEGKRCVMLKGDVGDEQFCQQAVQQTVQELGQLDILINNAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I  ++L R  RTNI   FF+ + AL ++KEGS+IINTTS+ AYKG+ +LLDY
Sbjct  135   HPQESIEKITAEQLERTFRTNIFGMFFMAKAALPHLKEGSAIINTTSVTAYKGNPQLLDY  194

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV K IRVNGVAPGPIWTPLIP++F +E+  SFG  VPM RA 
Sbjct  195   SSTKGAIVAFTRSLSKSLVEKKIRVNGVAPGPIWTPLIPSTFPEEKVESFGAQVPMHRAG  254

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P EVAP YVFL AS DSSY+SGQ+LHPNGG +VN
Sbjct  255   QPEEVAPCYVFL-ASDDSSYMSGQILHPNGGEVVN  288



>ref|WP_026567649.1| short-chain dehydrogenase [Bacillus sp. UNC41MFS5]
Length=289

 Score =   311 bits (798),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 197/276 (71%), Gaps = 6/276 (2%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P P   +  YK SNKLQG+ A++TGGDSGIGR+V   +A EGA VA  Y+   
Sbjct  20    GIEKDMRPLPDTENTNYKESNKLQGQNAIITGGDSGIGRSVSIAYAKEGANVAIIYLN--  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DAEET  ++++    +    + IA D+G +  CK+ V + V   G IDILVNNAAEQ
Sbjct  78    ESNDAEETKQLVEE----EGGRCLLIAGDIGDESFCKEAVQQTVDELGGIDILVNNAAEQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+ +I+ ++L +  RTNI S F LTR AL ++K GS+IINTTSI AY+GH KLLDY
Sbjct  134   HPQESIMDIETEQLEKTFRTNILSMFHLTRAALPHLKRGSAIINTTSITAYQGHPKLLDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAI  FTR LA QL  KGIRVNGVAPGPIWTPLIP++FT EE + FG+D PM+R  
Sbjct  194   SSTKGAITTFTRSLASQLAEKGIRVNGVAPGPIWTPLIPSTFTAEEVSQFGQDTPMKRPG  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YV+LA++ DSSY+SGQ+LH NGG +VNG
Sbjct  254   QPEEVAPAYVYLASNADSSYVSGQILHVNGGKVVNG  289



>ref|WP_015148322.1| dehydrogenase [Oscillatoria acuminata]
 ref|YP_007085598.1| dehydrogenase [Oscillatoria acuminata PCC 6304]
 gb|AFY81678.1| dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase 
like protein [Oscillatoria acuminata PCC 6304]
Length=286

 Score =   311 bits (797),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 153/276 (55%), Positives = 208/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M+PRP+  + EYK S KL+ K+AL+TGGDSGIGR+V   FA EGA VA  Y+   
Sbjct  18    GLESEMNPRPKARASEYKGSGKLENKVALITGGDSGIGRSVAILFAREGADVAIIYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA++T  +++     + +  + IA D+G    C++VV + V A+G +DIL+NNAAEQ
Sbjct  76    EHEDAKKTQEMVE----AEGRRCLPIAGDIGEKSFCEQVVKQTVDAFGHLDILINNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   ++E+I +++L +  RTNI S F+LT+ A+ ++KEGS+I+NTTS+ AYKG+  LLDY
Sbjct  132   HPQENIEDITQEQLEKTFRTNIFSMFYLTQAAMPHLKEGSAIVNTTSVTAYKGNETLLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+ ++V+KGIRVNGVAPGPIWTPLIPA+F  E+ ASFG+ VPM+RA 
Sbjct  192   SSTKGAIVAFTRALSQKVVSKGIRVNGVAPGPIWTPLIPATFPPEKVASFGQQVPMKRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVA SYVFL AS DSSY++GQ+LHPNGG +V G
Sbjct  252   EPEEVATSYVFL-ASDDSSYMTGQILHPNGGTVVGG  286



>ref|WP_027892061.1| short-chain dehydrogenase [Meiothermus chliarophilus]
Length=283

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/275 (57%), Positives = 198/275 (72%), Gaps = 7/275 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P+     Y+   KL+GK+ALVTGGDSGIGRAV   FA EGA VA  Y+  Q
Sbjct  15    GLESQMQPKPKAEDPGYRGCGKLKGKVALVTGGDSGIGRAVAIAFAKEGADVAIAYL--Q  72

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DAEET    K+      +  IAIA DLG +  C++VV  V+  +GR+D+LVNNAAEQ
Sbjct  73    EHSDAEET----KRRVEEYGRRCIAIAGDLGDEMVCRQVVQRVIDVFGRLDVLVNNAAEQ  128

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
                  +E+I  ++L R  RTNI +YF+LT+ AL ++KEGS++INTTS+ AY+G   LLDY
Sbjct  129   TPQERLEDISAEQLERTFRTNIFAYFYLTKAALPHLKEGSAVINTTSVTAYRGSPHLLDY  188

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIVAFTR LA  LV +GIRVNGVAPGPIWTPLIP++F +E+   FG+DVPM R  
Sbjct  189   SATKGAIVAFTRSLAGNLVKRGIRVNGVAPGPIWTPLIPSTFPEEKVEKFGEDVPMGRPG  248

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P EVAPSYVFL AS D+SY +GQ+LHPNGG ++N
Sbjct  249   QPEEVAPSYVFL-ASDDASYFAGQILHPNGGEVIN  282



>ref|WP_039747436.1| short-chain dehydrogenase [Hassallia byssoidea]
 gb|KIF33310.1| short-chain dehydrogenase [Hassallia byssoidea VB512170]
Length=284

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/276 (55%), Positives = 201/276 (73%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE  M P+P+     Y+ S KL+ K+AL+TGGDSGIGRAV   +A EGA VA  Y+   
Sbjct  16    GKESEMTPKPKADDSSYQGSGKLKDKVALITGGDSGIGRAVAIAYAKEGADVAIVYLN--  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  +++K      +  +AIA D+G +  C++ V + V   G++DILVNNAAEQ
Sbjct  74    EHDDAKETKNLVEK----HGRRAVAIAGDIGDESFCQQAVQQTVDELGKLDILVNNAAEQ  129

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I   +L R  RTNI S FF+T+ A+K++ EGS+I+NTTS+ AYKG+ +LLDY
Sbjct  130   HPQESIEDISASQLERTFRTNIFSMFFMTKAAMKHLHEGSAIVNTTSVTAYKGNPQLLDY  189

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV K IRVN VAPGPIWTPLIP++F +++  +FGK VPM+R  
Sbjct  190   SSTKGAIVAFTRSLSQSLVEKKIRVNAVAPGPIWTPLIPSTFPEDKVETFGKQVPMERPG  249

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPS+VFL AS DSSY SGQVLHPNGG++VNG
Sbjct  250   QPEEVAPSFVFL-ASDDSSYFSGQVLHPNGGSVVNG  284



>ref|WP_035153476.1| short-chain dehydrogenase [Calothrix sp. 336/3]
 gb|KFB83669.1| short-chain dehydrogenase [Calothrix sp. 336/3]
Length=279

 Score =   309 bits (791),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 200/275 (73%), Gaps = 7/275 (3%)
 Frame = -1

Query  1141  KEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQE  962
             KE  M PRP      Y+ S KLQ K+AL+TGGDSGIGRAV   +A EGA V   Y+K  E
Sbjct  12    KESEMSPRPAAERRAYQGSGKLQDKVALITGGDSGIGRAVAVMYAKEGADVVIMYLK--E  69

Query  961   DKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQY  782
             D DA+ET  +++K    + +  ++IA D+G +  C++ V+  V+ +G +DILVNNAAEQ+
Sbjct  70    DDDAQETKQLVEK----EGRRCLSIAGDVGDENFCRQAVERTVKEFGHLDILVNNAAEQH  125

Query  781   EASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDYT  602
                S+EEI  ++L R  RTNI S F+L++ AL ++KEGS+IINTTS+ AY+G  +LLDY+
Sbjct  126   LQPSLEEISAEQLERTFRTNIFSMFYLSKAALPHLKEGSTIINTTSVTAYEGSPQLLDYS  185

Query  601   ATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAAH  422
             ATKGAIVAFTR L+  L++K IRVNGVAPGPIWTPLI ++F +E+    G +VPMQR   
Sbjct  186   ATKGAIVAFTRSLSQSLIDKHIRVNGVAPGPIWTPLITSTFPEEKITKHGSNVPMQRVGQ  245

Query  421   PIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
             P EVAP YVFL AS DSSYI+GQ+LHPNGG IVNG
Sbjct  246   PDEVAPCYVFL-ASDDSSYIAGQILHPNGGKIVNG  279



>ref|WP_026235740.1| short-chain dehydrogenase [Echinicola pacifica]
Length=285

 Score =   309 bits (791),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/275 (55%), Positives = 203/275 (74%), Gaps = 7/275 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKEH M P+P+Y   +Y+ S KL+G++A+++GGDSGIGRAV   FA EGA +A  Y+   
Sbjct  17    GKEHEMYPKPEYIRSDYQGSGKLKGQVAIISGGDSGIGRAVAVHFAAEGANIAIIYLN--  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA+ETV +++K      ++ IAI ADL   + C   V++ + A+G++D+LVNNAA+Q
Sbjct  75    EDKDAQETVRLVEK----HGQEAIAIKADLSRKQECFDAVEKTISAFGQLDVLVNNAAQQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y    +E+I E++L     TNI SYFFLT+ AL ++ +G++I+NT SI AY+G   L+DY
Sbjct  131   YVQERLEDISEEQLRHTFETNIYSYFFLTQAALPHLNKGAAIVNTASITAYRGKPTLIDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR LA  L ++GIRVNGVAPGPIWTPLIPASF++E+ A FG D P+ R  
Sbjct  191   SSTKGAIVAFTRSLAGNLADRGIRVNGVAPGPIWTPLIPASFSEEKVAEFGVDTPLGRPG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
              P EVA +YV+L AS D+SY+SGQ LHPNGG +VN
Sbjct  251   EPSEVATAYVYL-ASKDASYMSGQFLHPNGGEVVN  284



>ref|WP_026236114.1| short-chain dehydrogenase [Pontibacter roseus]
Length=286

 Score =   309 bits (791),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/274 (55%), Positives = 202/274 (74%), Gaps = 7/274 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G EH M P+P+Y    YK S+KL+GK+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GDEHKMTPQPEYIRENYKGSDKLKGKVALITGGDSGIGRAVAVHFAREGADVAIVYL--N  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA++T+G+I+K    + +  + IA D+G +  CKK V + V+  G++DILVNNAAEQ
Sbjct  76    EDKDAKDTLGLIEK----EGRKGLIIAGDIGDEAFCKKAVQQAVKELGKLDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +E S +++I +D+L R  +TNI S F++T+ AL++MKEGS+I+N+TS+ +Y+G   L+DY
Sbjct  132   HEQSDLKDISKDQLQRTFQTNIFSMFYMTKAALEHMKEGSTIVNSTSVTSYRGSDHLMDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
              +TKGAI AFTR L+  L  K IRVN VAPGPIWTPLIPASF +++   FG++VP++R  
Sbjct  192   ASTKGAITAFTRSLSANLAEKNIRVNAVAPGPIWTPLIPASFDEDKVKEFGQNVPLKRPG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIV  323
              P EVAP+YV L AS D SYI+GQV+H NGG  V
Sbjct  252   QPSEVAPAYVLL-ASEDGSYITGQVIHVNGGEQV  284



>ref|WP_028558398.1| short-chain dehydrogenase [Paenibacillus sp. URHA0014]
Length=289

 Score =   309 bits (791),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 205/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M+P P + +  YK + KL+ ++AL+TGGDSGIGRA+   +A EGA V   ++   
Sbjct  21    GIESQMEPIPVFDNTAYKAAGKLKDRVALITGGDSGIGRAIAIAYAKEGADVVLVFLN--  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+ DAEET   ++ A S      + +A D+G +  C++++D+ V+ +G++DILVNNAAEQ
Sbjct  79    ENGDAEETKRHVENAGS----KCLHVAGDIGDENFCQQIIDQTVQEFGKLDILVNNAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   ++E+I  ++L R  RTNI S+F+LT+ A+K++K GS+IINTTS+ AY GH KLLDY
Sbjct  135   HPQQNIEDITSEQLERTFRTNIFSFFYLTKAAIKHLKPGSAIINTTSVTAYHGHEKLLDY  194

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIV FTR L+LQL +KGIRVN VAPGPIWTPLIP++FT+++ A+FG   PM+RA 
Sbjct  195   SATKGAIVTFTRSLSLQLHDKGIRVNAVAPGPIWTPLIPSTFTEQDVAAFGSQTPMKRAG  254

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+A SYVFLA   DSSY+SGQVLH NGGAIVNG
Sbjct  255   QPSELAASYVFLACE-DSSYMSGQVLHVNGGAIVNG  289



>ref|WP_018987439.1| hypothetical protein [Methylophilus methylotrophus]
Length=296

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 200/276 (72%), Gaps = 5/276 (2%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M+PRPQY    YK + KL+GK+ L+TGGDSGIGRAV   FA EGA V   Y+  Q
Sbjct  26    GTEAEMEPRPQYIDPNYKAARKLEGKVGLITGGDSGIGRAVAVHFAAEGANVVINYLSEQ  85

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DAE+T+ +I    + +    +A+  D+     C+ +VD+ +  +G++D++VNNAA+Q
Sbjct  86    EKQDAEKTISLI----TSNGGQGLAVQGDISDASFCQSLVDKTIETFGQLDVVVNNAAQQ  141

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y  SS+E+ID+ +L +  +TN+ S F+L + ALK++KEG+ IINT S+ AYKG+  L+DY
Sbjct  142   YPQSSIEDIDQAQLEKTFKTNLFSMFYLVKSALKHLKEGARIINTASVTAYKGNKMLVDY  201

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIV+FTR LA QL ++ I VN VAPGPIWTPLIPASF+ E+   FG DV ++R  
Sbjct  202   SATKGAIVSFTRSLAQQLADRHIYVNAVAPGPIWTPLIPASFSPEKVEDFGTDVLLKRPG  261

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP YVFLA++ DSSYI+GQV+HPNGG +VNG
Sbjct  262   QPSEVAPVYVFLASN-DSSYITGQVIHPNGGTVVNG  296



>ref|WP_029282714.1| short-chain dehydrogenase [Bacillus indicus]
 gb|KEZ52227.1| short-chain dehydrogenase [Bacillus indicus LMG 22858]
Length=289

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/276 (54%), Positives = 203/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M+P+P++ SH+YK S KL  K A++TGGDSGIGR+V   FA EGA V  +Y+   
Sbjct  21    GHEDQMNPKPEFDSHQYKGSGKLSDKTAIITGGDSGIGRSVAVHFAREGADVVISYL--D  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA ET  ++++    + +  + I  D+G +  C +VV+E V  +G+IDILVNNAAEQ
Sbjct  79    EHDDANETKRLVEQ----EGRQCLLIPGDIGDEAFCGQVVNETVSKFGKIDILVNNAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +  + +EEI +++L R  +TNI S+F++T+ AL ++K+GSSIINT+SI AY G+ +L+DY
Sbjct  135   HPQAGIEEISKEQLERTFKTNIFSFFYMTKAALPHLKQGSSIINTSSITAYAGNEQLIDY  194

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAI  FTR L++ LV KGIRVNGVAPGPIWTPLIP++F  E+ + FG D PM R  
Sbjct  195   SATKGAITTFTRSLSMSLVKKGIRVNGVAPGPIWTPLIPSTFDAEKVSEFGADTPMGRPG  254

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFLA+S DSSYI+GQ++H NGG I+NG
Sbjct  255   QPDELAPSYVFLASS-DSSYITGQMIHVNGGKIING  289



>gb|AHL75688.1| short-chain dehydrogenase [Pseudomonas stutzeri]
Length=285

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 204/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE +M+PRP++   +YK + KLQGK+A++TGGDSGIGR+V   FA EGA VA  Y+   
Sbjct  17    GKEGLMNPRPEFRGEDYKAAGKLQGKVAIITGGDSGIGRSVAVLFAREGADVAILYLD--  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             + +DA+ET  ++++      +  +  A D+   + C+KV+DE +  +G++DILVNNAAEQ
Sbjct  75    QHQDADETRRVVEE----QGRQCLTFAGDVADRDVCRKVIDETLAKFGKLDILVNNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I E++  +  RTNI   F +T+ AL ++KEG+SIINTTS+ AYKG  +LLDY
Sbjct  131   HPQKGLEDISEEQWEQTFRTNIFGMFQMTKAALPHLKEGASIINTTSVTAYKGSPQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAI AFTR L++ L  +GIRVNGVAPGPIWTPLIP++F +E+   FG +VPM+R  
Sbjct  191   SATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLIPSTFDEEKVQKFGANVPMERPG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YV+LA+S D+SY+SGQV+H NGG +VNG
Sbjct  251   QPDEVAPAYVYLASS-DASYVSGQVIHVNGGTVVNG  285



>ref|WP_029565118.1| short-chain dehydrogenase [Bacillus cibi]
 gb|KEZ53424.1| short-chain dehydrogenase [Bacillus cibi]
Length=289

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/276 (54%), Positives = 202/276 (73%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P++ SH+YK S KL  K A++TGGDSGIGR+V   FA EGA V  +Y+   
Sbjct  21    GHEDQMHPKPEFDSHQYKGSGKLSDKTAIITGGDSGIGRSVAVHFAREGADVVISYL--D  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA ET  ++++    + +  + I  D+G +  C +VV+E V  +G+IDILVNNAAEQ
Sbjct  79    EHDDANETKRLVEQ----EGRQCLLIPGDIGDEAFCGQVVNETVSKFGKIDILVNNAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +  + +EEI +++L R  +TNI S+F++T+ AL ++K+GSSIINT+SI AY G+ +L+DY
Sbjct  135   HPQAGIEEISKEQLERTFKTNIFSFFYMTKAALSHLKQGSSIINTSSITAYAGNEQLIDY  194

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAI  FTR L++ LV KGIRVNGVAPGPIWTPLIP++F  E+ + FG D PM R  
Sbjct  195   SATKGAITTFTRSLSMSLVKKGIRVNGVAPGPIWTPLIPSTFDAEKVSEFGADTPMGRPG  254

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFLA+S DSSYI+GQ++H NGG I+NG
Sbjct  255   QPDELAPSYVFLASS-DSSYITGQMIHVNGGKIING  289



>ref|WP_004433959.1| short-chain dehydrogenase [Bacillus methanolicus]
 gb|EIJ82740.1| short-chain dehydrogenase/reductase SDR [Bacillus methanolicus 
MGA3]
 gb|AIE60013.1| putative oxidoreductase YhxC [Bacillus methanolicus MGA3]
Length=289

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/276 (54%), Positives = 202/276 (73%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P+     Y+PS KLQ K  ++TGGDSGIG+AV   FA EGA +  +Y+   
Sbjct  21    GLESEMKPKPEAEDLSYRPSGKLQDKTVIITGGDSGIGKAVAILFAKEGANIVLSYLN--  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA ET    K+    + +  I IA D+G +  CK++V++ ++ +G++DILVNNAAEQ
Sbjct  79    EHEDANET----KRQVEEENRTCIPIAGDIGDENVCKQIVNQTIKQFGKLDILVNNAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+  I  ++L R  RTNI SYFF+++ AL ++++GSSIINT S+ AYKG+ +LLDY
Sbjct  135   HPQPSLSNITANQLERTFRTNIFSYFFMSKAALPFLQKGSSIINTASVTAYKGNEQLLDY  194

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGA+V+FTR LAL LV++GIRVNGVAPGPIWTPLIP++F   + A+FG + PM+RA 
Sbjct  195   SATKGAVVSFTRSLALSLVDQGIRVNGVAPGPIWTPLIPSTFPSHQMATFGANTPMKRAG  254

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YVFL AS D+SYI+GQ++H NGG IVNG
Sbjct  255   QPKEVAPTYVFL-ASEDASYITGQIIHVNGGEIVNG  289



>ref|WP_014095754.1| short-chain dehydrogenase [Bacillus coagulans]
 ref|YP_004858375.1| short-chain dehydrogenase/reductase SDR [Bacillus coagulans 36D1]
 gb|AEO99594.1| short-chain dehydrogenase/reductase SDR [Bacillus coagulans 36D1]
 gb|KGB30840.1| short-chain dehydrogenase [Bacillus coagulans]
Length=290

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 205/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M+P+P+     YK S KL GKIAL+TGGDSGIG++V   FA EGA VA  Y+   
Sbjct  22    GTETEMNPQPKNVKDNYKGSGKLDGKIALITGGDSGIGKSVAIYFAKEGAHVAICYLN--  79

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E++DA++T  +++K    + +  + I  D+G +++C+  V++VV  +GR+DILVNNAAEQ
Sbjct  80    ENEDAKQTKELVEK----EGRQCLIIPGDIGDEQHCRDAVEKVVSTFGRLDILVNNAAEQ  135

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+ +I E++L+R  RTNI S FF+ + AL ++KEGSSIINTTSI AY+G  +LLDY
Sbjct  136   HPQKSILDISEEQLVRTFRTNIFSQFFMVKAALPHLKEGSSIINTTSITAYQGSPQLLDY  195

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAI AF R L+  LV+KGIRVNGVAPGPIWTPLIP++FT ++   FG DVPM+R  
Sbjct  196   SATKGAIAAFIRSLSQALVSKGIRVNGVAPGPIWTPLIPSTFTADQVEKFGSDVPMKRPG  255

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+AP+YV+L AS DSSY++GQV+H NGG ++NG
Sbjct  256   QPSELAPAYVYL-ASDDSSYVTGQVIHVNGGTVING  290



>ref|WP_029193233.1| short-chain dehydrogenase [Paenibacillus alginolyticus]
Length=289

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 199/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M+P P +    YK + KL+ K+AL+TGGDSGIGRAV   +A EGA V   Y+   
Sbjct  21    GIEAKMNPLPVFEHSGYKAAGKLKDKVALITGGDSGIGRAVAIAYAKEGADVVLVYLN--  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DAEET   ++KA     +  + +A D+G +  C +++++ V  +G++DILVNNAAEQ
Sbjct  79    EHTDAEETQRHVEKA----GRKCLHVAGDMGDENFCMQIIEQAVGKFGKLDILVNNAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E I  ++L R  RTNI S+F+LT+ AL ++K GS+IINT SI AY GH +LLDY
Sbjct  135   HPQPSIENITSEQLERTFRTNIFSFFYLTKAALPHLKSGSAIINTASITAYHGHEQLLDY  194

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIV FTR L+LQL  KGIRVNGVAPGPIWTPLIP++FT EE A+FG   PM+RA 
Sbjct  195   SATKGAIVTFTRSLSLQLNAKGIRVNGVAPGPIWTPLIPSTFTAEEVATFGSTTPMKRAG  254

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+A SYVFL AS DSSY++GQ+LH NGGAIVNG
Sbjct  255   QPSELAASYVFL-ASEDSSYMAGQILHVNGGAIVNG  289



>emb|CDZ80776.1| General stress protein 39 [Chlamydia sp. 'Rubis']
Length=280

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 159/276 (58%), Positives = 203/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E IM P+P+    +YK +NKL+GK+A++TGGDSGIG+AV   FA EGA +AF Y+   
Sbjct  12    GHETIMQPKPEAIKKDYKAANKLEGKVAVITGGDSGIGKAVALAFAKEGADIAFIYL--D  69

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E KDAEET    KK      K    I+ D+G ++NC K V ++++ Y +IDIL+NNAAEQ
Sbjct  70    EHKDAEET----KKEVEKIGKKCFIISTDIGVEKNCIKAVQDIIKKYKKIDILINNAAEQ  125

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I E +L +  RTN+ S FFLT+  LK++KEGS+I+NTTS+ AY+G  KLLDY
Sbjct  126   HSQESIEDITEKQLEKTFRTNVYSMFFLTKAVLKHLKEGSTIVNTTSVTAYRGSPKLLDY  185

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR LA  L  K IRVN VAPGPIWTPLIPA+F +++  SFGKD  M+RA 
Sbjct  186   SSTKGAIVAFTRSLAKNLAEKKIRVNAVAPGPIWTPLIPATFPQDKVDSFGKDTEMKRAG  245

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EV+P YVFL AS DSSYI+GQVLHPNGG I+NG
Sbjct  246   QPSEVSPCYVFL-ASDDSSYITGQVLHPNGGDIING  280



>dbj|BAP79673.1| general stress protein 39 [Pseudomonas sp. MT-1]
Length=285

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/276 (54%), Positives = 203/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE  M PRP+Y   +YK + KLQ K+A++TGGDSGIGR+V   FA EGA VA  Y+   
Sbjct  17    GKESEMTPRPEYRGEDYKAAGKLQDKVAIITGGDSGIGRSVAVLFAREGADVAILYL--D  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             + +DAEET    K+A     +  +A A D+   + C+KV+DE V A+G++DILVNNAAEQ
Sbjct  75    QHQDAEET----KRAVEEQGRKCLAFAGDVADRDVCRKVIDETVSAFGKLDILVNNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I E++  +  RTNI   F +T+ AL ++K+G+SIINTTS+ AYKG  +LLDY
Sbjct  131   HPQEKLEDISEEQWEKTFRTNIFGMFQMTKAALPHLKKGASIINTTSVTAYKGSPQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAI AFTR L++ + ++GIRVNGVAPGPIWTPLIP++F +++   FG +VPM+R  
Sbjct  191   SSTKGAITAFTRSLSMNIADRGIRVNGVAPGPIWTPLIPSTFDEDKVEKFGANVPMERPG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YV+LA+S D+SY+SGQV+H NGG +VNG
Sbjct  251   QPDEVAPAYVYLASS-DASYVSGQVIHVNGGTVVNG  285



>ref|WP_028554445.1| short-chain dehydrogenase [Paenibacillus sp. URHA0014]
Length=288

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 200/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M PRP+++   YKP+ KL+ K+AL+TGGDSGIGRA+   +A EGA V   Y+   
Sbjct  20    GIESDMQPRPEFTKASYKPAGKLKDKVALITGGDSGIGRAIALAYAQEGADVIIVYLN--  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DAEE+   +++A     +  + +A D+G +  CK+VV + ++ +G++DILVNNAAEQ
Sbjct  78    EHADAEESHRHVEQA----GRKCLHVAGDIGDENFCKQVVAQAIKEFGKLDILVNNAAEQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+ +I   +L R  RTNI S+FF+T+ AL ++K GS+IINT SI AY+GH +L+DY
Sbjct  134   HPQKSITDITAAQLERTFRTNIFSFFFMTQAALPHLKAGSAIINTASITAYQGHEQLIDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIV FTR L+LQL  KGIRVNGVAPGPIWTPLIP++FT +E   FG   PM+R  
Sbjct  194   SATKGAIVTFTRSLSLQLNAKGIRVNGVAPGPIWTPLIPSTFTAKEVEVFGSTTPMKRPG  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFL AS DSSY++GQ+LH NGG IVNG
Sbjct  254   QPCELAPSYVFL-ASEDSSYMAGQILHVNGGTIVNG  288



>ref|WP_006528898.1| dehydrogenase of unknown specificity [Gloeocapsa sp. PCC 73106]
 gb|ELR98244.1| dehydrogenase of unknown specificity [Gloeocapsa sp. PCC 73106]
Length=289

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 203/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P P+    +Y+ S KL+ K+AL+TGGDSGIGR+V   FA EGA V   Y+   
Sbjct  21    GIESEMTPAPKADDSKYRGSEKLKNKVALITGGDSGIGRSVAIFFAKEGANVVILYLD--  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA+ET  +++K    + +  +AIA D+G +  C++ V + +  +G++DIL+NNAAEQ
Sbjct  79    EHEDAQETQRLVEK----EGQKCLAIAGDIGDESFCQQAVQKTIEEFGQLDILINNAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I  ++L R  RTNI   FFLT+ A+ Y+K+G++IINTTS+ AY+G  +LLDY
Sbjct  135   HPQDSIEDITAEQLERTFRTNIFGMFFLTKMAMPYLKKGAAIINTTSVTAYQGSPQLLDY  194

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  L+ K IRVNGVAPGPIWTPLIP++F++E+ A+FGK VPMQR  
Sbjct  195   SSTKGAIVAFTRSLSQALIEKEIRVNGVAPGPIWTPLIPSTFSEEKVANFGKQVPMQRVG  254

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP YVFL AS DSSY+SGQ+LHPNGG +VNG
Sbjct  255   QPEEVAPCYVFL-ASDDSSYMSGQILHPNGGNVVNG  289



>ref|WP_013322819.1| short-chain dehydrogenase [Cyanothece sp. PCC 7822]
 ref|YP_003887989.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. PCC 7822]
 gb|ADN14714.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. PCC 7822]
Length=286

 Score =   306 bits (785),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/276 (55%), Positives = 200/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P+  + +Y  S KL  K+AL+TGGDSGIGRAV   FA EGA +A  Y+   
Sbjct  18    GLESEMTPQPESENEQYTGSGKLNHKVALITGGDSGIGRAVAIAFAKEGADIAIVYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA +T   +++      +  + +A D+G ++ C+K V + V  + ++DILVNNAAEQ
Sbjct  76    EHEDANQTKQRVEEL----GRRCVTLAGDIGDEQFCQKAVQKTVDEFKQLDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I   +L R  RTNI S FF+T+ AL ++K+GS+IINTTS+ AYKG+  LLDY
Sbjct  132   HPQQSIEDISAAQLERTFRTNIFSMFFMTKAALPHLKKGSTIINTTSVTAYKGNQTLLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV KGIRVNGVAPGPIWTPLIP++F +E+  SFG  VPMQR A
Sbjct  192   SSTKGAIVAFTRSLSQALVEKGIRVNGVAPGPIWTPLIPSTFPEEKVESFGAQVPMQRPA  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFLA++ DSSY SGQ+LHPNGG +VNG
Sbjct  252   QPDEVAPSYVFLASN-DSSYFSGQILHPNGGEVVNG  286



>ref|WP_015126919.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Calothrix sp. PCC 
7507]
 ref|YP_007063928.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Calothrix sp. PCC 
7507]
 gb|AFY31094.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Calothrix sp. PCC 
7507]
Length=285

 Score =   306 bits (785),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 202/276 (73%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M+P+P+     Y+ S KLQ K+A++TGGDSGIGRA+   FA EGA VA  Y+  Q
Sbjct  17    GMESEMNPKPKADDANYRGSGKLQDKVAIITGGDSGIGRAIAIAFAKEGADVAIVYL--Q  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET    ++      +  + IA D+  +  C+++V + V  +G++DIL+NNAAEQ
Sbjct  75    EHDDAKET----QEGVENQGRRALTIAGDITDETFCQQIVQKTVDEFGKLDILINNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I +++L R  RTNI S F+LT+ A+K++  GS+IINTTS+ AYKG+ +LLDY
Sbjct  131   HPQKSIEDISKEQLERTFRTNIFSMFYLTKAAIKHLHPGSAIINTTSVTAYKGNPQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV KGIRVN VAPGPIWTPLI ++F +E+ A+FG+ VPM+R  
Sbjct  191   SSTKGAIVAFTRSLSQNLVEKGIRVNAVAPGPIWTPLITSTFPEEKVATFGQQVPMKRPG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFL AS D+SYISGQVLHPNGG ++NG
Sbjct  251   QPEEVAPSYVFL-ASDDASYISGQVLHPNGGEVING  285



>ref|WP_007960687.1| short-chain dehydrogenase [Pelosinus fermentans]
 gb|EIW46987.1| short chain dehydrogenase/reductase family oxidoreductase [Pelosinus 
fermentans JBW45]
Length=284

 Score =   306 bits (784),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 199/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M+PRP   S  Y+ S+KL+ K+AL++GGDSGIGRAV   FA EGA VA  Y+   
Sbjct  16    GVESQMNPRPISISDNYRSSSKLENKVALISGGDSGIGRAVALAFAREGANVAIAYLN--  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA ET    KK      K  + IA D+G +  C++VV E ++ +G++DILVNNAAEQ
Sbjct  74    EHADAGET----KKLVEETGKRCLIIAGDIGNETFCQQVVAETIKEFGQLDILVNNAAEQ  129

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +  +S++ I   +L R  RTNI SYF+L++ AL ++K GSSIINT S+ AY+G+ +L+DY
Sbjct  130   HVQTSLQNISALQLERTFRTNIFSYFYLSKAALPHLKYGSSIINTASVTAYEGNEQLIDY  189

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIV+FTR L+  L+ +GIRVNGVAPGPIWTPLIPASF  +  A FG++ PM+RA 
Sbjct  190   SATKGAIVSFTRSLSQSLIGQGIRVNGVAPGPIWTPLIPASFNDQHVAQFGQNTPMKRAG  249

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP YVFL AS DSSY+SGQ+LH NGG IVNG
Sbjct  250   QPAEVAPCYVFL-ASVDSSYMSGQILHVNGGTIVNG  284



>ref|WP_033099303.1| short-chain dehydrogenase [Thermoactinomyces daqus]
Length=291

 Score =   306 bits (785),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 197/276 (71%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  MDPRP +   +     KL GK+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  23    GLEAEMDPRPVFDRPDRPGCGKLAGKVALITGGDSGIGRAVAVAFAKEGADVAIVYLN--  80

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+ DA ET    K+   G  +  +A A D+G +  C +VV EVVR  GR+DILVNNAAEQ
Sbjct  81    EESDAAET----KRYVEGLGRRLLAFAGDIGDESFCGQVVTEVVRELGRLDILVNNAAEQ  136

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
                S VE+I + +L +  RTN+ S+F+  + A  ++K+GS+IINTTS+ AYKG+ +L+DY
Sbjct  137   TPQSGVEQITQAQLEKTFRTNLFSFFYFVKAASPHLKQGSAIINTTSVTAYKGNEQLIDY  196

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIV+FTR LAL LV +GIRVNGVAPGPIWTPLIP++F  ++ A FG D PM R  
Sbjct  197   SATKGAIVSFTRSLALSLVKRGIRVNGVAPGPIWTPLIPSTFPADQVAKFGTDTPMGRPG  256

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+E+AP+YVFL AS DSSY++GQ+LH NGG IVNG
Sbjct  257   QPVELAPAYVFL-ASDDSSYMTGQILHVNGGEIVNG  291



>gb|KIL17971.1| hypothetical protein B4127_1052 [Bacillus pumilus]
Length=286

 Score =   306 bits (784),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 157/276 (57%), Positives = 199/276 (72%), Gaps = 9/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E+ M+PRP +      P  KL GK A+VTGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  20    GLEYKMNPRPVFDRE--MPDKKLAGKTAIVTGGDSGIGRAVSVLFAKEGANVAIVYL--S  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DAEET   I+KA  G A   I IA DLG +    +VV +   A+G IDILVNNA EQ
Sbjct  76    EHRDAEETKDYIEKA-GGRA---ILIAGDLGDESFSNEVVKKTKDAFGSIDILVNNAGEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I   +LLR  +TNI + F+LT+  L ++K+GSSIINT S+ AYKGH  L+DY
Sbjct  132   HPQKSIEQITSHQLLRTFQTNIFAMFYLTKAVLPHLKKGSSIINTASVTAYKGHETLIDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGA+V FTR L+L L+ +GIRVNGVAPGPIWTPLIP++FT++E + FG DVPM+R  
Sbjct  192   SSTKGAVVTFTRSLSLSLIKQGIRVNGVAPGPIWTPLIPSTFTEKEVSEFGGDVPMERPG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+E+APSY+FL AS DSSYI+GQ+LH NGG I+NG
Sbjct  252   EPVELAPSYLFL-ASEDSSYINGQILHVNGGTILNG  286



>ref|WP_034663528.1| short-chain dehydrogenase [Bacillus pumilus]
 gb|KDE52333.1| short-chain dehydrogenase [Bacillus pumilus]
 gb|KEO48609.1| short-chain dehydrogenase [Bacillus pumilus]
Length=286

 Score =   306 bits (784),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 157/276 (57%), Positives = 199/276 (72%), Gaps = 9/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E+ M+PRP +      P  KL GK A+VTGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  20    GLEYKMNPRPVFDRE--VPDKKLAGKTAIVTGGDSGIGRAVSVLFAKEGANVAIVYL--S  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DAEET   I+KA  G A   I IA DLG +    +VV +   A+G IDILVNNA EQ
Sbjct  76    EHRDAEETKDYIEKA-GGRA---ILIAGDLGDETFSNEVVKKTKDAFGSIDILVNNAGEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I   +LLR  +TNI + F+LT+  L ++K+GSSIINTTS+ AYKGH  L+DY
Sbjct  132   HPQKSIEQITSHQLLRTFQTNIFAMFYLTKAVLPHLKKGSSIINTTSVTAYKGHETLIDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGA+V FTR L+L L+ +GIRVNGVAPGPIWTPLIP++FT+ E + FG DVPM+R  
Sbjct  192   SSTKGAVVTFTRSLSLSLIKQGIRVNGVAPGPIWTPLIPSTFTENEVSEFGGDVPMERPG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+E+APSY+FL AS DSSY++GQ+LH NGG I+NG
Sbjct  252   EPVELAPSYLFL-ASEDSSYMNGQILHVNGGTILNG  286



>ref|WP_019339147.1| short-chain dehydrogenase [Pseudomonas stutzeri]
Length=285

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 204/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE  M PRP+Y   +YK + KLQGK+A++TGGDSGIGR+V   FA EGA VA  Y+   
Sbjct  17    GKESEMRPRPEYRGEDYKAAGKLQGKVAIITGGDSGIGRSVAVLFAREGADVAILYL--D  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             + +DAEET  ++++      +  +  A D+   + C+KV+DE + A+G++D+LVNNAAEQ
Sbjct  75    QHQDAEETKRVVEQ----QGRKCLTFAGDVADRDVCRKVIDETLGAFGQLDLLVNNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I E++  +  RTNI   F +T+ AL ++K+G+SIINTTS+ AYKG  +LLDY
Sbjct  131   HPQEKLEDISEEQWEKTFRTNIFGMFQMTKAALPHLKKGASIINTTSVTAYKGSPQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAI AFTR L++ + ++GIRVNGVAPGPIWTPLIP++F +++   FG +VPM+R  
Sbjct  191   SSTKGAITAFTRSLSMNIADRGIRVNGVAPGPIWTPLIPSTFDEDKVEKFGANVPMERPG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YV+LA+S DSSY+SGQV+H NGG +VNG
Sbjct  251   QPDEVAPAYVYLASS-DSSYVSGQVIHVNGGTVVNG  285



>ref|WP_011140423.1| short-chain dehydrogenase [Gloeobacter violaceus]
 ref|NP_923366.1| oxidoreductase [Gloeobacter violaceus PCC 7421]
 dbj|BAC88361.1| glr0420 [Gloeobacter violaceus PCC 7421]
Length=286

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 199/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+PQ    +Y+ S KLQ K+AL+TGGDSGIGRAV   +A EGA VA  Y+   
Sbjct  18    GLESEMTPKPQADDPKYRGSGKLQDKVALITGGDSGIGRAVAIFYAKEGADVAVLYL--D  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  ++++      +  + IA D+G +  C++ V +VV  +GR+DILVNNAAEQ
Sbjct  76    EHDDAKETCRLVREI----GQRCLTIAGDIGDESFCRQAVAQVVDEFGRLDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I  ++L R  RTNI S+F++T+ AL ++K GS+IIN+TS+ AYKG  +LLDY
Sbjct  132   HPQKSIEDISAEQLERTFRTNIFSFFYMTKAALPHLKPGSAIINSTSVTAYKGSPQLLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  L+ KGIRVNGVAPGPIWTPLIPAS + E  AS G   PM R  
Sbjct  192   SSTKGAIVAFTRSLSQALLEKGIRVNGVAPGPIWTPLIPASMSPERTASHGSSAPMGRVG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFL AS DSSYI+GQ+LHPNGG +VNG
Sbjct  252   QPEEVAPSYVFL-ASDDSSYITGQILHPNGGEVVNG  286



>ref|XP_004356989.1| seed maturation protein PM34, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR24970.1| seed maturation protein PM34, putative [Acanthamoeba castellanii 
str. Neff]
Length=293

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 198/277 (71%), Gaps = 6/277 (2%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G EH M+P PQY +  YK S KL+ K+A++TGGDSGIGR+V   +A EGA V   Y+ P+
Sbjct  22    GYEHEMEPAPQYLAPNYKGSEKLKDKVAIITGGDSGIGRSVSILYAREGADVVIVYL-PE  80

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E KDA+ T G+++K    + +  + I  DL   + C  VVD+ ++ +G++DILVNNA+ Q
Sbjct  81    EQKDADTTKGLVEK----EGRQCLCIPGDLKKSDFCDSVVDQTIKRFGKLDILVNNASSQ  136

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +E   +E+I +++L    RTNI S F++ R ++K+MKEGS IINTTS+  Y+G   LLDY
Sbjct  137   WECEKIEDITDEQLETTFRTNIFSMFYMARASVKHMKEGSCIINTTSVTCYRGMKTLLDY  196

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGK-DVPMQRA  428
             ++TKGAI  FT  L+  LV +GIRVNGVAPGPIWTPLIPASF  E   +FG+ D PM RA
Sbjct  197   SSTKGAITTFTYSLSQNLVERGIRVNGVAPGPIWTPLIPASFKPERVKTFGQEDCPMGRA  256

Query  427   AHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
               P EVAP YVFLA++ DSSYISGQVLHPNGG+ V+G
Sbjct  257   GQPEEVAPCYVFLASNADSSYISGQVLHPNGGSPVHG  293



>ref|WP_003211351.1| short-chain dehydrogenase [Bacillus pumilus]
 gb|EDW23080.1| general stress protein 39 (GSP39) [Bacillus pumilus ATCC 7061]
Length=286

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 197/276 (71%), Gaps = 9/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E+ M+PRP +      P  KL GK A+VTGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  20    GLEYKMNPRPVFDRE--MPDKKLAGKTAIVTGGDSGIGRAVSVLFAKEGANVAIVYL--S  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DAEET   I+K         I IA DLG +    +VV +   A+G IDILVNNA EQ
Sbjct  76    EHRDAEETKDYIEKG----GGRVILIAGDLGDESFSNEVVKKTKDAFGSIDILVNNAGEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I   +LLR  +TNI + F+LT+  L ++K+GSSIINTTS+ AYKGH  L+DY
Sbjct  132   HPQKSIEQITSHQLLRTFQTNIFAMFYLTKAVLPHLKKGSSIINTTSVTAYKGHETLIDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGA+V FTR L+L L+ +GIRVNGVAPGPIWTPLIP++FT++E + FG DVPM+R  
Sbjct  192   SSTKGAVVTFTRSLSLSLIKQGIRVNGVAPGPIWTPLIPSTFTEKEVSEFGGDVPMERPG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+E+APSY+FL AS DSSYI+GQ+LH NGG I+NG
Sbjct  252   EPVELAPSYLFL-ASEDSSYINGQILHVNGGTILNG  286



>ref|WP_014820194.1| short-chain dehydrogenase [Pseudomonas stutzeri]
 ref|YP_006457654.1| short-chain dehydrogenase [Pseudomonas stutzeri CCUG 29243]
 gb|AFM33231.1| short-chain dehydrogenase [Pseudomonas stutzeri CCUG 29243]
Length=285

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 203/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE +M+PRP+Y   +YK + KL+GK+A++TGGDSGIGR+V   +A EGA VA  Y+   
Sbjct  17    GKEGLMNPRPEYRGKDYKAAGKLEGKVAIITGGDSGIGRSVAVLYAREGADVAILYL--D  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             + +DAEET  ++++      +  +  A D+   E C+KV+DE + A+G++DILVNNAAEQ
Sbjct  75    QHQDAEETRTVVEQY----GRRCLTFAGDVADREVCRKVIDETLAAFGKLDILVNNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I E++  +  RTNI   F +T+ AL ++ +G+SIINTTS+ AYKG  +LLDY
Sbjct  131   HPQEKLEDISEEQWEKTFRTNIFGMFQMTKAALPHLGKGASIINTTSVTAYKGSPQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAI AFTR L++ L  +GIRVNGVAPGPIWTPLIP++F  +E A FG + PM+R  
Sbjct  191   SATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLIPSTFDADEVAEFGSNTPMKRPG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YV+LA+S D++Y+SGQV+H NGG +VNG
Sbjct  251   QPDEVAPAYVYLASS-DAAYVSGQVIHVNGGTVVNG  285



>ref|WP_023172258.1| short-chain dehydrogenase/reductase SDR [Gloeobacter kilaueensis]
 ref|YP_008710902.1| short-chain dehydrogenase/reductase SDR [Gloeobacter kilaueensis 
JS1]
 gb|AGY57195.1| short-chain dehydrogenase/reductase SDR [Gloeobacter kilaueensis 
JS1]
Length=288

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 198/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P Y +  Y  +NKL  K+AL+TGGDSGIGRAV   FA E A +A  Y+   
Sbjct  20    GSEAQMTPQPVYDNENYHGANKLLNKVALITGGDSGIGRAVAVFFAKEKADIAIVYLD--  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA++T  ++++      +  + IA D+G +  CK+ V+  ++ +G+++ILVNNAAEQ
Sbjct  78    EHEDAQKTKQLVEQ----QGRRCVTIAGDIGDEAFCKQAVERTIQEFGQLNILVNNAAEQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+ +I  ++L R  RTNI + F+L + AL ++K GS+IINTTS+ AYKG  KLLDY
Sbjct  134   HPQESIADITSEQLERTFRTNIFAQFYLVKAALPHLKSGSAIINTTSVTAYKGSPKLLDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
               TKGAIVAFTR L+  L++KGIRVNGVAPGPIWTPLIPASF  E+ AS G + PM+RA 
Sbjct  194   ATTKGAIVAFTRSLSQALIDKGIRVNGVAPGPIWTPLIPASFGPEKTASHGSNAPMERAG  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFL AS DSSYISGQ+LHPNGG +VNG
Sbjct  254   QPAEVAPSYVFL-ASEDSSYISGQILHPNGGEVVNG  288



>ref|WP_007937306.1| MULTISPECIES: short-chain dehydrogenase [Pelosinus]
 gb|EIW16327.1| short chain dehydrogenase/reductase family oxidoreductase [Pelosinus 
fermentans B4]
 gb|EIW22693.1| short-chain dehydrogenase/reductase SDR [Pelosinus fermentans 
A11]
 gb|EIW29720.1| short chain dehydrogenase/reductase family oxidoreductase [Pelosinus 
fermentans DSM 17108]
Length=284

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 201/276 (73%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M+PRP   S  Y+ S+KL+ K+AL++GGDSGIGRAV   FA EGA V  +Y+   
Sbjct  16    GIESQMNPRPISISDNYRSSSKLENKVALISGGDSGIGRAVALAFAKEGANVVISYLN--  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA ET  ++++      K  + IA D+G +  C++VV E V+ +G++DILVNNAAEQ
Sbjct  74    EHADAGETKNLVEET----GKRCLIIAGDIGNETFCQQVVAETVKEFGQLDILVNNAAEQ  129

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +  +S++ I   +L R  RTNI SYF+L++ AL ++K GS+IINT S+ AY+G+ +L+DY
Sbjct  130   HVQTSLQNISALQLERTFRTNIFSYFYLSKAALPHLKYGSAIINTASVTAYEGNEQLIDY  189

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIV+FTR L+  L+ +GIRVNGVAPGPIWTPLIPASF  +  A FG++ PM+RA 
Sbjct  190   SATKGAIVSFTRSLSQSLIGQGIRVNGVAPGPIWTPLIPASFNDQHVAQFGQNTPMKRAG  249

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP YVFL AS DSSY+SGQ+LH NGG IVNG
Sbjct  250   QPAEVAPCYVFL-ASADSSYMSGQILHVNGGTIVNG  284



>ref|WP_012372871.1| short-chain dehydrogenase [Opitutus terrae]
 ref|YP_001816933.1| short-chain dehydrogenase/reductase SDR [Opitutus terrae PB90-1]
 gb|ACB73333.1| short-chain dehydrogenase/reductase SDR [Opitutus terrae PB90-1]
Length=282

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/276 (56%), Positives = 197/276 (71%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M PRP    +  KP+ +L GK+AL+TGGDSGIGRAV   FA EGA +A  Y+   
Sbjct  14    GIESAMTPRPVSEGNHLKPAGRLLGKVALITGGDSGIGRAVAIAFAREGANIALNYL--N  71

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA ET   ++       +  + +  D+G    C+K V   +  Y  ID++VNNAAEQ
Sbjct  72    EHTDAIETRTRVETL----GRSCLLLPGDVGDSRECEKFVTATLAKYEGIDVVVNNAAEQ  127

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +  +S+ +I + +L R  RTNI ++F+LTR AL Y+K+G+++INTTS+ AY+G + LLDY
Sbjct  128   HPQASLADITDAQLERTFRTNIFAHFYLTRAALPYLKKGATVINTTSVTAYRGSSHLLDY  187

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIVAFTR LAL LV KGIRVN VAPGPIWTPLIPA+F+KE+ ASFG DVPM+RA 
Sbjct  188   SATKGAIVAFTRSLALALVEKGIRVNAVAPGPIWTPLIPATFSKEKVASFGSDVPMKRAG  247

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP YVFL AS ++SYI+GQVLHPNGG I+NG
Sbjct  248   EPEEVAPCYVFL-ASEEASYITGQVLHPNGGEIING  282



>ref|WP_028394424.1| short-chain dehydrogenase [Bacillus sp. FJAT-14578]
Length=289

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 194/276 (70%), Gaps = 6/276 (2%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P P+ ++ +YK S KLQG+ A++TGGDSGIGRAV   +A EG  V   Y+   
Sbjct  20    GIEKEMRPLPKTNNDDYKGSEKLQGRTAIITGGDSGIGRAVAIAYAKEGTNVTIVYLN--  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DAEET  ++++         + +  D+G +  CK+VV E V   G +DILVNNA EQ
Sbjct  78    ESNDAEETKQLVEE----QGVRCLLLEGDIGDESFCKQVVQETVEKLGGLDILVNNAGEQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+ +I  ++L +  RTNI S F LT+ AL ++KEGS+IINTTSI AY GH  LLDY
Sbjct  134   HPKESILDISTEQLEKTFRTNIFSMFHLTKAALPHLKEGSAIINTTSITAYAGHKTLLDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAI  FTR L+LQL  KGIRVNGVAPGPIWTPLIP++FT E+ + FG+D PMQR  
Sbjct  194   SATKGAITTFTRSLSLQLAEKGIRVNGVAPGPIWTPLIPSTFTAEQVSKFGQDTPMQRPG  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+AP+YV+LA++ DSSY+SGQ+LH NGG +VNG
Sbjct  254   QPEELAPAYVYLASNADSSYVSGQILHINGGKVVNG  289



>ref|WP_025847183.1| short-chain dehydrogenase [Paenibacillus ehimensis]
Length=289

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/276 (54%), Positives = 199/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M PRP+    +YK S KLQGK+A++TGGDSGIGRA   CFA EGA +A  Y+   
Sbjct  21    GIESRMTPRPRAVDRKYKGSGKLQGKVAVITGGDSGIGRAAAVCFAAEGADLAIVYLN--  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DAEET  +I+     + +  + I  D+G +  C++ V   V  +GR+DILVNNAAEQ
Sbjct  79    ETGDAEETKRLIE----AEGRKCLLIQGDIGDEPFCQETVKRTVETFGRLDILVNNAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +++I +++L R  RTN+ S+F++T+ A+ ++KEGSSIINT SI AY+G+ +L+DY
Sbjct  135   HPQRRIDDISQEQLERTFRTNLFSFFYMTKAAMPHLKEGSSIINTASITAYRGNPELIDY  194

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIV+FTR L++ LV KGIRVNG+APGPIWTPLIP++F +E+ A FG D PM+R  
Sbjct  195   SATKGAIVSFTRSLSMNLVGKGIRVNGIAPGPIWTPLIPSTFDEEKVAEFGGDSPMKRPG  254

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+ P+YVFL AS DSSY+SGQ LH NGG IV G
Sbjct  255   QPEELGPAYVFL-ASDDSSYMSGQFLHINGGEIVGG  289



>gb|ESA23769.1| hypothetical protein GLOINDRAFT_15099 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX74133.1| oxidoreductase [Rhizophagus irregularis DAOM 197198w]
Length=307

 Score =   305 bits (782),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/261 (58%), Positives = 197/261 (75%), Gaps = 6/261 (2%)
 Frame = -1

Query  1099  EYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGAT-VAFTYVKPQEDKDAEETVGIIKK  923
             EY+P+NKL+ KIAL+TGGDSGIGR+V   FALEGA+ +A TY+ P+E+KDA ET   I+K
Sbjct  51    EYQPANKLKNKIALITGGDSGIGRSVACLFALEGASGIAITYL-PREEKDAHETKERIEK  109

Query  922   AKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQYEASSVEEIDEDRL  743
                 +    + I  D+G++EN   ++++VV+ +GRIDILVNNA+EQ+  S +E++  ++L
Sbjct  110   QSKTEI---LLINKDVGYEENAIDIINQVVKKWGRIDILVNNASEQHLTSRIEDLSSEQL  166

Query  742   LRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDYTATKGAIVAFTRGL  563
              R  RTNI    +L +HA+ +MK+GS+IINTTS+ AYKG+A LLDY++TKGAIV+FTR L
Sbjct  167   ERTFRTNIFGMIYLAKHAVPHMKKGSTIINTTSVTAYKGYATLLDYSSTKGAIVSFTRSL  226

Query  562   ALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAAHPIEVAPSYVFLAA  383
             +  L  +GIRVN VAPGPIWTPLI ASF  E    FGK+ P+ R   P EVA SYVFLA+
Sbjct  227   SQHLTERGIRVNAVAPGPIWTPLIVASFPTEAMEKFGKETPLGRPGQPSEVATSYVFLAS  286

Query  382   SPDSSYISGQVLHPNGGAIVN  320
             S DSSYI+GQVLHPNGG IVN
Sbjct  287   S-DSSYITGQVLHPNGGTIVN  306



>ref|WP_014247477.1| short-chain dehydrogenase [Azospirillum lipoferum]
 ref|YP_005038692.1| putative short-chain dehydrogenase/reductase [Azospirillum lipoferum 
4B]
 emb|CBS86455.1| putative short-chain dehydrogenase/reductase [Azospirillum lipoferum 
4B]
Length=286

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/276 (54%), Positives = 201/276 (73%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G +  MDP+P  +   Y+ S KL+ K+AL+TGGDSGIGRA+   +A EGA V   Y+   
Sbjct  18    GHQAPMDPQPSETRPGYRGSGKLRDKVALITGGDSGIGRAIAVLYAREGAKVGILYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED+DA ET  +++     + +    ++ D+G +E C+K V+ ++  +GRIDIL+NNAAEQ
Sbjct  76    EDEDARETRRLVE----AEGQPCTILSGDVGQEETCRKAVESMIGEHGRIDILINNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +  +S+E+I  ++L R  RTNI   FF+ + AL +M EG+ I+NTTS+ AYKG  +LLDY
Sbjct  132   HPQTSIEDITAEQLERTFRTNIFGQFFMVKAALPHMNEGACIVNTTSVTAYKGSPELLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIVAFTR L++ L ++GIRVN VAPGPIWTPLIP++F +E+  SFG +VPM+RA 
Sbjct  192   SATKGAIVAFTRSLSMALADRGIRVNAVAPGPIWTPLIPSTFDEEKVESFGGNVPMKRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP +VFL AS DSSY+SGQVLHPNGG +VNG
Sbjct  252   QPDEVAPCFVFL-ASDDSSYMSGQVLHPNGGTVVNG  286



>ref|WP_034131758.1| short-chain dehydrogenase [Peptococcaceae bacterium BICA1-8]
Length=289

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 198/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E +M+P+P      YK S KL  K+AL+TGGDSGIG++V   FA EGA +A  Y+   
Sbjct  21    GLETLMNPQPISEDPSYKGSGKLYKKVALITGGDSGIGKSVSIYFAKEGADIAIVYL--S  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E+KDAEET    KK    + +  + IA D+G +E CKK  +E V+  G++DILVNNAAEQ
Sbjct  79    ENKDAEET----KKQIEEEGQRCLLIAGDVGDEEFCKKATEETVKTLGKLDILVNNAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +  ++ E+I   ++ R  +TNI S F++++ ALKY+K+GSSIINT S+ AYKG+  L+DY
Sbjct  135   HVQTNFEDITSQQMERTFKTNIFSCFYMSKAALKYLKQGSSIINTASVTAYKGNPVLIDY  194

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKG+IV+FTR LAL L  +GIRVN VAPGPIWTPLIPASF  E+ A+FG   PMQR  
Sbjct  195   SSTKGSIVSFTRSLALSLAQRGIRVNSVAPGPIWTPLIPASFPAEQVATFGSTTPMQRPG  254

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+AP YVFL AS D SY++GQV+HPNGG IVNG
Sbjct  255   QPEEIAPCYVFL-ASDDGSYMTGQVMHPNGGEIVNG  289



>ref|WP_025911875.1| short-chain dehydrogenase [Bacillus flexus]
Length=288

 Score =   305 bits (780),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 199/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M+P+P     EYK S KL GK+A++TGGDSGIGR+V   FA EGA +  TY+   
Sbjct  20    GIESEMNPKPTAIEPEYKASGKLSGKVAIITGGDSGIGRSVAYHFAKEGANIVITYLD--  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET    KK         +A++ D+G +  C+KVV E +  +G++DILVNNAAEQ
Sbjct  78    EHDDADET----KKTIEEYGVSCLALSGDIGEEPFCEKVVHETIEKFGQLDILVNNAAEQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    + +I  ++L R  +TNI S+F+ T+ A+ ++K+GSSIINTTS+ AY GH +L+DY
Sbjct  134   HPQKDITQISAEQLQRTFQTNIFSFFYFTKAAMPHLKKGSSIINTTSVTAYHGHDQLIDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIV+FTR L+  L  KGIRVNGVAPGPIWTPLIP++F +++ ASFG D PMQRA 
Sbjct  194   SSTKGAIVSFTRSLSASLAAKGIRVNGVAPGPIWTPLIPSTFDEQQVASFGADTPMQRAG  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+ P+YVFLA++ DSSYISGQV+H NGG IVNG
Sbjct  254   QPSELGPAYVFLASN-DSSYISGQVIHINGGTIVNG  288



>ref|WP_008578832.1| short-chain dehydrogenase [candidate division TM7 genomosp. GTL1]
 gb|EDK72521.1| short-chain dehydrogenase/reductase SDR [candidate division TM7 
genomosp. GTL1]
Length=282

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 149/276 (54%), Positives = 199/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G++H M+ +P+  S EY+ S KL+ K+AL+TGGDSGIGRAV   FA EGA VA +Y+  +
Sbjct  14    GRQHEMEQQPRSESPEYRGSGKLKEKVALITGGDSGIGRAVAIAFAKEGAEVAISYL--E  71

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E KDAEET  +IK+    + KD +AI  D+     C +++  VV A+GR+DILVNNA EQ
Sbjct  72    EHKDAEETKRLIKE----EGKDCLAIPGDITDPSFCNELIRRVVEAFGRLDILVNNAGEQ  127

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    + +I +++L R  RTNI S F+L + +L ++ +G +I+NT+S+ AYKGH  L+DY
Sbjct  128   HPQDDISKISDEQLERTFRTNIFSMFYLVKASLPHLSKGGAIVNTSSVTAYKGHPLLIDY  187

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             + TKGAI+ FTR L+L L  KGIRVN VAPGPIWTPLIP++F +E    FGKD PMQR  
Sbjct  188   STTKGAIIGFTRSLSLSLAPKGIRVNAVAPGPIWTPLIPSTFPEENIERFGKDTPMQRPG  247

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVA S+VFL AS DSSYISGQ +HPNGG+++NG
Sbjct  248   QPEEVAASFVFL-ASDDSSYISGQTIHPNGGSVING  282



>ref|WP_038668342.1| short-chain dehydrogenase [Pelosinus sp. UFO1]
 gb|AIF50429.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Pelosinus sp. UFO1]
Length=290

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 198/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P P +    Y+ S KL+ K+A+++GGDSGIGRAV   FA EGA V  TY+   
Sbjct  22    GIESQMKPLPIFMDANYRASGKLENKVAIISGGDSGIGRAVALAFAKEGANVTITYLN--  79

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA ET  +I++      K  + IA D+G +  C++VV + V  +G++DILVNNAAEQ
Sbjct  80    EHDDAAETKKLIEQMN----KSCLTIAGDIGDERFCQQVVADTVSKFGQLDILVNNAAEQ  135

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +  +S++ I   +L +  RTNI SYFFL++ AL ++K+GS IINT S+ AYKG+ +L+DY
Sbjct  136   HVQTSLQNISAAQLEKTFRTNIFSYFFLSKAALSHLKKGSVIINTASVTAYKGNEQLIDY  195

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIVAFTR L+L L+ +GIRVNGVAPGPIWTPLIPASF   +  +FG+D PM+RA 
Sbjct  196   SATKGAIVAFTRSLSLSLIPQGIRVNGVAPGPIWTPLIPASFPDPDITTFGQDTPMKRAG  255

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+EVAP YVFL AS DS Y+SGQ+LH NGG IVNG
Sbjct  256   QPVEVAPCYVFL-ASQDSVYMSGQILHVNGGTIVNG  290



>ref|WP_023445357.1| MULTISPECIES: short-chain dehydrogenase [Pseudomonas stutzeri 
group]
 gb|ESQ99282.1| short-chain dehydrogenase [Pseudomonas chloritidismutans AW-1]
 emb|CEG51652.1| Uncharacterized oxidoreductase YhxC [Pseudomonas xanthomarina]
Length=285

 Score =   304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 203/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE +M+PRP+Y   +YK + KL+GK+A++TGGDSGIGR+V   +A EGA VA  Y+   
Sbjct  17    GKEGLMNPRPEYRGEDYKAAGKLEGKVAIITGGDSGIGRSVAVLYAREGADVAILYL--D  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             + +DAEET  ++++      +  +  A D+   + C+KV+DE + A+G++DILVNNAAEQ
Sbjct  75    QHQDAEETRTVVEQY----GRRCLTFAGDVADRDVCRKVIDETLAAFGKLDILVNNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I E++  +  RTNI   F +T+ AL ++ +G+SIINTTS+ AYKG  +LLDY
Sbjct  131   HPQEKLEDISEEQWEKTFRTNIFGMFQMTKAALPHLGKGASIINTTSVTAYKGSPQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAI AFTR L++ L  +GIRVNGVAPGPIWTPLIP++F  +E A FG + PM+R  
Sbjct  191   SATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLIPSTFDADEVAEFGSNTPMKRPG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YV+LA+S D++Y+SGQV+H NGG +VNG
Sbjct  251   QPDEVAPAYVYLASS-DAAYVSGQVIHVNGGTVVNG  285



>ref|WP_028989030.1| short-chain dehydrogenase [Thermithiobacillus tepidarius]
Length=287

 Score =   304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 198/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G+E  M PRP+     Y+ S KL  K AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  19    GRESDMTPRPRADDSRYRGSGKLANKAALITGGDSGIGRAVAIAFAKEGADVAIVYLS--  76

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DAEE+  ++++      +  I IA D G +  C++ V + + A+GR+D+LVNNAAEQ
Sbjct  77    EHGDAEESKRLVEQ----QGRRCITIAGDAGDEGFCRQAVQQTLDAFGRLDVLVNNAAEQ  132

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I  ++L +  RTNI SYFF+T+ AL ++K G++I+NTTS+ AYKG  +LLDY
Sbjct  133   HPQKRLEDISAEQLEKTFRTNIFSYFFMTKAALPHLKAGAAIVNTTSVTAYKGSPELLDY  192

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  L  +GIRVN VAPGPIWTPLIP++F  E+  SFGK+VP+ RA 
Sbjct  193   SSTKGAIVAFTRSLSQSLAEQGIRVNAVAPGPIWTPLIPSTFPPEKVESFGKNVPLGRAG  252

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFL AS D+SY++GQVLHPNGG +VNG
Sbjct  253   QPEEIAPSYVFL-ASDDASYMTGQVLHPNGGTVVNG  287



>ref|WP_035189366.1| short-chain dehydrogenase [Bacillus coagulans]
 gb|KGT38702.1| short-chain dehydrogenase [Bacillus coagulans P38]
Length=290

 Score =   304 bits (778),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/276 (54%), Positives = 204/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M+P+P+     YK S KL GK+AL+TGGDSGIG++V   FA EGA VA  Y+   
Sbjct  22    GTETEMNPQPENVKDNYKGSGKLDGKVALITGGDSGIGKSVAIYFAKEGAHVAICYLN--  79

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E++DA++T  +++K    + +  + I  D+G +++C+  V++V   +GR+DILVNNAAEQ
Sbjct  80    ENEDAKQTKELVEK----EGRQCLIIPGDIGEEQHCRDAVEKVAGTFGRLDILVNNAAEQ  135

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+ +I E++L++  RTNI S FF+ + AL ++KEGSSIINTTSI AY+G  +LLDY
Sbjct  136   HPQKSILDISEEQLVKTFRTNIFSQFFMVKAALPHLKEGSSIINTTSITAYQGSPQLLDY  195

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAI AF R L+  LV+KGIRVNGVAPGPIWTPLIP++FT ++   FG DVPM+R  
Sbjct  196   SATKGAIAAFIRSLSQALVSKGIRVNGVAPGPIWTPLIPSTFTADQVEKFGSDVPMKRPG  255

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+AP+YV+L AS DSSY++GQV+H NGG ++NG
Sbjct  256   QPSELAPAYVYL-ASDDSSYVTGQVIHVNGGTVING  290



>ref|WP_015436274.1| short-chain dehydrogenase family protein [Azoarcus sp. KH32C]
 ref|YP_007551945.1| short-chain dehydrogenase family protein [Azoarcus sp. KH32C]
 dbj|BAL24969.1| short-chain dehydrogenase family protein [Azoarcus sp. KH32C]
Length=291

 Score =   303 bits (777),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 204/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G+E  M P+PQ    +Y+ + KL+GK+A+VTGGDSGIGRAV   FA EGA VA  Y+  +
Sbjct  23    GREAPMRPQPQDHMKDYRGAGKLEGKVAIVTGGDSGIGRAVAIGFAKEGADVAVVYL--E  80

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DAE+T    +++     +  + IA D+G ++  K VV +V++ +GR+DI+VNNAAEQ
Sbjct  81    EHEDAEDT----RRSVEAAGRRCLLIAGDVGNEDFTKDVVGQVIKEFGRLDIVVNNAAEQ  136

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E I  ++L R  RTN+ + F LT+H+L ++KEG+ IINTTS+ AY+G A L+DY
Sbjct  137   HPQESLEGITREQLERTFRTNLFAMFDLTKHSLSHLKEGACIINTTSVTAYRGSAHLIDY  196

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIV+FTR LA  L +KGIRVN VAPGPIWTPLIP++F +E+ ASFG   P+ R  
Sbjct  197   SATKGAIVSFTRSLAQSLASKGIRVNAVAPGPIWTPLIPSTFEEEKVASFGAKEPLGRPG  256

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSY+FLA+S DSSY++GQVLHPNGG I+NG
Sbjct  257   QPDEVAPSYIFLASS-DSSYMTGQVLHPNGGEIING  291



>ref|WP_021169740.1| short chain dehydrogenase/reductase family oxidoreductase [Sporomusa 
ovata]
 gb|EQB26929.1| short chain dehydrogenase/reductase family oxidoreductase [Sporomusa 
ovata DSM 2662]
Length=292

 Score =   303 bits (777),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 154/276 (56%), Positives = 192/276 (70%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M PRP     +YKP  KL+ KIAL++GGDSGIGRAV   +ALEGA +   Y+   
Sbjct  24    GSELAMTPRPISVKQDYKPCGKLEKKIALISGGDSGIGRAVSLLYALEGADIGIIYLN--  81

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA  T   I+K         + +A D+G +E CK  V +V+  +G +DILVNNAAEQ
Sbjct  82    EHADANMTKSDIEKL----GHRCLLLAGDVGNEEFCKYAVTQVINEFGHLDILVNNAAEQ  137

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +  +++E I  ++L R  RTNI SYF+L++ AL ++  G  IINTTSI AY+GH  L+DY
Sbjct  138   HVQTTLENITAEQLERTFRTNIFSYFYLSKAALPHLTNGCVIINTTSITAYEGHELLMDY  197

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
              A+KGAIV FTR LA  LV KGIRVNGVAPGPIWTPLIPASF ++  A FG+D PM+RA 
Sbjct  198   AASKGAIVTFTRSLAQSLVGKGIRVNGVAPGPIWTPLIPASFNEQHVAQFGQDTPMKRAG  257

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSY+FL AS DSSY++GQ+LH NGG IVNG
Sbjct  258   QPAEVAPSYLFL-ASQDSSYVTGQILHVNGGTIVNG  292



>ref|WP_038660057.1| short-chain dehydrogenase [Pseudomonas stutzeri]
 gb|AHY42989.1| short-chain dehydrogenase [Pseudomonas stutzeri]
Length=285

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 202/276 (73%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE +M+PRP++   +YK + KL+GK+A++TGGDSGIGR+V   +A EGA VA  Y+   
Sbjct  17    GKEGLMNPRPEFRGEDYKAAGKLEGKVAIITGGDSGIGRSVAVLYAREGADVAILYL--D  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             + +DAEET  +++       +  +  A D+   E C+KV+DE + A+G++DILVNNAAEQ
Sbjct  75    QHQDAEETRTVVEHY----GRRCLTFAGDVADREVCRKVIDETLAAFGKLDILVNNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I E++  +  RTNI   F +T+ AL ++ +G+SIINTTS+ AYKG  +LLDY
Sbjct  131   HPQEKLEDISEEQWEKTFRTNIFGMFQMTKAALPHLGKGASIINTTSVTAYKGSPQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAI AFTR L++ L  +GIRVNGVAPGPIWTPLIP++F  +E A FG + PM+R  
Sbjct  191   SATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLIPSTFDADEVAEFGSNTPMKRPG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YV+LA+S D++Y+SGQV+H NGG +VNG
Sbjct  251   QPDEVAPAYVYLASS-DAAYVSGQVIHVNGGTVVNG  285



>ref|WP_010283432.1| short-chain dehydrogenase [Bacillus timonensis]
Length=288

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 201/276 (73%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P    H Y+ SNKL  K+A++TGGDSGIG+AV   FA EGA V   Y+  +
Sbjct  20    GTETEMVPKPVSEDHSYQGSNKLNNKVAIITGGDSGIGKAVAIHFAKEGANVVIVYL--E  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA+ET    K+    + +  + ++ D+G +E C++++ + +  +G++DILVNNAAEQ
Sbjct  78    EHEDAKET----KRQIEEEGQKCLLLSGDIGKEEFCEEIIKKTIDTFGQLDILVNNAAEQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+  I  ++L +  RTNI SYF+LT+ AL ++K+GSSIINT S+ AYKG+ +L+DY
Sbjct  134   HPQKSIANISSEQLEKTFRTNIFSYFYLTKAALPHLKQGSSIINTASVTAYKGNEQLIDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGA+V+FTR L++QL+ KGIRVNGVAPGPIWTPLIP++F  ++ A FG   PM+R  
Sbjct  194   SATKGAVVSFTRSLSMQLIGKGIRVNGVAPGPIWTPLIPSTFPSDQVAKFGSTTPMKRPG  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSY+FL AS D+SY+SGQ+LH NGG IVNG
Sbjct  254   QPEEVAPSYIFL-ASDDASYMSGQILHVNGGEIVNG  288



>ref|WP_040214279.1| short-chain dehydrogenase [Clostridium sp. MS1]
Length=292

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 157/277 (57%), Positives = 202/277 (73%), Gaps = 8/277 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEY-KPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKP  968
             G E+ M P P +    Y K S +LQGK+AL+TG DSGIGRAV   FA EGA +A  Y+  
Sbjct  23    GIENKMHPEPIFEDINYNKSSGRLQGKVALLTGADSGIGRAVAVAFAYEGADIAVLYL--  80

Query  967   QEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAE  788
              E  DAEET    KK      K  + I+ D+G ++ C++ VD+VV+ YG IDILVNNAAE
Sbjct  81    DEKSDAEET----KKHIEEVGKKCLLISGDIGDEDFCREAVDKVVKEYGHIDILVNNAAE  136

Query  787   QYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLD  608
             Q+E  S+ +I +++L R  +TN+   F++T+  L ++KEGSSIINTTS+ AY+G   LLD
Sbjct  137   QHEQQSIVDISKEQLERTFKTNVFGTFYITKAVLPHLKEGSSIINTTSVTAYRGSPALLD  196

Query  607   YTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRA  428
             Y++TKGAI+AFTR L+ QL +K IRVNGVAPGPIWTPLIPASF +E+ +SFGKDVP++RA
Sbjct  197   YSSTKGAILAFTRSLSGQLASKKIRVNGVAPGPIWTPLIPASFDEEKVSSFGKDVPLKRA  256

Query  427   AHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
               P+EVA +YVFL AS  +SYISGQV+H NGG IVNG
Sbjct  257   GQPVEVAQAYVFL-ASDAASYISGQVIHVNGGEIVNG  292



>gb|KGK84870.1| short-chain dehydrogenase [Pseudomonas sp. HMP271]
Length=284

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 199/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE +M PRP+Y   +YK + KL GK+A++TGGDSGIGR+V   FA EGA VA  Y+   
Sbjct  16    GKEGLMHPRPEYRGEDYKAAGKLAGKVAIITGGDSGIGRSVAVLFAREGADVAILYLD--  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             + +DAEET  ++++      +  +  A D+   + C++VVDE +   GR+DILVNNAAEQ
Sbjct  74    QHQDAEETRKVVEQ----HGRRCLTFAGDVAEKDVCRRVVDETLAQLGRLDILVNNAAEQ  129

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +     E++ + +  +  RTN+   F +T+ AL +++EG+SIINTTS+ AYKG+  L+DY
Sbjct  130   HPQERFEDVSQQQWEKTFRTNVFGMFQMTQAALPHLREGASIINTTSVTAYKGNPMLIDY  189

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIV FTR LA+ L  +GIRVNGVAPGPIWTPLIP++F  ++ A FG +VPM+R  
Sbjct  190   SSTKGAIVGFTRALAMHLAERGIRVNGVAPGPIWTPLIPSTFDADKVAEFGSNVPMKRPG  249

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YV+LA+S DSSY+SGQVLH NGG +VNG
Sbjct  250   QPEEVAPAYVYLASS-DSSYVSGQVLHVNGGTVVNG  284



>ref|WP_012628858.1| short-chain dehydrogenase [Cyanothece sp. PCC 7425]
 ref|YP_002484159.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. PCC 7425]
 gb|ACL45798.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. PCC 7425]
Length=285

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/274 (53%), Positives = 196/274 (72%), Gaps = 7/274 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P P+  +  Y+ S KL+GK+AL+TGGDSGIGRAV   +A EGA +A  Y    
Sbjct  17    GLESEMTPTPKSQASNYRGSGKLEGKVALITGGDSGIGRAVAVLYAREGADLAIVY----  72

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
               K+ +E  G  ++    + K  + +  D+G +  C++ V + V  +G +DIL+NNAAEQ
Sbjct  73    --KEEKEDAGQTQQMVEAEGKRCLTLQGDIGDESFCQQAVQQTVNEFGHLDILINNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I  ++L R  RTNI   FF+T+ AL  +KEGS+IINTTS+ AY+G ++LLDY
Sbjct  131   HPQPSIEQISAEQLERTFRTNIFGMFFMTKAALPQLKEGSAIINTTSVTAYQGSSQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIVAFTR L+  L+++GIRVNGVAPGPIWTPLIP++F +++  SFG  VPMQRA 
Sbjct  191   SATKGAIVAFTRSLSQSLLDRGIRVNGVAPGPIWTPLIPSTFPEDKVKSFGAQVPMQRAG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIV  323
              P EVAP YVFLA+S DSSY++GQ+LHPNGG +V
Sbjct  251   QPEEVAPCYVFLASS-DSSYMAGQILHPNGGEVV  283



>ref|WP_023959633.1| oxidoreductase, short chain dehydrogenase/reductase family [Paenibacillus 
sp. JCM 10914]
 dbj|GAE05886.1| oxidoreductase, short chain dehydrogenase/reductase family [Paenibacillus 
sp. JCM 10914]
Length=288

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/276 (54%), Positives = 200/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P++ S+EYK + KLQGK+AL+TGGDSGIGRAV   +A EGA V+  Y+   
Sbjct  20    GTESEMHPKPEFESNEYKAAGKLQGKVALITGGDSGIGRAVAVHYAKEGADVSIVYLS--  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DAEET    K+    +    + IA D+G D  C+  V E V   G++DILVNNAAEQ
Sbjct  78    EHQDAEET----KRQVEQEGHKCLLIAGDIGNDAFCRDAVTETVEKLGKLDILVNNAAEQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I +++L R  RTNI   F+LT+ A+ ++ +GSSIINTTSI AY+G  +LLDY
Sbjct  134   HTQKKIEDISKEQLERTFRTNIFGMFYLTQAAMPHLSKGSSIINTTSITAYRGSPELLDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L++ +V +GIRVN VAPGPIWTPLIP++F+++  A+FG   PM+R  
Sbjct  194   SSTKGAIVAFTRSLSMNVVGQGIRVNAVAPGPIWTPLIPSTFSEDHVANFGASQPMKRPG  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+AP+YV+L AS DSSY+SGQV+H NGG ++NG
Sbjct  254   QPEELAPAYVYL-ASTDSSYVSGQVIHINGGEVING  288



>ref|WP_015235209.1| dehydrogenase [Deinococcus peraridilitoris]
 ref|YP_007180667.1| dehydrogenase [Deinococcus peraridilitoris DSM 19664]
 gb|AFZ66901.1| dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase 
like protein [Deinococcus peraridilitoris DSM 19664]
Length=310

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/290 (55%), Positives = 208/290 (72%), Gaps = 7/290 (2%)
 Frame = -1

Query  1189  NNGqqfppqqqdsqPGKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCF  1010
             N+G+  PPQ QD QPG E  M PRP Y    YK + KL+GK+AL+TGGDSGIGRAV   F
Sbjct  27    NDGKTLPPQHQDRQPGLETEMTPRPIYIKDSYKAAGKLEGKVALITGGDSGIGRAVAVHF  86

Query  1009  ALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVR  830
             A EGA V   Y+   E++DAEET    K+    + +  +AIA D+G ++ C+  V+  V 
Sbjct  87    AREGADVCIMYLN--ENQDAEET----KRLVEAEGRRCLAIAGDVGDEQFCQSAVERTVS  140

Query  829   AYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINT  650
               GR+D LVNNAAEQ+   S+ +I  ++L +  RTNI  YF++ + AL +++ GS+IINT
Sbjct  141   ELGRLDCLVNNAAEQHPQESLTDISSEQLEKTFRTNIFGYFYMAKAALPHLQAGSTIINT  200

Query  649   TSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKE  470
             +S+  YKG  +LLDY++TKGAIVAFTR L++ LV KGIRVNGVAPGPIWTPLIPA+F+++
Sbjct  201   SSVTDYKGSPQLLDYSSTKGAIVAFTRSLSMNLVEKGIRVNGVAPGPIWTPLIPATFSED  260

Query  469   ECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
             + A FG  VPM+R   P EVAP +VFL AS DSSYISGQ+LHPNGG +VN
Sbjct  261   KVAEFGASVPMKRPGQPAEVAPCFVFL-ASDDSSYISGQMLHPNGGEVVN  309



>ref|WP_019988102.1| short-chain dehydrogenase [Rudanella lutea]
Length=284

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 202/276 (73%), Gaps = 6/276 (2%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P P+Y  + Y+ +NKL+ K+AL+TGGDSGIGRAV   FA EGA VA  Y  P+
Sbjct  15    GIEGQMTPEPKYIRYNYRGANKLKNKVALITGGDSGIGRAVAIHFAREGADVAIVYT-PR  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA+ T  +++     + +D + ++ DL   + C++VV++ VR YG+++ILVNNA  Q
Sbjct  74    EQQDAQHTKDLVE----AEGQDCLLLSGDLTNPDFCRQVVEDTVREYGQLNILVNNAGIQ  129

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y     E+I ++ LL+   TNI S+F +TR AL ++ EG +IINTTSI AY+G A L+DY
Sbjct  130   YPHDHFEQIRDEDLLKTYETNIYSFFRVTRAALPHLNEGDAIINTTSITAYQGRADLIDY  189

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAI+AFTR LA  L +K IRVNGVAPGPIWTPLIP+SF K++ A FGKDVPM+R  
Sbjct  190   SSTKGAIMAFTRALAGNLASKKIRVNGVAPGPIWTPLIPSSFDKQKVAMFGKDVPMKRPG  249

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YV+L AS DSSY++G+V+HPNGG I+NG
Sbjct  250   QPCEVAPAYVYL-ASDDSSYVTGEVIHPNGGTIING  284



>ref|WP_041063022.1| short-chain dehydrogenase [Cohnella sp. VKM B-2846]
 gb|KIL36020.1| short-chain dehydrogenase [Cohnella sp. VKM B-2846]
Length=298

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 199/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M PRP+  S  Y P+ KL+GK A+VTGGDSGIG++V   +A EGA VA  Y+   
Sbjct  30    GLETKMTPRPESESPAYLPAGKLKGKAAIVTGGDSGIGKSVSIAYAKEGADVAVVYL--N  87

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             ED DA+ET    KK    + +  + IA D+G  E CKKVVD+ + A+GR+DILVNNAAEQ
Sbjct  88    EDADAQET----KKQIEAEGRKCLLIAGDIGDPEFCKKVVDQTLSAFGRLDILVNNAAEQ  143

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I  ++L R  RTNI S F+LT  A+ ++K GS+I+NT S+ AY+G  +LLDY
Sbjct  144   HPKPRIEDITPEQLERTFRTNIFSMFYLTSAAMPHLKSGSAIVNTASVTAYRGSPQLLDY  203

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIV+FTR LAL ++ +GIRVN VAPGPIWTPLIP++F  +  A FG + PM+RA 
Sbjct  204   SSTKGAIVSFTRSLALNVIEQGIRVNAVAPGPIWTPLIPSTFDADTVAKFGSNSPMKRAG  263

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+AP+YV+L AS DSSY++GQVLH NGG +VNG
Sbjct  264   QPDELAPAYVYL-ASDDSSYMAGQVLHVNGGEVVNG  298



>ref|XP_002517193.1| short chain dehydrogenase, putative [Ricinus communis]
 gb|EEF45356.1| short chain dehydrogenase, putative [Ricinus communis]
Length=244

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 184/239 (77%), Gaps = 1/239 (0%)
 Frame = -1

Query  1078  LQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQEDKDAEETVGIIKKAKSGDAKD  899
             + GK +     DSGIGRAVC  FALE A+VAFTYV+  E+KD ++T+ ++   ++  A+D
Sbjct  1     MAGKDSFSDRKDSGIGRAVCYHFALESASVAFTYVEGIEEKDKDDTLQMLYSVQATGARD  60

Query  898   PIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQYEASSVEEIDEDRLLRVLRTNI  719
             PIA+  DLGFDENC++VVD+VV  YGR+DILVNNAAEQ+   S+++I   RL RV RTNI
Sbjct  61    PIAVP-DLGFDENCERVVDQVVTEYGRVDILVNNAAEQHLTKSMDDITAPRLERVFRTNI  119

Query  718   CSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDYTATKGAIVAFTRGLALQLVNKG  539
              S FF+TRH LK+MKEGSS+IN+TS+ AY G +++LDY++TKGAIVAFTRGLALQLV +G
Sbjct  120   FSQFFMTRHCLKHMKEGSSVINSTSVTAYTGGSEILDYSSTKGAIVAFTRGLALQLVGRG  179

Query  538   IRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAAHPIEVAPSYVFLAASPDSSYI  362
             IRVNGVAPGP+WTPL PAS   E     G  VPM RAA P E+APSYVFLA++  SSY 
Sbjct  180   IRVNGVAPGPVWTPLQPASMPPEMVKRLGSQVPMGRAAQPYEIAPSYVFLASNECSSYF  238



>ref|WP_013916625.1| short-chain dehydrogenase [Paenibacillus mucilaginosus]
 ref|YP_004641334.1| hypothetical protein KNP414_02906 [Paenibacillus mucilaginosus 
KNP414]
 gb|AEI41464.1| YhxC [Paenibacillus mucilaginosus KNP414]
Length=285

 Score =   302 bits (773),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 198/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M+PRP +    YKP+ KL+ K A++TGGDSGIGRAV   +A EGA V   Y+   
Sbjct  17    GIESRMNPRPVFEDDRYKPAGKLKDKTAIITGGDSGIGRAVAVTYAKEGADVLIVYLN--  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA+ET    KK    +      +A D+G +  C  +V+E +R  G++D+LVNNAAEQ
Sbjct  75    EHEDAQET----KKQVEAEGSRCELLAGDIGDEAFCISIVEETIRRLGKLDVLVNNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I  ++L R  RTNI S+F+LT+ AL +++EGS+IINT SI AY+G+  LLDY
Sbjct  131   HPQQKLEDITSEQLERTFRTNIFSFFYLTKAALPHLQEGSAIINTASITAYEGNPTLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIV FTR L+ QLV++GIRVN VAPGPIWTPLIP++F +++ ASFG + PM+RA 
Sbjct  191   SATKGAIVTFTRSLSQQLVSRGIRVNAVAPGPIWTPLIPSTFDEQKVASFGTNTPMKRAG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFLA   DSSY++GQVLH NGG IVNG
Sbjct  251   QPEELAPSYVFLACG-DSSYMTGQVLHVNGGTIVNG  285



>ref|WP_014370097.1| short-chain dehydrogenase [Paenibacillus mucilaginosus]
 ref|YP_005313151.1| hypothetical protein PM3016_3147 [Paenibacillus mucilaginosus 
3016]
 ref|YP_006189954.1| short-chain dehydrogenase [Paenibacillus mucilaginosus K02]
 gb|AFC30002.1| YhxC [Paenibacillus mucilaginosus 3016]
 gb|AFH62189.1| short-chain dehydrogenase [Paenibacillus mucilaginosus K02]
Length=285

 Score =   302 bits (773),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/276 (54%), Positives = 198/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M+PRP +    YKP+ KL+ K A++TGGDSGIGRAV   +A EGA V   Y+   
Sbjct  17    GIESRMNPRPVFEDDRYKPAGKLKDKTAIITGGDSGIGRAVAVTYAKEGADVLIVYLN--  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA+ET    K     + +    +A D+G +  C  +V+E +R  G++D+LVNNAAEQ
Sbjct  75    EHEDAQET----KMQVEAEGRRCELLAGDIGDEAFCSSIVEETIRRLGKLDVLVNNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I  ++L R  RTNI S+F+LT+ AL +++EGS+IINT SI AY+G+  LLDY
Sbjct  131   HPQQKLEDITSEQLERTFRTNIFSFFYLTKAALPHLQEGSAIINTASITAYEGNPTLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIV FTR L+ QLV++GIRVN VAPGPIWTPLIP++F +++ ASFG + PM+RA 
Sbjct  191   SATKGAIVTFTRSLSQQLVSRGIRVNAVAPGPIWTPLIPSTFDEQKVASFGTNTPMKRAG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFLA   DSSY++GQVLH NGG IVNG
Sbjct  251   QPEELAPSYVFLACG-DSSYMTGQVLHVNGGTIVNG  285



>ref|WP_018756071.1| hypothetical protein [Paenibacillus terrigena]
Length=290

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 154/276 (56%), Positives = 198/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M PRP +    YKP+ KL GK A+++GGDSGIGRAV   FA EGA VA  Y+   
Sbjct  22    GIEAEMTPRPAFEGKNYKPAGKLAGKKAIISGGDSGIGRAVAIAFAKEGADVAILYLN--  79

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E++DA+ET    K+A     +  IAI+ D+G +  CK  V +V+ A+ ++DI+VNNAAEQ
Sbjct  80    EEQDAQET----KQAVEQLGRQCIAISGDIGEEHFCKTAVKQVIDAWDQLDIVVNNAAEQ  135

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y   S+ +I   +LLR  +TNI  YF LT+ AL ++K+GSSI+NT SI AYKG  +L+DY
Sbjct  136   YPQKSLSDITTAQLLRTFKTNIFGYFHLTKMALPHLKQGSSIVNTASITAYKGSPELIDY  195

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIV+FTR LA  LV +GIRVNGVAPGPIWTPLIPASF +++ ++FG D PM R  
Sbjct  196   SATKGAIVSFTRSLAGSLVAQGIRVNGVAPGPIWTPLIPASFDEQQVSTFGSDTPMGRPG  255

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+A SYVFL AS D+SYI+GQ++H NGG IVNG
Sbjct  256   QPEELAASYVFL-ASDDASYITGQMIHVNGGDIVNG  290



>ref|WP_034386148.1| short-chain dehydrogenase [Deinococcus sp. YIM 77859]
Length=302

 Score =   302 bits (774),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 201/276 (73%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G +  M+ +P     +Y+ S KL GK+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  34    GHQSEMNQKPITIRDDYRGSGKLTGKVALITGGDSGIGRAVAVHFAREGADVAVVYLD--  91

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA+ TV +++    G+ +  +AI+ D+G  + C++ V + ++  GR+DILVNNAAEQ
Sbjct  92    EHEDAQSTVALVE----GEGRRALAISGDIGDPQFCQQAVQQTLQELGRLDILVNNAAEQ  147

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+ +I  ++L R  RTNI   F+LT+ AL ++K+G++IINTTS+ AYKG  +LLDY
Sbjct  148   HPQPSITDITPEQLERTFRTNIFGMFYLTQAALPHLKQGATIINTTSVTAYKGSPQLLDY  207

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  L  +GIRVN VAPGPIWTPLIP++F  ++  SFG+DVP++R  
Sbjct  208   SSTKGAIVAFTRSLSQSLAEQGIRVNAVAPGPIWTPLIPSTFEPQKVESFGQDVPLKRPG  267

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YVFL AS DSSY++GQVLHPNGG +VNG
Sbjct  268   QPAEVAPAYVFL-ASEDSSYMTGQVLHPNGGEVVNG  302



>ref|WP_035069901.1| short-chain dehydrogenase [Anditalea andensis]
 gb|KEO75398.1| short-chain dehydrogenase [Anditalea andensis]
Length=284

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/277 (54%), Positives = 202/277 (73%), Gaps = 12/277 (4%)
 Frame = -1

Query  1144  GKEHIMDPRPQY--SSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVK  971
             G ++ M+P+P+   SS  YK   KL GK+AL+TGGDSGIGRAV   FA +GA +   Y+ 
Sbjct  17    GDQYQMEPQPKSEPSSGTYK---KLAGKVALITGGDSGIGRAVAIAFAEQGADMVIAYL-  72

Query  970   PQEDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAA  791
              +EDKDAEET  +++K      +  + I  D+    +C+++VD+ + ++G++DI+VNNAA
Sbjct  73    -EEDKDAEETRSMVEK----HGQKAVVIKGDVSQSRHCQEIVDKAIASFGKLDIVVNNAA  127

Query  790   EQYEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLL  611
             +QY   ++E+I E++L +   TNI SYFF+T+ AL ++K+G+SIINT+S+ AY+G   LL
Sbjct  128   QQYPQDNLEDITEEQLTKTFSTNIYSYFFITKAALAHLKKGASIINTSSVTAYRGSHHLL  187

Query  610   DYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQR  431
             DY ATKGAIV+FTR L+  L  KGIRVNGVAPGPIWTPLIPA+F+KE    FG +VP+ R
Sbjct  188   DYAATKGAIVSFTRSLSANLAPKGIRVNGVAPGPIWTPLIPATFSKEHVDEFGTNVPLGR  247

Query  430   AAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVN  320
                P EVAPSYVFL AS DSSY++GQ LHPNGG I+N
Sbjct  248   PGEPAEVAPSYVFL-ASEDSSYMTGQFLHPNGGEIIN  283



>ref|WP_034323647.1| short-chain dehydrogenase [Bacillus sp. DW5-4]
 gb|KEP25586.1| short-chain dehydrogenase [Bacillus sp. DW5-4]
Length=286

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 154/276 (56%), Positives = 197/276 (71%), Gaps = 9/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E+ M+PRP +         KL GK A+VTGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  20    GLEYKMNPRPIFDREVQ--GKKLAGKTAIVTGGDSGIGRAVSVLFAKEGANVAIVYL--S  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DAEET   I+KA        I IA DLG +    +VV +   A+G IDILVNNA EQ
Sbjct  76    EHRDAEETKDYIEKA----GGHVILIAGDLGDEAFSNEVVKKTKDAFGSIDILVNNAGEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I   +LLR  +TNI + F+LT+  L ++K+GSSIINTTS+ AYKGH  L+DY
Sbjct  132   HPQKSIEQITSHQLLRTFQTNIFALFYLTKAVLPHLKKGSSIINTTSVTAYKGHETLIDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGA+V FTR L+L L+ +GIRVNGVAPGPIWTPLIP++FT++E + FG DVPM+R  
Sbjct  192   SSTKGAVVTFTRSLSLSLIKQGIRVNGVAPGPIWTPLIPSTFTEKEVSEFGGDVPMERPG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+E+APSY+FL AS DSSY++GQ+LH NGG I+NG
Sbjct  252   EPVELAPSYLFL-ASEDSSYMNGQILHVNGGTILNG  286



>ref|WP_006212031.1| MULTISPECIES: short-chain dehydrogenase [Paenibacillus]
 gb|EFU39141.1| short-chain dehydrogenase/reductase SDR [Paenibacillus vortex 
V453]
 gb|ETT32072.1| short-chain dehydrogenase/reductase SDR [Paenibacillus sp. FSL 
R5-808]
Length=288

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 200/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P++ S+EYK + KLQGK+AL+TGGDSGIGRAV   +A EGA V+  Y+   
Sbjct  20    GTESEMHPKPEFESNEYKAAGKLQGKVALITGGDSGIGRAVAVHYAKEGADVSIVYLS--  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E KDAEET    K+    + +  + I+ D+G D  C+  V E V   G++DILVNNAAEQ
Sbjct  78    EHKDAEET----KRQVEQEGRKCLLISGDVGDDAFCRDAVTETVEKLGKLDILVNNAAEQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I +++L R  RTNI   F+LT+ A+ ++ +GSSIINTTSI AY+G  +LLDY
Sbjct  134   HPQKKIEDISKEQLERTFRTNIFGMFYLTQAAMPHLSKGSSIINTTSITAYRGSPQLLDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
              +TKGAIVAFTR L++ +V +GIRVN VAPGPIWTPLIP++F +++ + FG   PM+R  
Sbjct  194   ASTKGAIVAFTRSLSMNIVEQGIRVNAVAPGPIWTPLIPSTFPEDQVSEFGATQPMKRPG  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+AP+YV+LA++ DSSY+SGQV+H NGG ++NG
Sbjct  254   QPEELAPAYVYLAST-DSSYVSGQVIHVNGGEVING  288



>ref|WP_027482598.1| short-chain dehydrogenase [Deinococcus pimensis]
Length=288

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/276 (54%), Positives = 198/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G+E  M+PRP Y   +YK + KLQGK+A++TGGDSGIGRAV   +A EGA VA  Y+   
Sbjct  20    GRESEMNPRPVYIKPDYKAAGKLQGKVAVITGGDSGIGRAVAVHYAREGADVAIVYLD--  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET  ++++A     +  + +A D+G +  C++ V   V   GR+D+LVNNAAEQ
Sbjct  78    EGDDAQETKRLVEEA----GRRCLTLAGDVGDEAFCQQAVQRTVSELGRLDVLVNNAAEQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+ +I  ++L R  RTNI  YF++ + A+ ++ EG +IINTTS+  YKG  +LLDY
Sbjct  134   HPQESITDITREQLERTFRTNIFGYFYMAKAAVNHIPEGGTIINTTSVTDYKGSPQLLDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L++ L  KGIRVNGVAPGPIWTPLIP++F  ++ A+FG DVPM+R  
Sbjct  194   SSTKGAIVAFTRSLSMSLAEKGIRVNGVAPGPIWTPLIPSTFPPDKVATFGADVPMKRPG  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVA  +VFL AS DSSY+SGQVLHPNGG +VNG
Sbjct  254   QPAEVATCFVFL-ASDDSSYMSGQVLHPNGGEVVNG  288



>ref|WP_003291252.1| short-chain dehydrogenase [Pseudomonas stutzeri]
 gb|EIK51415.1| short-chain dehydrogenase [Pseudomonas stutzeri TS44]
Length=284

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 198/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE +M PRP+Y   +YK + KL GK+A++TGGDSGIGR+V   FA EGA VA  Y+   
Sbjct  16    GKEGLMHPRPEYRGEDYKSAGKLAGKVAIITGGDSGIGRSVAVLFAREGADVAILYLD--  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             + +DAEET  ++++      +  +  A D+   + C++VVDE +   GR+DILVNNAAEQ
Sbjct  74    QHQDAEETRKVVEQ----HGRRCLTFAGDVAEKDVCRRVVDETLAQLGRLDILVNNAAEQ  129

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +     E++ + +  +  RTN+   F +T+ AL ++ EG+SIINTTS+ AYKG+  L+DY
Sbjct  130   HPQERFEDVSQQQWEKTFRTNVFGMFQMTQAALPHLPEGASIINTTSVTAYKGNPMLIDY  189

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIV FTR LA+ L  +GIRVNGVAPGPIWTPLIP++F  ++ A FG +VPM+R  
Sbjct  190   SSTKGAIVGFTRALAMHLAERGIRVNGVAPGPIWTPLIPSTFDADKVAEFGSNVPMKRPG  249

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YV+LA+S DSSY+SGQVLH NGG +VNG
Sbjct  250   QPEEVAPAYVYLASS-DSSYVSGQVLHVNGGTVVNG  284



>ref|WP_035348378.1| short-chain dehydrogenase [Bacillus ginsengihumi]
 gb|KHD85924.1| short-chain dehydrogenase [Bacillus ginsengihumi]
Length=280

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/276 (54%), Positives = 206/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E IM+P+P+  +  YK S KL GK AL+TGGDSGIG++V   FA EGA VA  Y+  +
Sbjct  12    GIETIMNPQPESVNTYYKGSGKLAGKTALITGGDSGIGKSVAIYFAKEGANVAICYL--E  69

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DAE T    KK    + ++ + ++ D+G +++C++ V++V+  +G +DILVNNAAEQ
Sbjct  70    EHEDAENT----KKQIEQEGQECLLVSGDIGDEQHCQQAVNKVIAQFGALDILVNNAAEQ  125

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+  I +++L R  +TNI S FF+ + A  ++K+GSSIINT SI AYKG+ +LLDY
Sbjct  126   HPQQSILNITKEQLERTFKTNIFSQFFMVKAAFPHLKKGSSIINTASITAYKGNPQLLDY  185

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIV+FTR LAL LV++GIRVNGVAPGPIWTPLIP++F+ E+ A+FG D PM+R  
Sbjct  186   SSTKGAIVSFTRSLALSLVSQGIRVNGVAPGPIWTPLIPSTFSPEQVATFGSDTPMKRPG  245

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+AP++VFL AS DSS+I+GQ++H NGG IVNG
Sbjct  246   QPSELAPAFVFL-ASDDSSFITGQMIHINGGEIVNG  280



>ref|WP_012009478.1| short-chain dehydrogenase [Bacillus pumilus]
 ref|YP_001486220.1| spore short-chain dehydrogenase [Bacillus pumilus SAFR-032]
 gb|ABV61660.1| spore short-chain dehydrogenase [Bacillus pumilus SAFR-032]
Length=286

 Score =   301 bits (771),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 196/276 (71%), Gaps = 9/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E+ M+PRP +      P  KL GK A+VTGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  20    GLEYKMNPRPVFDRE--MPDKKLAGKTAIVTGGDSGIGRAVSVLFAKEGANVAIVYL--S  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DAEET   I++A        I I+ DLG +    +VV +   A+G IDILVNNA EQ
Sbjct  76    EHRDAEETKDYIERA----GGQVILISGDLGDEAFSNEVVKKTKDAFGSIDILVNNAGEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I   +LLR  +TNI + F+LT+  L ++K+GSSIINT S+ AYKGH  L+DY
Sbjct  132   HPQKGIEQITSHQLLRTFQTNIFAMFYLTKAVLPHLKKGSSIINTASVTAYKGHETLIDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGA+V FTR L+L L+ +GIRVNGVAPGPIWTPLIP++FT++E + FG DVPM+R  
Sbjct  192   SSTKGAVVTFTRSLSLSLIKQGIRVNGVAPGPIWTPLIPSTFTEKEVSEFGGDVPMERPG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+E+APSY+FL AS DSSYI+GQ+LH NGG I+NG
Sbjct  252   EPVELAPSYLFL-ASEDSSYINGQMLHVNGGTILNG  286



>ref|WP_034301457.1| dehydrogenase [Bacillus sp. FJAT-14515]
Length=287

 Score =   301 bits (771),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 153/276 (55%), Positives = 195/276 (71%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E IM PRP + +  YKP+ KL  K+AL+TGGDSGIGRAV   FA EGA +A +Y+   
Sbjct  19    GIESIMTPRPIFENPNYKPAGKLMNKVALITGGDSGIGRAVAVTFAKEGADIAISYLN--  76

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA+ET   +KK      +  I I  D+G+++ C++ V + +  +GRIDILVNNA   
Sbjct  77    EHSDAKETEFYVKKY----GRRCITIPGDIGYEQPCQQAVMQTIHQFGRIDILVNNAGVL  132

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y  +S+ +ID D+      TNI S F LT+ AL YM  GSSIINTTSI+AY G    +DY
Sbjct  133   YIKNSLLDIDSDQRASTFHTNIFSQFILTKAALPYMNSGSSIINTTSISAYLGDQDSIDY  192

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +A+KGAIV+FTR L+L L ++GIRVNGV+PGPIWTPLIP+S   E+ A+FG +VPM+RA 
Sbjct  193   SASKGAIVSFTRSLSLSLASQGIRVNGVSPGPIWTPLIPSSLPPEQIATFGDNVPMKRAG  252

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YVFL AS D+SYISGQ+LH NGG IVNG
Sbjct  253   QPFEVAPAYVFL-ASEDASYISGQILHVNGGEIVNG  287



>ref|WP_003300330.1| short-chain dehydrogenase [Pseudomonas stutzeri]
 gb|EME00411.1| short-chain dehydrogenase [Pseudomonas stutzeri NF13]
Length=285

 Score =   301 bits (770),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 141/276 (51%), Positives = 202/276 (73%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE +M+PRP+Y   +YK + KL+GK+A++TGGDSGIGR+V   +A EGA V   Y+   
Sbjct  17    GKEGLMNPRPEYRGEDYKAAGKLEGKVAIITGGDSGIGRSVAVLYAREGADVTILYL--D  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             + +DAE+T  ++++      +  +  A D+   E C+KV+DE + A+G++DIL+NNAAEQ
Sbjct  75    QHQDAEQTRSVVERY----GRRCLTFAGDVADREVCRKVIDETLAAFGKLDILINNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I E++  +  RTNI   F +T+ AL ++ +G+SIINT+S+ AYKG  +LLDY
Sbjct  131   HPQEKLEDISEEQWEKTFRTNIFGMFQMTKAALPHLGKGASIINTSSVTAYKGSPQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAI AFTR L++ L  +GIRVNGVAPGPIWTPLIP++F  ++ A FG + PM+R  
Sbjct  191   SATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLIPSTFDADKVAEFGSNTPMKRPG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YV+LA+S D++Y+SGQVLH NGG +VNG
Sbjct  251   QPDEVAPAYVYLASS-DAAYVSGQVLHVNGGTVVNG  285



>ref|WP_040040170.1| short-chain dehydrogenase [Herbaspirillum sp. TSA66]
 gb|KIF81345.1| short-chain dehydrogenase [Herbaspirillum sp. TSA66]
Length=286

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 198/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P PQ     YK S KL+GK+AL+TGGDSGIGRAV   FA EGA V  +Y+  +
Sbjct  18    GSEAAMSPPPQAEGKNYKGSGKLKGKVALITGGDSGIGRAVAIAFAKEGANVVISYL--E  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA+ET  +I+     + ++ + +A D+G    CKK+VD  V ++G++DILVNNAA+Q
Sbjct  76    EHQDAQETRRLIE----AEGRECVTLAGDVGDSSFCKKMVDTTVSSFGKLDILVNNAAQQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y   S+ +I +++L +  RTNI S F+  R AL ++K G+ IINTTS+ AY+G + LLDY
Sbjct  132   YPQQSITDISDEQLEKTFRTNIFSMFYAVRAALPHLKPGARIINTTSVTAYRGSSHLLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAIVAFTR L+ QL  KGI VN VAPGP+WTPLIP++F+ E+ + FG+ VP+ R  
Sbjct  192   SATKGAIVAFTRSLSQQLAEKGIYVNAVAPGPVWTPLIPSTFSPEQVSKFGEKVPLGRPG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+AP+YV+LA   D+SY++GQVLHPNGG ++NG
Sbjct  252   QPDEIAPAYVYLACD-DASYMTGQVLHPNGGEVING  286



>ref|WP_019393868.1| hypothetical protein [Bacillus endophyticus]
Length=286

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 197/276 (71%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E+ M+P P      YKPS KL GK+A++TGGDSGIGRAV   +ALEGA V   Y+   
Sbjct  18    GIENEMNPLPVSIDPNYKPSGKLAGKVAVITGGDSGIGRAVSYHYALEGAKVVIVYLS--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +D EET   I++       D + +  D+G +  CK V+DE ++ YG+IDILVNNAAEQ
Sbjct  76    ETEDGEETKKRIEEMNG----DCLLLQGDVGDESFCKTVIDETMKKYGKIDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+ +I +++L R   TNI S+F+LT+ AL + K+GS+IINT S+ AYKGH  L+DY
Sbjct  132   HPQKSLLDITKEQLHRTFTTNIFSFFYLTKEALPHFKKGSTIINTASVTAYKGHETLIDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIV+FTR LA  LV +GIRVNGVAPGPIWTPLIP++F  ++  +FG + PM+RA 
Sbjct  192   SSTKGAIVSFTRSLAASLVGQGIRVNGVAPGPIWTPLIPSTFDSKQVETFGSNTPMERAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAPSYVFL AS  SSY++GQ+LH NGG  VNG
Sbjct  252   QPSEVAPSYVFL-ASDSSSYMTGQMLHVNGGTPVNG  286



>ref|WP_015736983.1| MULTISPECIES: short-chain dehydrogenase [Paenibacillus]
 ref|YP_003244945.1| short-chain dehydrogenase/reductase SDR [Paenibacillus sp. Y412MC10]
 gb|ACX67138.1| short-chain dehydrogenase/reductase SDR [Paenibacillus sp. Y412MC10]
 gb|ETT68626.1| short-chain dehydrogenase/reductase SDR [Paenibacillus sp. FSL 
H8-457]
Length=288

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 199/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P++ S+EYK + KL+GK+AL+TGGDSGIGRAV   +A EGA V+  Y+   
Sbjct  20    GTESEMHPKPEFESNEYKAAGKLKGKVALITGGDSGIGRAVAVYYAKEGADVSIVYLN--  77

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E KDAEET    K+    + +  + IA D+G D  C+  V E V   G++DILVNNAAEQ
Sbjct  78    EHKDAEET----KRQVEQEGRKCLLIAGDVGDDAFCRDAVTETVEKLGKLDILVNNAAEQ  133

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I +++L R  RTNI   F+LT+ A+ ++ +GSSIINTTSI AY+G  +LLDY
Sbjct  134   HPQKKIEDITKEQLERTFRTNIFGMFYLTQAAMPHLSKGSSIINTTSITAYRGSPQLLDY  193

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
              +TKGAIVAFTR L++ +V +GIRVN VAPGPIWTPLIP++F  ++ A FG   PM+R  
Sbjct  194   ASTKGAIVAFTRSLSMNVVGQGIRVNAVAPGPIWTPLIPSTFPADQVAEFGATQPMKRPG  253

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+AP+YV+LA++ DSSY+SGQV+H NGG ++NG
Sbjct  254   QPEELAPAYVYLAST-DSSYVSGQVIHVNGGEVING  288



>ref|WP_017715928.1| short-chain dehydrogenase [Oscillatoria sp. PCC 10802]
Length=286

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 200/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M P+P+    +YK S+KL+ K+AL+TGGDSGIGRAV    A EGA VA  Y+   
Sbjct  18    GLESEMTPKPKSDDAQYKGSDKLRDKVALITGGDSGIGRAVAIACAKEGAKVAIVYLN--  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DA+ET  ++ +      +  + IA D+G ++ C+  V + V  +G +DILVNNAAEQ
Sbjct  76    EHEDAQETKRLVGEYD----RSCLLIAGDVGDEKFCQLAVQQTVDTFGHLDILVNNAAEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+EEI  ++L R  RTN+ S F+LT+ AL ++K GS+IINTTS+ AY+G+ +LLDY
Sbjct  132   HPQPSIEEISAEQLERTFRTNVFSMFYLTKAALPHLKGGSAIINTTSVTAYQGNQQLLDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIVAFTR L+  LV KGIRVNGVAPGPIWTPLIP++F  ++  SFG+ VPM RA 
Sbjct  192   SSTKGAIVAFTRSLSQALVEKGIRVNGVAPGPIWTPLIPSTFPADKVESFGQQVPMGRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+AP YVFL AS DSSY+SGQ+LHPNGG +VNG
Sbjct  252   QPEEIAPCYVFL-ASDDSSYMSGQILHPNGGEVVNG  286



>ref|WP_003292953.1| short-chain dehydrogenase [Pseudomonas stutzeri]
 gb|EWC40891.1| short-chain dehydrogenase [Pseudomonas stutzeri KOS6]
Length=285

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/276 (51%), Positives = 201/276 (73%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE +M+PRP+Y   +YK + KL+GK+AL+TGGDSGIGR+V   FA EGA VA  Y+   
Sbjct  17    GKEGLMNPRPEYRGEDYKAAGKLEGKVALITGGDSGIGRSVAVLFAREGADVAILYL--D  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             + +DAE+T  ++++      +  +  A D+   E C+  ++E +  +G++DILVNNAAEQ
Sbjct  75    QHQDAEQTREVVEQY----GRRCLTFAGDVADREVCRNAIEETLSKFGKLDILVNNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +  + +E+I E++  +  RTNI   F +T+ AL ++ +G+SIINTTS+ AYKG  KLLDY
Sbjct  131   HPQNGLEDISEEQWEKTFRTNIFGMFQMTKAALPHLGKGASIINTTSVTAYKGSPKLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAI AFTR L++ L  +GIRVNGVAPGPIWTPLIP++F  +E A FG + PM+R  
Sbjct  191   SATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLIPSTFAADEVAEFGSNTPMKRPG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P +VAP+YV+LA+S D++Y+SGQV+H NGG +VNG
Sbjct  251   QPDDVAPAYVYLASS-DAAYVSGQVIHVNGGTVVNG  285



>ref|WP_040204499.1| short-chain dehydrogenase [Bacillus sp. JCA]
Length=290

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 200/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  MDPRPQ  ++ Y+P  KL GK A++TGGDSGIG++V   FA EGA +A  Y+  +
Sbjct  22    GIESEMDPRPQSVTNTYRPGGKLTGKTAIITGGDSGIGKSVALYFAKEGADIAIAYL--E  79

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DAEET    KK    + +  +  + D+G ++ CK++V + +  + R+DILVNNAAEQ
Sbjct  80    EHQDAEET----KKLIEAEGRRCLLFSGDIGNEDFCKEIVKQTIAQFSRLDILVNNAAEQ  135

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+  I   +L +  RTN+ S+F++T+ AL ++K+G+SIINT SI AY+G+ +LLDY
Sbjct  136   HPQQSLLSITAAQLEKTFRTNLFSFFYMTKMALPHLKKGASIINTASITAYEGNEQLLDY  195

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +A+KGAIV+FTR LA  L  +GIRVNGVAPGPIWTPLIP++FT ++  +FG + PM RA 
Sbjct  196   SASKGAIVSFTRSLAKSLAPQGIRVNGVAPGPIWTPLIPSTFTADQVTTFGGNTPMGRAG  255

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYVFL AS DSSY+SGQ++H NGG IVNG
Sbjct  256   QPYELAPSYVFL-ASEDSSYMSGQMIHVNGGTIVNG  290



>ref|WP_038091998.1| short-chain dehydrogenase [Tumebacillus flagellatus]
 gb|KEO81882.1| short-chain dehydrogenase [Tumebacillus flagellatus]
Length=287

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/276 (54%), Positives = 195/276 (71%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M PRP++ +  Y  S KL GK AL+TGGDSGIGRAV   +A EGA VA  Y+   
Sbjct  19    GIESEMTPRPKFENRNYNASGKLAGKAALITGGDSGIGRAVAVLYAKEGADVAIVYLN--  76

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DAEET    K+A   + +  + ++ D G +  C+  V  VV+A+G++D+LVNN AEQ
Sbjct  77    EHGDAEET----KRAVEAEGRRCVLLSGDAGDETFCQDAVASVVQAFGKLDVLVNNCAEQ  132

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+ EI   ++ R  RTNI S+F +++ AL ++K GS+I+NT S+ AY GH +L+DY
Sbjct  133   HPQKSLHEITAQQMERTFRTNIFSFFHMSKAALPHLKTGSAIVNTASVTAYHGHKELIDY  192

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGA+V FTR L+L L +KGIRVNGVAPGPIWTPLIP++FT E+ ASFG   PM+RA 
Sbjct  193   SATKGAVVTFTRSLSLTLADKGIRVNGVAPGPIWTPLIPSTFTAEQVASFGTTTPMKRAG  252

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVA +YVFL AS D+SY++GQ+LH NGG IVNG
Sbjct  253   QPEEVATAYVFL-ASDDASYVTGQILHVNGGEIVNG  287



>ref|WP_026136235.1| short-chain dehydrogenase [Paenibacillus sp. A9]
Length=287

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 198/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  M PRPQ+ + EYK + KL+GK A++TGGDSGIGRAV   FA EGA VA  Y    
Sbjct  19    GIESEMTPRPQFDAPEYKAAGKLEGKAAIITGGDSGIGRAVAIYFAKEGADVAIFY--KD  76

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DAEET  +++K    + +  IAIA D+G +   K  V++ V   G++DILVNNAAEQ
Sbjct  77    EHEDAEETKALVEK----EGRKCIAIAGDIGDESFAKSAVEKAVAELGKLDILVNNAAEQ  132

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   ++E+I  ++L R  RTNI   FF T+ A+ ++  G+SIINTTSI AY+G   LLDY
Sbjct  133   HVQQTIEDISAEQLERTFRTNIFGMFFTTKAAMPHLHAGASIINTTSITAYRGEPVLLDY  192

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAI++FTR L++ L  KGIRVNGVAPGPIWTPLIPASF +E+   FG+  PM+R  
Sbjct  193   SSTKGAILSFTRALSMNLAEKGIRVNGVAPGPIWTPLIPASFDEEKVKEFGQSQPMKRPG  252

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+AP+YV+LA+S DSSY+SGQV+H NGG I+NG
Sbjct  253   QPEELAPAYVYLASS-DSSYVSGQVIHVNGGEIING  287



>ref|WP_035410692.1| short-chain dehydrogenase [Bacillus sp. SJS]
 gb|KEZ55686.1| short-chain dehydrogenase [Bacillus sp. SJS]
Length=289

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 198/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G+E +M+P P+++   YK S KL+GK A++TGGDSGIGRAV   FA EGA V   Y+   
Sbjct  21    GQETLMNPAPKFAGDFYKGSGKLEGKTAIITGGDSGIGRAVAVFFAREGADVTIAYLN--  78

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E  DA ET  +++K    + +    IA D+G +  CK+VV E +  +G++DILVNNAAEQ
Sbjct  79    EHDDASETKRLVEK----EGRSCFIIAGDIGDEGFCKQVVRETIVKFGKLDILVNNAAEQ  134

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   + E+I  ++L R  +TNI S F LT+ +L ++KEGSSIINTTSI AY G   L+DY
Sbjct  135   HPQDNFEDITAEQLERTFKTNIFSMFHLTKASLPHLKEGSSIINTTSITAYAGSPGLIDY  194

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAI +FTR L+  L+ KGIRVNGVAPGPIWTPLIP++F +++ A FG D PMQR  
Sbjct  195   SATKGAITSFTRSLSGNLIKKGIRVNGVAPGPIWTPLIPSTFPEDKVAEFGADTPMQRPG  254

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+APSYV+L AS DS+Y++GQVLH NGG +VNG
Sbjct  255   QPEELAPSYVYL-ASADSTYVTGQVLHVNGGKVVNG  289



>ref|WP_034282185.1| MULTISPECIES: short-chain dehydrogenase [Bacillus]
 gb|KDE27219.1| spore short-chain dehydrogenase [Bacillus safensis FO-36b]
 gb|KIL22208.1| hypothetical protein B4134_1115 [Bacillus pumilus]
Length=286

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 153/276 (55%), Positives = 197/276 (71%), Gaps = 9/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E+ M+PRP +       + KL GK A+VTGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  20    GLEYKMNPRPVFDREVQ--NKKLAGKTAIVTGGDSGIGRAVSVLFAKEGANVAIVYL--S  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DAEET   I+KA        I IA DLG +    +VV +   A+G IDILVNNA EQ
Sbjct  76    EHRDAEETKDYIEKA----GGRVILIAGDLGDEAFSNEVVKKTKDAFGSIDILVNNAGEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I   +LLR  +TNI + F+LT+  L ++K+GSSIINT S+ AYKGH  L+DY
Sbjct  132   HPQKSIEQITSHQLLRTFQTNIFAMFYLTKAVLPHLKKGSSIINTASVTAYKGHETLIDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGA+V FTR L+L L+ +GIRVNGVAPGPIWTPLIP++FT++E + FG DVPM+R  
Sbjct  192   SSTKGAVVTFTRSLSLSLIKQGIRVNGVAPGPIWTPLIPSTFTEKEVSEFGGDVPMERPG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+E+APSY+FL AS DSSY++GQ+LH NGG I+NG
Sbjct  252   EPVELAPSYLFL-ASEDSSYMNGQMLHVNGGTILNG  286



>ref|WP_008567791.1| short-chain dehydrogenase [Pseudomonas sp. Chol1]
 gb|EKM95878.1| short-chain dehydrogenase [Pseudomonas sp. Chol1]
 gb|EKM96936.1| short-chain dehydrogenase [Pseudomonas sp. Chol1]
Length=284

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 197/276 (71%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE +M PRPQY   +Y+ + KL G++A++TGGDSGIGR+V   FA EGA VA  Y+   
Sbjct  16    GKEGLMHPRPQYRGEDYQAAGKLAGRVAIITGGDSGIGRSVAVLFAREGADVAILYLD--  73

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             + +DAEET  ++++      +  +  A D+   + C++VVDE +   GR+DILVNNAAEQ
Sbjct  74    QHQDAEETRKVVEQ----HGRRCLTFAGDVAEKDVCRRVVDETLAQLGRLDILVNNAAEQ  129

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +     E++ + +  +  RTN+   F +T+ AL ++ EG+SIINTTS+ AYKG+  L+DY
Sbjct  130   HPQERFEDVSQQQWEKTFRTNVFGMFQMTQAALPHLPEGASIINTTSVTAYKGNPMLIDY  189

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGAIV FTR LA+ L  +GIRVNGVAPGPIWTPLIP++F  ++ A FG +VPM+R  
Sbjct  190   SSTKGAIVGFTRALAMHLAERGIRVNGVAPGPIWTPLIPSTFDADKVAEFGSNVPMKRPG  249

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YV+L AS DSSY+SGQVLH NGG +VNG
Sbjct  250   QPEEVAPAYVYL-ASRDSSYVSGQVLHVNGGTVVNG  284



>ref|WP_015276966.1| dehydrogenase [Pseudomonas stutzeri]
 ref|YP_007240312.1| dehydrogenase [Pseudomonas stutzeri RCH2]
 gb|AGA86682.1| dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase 
like protein [Pseudomonas stutzeri RCH2]
Length=285

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/276 (52%), Positives = 200/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE +M+PRP+Y   +YK + KL+GK A++TGGDSGIGR+V   FA EGA VA  Y+   
Sbjct  17    GKEGLMNPRPEYRGEDYKAAGKLEGKTAIITGGDSGIGRSVAVLFAREGADVAILYL--D  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             + +DAEET  ++++      +  +  A D+   + C+KV+DE + A+G++DILVNNAAEQ
Sbjct  75    QHQDAEETRTVVEQY----GRRCLTFAGDVADRDVCRKVIDETLAAFGKLDILVNNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I E++  +  RTNI   F +T+  L ++ +G+SIINTTS+ AYKG  +LLDY
Sbjct  131   HPQEKLEDISEEQWEKTFRTNIFGMFQMTKAVLPHLGKGASIINTTSVTAYKGSPQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAI AFTR L++ L  +GIRVNGVAPGPIWTPLI ++F  +E A FG + PM+R  
Sbjct  191   SATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLISSTFDADEVAEFGSNTPMKRPG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YV+LA+S D++Y+SGQV+H NGG +VNG
Sbjct  251   QPDEVAPAYVYLASS-DAAYVSGQVIHVNGGTVVNG  285



>ref|WP_026899363.1| short-chain dehydrogenase [Pedobacter oryzae]
Length=286

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 195/276 (71%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE  M+P+P+Y S  YK + KLQGKIAL++GGDSGIGRAVC  FA EGA +A  Y+   
Sbjct  18    GKESEMNPKPEYISKHYKAAGKLQGKIALISGGDSGIGRAVCVHFAKEGADIAILYL--D  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             EDKDA+ET  +++K    + +  + +  D+   + CKK + + V   G ++IL+NNAA+Q
Sbjct  76    EDKDAKETQKLVEK----EGRKCLLLKGDISNSDFCKKAIKQTVNDLGGLNILINNAAKQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             Y  + +++IDE +L    +TNI  YF+L++ AL Y KEG  IINT+S+ AY+G   L+DY
Sbjct  132   YPQNDIQDIDEKQLDLTFKTNIYPYFYLSQEALNYFKEGDVIINTSSVTAYRGSEHLIDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAI+ FTR LA  L  K IRVN VAPGP+WTPLI +SF  E   +FGKD PM RA 
Sbjct  192   SATKGAIITFTRSLAKNLAAKKIRVNAVAPGPVWTPLIVSSFDSEHIKNFGKDTPMGRAG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P E+AP+YV+LA  PDSSY++GQV+H NGG IVNG
Sbjct  252   QPSEIAPAYVYLAC-PDSSYVTGQVIHINGGEIVNG  286



>ref|WP_003285036.1| short-chain dehydrogenase [Pseudomonas stutzeri]
 gb|EHY79276.1| short-chain dehydrogenase [Pseudomonas stutzeri ATCC 14405 = 
CCUG 16156]
Length=285

 Score =   299 bits (766),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/276 (52%), Positives = 200/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             GKE +M+PRP+Y   +Y  + KL+GK A++TGGDSGIGR+V   +A EGA VA  Y+   
Sbjct  17    GKEGLMNPRPEYRGEDYNAAGKLEGKTAIITGGDSGIGRSVAVLYAREGADVAILYL--D  74

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             + +DAEET  ++++      +  +  A D+     C+KV+DE + A+G++DILVNNAAEQ
Sbjct  75    QHQDAEETRTVVEQY----GRRCLTFAGDVADRGVCRKVIDETLAAFGKLDILVNNAAEQ  130

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +    +E+I E++  +  RTNI   F +T+ AL ++ +G+SIINTTS+ AYKG  +LLDY
Sbjct  131   HPQEKLEDISEEQWEKTFRTNIFGMFQMTKAALPHLGKGASIINTTSVTAYKGSPQLLDY  190

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             +ATKGAI AFTR L++ L  +GIRVNGVAPGPIWTPLIP++F  +E A FG + PM+R  
Sbjct  191   SATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLIPSTFDADEVAEFGSNTPMKRPG  250

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P EVAP+YV+LA+S D++Y+SGQV+H NGG +VNG
Sbjct  251   QPDEVAPAYVYLASS-DAAYVSGQVIHVNGGTVVNG  285



>ref|WP_015192834.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Stanieria cyanosphaera]
 ref|YP_007132129.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Stanieria cyanosphaera 
PCC 7437]
 gb|AFZ35163.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Stanieria cyanosphaera 
PCC 7437]
Length=288

 Score =   299 bits (766),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/278 (54%), Positives = 199/278 (72%), Gaps = 9/278 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E  + P+PQY   +Y+ S KL+ K+AL+TGGDSGIGR+V   +A EGA VA  Y+   
Sbjct  18    GLESEIKPQPQYDRDDYQGSGKLRDKVALITGGDSGIGRSVAVLYAKEGADVAIVYL--D  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DAE+T  +++       +  + I  D+  ++ C++ V++ V+  G++DILVNNAAEQ
Sbjct  76    EHEDAEKTKSLVE----AQGRKCLLIPGDISGEKFCREAVEQTVKELGKLDILVNNAAEQ  131

Query  784   Y--EASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLL  611
             Y  +A ++E+ID +RL  +  TNI S F+ T+ A+ ++KEGSSIINTTSINAYKG+A LL
Sbjct  132   YLEDAETLEDIDSERLGSIFSTNIFSMFYFTKAAIPHLKEGSSIINTTSINAYKGNAALL  191

Query  610   DYTATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQR  431
              Y+ TKGAI+AFTR L+  L+ KGIRVNGVAPGPIWTP IP +F  E+   FGK VPMQR
Sbjct  192   SYSTTKGAILAFTRSLSQSLLKKGIRVNGVAPGPIWTPFIPDAFDAEKVEGFGKQVPMQR  251

Query  430   AAHPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
                P+EVA S+VFL AS DSSY +GQVLHPNGG +V G
Sbjct  252   PGQPVEVATSFVFL-ASDDSSYFAGQVLHPNGGVVVGG  288



>ref|WP_024425480.1| MULTISPECIES: short-chain dehydrogenase [Bacillus]
 gb|KEP31466.1| short-chain dehydrogenase [Bacillus safensis]
 gb|AIZ59653.1| short-chain dehydrogenase [Bacillus sp. WP8]
 gb|KIL10390.1| hypothetical protein B4107_0943 [Bacillus pumilus]
Length=286

 Score =   299 bits (766),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 153/276 (55%), Positives = 196/276 (71%), Gaps = 9/276 (3%)
 Frame = -1

Query  1144  GKEHIMDPRPQYSSHEYKPSNKLQGKIALVTGGDSGIGRAVCQCFALEGATVAFTYVKPQ  965
             G E+ M+PRP +         KL GK A+VTGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  20    GLEYKMNPRPVFDREVQ--DKKLAGKTAIVTGGDSGIGRAVSVLFAKEGANVAIVYL--S  75

Query  964   EDKDAEETVGIIKKAKSGDAKDPIAIAADLGFDENCKKVVDEVVRAYGRIDILVNNAAEQ  785
             E +DAEET   I+KA        I IA DLG +    +VV +   A+G IDILVNNA EQ
Sbjct  76    EHRDAEETKDYIEKA----GGRVILIAGDLGDEAFSNEVVKKTKDAFGSIDILVNNAGEQ  131

Query  784   YEASSVEEIDEDRLLRVLRTNICSYFFLTRHALKYMKEGSSIINTTSINAYKGHAKLLDY  605
             +   S+E+I   +LLR  +TNI + F+LT+  L ++K+GSSIINT S+ AYKGH  L+DY
Sbjct  132   HPQKSIEQITSHQLLRTFQTNIFAMFYLTKAVLPHLKKGSSIINTASVTAYKGHETLIDY  191

Query  604   TATKGAIVAFTRGLALQLVNKGIRVNGVAPGPIWTPLIPASFTKEECASFGKDVPMQRAA  425
             ++TKGA+V FTR L+L L+ +GIRVNGVAPGPIWTPLIP++FT++E + FG DVPM+R  
Sbjct  192   SSTKGAVVTFTRSLSLSLIKQGIRVNGVAPGPIWTPLIPSTFTEKEVSEFGGDVPMERPG  251

Query  424   HPIEVAPSYVFLAASPDSSYISGQVLHPNGGAIVNG  317
              P+E+APSY+FL AS DSSY++GQ+LH NGG I+NG
Sbjct  252   EPVELAPSYLFL-ASEDSSYMNGQMLHVNGGTILNG  286



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4165359221472