BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14474_g1_i1 len=1121 path=[2627:0-1120]

Length=1121
                                                                      Score     E

ref|XP_007161907.1|  hypothetical protein PHAVU_001G107600g           90.9    3e-17   
ref|XP_010677865.1|  PREDICTED: myb-related protein 306 isoform X2    89.7    4e-17   
ref|XP_010677864.1|  PREDICTED: myb-related protein 306 isoform X1    89.7    5e-17   
ref|XP_008240570.1|  PREDICTED: myb-related protein 306               89.7    6e-17   
ref|XP_007029927.1|  Myb domain protein 60                            90.5    6e-17   
ref|XP_010938925.1|  PREDICTED: myb-related protein 306-like          86.3    9e-16   
ref|XP_010105221.1|  Myb-related protein 306                          86.7    1e-15   
ref|XP_006339334.1|  PREDICTED: myb-related protein 306-like          85.1    2e-15   
ref|NP_001268022.1|  R2R3 MYB60 transcription factor                  85.5    2e-15   
ref|XP_004249768.1|  PREDICTED: myb-related protein 306-like          84.3    3e-15   
ref|XP_009772442.1|  PREDICTED: myb-related protein 306-like isof...  84.0    4e-15   
ref|XP_004493248.1|  PREDICTED: myb-related protein 306-like          84.7    5e-15   
ref|XP_011047044.1|  PREDICTED: myb-related protein 306               84.3    5e-15   
gb|KDP39628.1|  hypothetical protein JCGZ_02648                       83.2    1e-14   
ref|XP_007203968.1|  hypothetical protein PRUPE_ppa023776mg           83.2    1e-14   
ref|XP_002319734.1|  hypothetical protein POPTR_0013s06390g           82.8    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_009628670.1|  PREDICTED: myb-related protein 306               82.4    2e-14   
gb|KHF98844.1|  Myb-related protein                                   82.4    2e-14   
ref|XP_009110873.1|  PREDICTED: myb-related protein 306-like          81.6    3e-14   
ref|XP_008775987.1|  PREDICTED: myb-related protein 306-like          82.0    3e-14   
gb|AGN52169.1|  MYB-related transcription factor                      82.0    3e-14   
gb|ABK96779.1|  unknown                                               80.9    4e-14   Populus trichocarpa x Populus deltoides
ref|XP_006829805.1|  hypothetical protein AMTR_s00119p00069270        80.1    4e-14   
gb|AGN52059.1|  MYB-related transcription factor                      81.6    4e-14   
dbj|BAJ61429.1|  R2R3-MYB transcription factor                        80.5    5e-14   
ref|XP_006437263.1|  hypothetical protein CICLE_v10031946mg           81.3    1e-13   
ref|XP_009353049.1|  PREDICTED: myb-related protein 306-like          80.5    1e-13   
gb|KDO46625.1|  hypothetical protein CISIN_1g018559mg                 80.9    1e-13   
ref|XP_006371226.1|  hypothetical protein POPTR_0019s06290g           79.3    3e-13   
ref|XP_008386907.1|  PREDICTED: myb-related protein 306               79.0    4e-13   
gb|EPS73580.1|  hypothetical protein M569_01180                       77.8    6e-13   
ref|XP_010922900.1|  PREDICTED: myb-related protein 306               78.2    8e-13   
emb|CCI55454.1|  PH01B001E05.10                                       77.8    1e-12   
ref|NP_973795.1|  putative transcription factor MYB60                 75.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|EPS61331.1|  hypothetical protein M569_13466                       77.0    1e-12   
emb|CDP12647.1|  unnamed protein product                              76.6    1e-12   
ref|XP_010246153.1|  PREDICTED: myb-related protein 306               77.0    2e-12   
ref|XP_008391728.1|  PREDICTED: myb-related protein 306-like          77.0    2e-12   
emb|CBI31183.3|  unnamed protein product                              75.5    4e-12   
ref|XP_003554062.1|  PREDICTED: myb-related protein 306               76.3    5e-12   
ref|XP_009148134.1|  PREDICTED: myb-related protein 306               75.1    6e-12   
gb|KHN34624.1|  Myb-related protein 306                               75.9    7e-12   
ref|XP_009391637.1|  PREDICTED: myb-related protein 306-like          75.1    7e-12   
ref|XP_010258354.1|  PREDICTED: myb-related protein 306               75.5    7e-12   
ref|XP_009348270.1|  PREDICTED: myb-related protein 306-like          75.5    7e-12   
ref|XP_002530950.1|  r2r3-myb transcription factor, putative          75.9    8e-12   Ricinus communis
gb|ABG76203.1|  putative transcription factor                         74.7    8e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172358.1|  putative transcription factor MYB60                 74.3    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAF99772.1|AC003981_22  F22O13.30                                  74.3    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006484863.1|  PREDICTED: myb-related protein 306-like          74.3    2e-11   
gb|AAC83617.1|  putative transcription factor                         73.6    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004979484.1|  PREDICTED: myb-related protein 306-like          73.2    2e-11   
ref|XP_011069952.1|  PREDICTED: myb-related protein 306               73.9    2e-11   
ref|XP_010943691.1|  PREDICTED: myb-related protein 306-like          73.6    3e-11   
ref|XP_002450969.1|  hypothetical protein SORBIDRAFT_05g021820        73.2    3e-11   Sorghum bicolor [broomcorn]
ref|NP_001267555.1|  myb-related protein 306-like                     73.2    3e-11   
ref|XP_004158001.1|  PREDICTED: LOW QUALITY PROTEIN: myb-related ...  72.8    4e-11   
ref|XP_009629125.1|  PREDICTED: myb-related protein 306-like          73.2    4e-11   
ref|XP_003520923.1|  PREDICTED: myb-related protein 306-like          73.6    4e-11   
ref|XP_004144357.1|  PREDICTED: myb-related protein 306-like          72.4    7e-11   
ref|XP_002892473.1|  hypothetical protein ARALYDRAFT_888116           71.6    8e-11   
ref|XP_008792495.1|  PREDICTED: myb-related protein 306               72.4    1e-10   
ref|XP_011079260.1|  PREDICTED: myb-related protein 306-like          72.0    1e-10   
ref|XP_002866494.1|  hypothetical protein ARALYDRAFT_496423           72.4    1e-10   
ref|NP_851248.1|  Myb transcription factor                            72.4    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201053.2|  Myb transcription factor                            72.4    1e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAS10115.1|  MYB transcription factor                              72.4    1e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KHG14344.1|  Myb-related protein                                   71.2    1e-10   
ref|XP_010458949.1|  PREDICTED: myb-related protein 306-like          72.0    1e-10   
ref|XP_003599668.1|  R2R3-MYB transcription factor                    71.6    1e-10   
ref|XP_010483959.1|  PREDICTED: myb-related protein 306-like          72.0    1e-10   
gb|AES69919.2|  R2R3-myb transcription factor                         71.6    1e-10   
ref|XP_009417866.1|  PREDICTED: myb-related protein 306-like          71.6    1e-10   
ref|XP_009151368.1|  PREDICTED: myb-related protein 306               72.0    1e-10   
emb|CDY69264.1|  BnaCnng62710D                                        71.6    2e-10   
dbj|BAJ87308.1|  predicted protein                                    71.2    2e-10   
ref|NP_001170619.1|  putative MYB DNA-binding domain superfamily ...  70.9    2e-10   Zea mays [maize]
gb|AAZ83352.1|  myb transcription factor MYB30                        71.2    2e-10   Gossypium hirsutum [American cotton]
emb|CDX87250.1|  BnaC09g05650D                                        71.2    2e-10   
ref|XP_010475698.1|  PREDICTED: myb-related protein 306-like          70.5    2e-10   
emb|CBI15225.3|  unnamed protein product                              70.1    2e-10   
ref|XP_007138187.1|  hypothetical protein PHAVU_009G187700g           70.9    2e-10   
ref|XP_009112022.1|  PREDICTED: myb-related protein 306-like          70.9    3e-10   
ref|XP_006394392.1|  hypothetical protein EUTSA_v10004487mg           71.2    3e-10   
ref|XP_009410470.1|  PREDICTED: myb-related protein 306-like isof...  70.1    3e-10   
ref|XP_009410469.1|  PREDICTED: myb-related protein 306-like isof...  70.1    3e-10   
ref|XP_004299363.1|  PREDICTED: myb-related protein 306-like          70.9    3e-10   
ref|XP_008790474.1|  PREDICTED: myb-related protein 306-like isof...  69.7    3e-10   
gb|EYU20889.1|  hypothetical protein MIMGU_mgv1a011578mg              69.7    4e-10   
ref|XP_010458145.1|  PREDICTED: myb-related protein 306-like          69.3    5e-10   
gb|AGN96216.1|  transcription factor MYBJ2                            70.1    5e-10   
ref|XP_010444096.1|  PREDICTED: myb-related protein 306-like          70.1    6e-10   
gb|KFK27973.1|  hypothetical protein AALP_AA8G455500                  70.1    6e-10   
ref|XP_008790473.1|  PREDICTED: myb-related protein 306-like isof...  69.7    6e-10   
ref|XP_010547821.1|  PREDICTED: myb-related protein 306-like          70.1    6e-10   
gb|ABH02921.1|  MYB transcription factor MYB74                        67.0    7e-10   Glycine max [soybeans]
ref|XP_004499445.1|  PREDICTED: myb-related protein 306-like          69.7    7e-10   
emb|CDY32135.1|  BnaCnng06440D                                        68.6    7e-10   
ref|XP_009772443.1|  PREDICTED: myb-related protein 306-like isof...  66.2    7e-10   
gb|AFW55877.1|  putative MYB DNA-binding domain superfamily protein   68.9    8e-10   
ref|XP_006364601.1|  PREDICTED: myb-related protein 306-like          69.7    8e-10   
emb|CAA09728.1|  MYB96 protein                                        69.3    9e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KHN32523.1|  Myb-related protein 306                               69.3    9e-10   
ref|XP_006662698.1|  PREDICTED: myb-related protein 306-like          68.9    1e-09   
ref|XP_009130218.1|  PREDICTED: myb-related protein 306-like          69.3    1e-09   
ref|XP_009594207.1|  PREDICTED: myb-related protein 306               69.3    1e-09   
ref|XP_006280703.1|  hypothetical protein CARUB_v10026666mg           69.3    1e-09   
sp|P81392.1|MYB06_ANTMA  RecName: Full=Myb-related protein 306        68.9    1e-09   Antirrhinum majus [garden snapdragon]
gb|EMT05173.1|  Myb-related protein 306                               66.2    1e-09   
ref|XP_004236011.1|  PREDICTED: myb-related protein 306               68.9    1e-09   
ref|XP_006431144.1|  hypothetical protein CICLE_v10012152mg           68.9    1e-09   
ref|NP_001242312.1|  myb-related protein 306-like                     68.2    2e-09   
gb|ABH02908.1|  MYB transcription factor MYB60                        66.2    2e-09   Glycine max [soybeans]
ref|XP_009399931.1|  PREDICTED: myb-related protein 306-like          68.2    2e-09   
ref|XP_006305493.1|  hypothetical protein CARUB_v10009957mg           67.8    2e-09   
gb|AIZ97490.1|  R2R3-MYB transcription factor subgroup 7              67.8    2e-09   
ref|XP_010489412.1|  PREDICTED: myb-related protein 306-like          67.4    2e-09   
ref|XP_010931466.1|  PREDICTED: myb-related protein 306-like isof...  67.8    2e-09   
ref|XP_009765566.1|  PREDICTED: myb-related protein 306-like          67.8    3e-09   
ref|XP_006417645.1|  hypothetical protein EUTSA_v10008426mg           67.4    3e-09   
ref|NP_001063167.1|  Os09g0414300                                     67.8    3e-09   Oryza sativa Japonica Group [Japonica rice]
gb|KHN30839.1|  Myb-related protein 306                               67.8    3e-09   
ref|XP_003527079.1|  PREDICTED: myb-related protein 306-like          67.8    3e-09   
gb|KHN13621.1|  Myb-related protein 306                               67.4    3e-09   
ref|XP_008239949.1|  PREDICTED: myb-related protein 306-like          68.2    3e-09   
ref|XP_009785597.1|  PREDICTED: myb-related protein 306-like          67.8    3e-09   
gb|AAL84627.1|AF474137_1  typical P-type R2R3 Myb protein             65.9    3e-09   Oryza sativa [red rice]
ref|XP_007209276.1|  hypothetical protein PRUPE_ppa007562mg           67.8    3e-09   
ref|XP_003534453.1|  PREDICTED: myb-related protein 306               67.4    4e-09   
ref|XP_009395129.1|  PREDICTED: myb-related protein 306-like          67.0    4e-09   
gb|KHN11601.1|  Myb-related protein 306                               67.4    4e-09   
ref|XP_004157466.1|  PREDICTED: myb-related protein 306-like          65.9    4e-09   
ref|XP_010931465.1|  PREDICTED: myb-related protein 306-like isof...  67.4    4e-09   
ref|XP_010532312.1|  PREDICTED: myb-related protein 306-like          67.0    4e-09   
ref|XP_003577454.1|  PREDICTED: myb-related protein 306-like          66.6    4e-09   
gb|ACW84412.1|  transcription factor MYB392                           67.4    4e-09   
ref|NP_001240154.1|  MYB transcription factor MYB60                   67.4    4e-09   
ref|XP_007214856.1|  hypothetical protein PRUPE_ppa008366mg           67.4    4e-09   
ref|XP_008230764.1|  PREDICTED: myb-related protein 306               67.4    5e-09   
gb|AEV91154.1|  R2R3-MYB protein                                      67.0    5e-09   
ref|XP_008365400.1|  PREDICTED: myb-related protein 306-like          67.4    5e-09   
ref|NP_001280966.1|  myb-related protein 306                          67.0    5e-09   
ref|XP_011008114.1|  PREDICTED: myb-related protein 306-like          67.0    5e-09   
ref|XP_002323853.1|  myb family transcription factor family protein   67.0    5e-09   Populus trichocarpa [western balsam poplar]
ref|XP_011071639.1|  PREDICTED: myb-related protein 306-like          67.0    6e-09   
ref|XP_008455771.1|  PREDICTED: myb-related protein 306               67.0    6e-09   
ref|XP_008341573.1|  PREDICTED: myb-related protein 306-like          67.0    6e-09   
gb|EEE69698.1|  hypothetical protein OsJ_29353                        66.6    6e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004148709.1|  PREDICTED: myb-related protein 306-like          66.2    6e-09   
ref|XP_002460209.1|  hypothetical protein SORBIDRAFT_02g024640        66.6    6e-09   Sorghum bicolor [broomcorn]
ref|XP_007139579.1|  hypothetical protein PHAVU_008G041500g           66.6    7e-09   
ref|XP_009341011.1|  PREDICTED: myb-related protein 306-like          66.6    7e-09   
ref|XP_003621186.1|  MYB family transcription factor-like protein     65.9    7e-09   
gb|EYU24375.1|  hypothetical protein MIMGU_mgv1a009382mg              66.6    7e-09   
gb|EMT12411.1|  Myb-related protein 306                               66.6    7e-09   
gb|AEL12216.1|  putative MYB domain protein 94                        65.9    7e-09   
gb|ABD32205.1|  Homeodomain-related                                   66.6    8e-09   Medicago truncatula
ref|XP_008459311.1|  PREDICTED: myb-related protein 306-like          66.2    8e-09   
ref|XP_006660623.1|  PREDICTED: myb-related protein 306-like          63.9    8e-09   
ref|XP_004137409.1|  PREDICTED: myb-related protein 306-like          66.2    9e-09   
ref|XP_010546059.1|  PREDICTED: myb-related protein 306-like          66.6    9e-09   
gb|AGN52053.1|  MYB-related transcription factor                      65.9    9e-09   
ref|XP_003624757.1|  MYB transcription factor                         66.6    9e-09   
gb|KFK43192.1|  hypothetical protein AALP_AA1G091800                  65.9    9e-09   
ref|XP_007151227.1|  hypothetical protein PHAVU_004G028500g           66.2    9e-09   
ref|XP_008442096.1|  PREDICTED: myb-related protein 306-like          66.2    9e-09   
ref|XP_002441752.1|  hypothetical protein SORBIDRAFT_08g001800        66.2    1e-08   Sorghum bicolor [broomcorn]
ref|XP_010939500.1|  PREDICTED: myb-related protein 306               65.9    1e-08   
ref|XP_004232220.1|  PREDICTED: myb-related protein 306-like          65.5    1e-08   
ref|XP_011098622.1|  PREDICTED: myb-related protein 306-like          65.9    1e-08   
gb|KHG13336.1|  Myb-related protein                                   65.9    1e-08   
ref|XP_010693237.1|  PREDICTED: myb-related protein 306-like          65.9    1e-08   
gb|EEC84571.1|  hypothetical protein OsI_31358                        65.9    1e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_004956812.1|  PREDICTED: myb-related protein 306-like          65.9    1e-08   
ref|XP_008670193.1|  PREDICTED: myb-related protein 306               65.9    1e-08   
ref|XP_004304297.1|  PREDICTED: myb-related protein 306-like          66.2    1e-08   
ref|XP_010036271.1|  PREDICTED: myb-related protein 306               65.9    1e-08   
ref|XP_009376268.1|  PREDICTED: myb-related protein 306               65.9    1e-08   
ref|XP_006660161.1|  PREDICTED: myb-related protein 306-like          63.9    1e-08   
gb|AGN52085.1|  MYB-related transcription factor                      65.5    2e-08   
gb|KGN54653.1|  hypothetical protein Csa_4G416980                     64.7    2e-08   
gb|KGN64000.1|  hypothetical protein Csa_1G033200                     65.1    2e-08   
ref|XP_009385639.1|  PREDICTED: myb-related protein 306-like          64.7    2e-08   
ref|XP_003577718.1|  PREDICTED: myb-related protein 306-like          64.7    2e-08   
ref|XP_009618496.1|  PREDICTED: myb-related protein 306-like          65.1    2e-08   
ref|NP_001267946.1|  R2R3 Myb30 transcription factor                  65.1    2e-08   
ref|XP_010937134.1|  PREDICTED: myb-related protein 306-like          65.1    2e-08   
emb|CDY30719.1|  BnaA02g33410D                                        64.3    2e-08   
emb|CDY00289.1|  BnaA06g21900D                                        64.3    2e-08   
ref|NP_001068096.1|  Os11g0558200                                     65.1    2e-08   Oryza sativa Japonica Group [Japonica rice]
emb|CDY16773.1|  BnaA09g06090D                                        64.7    2e-08   
gb|EAZ07112.1|  hypothetical protein OsI_29359                        64.7    3e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_001175597.1|  Os08g0437200                                     64.7    3e-08   
ref|XP_009410391.1|  PREDICTED: myb-related protein 306-like          64.7    3e-08   
gb|KHG11637.1|  Myb-related protein                                   64.3    3e-08   
ref|XP_009410003.1|  PREDICTED: myb-related protein 306-like          64.7    3e-08   
gb|ABH02904.1|  MYB transcription factor MYB53                        62.4    3e-08   Glycine max [soybeans]
ref|XP_009390302.1|  PREDICTED: myb-related protein 306-like          64.3    3e-08   
ref|XP_009419868.1|  PREDICTED: myb-related protein 306-like          64.3    4e-08   
emb|CDP12307.1|  unnamed protein product                              64.3    4e-08   
ref|XP_006662979.1|  PREDICTED: myb-related protein 306-like          64.3    4e-08   
ref|XP_003549675.2|  PREDICTED: myb-related protein 306-like isof...  64.3    4e-08   
ref|XP_008652703.1|  PREDICTED: myb-related protein 306-like          63.9    4e-08   
ref|XP_009419866.1|  PREDICTED: myb-related protein 306-like          63.9    5e-08   
dbj|BAJ61426.1|  R2R3-MYB transcription factor                        63.5    5e-08   
emb|CDX85848.1|  BnaC06g22860D                                        63.9    5e-08   
ref|XP_010426206.1|  PREDICTED: myb-related protein 306-like          63.9    5e-08   
ref|XP_006404360.1|  hypothetical protein EUTSA_v10010525mg           63.9    5e-08   
ref|XP_002877569.1|  hypothetical protein ARALYDRAFT_905992           63.9    5e-08   
ref|XP_006291477.1|  hypothetical protein CARUB_v10017612mg           63.9    5e-08   
ref|XP_010503364.1|  PREDICTED: myb-related protein 306-like          63.9    5e-08   
ref|XP_003576343.1|  PREDICTED: myb-related protein 306-like          63.2    6e-08   
gb|ACU20420.1|  unknown                                               62.4    6e-08   Glycine max [soybeans]
ref|NP_190344.1|  putative transcription factor MYB94                 63.9    6e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAC83640.1|  putative transcription factor                         63.9    6e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34064.1|  hypothetical protein AALP_AA5G097400                  63.9    6e-08   
ref|XP_010528337.1|  PREDICTED: myb-related protein 306               63.5    6e-08   
gb|KFK33762.1|  hypothetical protein AALP_AA5G057000                  63.5    7e-08   
ref|XP_003574549.1|  PREDICTED: myb-related protein 306-like          63.2    8e-08   
ref|NP_001234294.1|  transcription factor                             63.5    9e-08   
ref|XP_010315878.1|  PREDICTED: transcription factor isoform X1       63.5    9e-08   
ref|XP_003524812.1|  PREDICTED: myb-related protein 306-like          63.2    9e-08   
ref|XP_007155313.1|  hypothetical protein PHAVU_003G190400g           62.8    1e-07   
ref|XP_002514763.1|  r2r3-myb transcription factor, putative          63.2    1e-07   Ricinus communis
ref|NP_189533.1|  myb domain protein 30                               62.8    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|KEH15858.1|  R2R3-myb transcription factor                         62.8    1e-07   
ref|XP_002875478.1|  hypothetical protein ARALYDRAFT_484660           62.8    1e-07   
gb|AAM64792.1|  MYB family transcription factor (hsr1), putative      62.8    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502890.1|  PREDICTED: myb-related protein 306-like          62.8    1e-07   
ref|XP_003609059.1|  MYB transcription factor                         62.8    1e-07   
ref|XP_010514606.1|  PREDICTED: myb-related protein 306-like          62.8    1e-07   
gb|AAC83595.1|  putative transcription factor                         62.8    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AFK37503.1|  unknown                                               62.8    1e-07   
ref|XP_010425680.1|  PREDICTED: myb-related protein 306-like          62.8    1e-07   
ref|XP_006291492.1|  hypothetical protein CARUB_v10017640mg           62.8    1e-07   
gb|EYU35835.1|  hypothetical protein MIMGU_mgv1a012184mg              62.0    1e-07   
ref|XP_006390404.1|  hypothetical protein EUTSA_v10019477mg           62.8    2e-07   
ref|XP_003543783.1|  PREDICTED: myb-related protein 306               62.8    2e-07   
ref|XP_002306049.2|  hypothetical protein POPTR_0004s12530g           62.8    2e-07   Populus trichocarpa [western balsam poplar]
gb|KHN13225.1|  Myb-related protein 306                               62.4    2e-07   
gb|AFH03056.1|  R2R3-MYB transcription factor MYB4                    62.8    2e-07   
ref|XP_010550057.1|  PREDICTED: myb-related protein 306-like          61.6    2e-07   
emb|CBI22219.3|  unnamed protein product                              62.0    2e-07   
ref|XP_009405155.1|  PREDICTED: myb-related protein 306-like          61.6    2e-07   
gb|AHN60123.1|  MYB transcription factor 30                           62.4    2e-07   
emb|CDY04044.1|  BnaC02g37590D                                        62.0    2e-07   
ref|XP_011015034.1|  PREDICTED: myb-related protein 306-like          62.0    2e-07   
emb|CDX86405.1|  BnaA06g31220D                                        62.0    2e-07   
ref|XP_006395328.1|  hypothetical protein EUTSA_v10004538mg           62.0    3e-07   
emb|CDX86406.1|  BnaA06g31230D                                        62.0    3e-07   
emb|CDY00107.1|  BnaC09g01940D                                        62.0    3e-07   
ref|XP_009151834.1|  PREDICTED: myb-related protein 306               62.0    3e-07   
emb|CDX85227.1|  BnaC07g25380D                                        62.0    3e-07   
ref|XP_004138300.1|  PREDICTED: myb-related protein 306-like          62.0    3e-07   
gb|KGN63666.1|  hypothetical protein Csa_1G009700                     62.0    3e-07   
ref|XP_009129351.1|  PREDICTED: myb-related protein 306-like          61.6    3e-07   
ref|XP_008453202.1|  PREDICTED: myb-related protein 306-like          62.0    3e-07   
emb|CDY44428.1|  BnaA02g29490D                                        61.6    3e-07   
ref|XP_010552909.1|  PREDICTED: myb-related protein 306-like isof...  61.6    3e-07   
ref|XP_010552901.1|  PREDICTED: myb-related protein 306-like isof...  61.6    3e-07   
emb|CDX73103.1|  BnaC06g35510D                                        61.6    3e-07   
ref|XP_009106128.1|  PREDICTED: myb-related protein 306-like          61.6    3e-07   
ref|XP_009618824.1|  PREDICTED: myb-related protein 306-like          61.6    3e-07   
dbj|BAJ61428.1|  R2R3-MYB transcription factor                        61.2    3e-07   
ref|XP_009111612.1|  PREDICTED: myb-related protein 306-like          61.6    3e-07   
ref|XP_008664657.1|  PREDICTED: myb-related protein 306-like          61.2    3e-07   
ref|XP_002463232.1|  hypothetical protein SORBIDRAFT_02g040160        61.6    3e-07   Sorghum bicolor [broomcorn]
ref|XP_004973531.1|  PREDICTED: myb-related protein 306-like          61.2    3e-07   
ref|NP_001065636.1|  Os11g0128500                                     61.2    4e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009793068.1|  PREDICTED: myb-related protein 306-like isof...  61.6    4e-07   
ref|XP_009381357.1|  PREDICTED: myb-related protein 306-like          61.2    4e-07   
ref|NP_001066042.1|  Os12g0125000                                     61.2    4e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008443185.1|  PREDICTED: myb-related protein 306-like          60.8    4e-07   
ref|XP_011013219.1|  PREDICTED: myb-related protein 306-like          61.2    4e-07   
ref|XP_011087249.1|  PREDICTED: myb-related protein 306-like          61.2    5e-07   
dbj|BAJ61427.1|  R2R3-MYB transcription factor                        60.5    5e-07   
emb|CDX68173.1|  BnaA07g22130D                                        60.8    5e-07   
ref|NP_001060354.1|  Os07g0629000                                     58.5    5e-07   Oryza sativa Japonica Group [Japonica rice]
ref|NP_177603.1|  myb domain protein 31                               60.8    6e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104754.1|  PREDICTED: myb-related protein 306-like          60.8    6e-07   
emb|CAA62034.1|  cY13                                                 60.8    6e-07   
ref|XP_006424474.1|  hypothetical protein CICLE_v10028804mg           60.8    6e-07   
ref|XP_010471555.1|  PREDICTED: myb-related protein 306-like          60.5    7e-07   
ref|XP_010550604.1|  PREDICTED: myb-related protein 306               60.5    7e-07   
ref|NP_001132068.2|  putative MYB DNA-binding domain superfamily ...  60.1    7e-07   
ref|XP_010416321.1|  PREDICTED: myb-related protein 306-like          60.5    8e-07   
ref|XP_009383605.1|  PREDICTED: myb-related protein 306-like          59.7    8e-07   
ref|XP_010416322.1|  PREDICTED: myb-related protein 306-like          60.5    8e-07   
ref|XP_010105629.1|  Myb-related protein 306                          60.5    9e-07   
ref|XP_006302520.1|  hypothetical protein CARUB_v10020618mg           60.1    1e-06   
ref|XP_009412676.1|  PREDICTED: myb-related protein 306-like          59.3    1e-06   
ref|XP_006658859.1|  PREDICTED: myb-related protein 306-like          58.5    1e-06   
gb|EEE67641.1|  hypothetical protein OsJ_25225                        58.9    2e-06   
ref|XP_009128055.1|  PREDICTED: myb-related protein 306-like          59.7    2e-06   
ref|XP_008443380.1|  PREDICTED: transcription factor MYB76-like i...  57.8    2e-06   
gb|ABS32247.1|  putative MYB transcription factor                     59.3    2e-06   
ref|XP_004958408.1|  PREDICTED: myb-related protein 306-like          59.3    2e-06   
ref|XP_004136689.1|  PREDICTED: transcription factor MYB76-like       58.2    2e-06   
ref|NP_001147454.1|  LOC100281063                                     59.3    2e-06   
ref|XP_003561588.1|  PREDICTED: myb-related protein 306-like          58.5    2e-06   
gb|AAP92746.1|  putative myb protein                                  59.3    2e-06   
gb|ACF87616.1|  unknown                                               59.3    2e-06   
ref|XP_008662384.1|  PREDICTED: myb-related protein Myb4              58.9    2e-06   
gb|AFW55879.1|  putative MYB DNA-binding domain superfamily protein   58.9    2e-06   
dbj|BAJ88519.1|  predicted protein                                    58.9    3e-06   
ref|XP_009403169.1|  PREDICTED: myb-related protein 306-like isof...  58.2    3e-06   
gb|EPS62440.1|  hypothetical protein M569_12349                       56.2    3e-06   
tpg|DAA41541.1|  TPA: putative MYB DNA-binding domain superfamily...  58.5    3e-06   
ref|XP_006651436.1|  PREDICTED: myb-related protein 306-like          57.0    3e-06   
ref|NP_001150967.1|  MYB94                                            58.5    3e-06   
ref|XP_009403168.1|  PREDICTED: myb-related protein 306-like isof...  57.8    4e-06   
gb|AAL84626.1|AF474136_1  typical P-type R2R3 Myb protein             56.6    4e-06   
ref|XP_003559924.2|  PREDICTED: myb-related protein 306-like          57.8    6e-06   
gb|EAZ27116.1|  hypothetical protein OsJ_11048                        57.4    6e-06   
gb|AAL58235.1|AC084762_9  putative transcription factor               57.4    6e-06   
ref|XP_008443415.1|  PREDICTED: myb-related protein 306-like          57.4    6e-06   
ref|XP_004163532.1|  PREDICTED: LOW QUALITY PROTEIN: myb-related ...  57.4    7e-06   
ref|XP_004147470.1|  PREDICTED: myb-related protein 306-like          57.4    7e-06   
gb|EAY90234.1|  hypothetical protein OsI_11803                        57.4    7e-06   
ref|XP_006490473.1|  PREDICTED: transcription factor LAF1-like        57.0    7e-06   
ref|XP_006421905.1|  hypothetical protein CICLE_v10006897mg           57.0    8e-06   
gb|KDO60019.1|  hypothetical protein CISIN_1g045400mg                 57.0    8e-06   
ref|XP_008662386.1|  PREDICTED: myb-related protein 308-like          57.0    9e-06   
gb|AAM08125.1|  myb protein                                           54.3    9e-06   
dbj|BAE54312.1|  transcription factor DcMYB1                          56.2    9e-06   
gb|AEV91147.1|  R2R3-MYB protein                                      57.0    1e-05   
gb|AIB05013.1|  MYB transcription factor                              57.0    1e-05   
ref|XP_008443379.1|  PREDICTED: transcription factor MYB76-like i...  55.8    1e-05   
gb|AFW55881.1|  putative MYB DNA-binding domain superfamily protein   57.0    1e-05   
ref|XP_008443378.1|  PREDICTED: transcription factor MYB76-like i...  55.8    1e-05   
ref|XP_008443377.1|  PREDICTED: transcription factor MYB76-like i...  55.8    1e-05   
ref|XP_009339144.1|  PREDICTED: myb-related protein Hv1-like          56.6    1e-05   
gb|AGD80146.1|  mixta-like 3 protein                                  55.5    1e-05   
emb|CBI22245.3|  unnamed protein product                              56.2    1e-05   
gb|AGD80147.1|  mixta-like 3 protein                                  55.5    1e-05   
gb|EMS64649.1|  Transcription factor MYB39                            53.9    2e-05   
gb|AHI18165.1|  Mixta-like1                                           53.5    2e-05   
gb|AGT16957.1|  hypothetical protein SHCRBa_121_P14_F_10              56.2    2e-05   
ref|XP_007139534.1|  hypothetical protein PHAVU_008G038000g           56.2    2e-05   
gb|AHI18166.1|  Mixta-like1                                           53.1    2e-05   
ref|XP_001768810.1|  predicted protein                                53.5    2e-05   
gb|AIT52298.1|  MYB family protein                                    56.2    2e-05   
gb|ACN69972.1|  MYB transcription factor ML2                          55.8    2e-05   
ref|XP_004240193.1|  PREDICTED: myb-related protein Myb4-like         54.7    2e-05   
gb|AGE09536.1|  GUIDELESS                                             55.8    2e-05   
ref|XP_009356321.1|  PREDICTED: uncharacterized protein LOC103947194  55.8    3e-05   
gb|EMT13132.1|  Transcription factor MYB39                            53.5    3e-05   
gb|ACT78694.1|  mixta-like2 MYB transcription factor                  55.8    3e-05   
gb|ACT78693.1|  mixta-like2 MYB transcription factor                  55.8    3e-05   
dbj|BAJ61438.1|  R2R3-MYB transcription factor                        54.7    3e-05   
ref|XP_009381410.1|  PREDICTED: myb-related protein Hv1               55.8    3e-05   
gb|AFW72001.1|  putative MYB DNA-binding domain superfamily prote...  55.1    3e-05   
ref|XP_004952890.1|  PREDICTED: transcription factor MYB28-like       55.5    3e-05   
ref|XP_008221584.1|  PREDICTED: myb-related protein 306-like          55.8    3e-05   
gb|AHI18167.1|  Mixta-like1                                           52.8    3e-05   
ref|XP_009607191.1|  PREDICTED: myb-related protein 308-like          55.5    3e-05   
gb|EPS71765.1|  protein 1                                             54.3    3e-05   
ref|XP_008350919.1|  PREDICTED: transcription factor MYB28-like       55.8    3e-05   
gb|AGN52095.1|  MYB-related transcription factor                      55.5    3e-05   
gb|AGD80151.1|  mixta-like 2.2 protein                                55.1    3e-05   
ref|XP_003572652.1|  PREDICTED: myb-related protein Zm38-like         55.1    3e-05   
gb|AHI18170.1|  Mixta-like2                                           55.5    4e-05   
gb|ABD60285.2|  R2R3-MYB transcription factor MYB12                   52.8    4e-05   
gb|ADV29942.1|  MYB transcription factor MIXTA-like 5 protein         55.1    4e-05   
ref|XP_006446589.1|  hypothetical protein CICLE_v10018311mg           53.9    4e-05   
gb|AGD80158.1|  mixta-like 2 protein                                  55.1    4e-05   
gb|ADV29945.1|  MYB transcription factor MIXTA-like 5 protein         55.1    4e-05   
ref|XP_004973509.1|  PREDICTED: transcription factor MYB32-like       55.5    4e-05   
ref|XP_006648783.1|  PREDICTED: transcription factor MYB28-like       55.1    4e-05   
gb|EYU22401.1|  hypothetical protein MIMGU_mgv1a023545mg              55.5    4e-05   
gb|ADV29944.1|  MYB transcription factor MIXTA-like 5 protein         55.1    4e-05   
gb|ADV29943.1|  MYB transcription factor MIXTA-like 5 protein         55.1    4e-05   
ref|XP_002304517.1|  hypothetical protein POPTR_0003s13190g           55.1    4e-05   
ref|XP_006385776.1|  hypothetical protein POPTR_0003s13190g           55.1    4e-05   
ref|XP_002446620.1|  hypothetical protein SORBIDRAFT_06g019020        55.1    4e-05   
dbj|BAM71807.1|  R2R3-MYB transcription factor                        55.1    4e-05   
ref|XP_004491832.1|  PREDICTED: transcription factor MYB39-like i...  55.1    4e-05   
ref|XP_004491833.1|  PREDICTED: transcription factor MYB39-like i...  55.1    4e-05   
ref|XP_010258093.1|  PREDICTED: transcription factor MYB34-like       55.5    4e-05   
gb|AIS35933.1|  MYB transcription factor 16                           55.1    4e-05   
dbj|BAD29569.1|  MYB27 protein-like                                   53.1    4e-05   
gb|AHI18178.1|  Mixta-like3                                           53.9    4e-05   
gb|KHN01977.1|  Transcription factor MYB39                            55.5    4e-05   
ref|XP_006659430.1|  PREDICTED: transcription factor MYB28-like       55.1    4e-05   
gb|ADV29954.1|  MYB transcription factor MIXTA-like 8 protein         55.1    4e-05   
gb|AGD80157.1|  mixta-like 2 protein                                  55.1    4e-05   
ref|XP_003520088.1|  PREDICTED: transcription factor MYB28-like       55.5    4e-05   
ref|NP_001061874.1|  Os08g0433400                                     55.1    4e-05   
gb|AHI18174.1|  Mixta-like2                                           55.1    4e-05   
ref|XP_006653483.1|  PREDICTED: transcription factor MYB39-like       54.3    4e-05   
gb|AGD80153.1|  mixta-like 2 protein                                  55.1    4e-05   
gb|AGD80156.1|  mixta-like 2 protein                                  55.1    4e-05   
ref|XP_008669319.1|  PREDICTED: uncharacterized protein LOC103646361  55.1    4e-05   
gb|AHI18177.1|  Mixta-like3                                           53.9    5e-05   
gb|AHI18172.1|  Mixta-like2                                           55.1    5e-05   
ref|XP_006602925.1|  PREDICTED: transcription factor MYB28-like       55.1    5e-05   
gb|AGD80152.1|  mixta-like 2 protein                                  55.1    5e-05   
gb|AGD80154.1|  mixta-like 2 protein                                  55.1    5e-05   
gb|AGD80155.1|  mixta-like 2 protein                                  55.1    5e-05   
ref|XP_004975862.1|  PREDICTED: myb-related protein Myb4-like         55.1    5e-05   
gb|AAV70655.1|  MYB transcription factor MIXTA-like 2                 55.1    5e-05   
gb|AGD80159.1|  mixta-like 2 protein                                  54.7    5e-05   
ref|XP_004489411.1|  PREDICTED: transcription factor MYB28-like       55.1    5e-05   
gb|AHI18169.1|  Mixta-like2                                           54.7    5e-05   
gb|EYU28787.1|  hypothetical protein MIMGU_mgv1a023201mg              53.5    5e-05   
gb|KHG14813.1|  Transcription factor MYB39 -like protein              55.1    5e-05   
ref|XP_007151240.1|  hypothetical protein PHAVU_004G029800g           55.1    5e-05   
ref|XP_008783569.1|  PREDICTED: transcription factor MYB39-like       55.1    5e-05   
gb|AGN52091.1|  MYB-related transcription factor                      54.7    5e-05   
gb|AHI18171.1|  Mixta-like2                                           54.7    5e-05   
ref|XP_008802568.1|  PREDICTED: myb-related protein 306-like          55.1    5e-05   
gb|AGO03566.1|  MIXTA-like 2                                          55.1    5e-05   
ref|XP_008366447.1|  PREDICTED: myb-related protein 315-like          54.7    5e-05   
ref|NP_001052993.1|  Os04g0461000                                     54.7    5e-05   
ref|XP_007210715.1|  hypothetical protein PRUPE_ppa023143mg           54.7    5e-05   
ref|XP_011085743.1|  PREDICTED: myb-related protein 306-like          55.1    5e-05   
gb|AAK19616.1|AF336283_1  GHMYB25                                     54.7    5e-05   
gb|AHI18173.1|  Mixta-like2                                           54.7    5e-05   
gb|AHI18168.1|  Mixta-like2                                           54.7    5e-05   
ref|XP_004234040.1|  PREDICTED: myb-related protein Myb4              54.3    5e-05   
emb|CAH67454.1|  H0219H12.11                                          54.7    5e-05   
ref|XP_007217733.1|  hypothetical protein PRUPE_ppa006769mg           55.1    5e-05   
ref|XP_010939829.1|  PREDICTED: snRNA-activating protein complex ...  55.1    5e-05   
ref|XP_010088130.1|  Transcription factor                             55.1    5e-05   
ref|XP_008459338.1|  PREDICTED: myb-related protein 306-like          55.1    5e-05   
ref|XP_010032514.1|  PREDICTED: myb-related protein 306               55.1    5e-05   
ref|XP_007032600.1|  Myb domain protein 106                           55.1    5e-05   
gb|KDP27171.1|  hypothetical protein JCGZ_19870                       54.7    5e-05   
ref|XP_004304285.1|  PREDICTED: transcription factor MYB39-like       54.7    5e-05   
ref|XP_010258286.1|  PREDICTED: transcription factor MYB34-like       55.1    5e-05   
gb|ADV29952.1|  MYB transcription factor MIXTA-like 8 protein         54.7    5e-05   
ref|XP_011098652.1|  PREDICTED: myb-related protein 306-like          54.7    5e-05   
ref|XP_010424105.1|  PREDICTED: myb-related protein Hv1-like          54.7    6e-05   
gb|KGN52476.1|  hypothetical protein Csa_5G637660                     55.1    6e-05   
ref|XP_010257368.1|  PREDICTED: myb-related protein 306-like          54.7    6e-05   
gb|AGD80139.1|  mixta                                                 54.3    6e-05   
ref|XP_001751220.1|  predicted protein                                54.7    6e-05   
ref|XP_003543812.1|  PREDICTED: protein ODORANT1-like                 55.1    6e-05   
ref|XP_009402014.1|  PREDICTED: myb-related protein Myb4-like         54.7    6e-05   
gb|AEV91158.1|  R2R3-MYB protein                                      54.7    6e-05   
gb|ADD64500.1|  MYBML1                                                54.7    6e-05   
gb|AAO49410.1|AF485892_1  MYB1                                        54.7    6e-05   
ref|XP_009360604.1|  PREDICTED: myb-related protein 330-like          54.7    6e-05   
gb|KHN13211.1|  Transcription factor MYB39                            55.1    6e-05   
gb|AEO27486.1|  MIXTA-like transcription factor                       54.7    6e-05   
gb|ACJ07153.1|  R2R3 MYB transcription factor                         54.7    6e-05   
emb|CDP02253.1|  unnamed protein product                              54.7    6e-05   
ref|XP_009410047.1|  PREDICTED: transcription factor MYB34-like       54.7    6e-05   
ref|XP_004141447.1|  PREDICTED: myb-related protein 306-like          54.7    6e-05   
ref|XP_001782291.1|  predicted protein                                52.4    6e-05   
ref|XP_008230795.1|  PREDICTED: myb-related protein 330               54.7    6e-05   
gb|AGD80140.1|  mixta                                                 54.3    6e-05   
ref|XP_002283843.1|  PREDICTED: myb-related protein 306-like          54.7    6e-05   
ref|XP_009376291.1|  PREDICTED: transcription factor MYB34            54.7    6e-05   
gb|AFX97765.1|  R2R3-MYB transcription factor                         54.7    6e-05   
ref|XP_007046022.1|  Myb domain protein 106, putative                 54.7    6e-05   
ref|XP_008239919.1|  PREDICTED: myb-related protein Hv1-like          54.7    6e-05   
emb|CDX85555.1|  BnaA02g02580D                                        54.7    6e-05   
gb|AHN60122.1|  MYB transcription factor 16                           54.3    6e-05   
dbj|BAJ91587.1|  predicted protein                                    54.7    6e-05   
gb|AHI18175.1|  Mixta-like3                                           54.7    6e-05   
gb|AGD80143.1|  mixta                                                 54.3    6e-05   
emb|CAN77989.1|  hypothetical protein VITISV_028880                   54.7    6e-05   
ref|XP_010453666.1|  PREDICTED: myb-related protein Hv1-like          54.7    6e-05   
emb|CBI31930.3|  unnamed protein product                              54.7    6e-05   
ref|XP_002311317.2|  hypothetical protein POPTR_0008s08870g           54.7    6e-05   
emb|CDX90998.1|  BnaC02g05990D                                        54.7    6e-05   
ref|XP_009405030.1|  PREDICTED: myb-related protein Myb4-like         54.7    6e-05   
ref|XP_002323871.1|  hypothetical protein POPTR_0017s12230g           54.7    6e-05   
ref|XP_008379378.1|  PREDICTED: transcription factor MYB34            54.7    6e-05   
ref|XP_011017649.1|  PREDICTED: transcription factor MYB76-like       54.7    6e-05   
ref|XP_006431202.1|  hypothetical protein CICLE_v10011948mg           54.7    6e-05   
gb|AFW72000.1|  putative MYB DNA-binding domain superfamily protein   54.3    6e-05   
emb|CDX78625.1|  BnaA03g05370D                                        54.3    6e-05   
gb|KDO72620.1|  hypothetical protein CISIN_1g016708mg                 54.7    6e-05   
ref|XP_008341595.1|  PREDICTED: transcription factor MYB34-like       54.7    6e-05   
ref|XP_010937203.1|  PREDICTED: myb-related protein Pp2-like          54.7    6e-05   
gb|AGD80162.1|  mixta-like 1 protein                                  54.3    6e-05   
ref|XP_010108699.1|  Transcription factor                             54.7    6e-05   
ref|XP_009126044.1|  PREDICTED: transcription factor MYB34-like       54.3    6e-05   
ref|XP_006438735.1|  hypothetical protein CICLE_v10033327mg           54.7    6e-05   
ref|XP_002268469.2|  PREDICTED: myb-related protein 306-like          54.7    6e-05   
ref|XP_002311313.2|  hypothetical protein POPTR_0008s08920g           54.7    6e-05   
ref|XP_011017669.1|  PREDICTED: transcription factor MYB34-like       54.7    6e-05   
ref|XP_006482628.1|  PREDICTED: transcription factor MYB28-like       54.7    7e-05   
ref|XP_011035792.1|  PREDICTED: protein ODORANT1                      54.7    7e-05   
ref|XP_006827320.1|  hypothetical protein AMTR_s00010p00267100        54.7    7e-05   
ref|XP_008374938.1|  PREDICTED: myb-related protein Myb4-like         54.3    7e-05   
gb|AHI18160.1|  Mixta-like1                                           54.7    7e-05   
ref|XP_009131458.1|  PREDICTED: myb-related protein Hv1-like          54.3    7e-05   
ref|XP_010492363.1|  PREDICTED: myb-related protein Hv1-like isof...  54.3    7e-05   
ref|XP_009624863.1|  PREDICTED: myb-related protein 306               54.7    7e-05   
ref|XP_006483693.1|  PREDICTED: transcription factor MYB29-like       54.7    7e-05   
ref|XP_010492364.1|  PREDICTED: myb-related protein Hv1-like isof...  54.3    7e-05   
emb|CAA55725.1|  mixta                                                54.3    7e-05   
gb|AGD80161.1|  mixta-like 1 protein                                  54.3    7e-05   
gb|AHI18161.1|  Mixta-like1                                           54.3    7e-05   
ref|XP_004498932.1|  PREDICTED: transcription factor RAX2-like        54.3    7e-05   
ref|XP_006400051.1|  hypothetical protein EUTSA_v10014101mg           54.3    7e-05   
emb|CDP20238.1|  unnamed protein product                              54.7    7e-05   



>ref|XP_007161907.1| hypothetical protein PHAVU_001G107600g [Phaseolus vulgaris]
 gb|ESW33901.1| hypothetical protein PHAVU_001G107600g [Phaseolus vulgaris]
Length=333

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 87/230 (38%), Positives = 114/230 (50%), Gaps = 38/230 (17%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS---PGSENNAQMGSENSPTSATSYHHHH  172
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK Q+   P S +++ M  +  P S        
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQAALDPHSASDSTMSGQYLPKSFND-RRSL  148

Query  173  HLVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGRe  352
             + S +      +++ S SS YASS ENISRLLEGWMR+S  +          S      
Sbjct  149  DMSSNSEHVSSGRLSQSQSSTYASSTENISRLLEGWMRSSPKALKRSQDEELQSIDDDNN  208

Query  353  eeeeeDDQNRPEAAAGGGLAGSN---------DDNNGV--IPKEEYLDSILTFGSLMN--  493
                 ++ N+    A   L   N         D+  GV  I   E  DSIL+F +L N  
Sbjct  209  NNNNFENTNKLLKCA--SLPALNLHHHRKRNKDEQEGVVDIVSHEEFDSILSFENLNNAA  266

Query  494  ----------------GMESGNN---KQNVQEGNDNDNPPPLSFLEKWLL  586
                              ES +    ++ +++ ++N+  PPLSFLEKWLL
Sbjct  267  WDKSTCDSMPDKSPEAAAESSHEVFCEERIRQKSENNTAPPLSFLEKWLL  316



>ref|XP_010677865.1| PREDICTED: myb-related protein 306 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=292

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 109/216 (50%), Gaps = 54/216 (25%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKLK+ QS       Q+      T++TS   H+   
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKRFQSAFQTQEPQLPG----TTSTSSSPHYKFG  145

Query  182  SKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReeee  361
            + ++   +PQ+   +S+ YASS ENISRLLE WM+ S        ++    H        
Sbjct  146  NDDNVATQPQL---TSTCYASSTENISRLLESWMKCSP-------ISNPKHHDNDDNNNN  195

Query  362  eeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMES------------  505
                      +  GG  G  DD         + +++++F +L +  ES            
Sbjct  196  --------NTSYHGGCVGEQDD---------HFETLMSFDNLNDHKESMVTTTCDSVEED  238

Query  506  ----GNNKQN-----VQEGNDNDNPPPLSFLEKWLL  586
                G NK N     ++E  D++N PPL+FLEKWLL
Sbjct  239  IINEGGNKVNENIDSMEE--DDENNPPLTFLEKWLL  272



>ref|XP_010677864.1| PREDICTED: myb-related protein 306 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=293

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 109/216 (50%), Gaps = 54/216 (25%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKLK+ QS       Q+      T++TS   H+   
Sbjct  91   AAIASYLPQRTDNDIKNYWNTHLKKKLKRFQSAFQTQEPQLPG----TTSTSSSPHYKFG  146

Query  182  SKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReeee  361
            + ++   +PQ+   +S+ YASS ENISRLLE WM+ S        ++    H        
Sbjct  147  NDDNVATQPQL---TSTCYASSTENISRLLESWMKCSP-------ISNPKHHDNDDNNNN  196

Query  362  eeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMES------------  505
                      +  GG  G  DD         + +++++F +L +  ES            
Sbjct  197  --------NTSYHGGCVGEQDD---------HFETLMSFDNLNDHKESMVTTTCDSVEED  239

Query  506  ----GNNKQN-----VQEGNDNDNPPPLSFLEKWLL  586
                G NK N     ++E  D++N PPL+FLEKWLL
Sbjct  240  IINEGGNKVNENIDSMEE--DDENNPPLTFLEKWLL  273



>ref|XP_008240570.1| PREDICTED: myb-related protein 306 [Prunus mume]
Length=320

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 108/236 (46%), Gaps = 67/236 (28%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK QS     +  M S+    S TS  H  ++V
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQSAL---DPHMASD----STTSTSHQLNIV  142

Query  182  SKNSFTD-----------RPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTA  328
            S+ S ++              +  + SS YASS  NISRLLEGWMR+S         T  
Sbjct  143  SRRSLSEGSLDNMASHASSVTLKNNQSSTYASSTANISRLLEGWMRSSP--------TQK  194

Query  329  TSHGGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESG  508
            T       +    DD    E  AG            ++ + E L+SIL++ +L N     
Sbjct  195  TLSNTNHLKLNASDDLQDQETPAGN-----------LVSRHEELESILSYENLNNVASWD  243

Query  509  NNKQNVQEGNDNDNP------------------------------PPLSFLEKWLL  586
             +  +  + ++  NP                              PPLSFLEKWLL
Sbjct  244  RSTCDSTQSDNKLNPRCDSIHDDDLVPDRDQKNKQIIRCESSTSAPPLSFLEKWLL  299



>ref|XP_007029927.1| Myb domain protein 60 [Theobroma cacao]
 gb|EOY10429.1| Myb domain protein 60 [Theobroma cacao]
Length=378

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 118/243 (49%), Gaps = 58/243 (24%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK QS    N AQ       ++ATS    H  V
Sbjct  126  AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQSALEPNMAQ------DSTATS----HQFV  175

Query  182  SKN--------------SFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGL  319
            SK+              S T R    +SSSS YASS ENISRLLEGWMR+S  ++SS   
Sbjct  176  SKSLNERRSLDFGTPAASTTLRLNQTSSSSSTYASSTENISRLLEGWMRSSPKTNSSNST  235

Query  320  TTAT---SHGGGReeeeeeDDQNRPEAAA----GGGLAGSNDDNNGVIPKEEYLDSILTF  478
            T      SH       +  D      AAA     GG     +   G +   E  +SIL+F
Sbjct  236  TLLKEKWSHHQNNNSFDNNDSIGSTSAAAPTSLQGGYRRKAEQEGGELISHEEFESILSF  295

Query  479  GSLMN---------------GMESGNNKQNV------------QEGNDNDNPPPLSFLEK  577
             ++ N                 +SGN+   V            +    N+N PPLSFLEK
Sbjct  296  ENMNNVAWDKSTCDSTSKGTCQDSGNDDDKVNNVTMTPETRKQKADQSNNNNPPLSFLEK  355

Query  578  WLL  586
            WLL
Sbjct  356  WLL  358



>ref|XP_010938925.1| PREDICTED: myb-related protein 306-like [Elaeis guineensis]
Length=295

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 95/207 (46%), Gaps = 36/207 (17%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKK+KK Q+           +N   S  S   HH ++
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKIKKYQT---------AIDNYMISTDSGSTHHDII  140

Query  182  SKNSFTDR------------PQIatsssslyassaenisRLLEGWMRAsssssssKGLTT  325
            SK    D             P     S S YASS ENISRLLEGWMR+S   +  K    
Sbjct  141  SKGYQKDAIRNPDLAGSHSPPSRFHQSPSTYASSTENISRLLEGWMRSSPKFTQDKN---  197

Query  326  ATSHGGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMES  505
                    +     D+++       G  A    +N   +   E   SI+  G  +     
Sbjct  198  --------QRSNIIDNEDNESLGDQGSYAAVTKENLDSLISLENFSSIVLQGPEL-AQAD  248

Query  506  GNNKQNVQEGNDNDNPPPLSFLEKWLL  586
               K  V EG      PPL FLEKWLL
Sbjct  249  AETKHGVAEGQQQ---PPLFFLEKWLL  272



>ref|XP_010105221.1| Myb-related protein 306 [Morus notabilis]
 gb|EXC04086.1| Myb-related protein 306 [Morus notabilis]
Length=348

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 89/243 (37%), Positives = 113/243 (47%), Gaps = 54/243 (22%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS---------PGSENNAQMGSENSPTSAT  154
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK QS         P      Q+ S  S  S T
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQSVFDPHNNNIPSDSTTGQLVSNRS--SGT  147

Query  155  SYHHHHHLV--------SKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssss  310
            ++     L         S N  + +   ++S  S YASS ENISRLLEGWMR+S   + S
Sbjct  148  TFSDRRSLADYVTSHGSSDNHLSLQNSSSSSPPSTYASSTENISRLLEGWMRSSPKPNKS  207

Query  311  KGLTTATSH----------GGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYL  460
               T+ + H          G G             EAA GG L  S+D+   ++  +   
Sbjct  208  ISTTSISDHNITIKVFENDGNGTLPSGGGSGMKVEEAAEGGDLV-SHDEFESIMSFDPNT  266

Query  461  DSILT---------------------FGSLMNGMESGNNKQNVQEGNDNDNPPPLSFLEK  577
            +++++                        +   ME  + KQ  + G  N   PPLSFLEK
Sbjct  267  NNVVSSCDRSTCESTSYKVSAVDNEDMIKVHVVMEKNSIKQRSESGASN---PPLSFLEK  323

Query  578  WLL  586
            WLL
Sbjct  324  WLL  326



>ref|XP_006339334.1| PREDICTED: myb-related protein 306-like [Solanum tuberosum]
Length=272

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 117/223 (52%), Gaps = 41/223 (18%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSP-GSENNAQMGSENSPTSATSYHHHHHL  178
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK Q+   S NN  +   N   S+T+ + HH  
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQTELDSHNNLPLPPPNFDNSSTNNYDHHQF  149

Query  179  VSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReee  358
                S       ++SSSSLYASS ENISRLLEGWMR+S + S    +     H     E 
Sbjct  150  ----SKLLNSPNSSSSSSLYASSTENISRLLEGWMRSSPNPSRRNNI----DHDEMLHEA  201

Query  359  eeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNVQEGN  538
            ++  DQ+           G ++D+   IP E+   +I    S +   E            
Sbjct  202  QKNQDQD----------GGVSNDDVVTIPNEKSSYNINCESSEVVTHEKA----------  241

Query  539  DNDNPPPLSFLEKWLLdesaaqveeeedgedqvavMELPTIFS  667
               +PPP ++LEKWLL         EE+G     +MELP IF+
Sbjct  242  ---SPPPFTYLEKWLL---------EENGGQVEELMELPMIFT  272



>ref|NP_001268022.1| R2R3 MYB60 transcription factor [Vitis vinifera]
 gb|ACF21938.1| R2R3 MYB60 transcription factor [Vitis vinifera]
Length=321

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 111/228 (49%), Gaps = 47/228 (21%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSAT-------SY  160
            AAIASYLPQRTDNDIKNYWNTHLKKK+KK QS  S     M S+++ ++ T       SY
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKIKKFQSALS---PHMASDSTTSTCTNHQFVPRSY  146

Query  161  HHHHHLVSKNSF-------TDRPQIatsssslyassaenisRLLEGWMRAsssssssKGL  319
                H    +SF       +  P +  S  S YASS ENISRLLEGWMR+S  ++  K  
Sbjct  147  AGDDHHRRGSSFEVINGHSSAHPSL-NSPISTYASSTENISRLLEGWMRSSPKATKEKLH  205

Query  320  TTATSHGGG--------ReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILT  475
              ++   G                    RP+   GGG   +ND+           +SIL 
Sbjct  206  QNSSLEEGSIDMTGNSMAVAAVTSVQCYRPKLEQGGGELVANDE----------FESILE  255

Query  476  FGSLMNGMESGNNKQNVQEGNDNDNP-----------PPLSFLEKWLL  586
            + +L +      +     + +D+D+            PPLSFLEKWLL
Sbjct  256  YENLNDDHHQTTDATIPSDDHDHDHEMKMDHDQKKHNPPLSFLEKWLL  303



>ref|XP_004249768.1| PREDICTED: myb-related protein 306-like [Solanum lycopersicum]
Length=270

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 119/223 (53%), Gaps = 43/223 (19%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSAT-SYHHHHHL  178
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK Q     +N  +   N   S T +Y HHHH 
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQIELDSHNLTLPPPNLDNSNTNNYDHHHHQ  149

Query  179  VSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReee  358
             +K   +     ++SSSSLYASS ENISRLLEGWMR+S + S    +         ++E 
Sbjct  150  FTKLLNSPN---SSSSSSLYASSTENISRLLEGWMRSSPNPSRRNNIDHDEMLHEAQKEL  206

Query  359  eeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNVQEGN  538
            +++D          GG+  SNDD             ++   ++    ES          +
Sbjct  207  QDQD----------GGV--SNDD-------------VVIIPNVNVDCESSE-----VVTH  236

Query  539  DNDNPPPLSFLEKWLLdesaaqveeeedgedqvavMELPTIFS  667
            +  +PPP ++LEKWLL         EE+G     +MELP IF+
Sbjct  237  EKTSPPPFTYLEKWLL---------EENGGQVEELMELPMIFT  270



>ref|XP_009772442.1| PREDICTED: myb-related protein 306-like isoform X1 [Nicotiana 
sylvestris]
Length=290

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 108/205 (53%), Gaps = 32/205 (16%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK Q+     ++ + S     S T  H   H +
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQT---GLDSHLTSPPPADSTTCDHFSWHFM  146

Query  182  SKNS-------FTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHG  340
            S N+                SSSSLYASS ENISRLLEGWMR+S +       +T  +  
Sbjct  147  SDNNKQGSKLLLQQNHNSPNSSSSLYASSTENISRLLEGWMRSSPNP------STKINEM  200

Query  341  GGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGV--IPKEEYLDSILTFGSLMNGMESGNN  514
               E +  +DDQ+    +    L      +N +  IP+E        + S+++  ES   
Sbjct  201  IFHENQHNQDDQDL-FISCETSLVQDEGISNSIKTIPRE--------YKSVISACESS--  249

Query  515  KQNVQEGNDNDN-PPPLSFLEKWLL  586
               V E   N N PPP ++LEKWLL
Sbjct  250  --GVAEKTMNTNTPPPFTYLEKWLL  272



>ref|XP_004493248.1| PREDICTED: myb-related protein 306-like [Cicer arietinum]
Length=327

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 69/108 (64%), Gaps = 18/108 (17%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK Q    +N  Q+ S NS +      HHH  +
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQEASLDNPNQVQSSNSTS------HHHQYL  143

Query  182  SKNSFTDR------------PQIatsssslyassaenisRLLEGWMRA  289
            S  SF+DR                +SSS+ YASS ENISRLLEGWMR 
Sbjct  144  SNKSFSDRSLDISNNHASSLKLTQSSSSTTYASSTENISRLLEGWMRT  191



>ref|XP_011047044.1| PREDICTED: myb-related protein 306 [Populus euphratica]
Length=323

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 108/222 (49%), Gaps = 33/222 (15%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHL-  178
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK QS  + +    GS +    + S++    L 
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQS--ALDPMAQGSASGQFMSKSFNERKCLE  147

Query  179  --VSKNSFTDRPQIatsssslyassaenisRLLEGWMRAs----------ssssssKGLT  322
               + +S  +RP       S YASS ENISRLLEGWMR+S           +   +K   
Sbjct  148  DFTTDSSVLNRPN----QVSTYASSTENISRLLEGWMRSSPKPNGTDLLKENWEKNKNSL  203

Query  323  TATSHGGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEY---------LDSILT  475
                H  G           RP+     G   S+++   ++  E            DS   
Sbjct  204  ENNDHSFGNSVATNSLQSYRPKPEEESGDLISHEEFESILSLENLNNVAWDKSSCDSATA  263

Query  476  FGSLMNGMES-GNNKQNV----QEGNDNDNPPPLSFLEKWLL  586
              S  +   S  + K N+    ++ N +++ PPLSFLEKWLL
Sbjct  264  VTSTKDFKSSTSDEKDNITMTERKQNSDESTPPLSFLEKWLL  305



>gb|KDP39628.1| hypothetical protein JCGZ_02648 [Jatropha curcas]
 gb|AIT52310.1| MYB family protein [Jatropha curcas]
Length=310

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 113/208 (54%), Gaps = 33/208 (16%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHL-  178
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK QS           ++ PT++    + ++L 
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQS--------AALDSIPTTSERSRNVYNLS  141

Query  179  -VSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGRee  355
             +S  + T+      SSSS YASS ENISRLL+GWM +S  ++   G  T T+ G     
Sbjct  142  PISSRNVTNS----PSSSSTYASSTENISRLLQGWMTSSPKTTFY-GNNTTTNDGASIII  196

Query  356  eeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMN-----------GME  502
                   N P            + +NG+I  EE+ +SIL+F +L N             E
Sbjct  197  G------NSPVGNDNVKGVAVQEMSNGLISHEEF-ESILSFENLNNISAWDKCTCDSASE  249

Query  503  SGNNKQNVQEGNDNDNPPPLSFLEKWLL  586
                +   ++ ++ +N PPLSFLEKWLL
Sbjct  250  EKEAENKKKQKSEINNNPPLSFLEKWLL  277



>ref|XP_007203968.1| hypothetical protein PRUPE_ppa023776mg [Prunus persica]
 gb|EMJ05167.1| hypothetical protein PRUPE_ppa023776mg [Prunus persica]
Length=327

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 89/243 (37%), Positives = 116/243 (48%), Gaps = 74/243 (30%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK QS     +  M S+    S TS +H  ++V
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQSAL---DPHMASD----STTSTNHQLNIV  142

Query  182  SKNSFTD-----------RPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTA  328
            S+ S ++              +  + SS YASS  NISRLLEGWMR+    S +  + + 
Sbjct  143  SRRSLSEGSLDNMATHASSVTLKNNQSSTYASSTANISRLLEGWMRS----SPTPKMLSN  198

Query  329  TSHGGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGME--  502
            T+H     +     D    E  AG  L+           + E L+SIL++ +L N     
Sbjct  199  TNH----LKLNASHDLQDQETPAGNLLS-----------RHEELESILSYENLNNVASWD  243

Query  503  -------SGNNKQNVQEG---NDND-------------------------NPPPLSFLEK  577
                     +NK N + G   ND++                         + PPLSFLEK
Sbjct  244  RSTCDSTQSDNKLNPRCGRVANDDEIIHEDDLVPDRDQKNKQIIRCEGSTSAPPLSFLEK  303

Query  578  WLL  586
            WLL
Sbjct  304  WLL  306



>ref|XP_002319734.1| hypothetical protein POPTR_0013s06390g [Populus trichocarpa]
 gb|EEE95657.1| hypothetical protein POPTR_0013s06390g [Populus trichocarpa]
Length=323

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 108/222 (49%), Gaps = 33/222 (15%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHL-  178
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK QS  + +    GS +S   + S++    L 
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQS--ALDPMAQGSASSQFMSKSFNERKCLD  147

Query  179  --VSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGL----------T  322
               + +S  +RP       S YASS ENISRLLEGWMR+S   + +  L           
Sbjct  148  DFTTDSSVLNRPN----QVSTYASSTENISRLLEGWMRSSPKPNGTDLLKENWEKNNNSL  203

Query  323  TATSHGGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEY---------LDSILT  475
                H  G           RP+     G   S+++   ++  E            DS   
Sbjct  204  ENNGHSFGNSVATNSLQSYRPKPEEESGDLISHEEFESILSLENLNNVAWDKSSCDSATV  263

Query  476  FGSLMNGMES-GNNKQNV----QEGNDNDNPPPLSFLEKWLL  586
              +  +   S  + K N+    ++   +++ PPLSFLEKWLL
Sbjct  264  VTTTKDFKSSTSDEKANITMTERKQKSDESTPPLSFLEKWLL  305



>ref|XP_009628670.1| PREDICTED: myb-related protein 306 [Nicotiana tomentosiformis]
Length=291

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 121/231 (52%), Gaps = 38/231 (16%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK Q+ G +++    S     S+T  H   + +
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQT-GLDSHL---STPPADSSTCDHFSWNFM  145

Query  182  SKNS-------FTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHG  340
            S N+                SSSS YASS ENISRLLEGWMR+S + S  + +     H 
Sbjct  146  SDNNKQGSKLLLQQNHNSPNSSSSFYASSTENISRLLEGWMRSSPNPS--RKVDEMILHE  203

Query  341  GGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGV--IPKEEYLDSILTFGSLMNGMESGNN  514
                ++++            GG++      NG+  IPKE        + S+++ + +  +
Sbjct  204  NQNSQDQDLFKSRETSLVQDGGIS------NGIKTIPKE--------YMSVISDISACES  249

Query  515  KQNVQEGNDNDNPPPLSFLEKWLLdesaaqveeeedgedqvavMELPTIFS  667
                ++  + + PPP ++LEKWLL         EE+      +MELP IF+
Sbjct  250  SGVAEKTMNTNTPPPFTYLEKWLL---------EENAGQVEELMELPMIFT  291



>gb|KHF98844.1| Myb-related protein [Gossypium arboreum]
Length=297

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 108/252 (43%), Gaps = 75/252 (30%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENS------PTSATSYH  163
            AAIASYLPQRTDNDIKNYWNTHLKKKL+K QS   E  +  G E S       T A S +
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLRKFQS-AMEPPSMAGDEKSLDFAESETGAGSSN  148

Query  164  HHHHLVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGG  343
               +  S +  +    I+               RLL+GWMR+S   +++   +       
Sbjct  149  LKLNQTSSSYASSTENIS---------------RLLQGWMRSSPKINNNNNNS-------  186

Query  344  GReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNG--MESGNNK  517
                    D      AAA   L    DD          L+SIL+F ++ +   ME   +K
Sbjct  187  --------DSIGSCSAAANNDLISHGDDQ---------LESILSFENMKDVALMEKSTSK  229

Query  518  QNVQE-GNDNDNP----------------------PPLSFLEKWLLdesaaqveeeedge  628
               Q+ G    NP                      PPLSFLEKWLL     +       E
Sbjct  230  ATFQDSGEKIINPERKQKADNNNNNIDDNNNNNSNPPLSFLEKWLL----DESSSAAQVE  285

Query  629  dqvavMELPTIF  664
            +   +MELP+IF
Sbjct  286  EIDQMMELPSIF  297



>ref|XP_009110873.1| PREDICTED: myb-related protein 306-like [Brassica rapa]
 emb|CDY31125.1| BnaA08g26750D [Brassica napus]
Length=265

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 102/197 (52%), Gaps = 45/197 (23%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            A+IASYLPQRTDNDIKNYWNTHLKKKL K     SE+  ++ SEN P   ++        
Sbjct  90   ASIASYLPQRTDNDIKNYWNTHLKKKLNK-----SESEERIISENIPLQPSA--------  136

Query  182  SKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReeee  361
            ++N+   R        S YASS ENISRLLEGWMRAS  SS++  L    S     +  +
Sbjct  137  ARNTINHR--------STYASSTENISRLLEGWMRASPKSSTANFLEQK-SQNRTNDLMD  187

Query  362  eeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNVQEGND  541
              +DQ+  E        GS D    V PK              N  E+     +VQE  D
Sbjct  188  HHNDQSPYE-------QGSWDQGFHVHPK--------------NSEENVKCDHDVQEDGD  226

Query  542  NDN--PPPLSFLEKWLL  586
             D    PPL+F+EKWLL
Sbjct  227  GDGDATPPLTFIEKWLL  243



>ref|XP_008775987.1| PREDICTED: myb-related protein 306-like [Phoenix dactylifera]
Length=304

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 103/210 (49%), Gaps = 33/210 (16%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKK+KK Q+          S +S     S  +    +
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKIKKYQTALDNYMISTDSGSSCHDMMSKGYDKDAI  149

Query  182  SKNSFTD---RPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGRe  352
                F+    +P     S S YASS +NISRLLEGWMR           +  ++ G  + 
Sbjct  150  QNPDFSGSHLQPSRYHQSPSTYASSTDNISRLLEGWMRP----------SPKSTQGKNQR  199

Query  353  eeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKE-----------EYLDSILTFGSLM-NG  496
                ED ++  +   G   A + +D + +I  E             +DS+L    L   G
Sbjct  200  SNNSEDSESLGD--RGCCAAVTKEDLDSLISFENLSSISWEKSSSLVDSVLQRPQLEPAG  257

Query  497  MESGNNKQNVQEGNDNDNPPPLSFLEKWLL  586
             E+   KQ V EG      PPLSFLEKWLL
Sbjct  258  SEA---KQGVAEGQQQ---PPLSFLEKWLL  281



>gb|AGN52169.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=314

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 114/243 (47%), Gaps = 42/243 (17%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIA+YLPQRTDNDIKNYWNTHLKKKLKK QS         G E  P  A      H   
Sbjct  92   AAIATYLPQRTDNDIKNYWNTHLKKKLKKFQS---------GLE--PQMAVDPAAFHQFA  140

Query  182  SKN----SFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGR  349
            SK+    S ++       +SS+YASSAENISRLLEGWMR+S    ++  +   ++H    
Sbjct  141  SKSYGESSKSESSLRIGENSSVYASSAENISRLLEGWMRSSPLQPNTNQINGISNHDNKF  200

Query  350  eeeeeeDDQNRPEAAAGGGLAGSN--DDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQN  523
                 +   N   + A   L           V+P +  L+ +L F    +   S ++ Q 
Sbjct  201  YGNFGKIIPNFENSDASASLIQCYRPQKMEHVMPSDHELEGMLVFDHHHHHKSSCDSSQK  260

Query  524  VQEGN---DNDNP-------------PPLSFLEKWLLdesaaqveeeedgedqvavMELP  655
              E +   D+D               PPLSFLEKWLL         +E        MELP
Sbjct  261  GSESSGLIDHDKACFEHEQKAKIDGNPPLSFLEKWLL---------DESAAQVEGAMELP  311

Query  656  TIF  664
             IF
Sbjct  312  PIF  314



>gb|ABK96779.1| unknown [Populus trichocarpa x Populus deltoides]
Length=240

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 115/226 (51%), Gaps = 41/226 (18%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHL-  178
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK QS    +     S +S  ++ S++    L 
Sbjct  5    AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQSAW--DPMAQDSTSSQFTSKSFNDRKSLD  62

Query  179  --VSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGRe  352
               + +S   RP    + +S YASS ENISRLLEGWMR+S   +SS  L           
Sbjct  63   NFTTNSSSALRP----NQASTYASSTENISRLLEGWMRSSPKPNSSNFLLKENREQEN--  116

Query  353  eeeeeDDQNRPEAAAGGGLAGSND----DNNGVIPKEEYLDSILTFGSLMNG--------  496
              +E +D +   + A   L    +    +   +I  EE+ +SIL+  SL N         
Sbjct  117  NSQENNDHDIANSVAINYLQSYKEKPEQERGDLISHEEF-ESILSLESLHNVAWDKSCCD  175

Query  497  --------------MESGNNKQN---VQEGNDNDNPPPLSFLEKWL  583
                          + + + K+N   ++    +++ PPLSFLEKWL
Sbjct  176  SGTVTTTTTTKGFHISASDEKENMTMIERNQKSESTPPLSFLEKWL  221



>ref|XP_006829805.1| hypothetical protein AMTR_s00119p00069270 [Amborella trichopoda]
 gb|ERM97221.1| hypothetical protein AMTR_s00119p00069270 [Amborella trichopoda]
Length=212

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 111/209 (53%), Gaps = 43/209 (21%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIA+YLPQRTDNDIKNYWNTHLKKK+KKLQS G E      ++++P    S      L+
Sbjct  14   AAIATYLPQRTDNDIKNYWNTHLKKKIKKLQS-GIE------TQSNPVVLNSC----QLI  62

Query  182  SKNSFTDR------PQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGG  343
             + ++  +       Q  +  SS YASS ENISRLLEGWMR+                  
Sbjct  63   FRTNWEKKSQNLVNAQYPSHQSSTYASSTENISRLLEGWMRS-----------------S  105

Query  344  GReeeeeeDDQNRP-----EAAAGGGLAGSNDDN--NGVIPKEEYLDSILTFGS-LMNGM  499
             + ++ E  ++ +P      A   G     ND+N  + +I  E+ L+S+L+F S ++   
Sbjct  106  PKAQKIEATNEQKPLIFNIRATDSGKHNRVNDENGKSDMISHED-LESLLSFDSTVLYES  164

Query  500  ESGNNKQNVQEGNDNDNPPPLSFLEKWLL  586
                  + +++  +    PPLS LEKWL+
Sbjct  165  PQATISEELKDAMEISAQPPLSLLEKWLM  193



>gb|AGN52059.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=314

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 92/240 (38%), Positives = 118/240 (49%), Gaps = 36/240 (15%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHH-L  178
            AAIA+YLPQRTDNDIKNYWNTHLKKKLKK QS G E   QM  +  PT+   +    +  
Sbjct  92   AAIATYLPQRTDNDIKNYWNTHLKKKLKKFQS-GLE--PQMAGD--PTAFHQFASKSYGE  146

Query  179  VSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReee  358
             SKN  + R      +SS+YASSAENISRLLEGWMR+S    ++  +   ++H       
Sbjct  147  SSKNESSLR---IGENSSVYASSAENISRLLEGWMRSSPLQPNTNQINGISNHDNKFYGN  203

Query  359  eeeDDQNRPEAAAGGGLAGSN--DDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNVQE  532
              +   N   + A   L           V+P +  L+ +L F    +   S ++ Q   E
Sbjct  204  FGKIIPNFENSDASASLIQCYRPQKMEHVMPSDHELEGMLVFDHHHHHKSSCDSSQKGSE  263

Query  533  GN---DNDNP-------------PPLSFLEKWLLdesaaqveeeedgedqvavMELPTIF  664
             +   D+D               PPLSFLEKWLL         +E        MELP IF
Sbjct  264  SSGLIDHDKACFEHEQKAKIDGNPPLSFLEKWLL---------DESAAQVEGAMELPPIF  314



>dbj|BAJ61429.1| R2R3-MYB transcription factor [Lupinus albus]
Length=243

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 114/221 (52%), Gaps = 38/221 (17%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHL-  178
            AAIAS LPQR DNDIKNYWNTHLKKK+KK++   + ++  +G      S+ S+++   L 
Sbjct  18   AAIASLLPQRRDNDIKNYWNTHLKKKMKKIR--VASDSTTIGQ----YSSKSFNYSRSLD  71

Query  179  VSK----NSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGG  346
            +S+    +SF  RP  + + SS YASS ENISRLL+GWMR+    S  + L   T     
Sbjct  72   ISRSNHGSSF--RPSQSQTHSSTYASSTENISRLLQGWMRS----SPKQPLKEITQEEEK  125

Query  347  ReeeeeeDDQNRPEAAAGG------GLAGSNDDNNGVIPKEEYLDSILTFGSLMNG----  496
             +  +E ++ N    +A         L      N   +   E  DSIL+F +L N     
Sbjct  126  FQSYDEFENSNNIVKSASVPASLNLQLQQHKTKNEHDMVSHEEFDSILSFENLNNAPWDK  185

Query  497  -----------MESGNNKQNVQEGNDNDNPPPLSFLEKWLL  586
                       + S    +  +  ++N N PPLSFLEKWLL
Sbjct  186  STCDSMPENVYVASVKGAEKNRVTSENSNAPPLSFLEKWLL  226



>ref|XP_006437263.1| hypothetical protein CICLE_v10031946mg [Citrus clementina]
 gb|ESR50503.1| hypothetical protein CICLE_v10031946mg [Citrus clementina]
Length=354

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 119/250 (48%), Gaps = 61/250 (24%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK QS   E +    S     SATS + H    
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQSAALEPHMPQDS-----SATSNNTHPFAK  144

Query  182  SKNSFT-DRPQIatssssly-------------assaenisRLLEGWMRAsssssssKGL  319
            + NSF+ +R  +  S+ +               ASS ENISRLLEGWMR+S  +SS+   
Sbjct  145  TGNSFSNERRSLDFSNQAASNNNLRLHQQGSSYASSTENISRLLEGWMRSSPKTSSNSSS  204

Query  320  TTATSHGGGReeeeeeDDQ---NRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLM  490
                   G   +    ++     RP+    GG +G +     +I  EE++ SIL+F   +
Sbjct  205  ALLIKGNGNIFDNRSIENSVGTYRPKEEQEGGGSGGDGGGGDLISNEEFI-SILSFEQNL  263

Query  491  NGM------------------ESGNNK--------------------QNVQEGNDNDNPP  556
            N +                  +S NN+                    +  Q  + N + P
Sbjct  264  NNVTWDKASTGDSSAKGSSTQDSANNEDQSTKVNNNNNDNNDIIANAEKKQRSDQNIHNP  323

Query  557  PLSFLEKWLL  586
            PLSFLEKWLL
Sbjct  324  PLSFLEKWLL  333



>ref|XP_009353049.1| PREDICTED: myb-related protein 306-like [Pyrus x bretschneideri]
Length=325

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 87/237 (37%), Positives = 112/237 (47%), Gaps = 64/237 (27%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS----------PGSENNAQMG-SENSPTS  148
            AAIASYLPQRTDNDIKNYWNTHLKKKLK  QS          P + N ++M  SE S  +
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKNFQSALDPHTTSDDPFNVNVSRMSLSEGSLDN  149

Query  149  ATSYHHHHHLVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTA  328
             TS      ++ +N+          SSS YASS ENISRLLEGWMR+S +       T++
Sbjct  150  MTS--QASSIILRNN---------QSSSTYASSTENISRLLEGWMRSSPTPR-----TSS  193

Query  329  TSHGGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESG  508
              H         +DDQ +P   + G LA SN++   ++  E   +      S  +     
Sbjct  194  LKHHAA-----SDDDQGKPSGISTGNLA-SNEEFESILSYENLNNFASWDRSTCDSSTYS  247

Query  509  NNKQN-------------------------------VQEGNDNDNPPPLSFLEKWLL  586
            NNK +                                +  + N N PPL+FLEKWLL
Sbjct  248  NNKVSQLSIKVPNNGEIIHDRHLLRDEDQKSKQILRCESSSTNCNNPPLTFLEKWLL  304



>gb|KDO46625.1| hypothetical protein CISIN_1g018559mg [Citrus sinensis]
Length=354

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 118/250 (47%), Gaps = 61/250 (24%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK QS   E +    S     SATS + H    
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQSAALEPHMPQDS-----SATSNNTHPFSK  144

Query  182  SKNSFT-DRPQIatssssly-------------assaenisRLLEGWMRAsssssssKGL  319
            + NSF+ +R  +  S+ +               ASS ENISRLLEGWMR+S  +SS+   
Sbjct  145  TGNSFSNERRSLDFSNQAASNNNLRLQQQGSSYASSTENISRLLEGWMRSSPKTSSNSSS  204

Query  320  TTATSHGGGReeeeeeDDQ---NRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLM  490
                   G   +    ++     RP+    GG +G       +I  EE++ SIL+F   +
Sbjct  205  ALLIKGNGNIFDNRSIENSIGTYRPKEEQEGGGSGGGGGGGDLISNEEFI-SILSFEQNL  263

Query  491  NGM------------------ESGNNK--------------------QNVQEGNDNDNPP  556
            N +                  +S NN+                    +  Q  + N + P
Sbjct  264  NNVTWDKASTGDSSAKGSSTQDSANNEDQSTKVNNNNNDNNDIIANAEKKQRSDQNIHNP  323

Query  557  PLSFLEKWLL  586
            PLSFLEKWLL
Sbjct  324  PLSFLEKWLL  333



>ref|XP_006371226.1| hypothetical protein POPTR_0019s06290g [Populus trichocarpa]
 gb|ERP49023.1| hypothetical protein POPTR_0019s06290g [Populus trichocarpa]
Length=325

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 115/226 (51%), Gaps = 41/226 (18%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHL-  178
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK QS  + +     S +S  ++ S++    L 
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQS--AWDPMAQDSTSSQFTSKSFNDRKSLD  147

Query  179  --VSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGRe  352
               + +S   RP      +S YASS ENISRLLEGWMR+S   +SS  L           
Sbjct  148  NFTTNSSSALRPN----QASTYASSTENISRLLEGWMRSSPKPNSSNFLLKENRE--QEN  201

Query  353  eeeeeDDQNRPEAAAGGGLAGSND----DNNGVIPKEEYLDSILTFGSLMNG--------  496
              +E +D +   + A   L    +    +   +I  EE+ +SIL+  SL N         
Sbjct  202  NSQENNDHDIANSVAINYLQSYKEKPEQERGDLISHEEF-ESILSLESLHNVAWDKSCCD  260

Query  497  --------------MESGNNKQN---VQEGNDNDNPPPLSFLEKWL  583
                          + + + K+N   ++    +++ PPLSFLEKWL
Sbjct  261  SGTVTTTTTTKGFHISASDEKENMTMIERNQKSESTPPLSFLEKWL  306



>ref|XP_008386907.1| PREDICTED: myb-related protein 306 [Malus domestica]
Length=325

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 89/235 (38%), Positives = 115/235 (49%), Gaps = 60/235 (26%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS---PGSENNAQMG--------SENSPTS  148
            AAIASYLPQRTDNDIKNYWNTHLKKKLK  QS   P + +N            SE S  +
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKPFQSALDPHTTSNDPFNVNVSRRSLSEGSLDN  149

Query  149  ATSYHHHHHLVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTA  328
             TS  H   ++ +N+         SSSS YASS ENISRLLEGWMR+S +  +S     A
Sbjct  150  MTS--HASSIILRNN--------QSSSSTYASSTENISRLLEGWMRSSPTPKTSSLKYNA  199

Query  329  TSHGGGReeeeeeDDQNRPEAAAGGGLAG--------SNDDNNGVIPKEEYLDSILTFGS  484
             S          +DDQ +P   + G L          S ++ N V   + Y     T+ +
Sbjct  200  AS----------DDDQEKPSGTSTGNLVSNEEFESILSYENLNNVASWDMYTCDSSTYSN  249

Query  485  LMNGM-------------------ESGNNKQNV--QEGNDNDNPPPLSFLEKWLL  586
             ++ +                   E   NKQ +  +  + N N PPL++LEKWLL
Sbjct  250  KVSQLSIKVPNGAEIIHDHHLLRDEDQKNKQIIRCESSSTNCNNPPLTYLEKWLL  304



>gb|EPS73580.1| hypothetical protein M569_01180 [Genlisea aurea]
Length=278

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 110/210 (52%), Gaps = 53/210 (25%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIA+YLPQRTDNDIKNYWNTHLKKKLK LQS      +Q+  +NS          H+ +
Sbjct  90   AAIATYLPQRTDNDIKNYWNTHLKKKLKMLQS-----ESQLAGDNSAAC-------HNFL  137

Query  182  SKNSFTDRPQ--IatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGRee  355
            SK      PQ     +++ +YASSAENISRLLEGWMR+SSS +S   LT +  H      
Sbjct  138  SKPP----PQHNKNHNNNLVYASSAENISRLLEGWMRSSSSPNS--NLTQSKFHRD----  187

Query  356  eeeeDDQNRPEAAAGGGLAGSNDDNNGVI--PKEEYLDSILTFGSLMNGMESGNNKQNVQ  529
                          GG  + S+D    +   P    L+ I++F    N + S  +K +  
Sbjct  188  -------------PGGYFSESSDVIRCIENDPDVNELNCIVSFDH--NALASRFDKSSCD  232

Query  530  EGN-----------DNDNPPPLSFLEKWLL  586
              +            +DN PPLSFLEKWLL
Sbjct  233  STHKESAFGIDTMAKSDN-PPLSFLEKWLL  261



>ref|XP_010922900.1| PREDICTED: myb-related protein 306 [Elaeis guineensis]
Length=337

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 121/236 (51%), Gaps = 52/236 (22%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKK+KK Q+        +GS  +P+ +T     H L+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKIKKYQT-------TIGSYMTPSDSTIT--CHELI  140

Query  182  SKNSFTDRPQ------------IatsssslyassaenisRLLEGWMRAssss--------  301
            S+ S+ D  +             ++ +SS YASS ENISRLLEGWMR+SS +        
Sbjct  141  SR-SYRDETRNSDISTIHSLLPRSSHNSSTYASSTENISRLLEGWMRSSSKADLKLAQDK  199

Query  302  -----sssKGLTTATSHGGGReeeeeeDDQNR----PEAAAGGGLAGSNDDNNGVIPKEE  454
                  + K  + A  +    E  + + D+      P+A   GG    + ++ G IP EE
Sbjct  200  QHQSIDAFKISSNAAFNQAYFEVGQVKSDRECGDPIPQAHIEGGQVMDDQEHCGRIPHEE  259

Query  455  YLDSILTF--GSLMNGMESGNN------KQNVQEGNDNDNPP----PLSFLEKWLL  586
             ++S L+F   S ++  +S  N      +  V +      P     PLS LEKWLL
Sbjct  260  -VESFLSFENSSGISWEKSCVNSTFYRPQSMVADAEAKQRPDSGRHPLSLLEKWLL  314



>emb|CCI55454.1| PH01B001E05.10 [Phyllostachys edulis]
Length=311

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENS-PTSATSYHHHHHL  178
            AAIASYLPQRTDNDIKNYWNTHLKK+LKK Q+ G+   +   +E++ PT+A     HHH+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKRLKKHQAMGAIFASSSSAESTNPTTAGHVLDHHHM  149

Query  179  VSKNS  193
            ++ +S
Sbjct  150  ITTSS  154



>ref|NP_973795.1| putative transcription factor MYB60 [Arabidopsis thaliana]
 gb|AEE28350.1| myb domain protein 60 [Arabidopsis thaliana]
Length=197

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 92/203 (45%), Gaps = 43/203 (21%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            A+IASYLPQRTDNDIKNYWNTHLKKKL K  S     +  +  + S T  T  H   +  
Sbjct  7    ASIASYLPQRTDNDIKNYWNTHLKKKLNKSDSDERSRSENIALQTSSTRNTINHRSTYAS  66

Query  182  SKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReeee  361
            S  + +                     RLLEGWMRAS  SS+S   TT   H        
Sbjct  67   STENIS---------------------RLLEGWMRASPKSSTS---TTFLEHKMQNRTNN  102

Query  362  eeD---DQNRPEAAAGGGLAGSN-----DDNNGVIPKEEYLDSILTFGSLMNGMESGNNK  517
              D   DQ   E   G    G +     DD+ G+   E             NG +  +  
Sbjct  103  FIDHHSDQFPYEQLQGSWEEGHSKGINGDDDQGIKNSENN-----------NGDDVHHED  151

Query  518  QNVQEGNDNDNPPPLSFLEKWLL  586
             + ++ +D++  PPL+F+EKWLL
Sbjct  152  GDHEDDDDHNATPPLTFIEKWLL  174



>gb|EPS61331.1| hypothetical protein M569_13466 [Genlisea aurea]
Length=285

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 86/235 (37%), Positives = 123/235 (52%), Gaps = 53/235 (23%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIA+YLPQRTDNDIKNYWNTHLKKKLK +QS       Q+  +    SAT   +H  + 
Sbjct  90   AAIATYLPQRTDNDIKNYWNTHLKKKLKMMQS-----EPQLAGD----SAT---YHQFMT  137

Query  182  SKNSFTDRPQIatsss--slyassaenisRLLEGWMRAsssssssKGLTTATSHGGGRee  355
                + +R     ++   S+YASSAENIS+LLEGWM  SSS + +   + A+++   R +
Sbjct  138  KPPPYGERAAADENNQNPSVYASSAENISKLLEGWMMRSSSPNQT---SAASNYNDDRSK  194

Query  356  eeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFG-SLMNGME--SGNNKQNV  526
              +  D+++                 G+    + LD IL+F  +   G++  S ++ Q  
Sbjct  195  FNQFSDRSQ---------------QIGIGIGHDELDCILSFDHNPTAGLDKSSCDSSQKG  239

Query  527  QEGN---------DNDNPPPLSFLEKWLLdesaaqveeeedgedqvavMELPTIF  664
             EG+         + D+ PPLSFLEKWLL         +E        MELP++F
Sbjct  240  SEGSGLVDSRGKIEGDDHPPLSFLEKWLL---------DESAGHGEGAMELPSLF  285



>emb|CDP12647.1| unnamed protein product [Coffea canephora]
Length=268

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 116/229 (51%), Gaps = 58/229 (25%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKK+K+ Q+         GS+    S +S    + LV
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKIKRFQA---------GSDPQILSDSSTATINQLV  140

Query  182  SKNSFTDRPQ--------IatsssslyassaenisRLLEGWMRAsssssssKGLTTATSH  337
            S+ +F D  +            ++++YASSAENISRLLEGWM++S  S++     T +  
Sbjct  141  SR-AFCDDGKHNNTSAALKLNQNTTVYASSAENISRLLEGWMKSSPRSNN----ITNSPT  195

Query  338  GGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESGNNK  517
            GG         D+ R    +   ++GS    N     EE +        +M+     + +
Sbjct  196  GG---------DKTRATGDSVASISGSETSGN-----EEKI--------IMSSDHHAHEQ  233

Query  518  QNVQEGNDNDNPPPLSFLEKWLLdesaaqveeeedgedqvavMELPTIF  664
            +   E N     PPLSFLE WLL         +E       VME+P+IF
Sbjct  234  KPKLENN-----PPLSFLENWLL---------DEAAAQVEGVMEIPSIF  268



>ref|XP_010246153.1| PREDICTED: myb-related protein 306 [Nelumbo nucifera]
Length=320

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 80/225 (36%), Positives = 112/225 (50%), Gaps = 43/225 (19%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKK+KK Q+     + Q+ S ++         + HLV
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKIKKFQTAL---DPQLVSNST---------NRHLV  137

Query  182  SKNSFTDR---------PQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATS  334
            SK S++D+           +  + SS YASS ENISRLLEGWMR+S  S++ +       
Sbjct  138  SK-SYSDKRNLDINNHVSLLRLNQSSTYASSTENISRLLEGWMRSSPKSNNGRKDQEKPH  196

Query  335  HGGGReeeeeeDDQNRPEAAAGGGL----AGSNDDNNGVIPKEEYLDSILTFGSLMNGME  502
                      +++ +   + A        A    +NN  I   E L+S+L+  +L N   
Sbjct  197  QSSSSNSNTNKNNNSNSNSVAAAPFQCNQAKVEQENNCDIISHEELESLLSLDNLNNISW  256

Query  503  SGNNKQNVQEGNDN-----------------DNPPPLSFLEKWLL  586
              ++  +  +G+                   +N  PLS LEKWLL
Sbjct  257  EKSSCDSTLQGSQTTPTDETLDCTSERVQRLENQAPLSLLEKWLL  301



>ref|XP_008391728.1| PREDICTED: myb-related protein 306-like [Malus domestica]
Length=325

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 83/236 (35%), Positives = 113/236 (48%), Gaps = 62/236 (26%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS---PGSENNAQMGSENSPTSATS-----  157
            AAIASYLPQRTDNDIKNYWNTHLKKKLK  QS   P + ++       S  S +      
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKNFQSALDPHTTSDDLFNVNVSRRSLSEGSLDN  149

Query  158  -YHHHHHLVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATS  334
               H   ++ +N+          SSS YASS ENISRLLEGWMR+S +       T++  
Sbjct  150  MXSHASSIILRNN---------QSSSTYASSTENISRLLEGWMRSSPTPK-----TSSLK  195

Query  335  HGGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFG-SLMNGMESGN  511
            H         ++DQ +P   + G LA SN++   ++  E  L+++ ++  S  +     N
Sbjct  196  HHAA-----CDNDQGKPSGISTGNLA-SNEEFESILSYEN-LNNVASWDRSTCDSSTYSN  248

Query  512  NKQN-------------------------------VQEGNDNDNPPPLSFLEKWLL  586
            NK +                                +  + N N PPL+FLEKWLL
Sbjct  249  NKVSQLSIKVXNNGEIIHDRHLLRDEDQKSKQILRCESSSTNCNNPPLTFLEKWLL  304



>emb|CBI31183.3| unnamed protein product [Vitis vinifera]
Length=279

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 100/206 (49%), Gaps = 45/206 (22%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKK+K       +++ + GS     +  S  H     
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKIKNY---AGDDHHRRGSSFEVINGHSSAH----P  142

Query  182  SKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReeee  361
            S NS            S YASS ENISRLLEGWMR+S  ++  K    ++   G      
Sbjct  143  SLNS----------PISTYASSTENISRLLEGWMRSSPKATKEKLHQNSSLEEGSI----  188

Query  362  eeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNVQEGND  541
               D      A GGG   +ND+           +SIL + +L +      +     + +D
Sbjct  189  ---DMTGNSMAQGGGELVANDE----------FESILEYENLNDDHHQTTDATIPSDDHD  235

Query  542  NDNP-----------PPLSFLEKWLL  586
            +D+            PPLSFLEKWLL
Sbjct  236  HDHEMKMDHDQKKHNPPLSFLEKWLL  261



>ref|XP_003554062.1| PREDICTED: myb-related protein 306 [Glycine max]
Length=348

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 86/247 (35%), Positives = 116/247 (47%), Gaps = 58/247 (23%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS---PGSENNAQMGSENSPTSAT---SYH  163
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK Q+   P S +++    +  P S +   S  
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQAALDPHSASDSTASGQFLPKSFSDRRSLD  149

Query  164  HHHHLVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAs-----------ssssss  310
                  +  S       + SSS+ YASS ENISRLLEGWMR+S                 
Sbjct  150  ISSSNNNHGSSIRLSHQSQSSSTTYASSTENISRLLEGWMRSSPKPLKGSSSQDDEDIQL  209

Query  311  KGLTTATSHGGGReeeeeeDD--------QNRPEAAAGGGLAGSNDDNNGVIPKEEYLDS  466
            +G+     +    E   +  +        +N+ E   GGG    N     ++  EE+ DS
Sbjct  210  QGINDDDKNNNNFESTTKLVNLHHLQHKVRNKDEHQEGGGGGVDN-----MVSHEEF-DS  263

Query  467  ILTFGSLMNGM---------------------------ESGNNKQNVQEGNDNDNPPPLS  565
            IL+F +L N                              + + + N+++ ++N   PPLS
Sbjct  264  ILSFENLNNAAWDKSTCDSMPEKSSEAAAEYSVDHHHDIAAHERNNIRQKSENSGAPPLS  323

Query  566  FLEKWLL  586
            FLEKWLL
Sbjct  324  FLEKWLL  330



>ref|XP_009148134.1| PREDICTED: myb-related protein 306 [Brassica rapa]
Length=282

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 89/204 (44%), Gaps = 41/204 (20%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            A+IASYLPQRTDNDIKNYWNTHLKKKL K +S     +  M  + S T  T+ H   +  
Sbjct  90   ASIASYLPQRTDNDIKNYWNTHLKKKLNKSESEERSFSENMALQTSATRNTTNHKSTYAS  149

Query  182  SKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGL------TTATSHGG  343
            S  + +                      LLEGWMRAS  S++   L       T      
Sbjct  150  STENIS---------------------CLLEGWMRASPESNTVNFLEEKLQNQTTNLMND  188

Query  344  GReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQN  523
               +   E  Q   E        G +D    V PKE               ++S  + Q 
Sbjct  189  HHNQFPCEHVQGSWEEGHSQTFNGDDDQVINVHPKESE-----------KNVKSDRDVQE  237

Query  524  VQEGNDNDN---PPPLSFLEKWLL  586
              +G D+D+    PPL+F+EKWLL
Sbjct  238  DGDGVDDDHNNASPPLTFIEKWLL  261



>gb|KHN34624.1| Myb-related protein 306 [Glycine soja]
Length=348

 Score = 75.9 bits (185),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 86/247 (35%), Positives = 116/247 (47%), Gaps = 58/247 (23%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS---PGSENNAQMGSENSPTSAT---SYH  163
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK Q+   P S +++    +  P S +   S  
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQAALDPHSASDSTASGQFLPKSFSDRRSLD  149

Query  164  HHHHLVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAs-----------ssssss  310
                  +  S       + SSS+ YASS ENISRLLEGWMR+S                 
Sbjct  150  ISSSNNNHGSSIRLSHQSQSSSTTYASSTENISRLLEGWMRSSPKPLKGSSSQDDEDIQL  209

Query  311  KGLTTATSHGGGReeeeeeDD--------QNRPEAAAGGGLAGSNDDNNGVIPKEEYLDS  466
            +G+     +    E   +  +        +N+ E   GGG    N     ++  EE+ DS
Sbjct  210  QGINDDDKNNNNFESTTKLVNLHHLQHKVRNKDEHQEGGGGGVDN-----MVSHEEF-DS  263

Query  467  ILTFGSLMNGM---------------------------ESGNNKQNVQEGNDNDNPPPLS  565
            IL+F +L N                              + + + N+++ ++N   PPLS
Sbjct  264  ILSFENLNNAAWDKSTCDSMPEKSSEAAAEYFVDHHHDIAAHERNNIRQKSENSGAPPLS  323

Query  566  FLEKWLL  586
            FLEKWLL
Sbjct  324  FLEKWLL  330



>ref|XP_009391637.1| PREDICTED: myb-related protein 306-like [Musa acuminata subsp. 
malaccensis]
Length=289

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 98/198 (49%), Gaps = 24/198 (12%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLP+RTDNDIKNYWNTHLKKK+KK ++  + +  +M    S     +       +
Sbjct  90   AAIASYLPRRTDNDIKNYWNTHLKKKIKKHEA--AADGYEMTCGTSSICLDNMEARKQDI  147

Query  182  SKNS---FTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGRe  352
            +  +   F   P I       YASS ENISRLLEGW+ +S      +G     S+     
Sbjct  148  ATLTFPGFYKAPSI-------YASSTENISRLLEGWVCSSPRQGKLQGSAITDSN-----  195

Query  353  eeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNVQE  532
                    +   A     +   +D  +      E L S+L+F + M+G+     KQ ++ 
Sbjct  196  -NNNGSSSSNSNAIILQKVQAESDRGSFETMMHEDLASLLSFEN-MSGIAGAEAKQGME-  252

Query  533  GNDNDNPPPLSFLEKWLL  586
                D+ PPLSFLEKWL 
Sbjct  253  ----DDQPPLSFLEKWLF  266



>ref|XP_010258354.1| PREDICTED: myb-related protein 306 [Nelumbo nucifera]
Length=329

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 80/230 (35%), Positives = 109/230 (47%), Gaps = 48/230 (21%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSA---------T  154
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK ++ G + NA+ G  +S +           T
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFET-GLDGNAKDGFSDSQSMTKGQWERRLQT  148

Query  155  SYHHHHHLVSKNSFTDRP--------------QIatsssslyassaenisRLLEGWMRAs  292
              H     + +    ++P               +  + ++ YASS ENISRLL+GWM+ S
Sbjct  149  DIHMARKALCEALSLEKPSSLCDLKASSGFYSMMRPNQATTYASSTENISRLLQGWMKNS  208

Query  293  ssssssKGLTTATSHGGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSIL  472
              S  S   TT  S           ++    ++    G   ++++ + V P  E L+S+L
Sbjct  209  PKSGRSTSETTQNS----------VNNMTGTDSTYSEGTPSASNNTDIVSP--EALESLL  256

Query  473  TFGSLMNGM-------ESGNNKQNVQEGNDNDNPP-----PLSFLEKWLL  586
               S   G+       E+ N KQ      D   P      PLS LEKWL 
Sbjct  257  GLDSSTPGVSQSASLDETTNIKQETNTFQDECKPKMETQVPLSVLEKWLF  306



>ref|XP_009348270.1| PREDICTED: myb-related protein 306-like [Pyrus x bretschneideri]
 ref|XP_009348271.1| PREDICTED: myb-related protein 306-like [Pyrus x bretschneideri]
Length=325

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 89/237 (38%), Positives = 119/237 (50%), Gaps = 64/237 (27%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS----------PGSENNAQMG-SENSPTS  148
            AAIASYLPQRTDNDIKNYWNTHLKKKLK+  S          P + N ++   SE S  +
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKQFPSALDPHTTSDDPFNVNVSRRSLSEGSLDN  149

Query  149  ATSYHHHHHLVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTA  328
             TS  H   ++ +N+         SSSS YASS ENISRLLEGWMR+S +  +S     A
Sbjct  150  MTS--HASSIILRNN--------QSSSSTYASSTENISRLLEGWMRSSPTPKTSSLKYNA  199

Query  329  TSHGGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFG---------  481
             S          +DDQ +P   + G L  SN++   ++  E  L+++ ++          
Sbjct  200  AS----------DDDQEKPSGISTGNLV-SNEEFESILSYEN-LNNVASWDRSTCDSSTY  247

Query  482  ---------SLMNGM-----------ESGNNKQNV--QEGNDNDNPPPLSFLEKWLL  586
                      + NG            E   NKQ +  +  + N N PPL++LEKWLL
Sbjct  248  SNKVSRLSIEVPNGAEIIHDHHLLRDEDQKNKQIIRCESSSTNCNNPPLTYLEKWLL  304



>ref|XP_002530950.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF31422.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=365

 Score = 75.9 bits (185),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 95/258 (37%), Positives = 119/258 (46%), Gaps = 64/258 (25%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS--------PGSENNAQMG---SEN----  136
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK QS        P +   + M    SE     
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQSALDPMAAAPEASTASFMSKSFSEKSRSL  149

Query  137  --SPTSATSYHHHHHLVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssss  310
              SP S+++   +H + S ++ T    I T +++ YASS ENISRLLEGWMR S   +  
Sbjct  150  DLSPNSSSTIKLNHQIASSSTSTSTTTITTMTTASYASSTENISRLLEGWMRPSPKPNDH  209

Query  311  KGLTTATSHGGGRe----eeeeeDDQNRPEA------AAGGGLAGSNDDNNGVIPKEEYL  460
              +    S   G               RP+A        GGG   S+     +I  EE+ 
Sbjct  210  VIIKEKWSQNDGSIGDNLVATTSLQCYRPKADEENGRGGGGGGGCSSMGGGDLISHEEF-  268

Query  461  DSILTFGSLMN----------------------------GMESGNNKQNVQEG-------  535
            +SIL+F +L N                                   K+NV  G       
Sbjct  269  ESILSFENLNNVAWDHKSTSDSTTVATSASTIKGCHQESSASDHQEKENVTAGFTENKKQ  328

Query  536  -NDNDNPPPLSFLEKWLL  586
             +D +N PPLSFLEKWLL
Sbjct  329  KSDQNNNPPLSFLEKWLL  346



>gb|ABG76203.1| putative transcription factor [Arabidopsis thaliana]
Length=280

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 89/200 (45%), Gaps = 37/200 (19%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            A+IASYLPQRTDNDIKNYWNTHLKKKL K  S     +  +  + S T  T  H   +  
Sbjct  90   ASIASYLPQRTDNDIKNYWNTHLKKKLNKSDSDERSRSENIALQTSSTRNTINHRSTYAS  149

Query  182  SKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReeee  361
            S  + +                     RLLEGWMRAS  SS+S                +
Sbjct  150  STENIS---------------------RLLEGWMRASPKSSTSTTFLEHKMQNRTNNLID  188

Query  362  eeDDQNRPEAAAGGGLAGSN-----DDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNV  526
               DQ   E   G    G +     DD+ G+   E             NG +  +   + 
Sbjct  189  HHSDQFPYEQLQGSWEEGHSKGINGDDDQGIKNSENN-----------NGDDVHHEDGDH  237

Query  527  QEGNDNDNPPPLSFLEKWLL  586
            ++ +D++  PPL+F+EKWLL
Sbjct  238  EDDDDHNATPPLTFIEKWLL  257



>ref|NP_172358.1| putative transcription factor MYB60 [Arabidopsis thaliana]
 dbj|BAC42133.1| putative transcription factor [Arabidopsis thaliana]
 gb|AAO50607.1| putative myb family transcription factor [Arabidopsis thaliana]
 gb|AAS10021.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE28351.1| myb domain protein 60 [Arabidopsis thaliana]
Length=280

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 89/200 (45%), Gaps = 37/200 (19%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            A+IASYLPQRTDNDIKNYWNTHLKKKL K  S     +  +  + S T  T  H   +  
Sbjct  90   ASIASYLPQRTDNDIKNYWNTHLKKKLNKSDSDERSRSENIALQTSSTRNTINHRSTYAS  149

Query  182  SKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReeee  361
            S  + +                     RLLEGWMRAS  SS+S                +
Sbjct  150  STENIS---------------------RLLEGWMRASPKSSTSTTFLEHKMQNRTNNFID  188

Query  362  eeDDQNRPEAAAGGGLAGSN-----DDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNV  526
               DQ   E   G    G +     DD+ G+   E             NG +  +   + 
Sbjct  189  HHSDQFPYEQLQGSWEEGHSKGINGDDDQGIKNSENN-----------NGDDVHHEDGDH  237

Query  527  QEGNDNDNPPPLSFLEKWLL  586
            ++ +D++  PPL+F+EKWLL
Sbjct  238  EDDDDHNATPPLTFIEKWLL  257



>gb|AAF99772.1|AC003981_22 F22O13.30 [Arabidopsis thaliana]
Length=287

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 89/200 (45%), Gaps = 37/200 (19%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            A+IASYLPQRTDNDIKNYWNTHLKKKL K  S     +  +  + S T  T  H   +  
Sbjct  97   ASIASYLPQRTDNDIKNYWNTHLKKKLNKSDSDERSRSENIALQTSSTRNTINHRSTYAS  156

Query  182  SKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReeee  361
            S  + +                     RLLEGWMRAS  SS+S                +
Sbjct  157  STENIS---------------------RLLEGWMRASPKSSTSTTFLEHKMQNRTNNFID  195

Query  362  eeDDQNRPEAAAGGGLAGSN-----DDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNV  526
               DQ   E   G    G +     DD+ G+   E             NG +  +   + 
Sbjct  196  HHSDQFPYEQLQGSWEEGHSKGINGDDDQGIKNSENN-----------NGDDVHHEDGDH  244

Query  527  QEGNDNDNPPPLSFLEKWLL  586
            ++ +D++  PPL+F+EKWLL
Sbjct  245  EDDDDHNATPPLTFIEKWLL  264



>ref|XP_006484863.1| PREDICTED: myb-related protein 306-like [Citrus sinensis]
Length=322

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 66/109 (61%), Gaps = 19/109 (17%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK QS   E +    S     SATS + H    
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQSAALEPHMPQDS-----SATSNNTHPFSK  144

Query  182  SKNSFT-DRPQIatssssly-------------assaenisRLLEGWMR  286
            + NSF+ +R  +  S+ +               ASS ENISRLLEGWMR
Sbjct  145  TGNSFSNERRSLDFSNQAASNNNLRLHQQGSSYASSTENISRLLEGWMR  193



>gb|AAC83617.1| putative transcription factor [Arabidopsis thaliana]
Length=280

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 89/200 (45%), Gaps = 37/200 (19%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            A+IASYLPQRTDNDIKNYWNTHLKKKL K  S     +  +  + S T  T  H   +  
Sbjct  90   ASIASYLPQRTDNDIKNYWNTHLKKKLNKSDSDERSRSENIALQTSSTRNTINHRSTYAS  149

Query  182  SKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReeee  361
            S  + +                     RL+EGWMRAS  SS+S                +
Sbjct  150  STENIS---------------------RLVEGWMRASPKSSTSTTFLEHKMQNRTNNFID  188

Query  362  eeDDQNRPEAAAGGGLAGSN-----DDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNV  526
               DQ   E   G    G +     DD+ G+   E             NG +  +   + 
Sbjct  189  HHSDQFPYEQLQGSREEGHSKGINGDDDQGIKNSENN-----------NGDDVHHEDGDH  237

Query  527  QEGNDNDNPPPLSFLEKWLL  586
            ++ +D++  PPL+F+EKWLL
Sbjct  238  EDDDDHNATPPLTFIEKWLL  257



>ref|XP_004979484.1| PREDICTED: myb-related protein 306-like [Setaria italica]
Length=280

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 44/63 (70%), Gaps = 5/63 (8%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSY----HHH  169
            AAIASYLPQRTDNDIKNYWNTHLKKK+K+LQ P ++ + Q    N+ TS   Y      H
Sbjct  91   AAIASYLPQRTDNDIKNYWNTHLKKKVKRLQQPAAD-SFQTAPSNAVTSPNYYSPTSSSH  149

Query  170  HHL  178
            H L
Sbjct  150  HSL  152



>ref|XP_011069952.1| PREDICTED: myb-related protein 306 [Sesamum indicum]
Length=330

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 127/267 (48%), Gaps = 72/267 (27%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIA+YLPQRTDNDIKNYWNTHLKKKLKKLQS         GS    T++ S  H+H  +
Sbjct  90   AAIATYLPQRTDNDIKNYWNTHLKKKLKKLQS---------GSLQPQTASDSTAHYHQFL  140

Query  182  SKNSFTDRPQ-----------IatsssslyassaenisRLLEGWMRAsssssssKGLTTA  328
            SK+    R             + + +SS+YASSAENISRLLEGWMR+S +       T  
Sbjct  141  SKSYGDQRAMNENSKHQSGHGMLSENSSVYASSAENISRLLEGWMRSSPN-------TAN  193

Query  329  TSHGGGReeeeeeD-DQNRPEAAAGGGLAGS-----------NDDNNGVIPKEEYLDSIL  472
            TS+     +    D  +  P      G   S           +D  NG+ P +  L+ IL
Sbjct  194  TSYMNENRDRFYRDFGKIVPSELCNDGSGSSVQCYRPQQLDQHDGANGINPADHDLECIL  253

Query  473  TFG-----SLMNGMESGNNKQNVQEGN------------------DNDNPPPLSFLEKWL  583
            +F      S+     S ++ Q   E +                  DN+N PPLSFLEKWL
Sbjct  254  SFDDHKLTSMACDKSSCDSSQKGSESSCGLLDHHDDHDQHNKAKIDNNN-PPLSFLEKWL  312

Query  584  LdesaaqveeeedgedqvavMELPTIF  664
            L         +E       VME+P IF
Sbjct  313  L---------DESAGQVEGVMEIPPIF  330



>ref|XP_010943691.1| PREDICTED: myb-related protein 306-like [Elaeis guineensis]
Length=314

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 103/207 (50%), Gaps = 17/207 (8%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSE-----NSPTSATSYHH  166
            AAIASYLPQRTDNDIKN+WNTHLKKK KK Q+  + ++  + S+     N P S      
Sbjct  90   AAIASYLPQRTDNDIKNHWNTHLKKKFKKYQT--AIDSYMISSDAGPSCNEPISKGYKME  147

Query  167  HHHLVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGG  346
               +    +    P     S S YAS+ ENISRLLEGWM +S   +  K   +   +   
Sbjct  148  GIRIPDLTASHSPPSRFYQSPSTYASNTENISRLLEGWMWSSPKCTQDKHQQSTIINDAD  207

Query  347  ReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSIL------TFGSLMNGMESG  508
               E  +  Q + +  +   +A   DD++ ++  E  L SI+      +  S++ G +  
Sbjct  208  GNIESLQGSQAKGDQWSCAAIA--KDDHDSLLSFEN-LSSIMWDKSPSSVDSVLRGTQLA  264

Query  509  NNKQNVQEG-NDNDNPPPLSFLEKWLL  586
            +     + G  D    PPLS LEKWL 
Sbjct  265  SADAETKHGVADGRQQPPLSLLEKWLF  291



>ref|XP_002450969.1| hypothetical protein SORBIDRAFT_05g021820 [Sorghum bicolor]
 gb|EES09957.1| hypothetical protein SORBIDRAFT_05g021820 [Sorghum bicolor]
Length=296

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 2/56 (4%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQM--GSENSPTSATSYH  163
            AAIASYLPQRTDNDIKNYWNTHLKKK+K+LQ P +  + Q    + N+ T + +Y+
Sbjct  91   AAIASYLPQRTDNDIKNYWNTHLKKKVKRLQQPAAAESFQTTAAASNAVTCSPNYY  146



>ref|NP_001267555.1| myb-related protein 306-like [Cucumis sativus]
 gb|ABC33923.1| MYB transcription factor [Cucumis sativus]
 gb|KGN59390.1| MYB transcription factor [Cucumis sativus]
Length=294

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 107/204 (52%), Gaps = 26/204 (13%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKLK        N+A + +   P SAT+    +  V
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLK------KLNSAAVDTPEPPESATTRFQSNDKV  143

Query  182  SKNSFTDRP-QIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReee  358
                  D P  + ++ ++ YASSAENISRLL+ WMR+S   S  K         G     
Sbjct  144  PT---ADSPSSLVSNRATTYASSAENISRLLQAWMRSSPEESRRK-------MSGENSIA  193

Query  359  eeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFG--SL-MNGMESGNNKQNVQ  529
                 Q +P+A   GG   S ++ + ++  E  + S+ ++G  SL   G E  N  +   
Sbjct  194  AATQQQQQPKAEPDGGELVSGEEFDSILSFEN-MKSVNSWGKSSLSYKGKEEVNVGEKQS  252

Query  530  EGND-----NDNPPPLSFLEKWLL  586
              ND     N   PPLSFLEKWL 
Sbjct  253  SENDDATAENATAPPLSFLEKWLF  276



>ref|XP_004158001.1| PREDICTED: LOW QUALITY PROTEIN: myb-related protein 306-like 
[Cucumis sativus]
Length=282

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 102/199 (51%), Gaps = 27/199 (14%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKLK   S   +NN      NSP ++ S +H     
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLK---SAFEDNN------NSPHTSKSSNH-----  135

Query  182  SKNSFTDRPQIatsssslyassaen-isRLLEGWMRAsssssssKGLTTATSHGGGReee  358
              +  +DR   A+SSSS    S+   ISRLLEGWMR+S   +          H      E
Sbjct  136  --SPTSDRSSTASSSSSSTYYSSAENISRLLEGWMRSSPKKTDDNENILIHFH------E  187

Query  359  eeeDDQNRPEAAAGGGLAGSNDDNNG---VIPKEEYLDSILTFGSLMNGMESGNNKQNVQ  529
            ++  D       +  GL    +++ G   V+ KE     +++  +L N   +        
Sbjct  188  KQNHDNGDSSMVSIQGLEPKTEEDGGDRLVLGKEIESSMVVSPENLNNDDHNVGVCWEKS  247

Query  530  EGNDNDNPPPLSFLEKWLL  586
               D DNPP LSFLEKWLL
Sbjct  248  SNFDVDNPP-LSFLEKWLL  265



>ref|XP_009629125.1| PREDICTED: myb-related protein 306-like [Nicotiana tomentosiformis]
Length=324

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 111/222 (50%), Gaps = 37/222 (17%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSEN----SPTSATSYHH-  166
            AAIASYLP+RTDNDIKNYWNTHLKKK+K LQ   S ++     EN    S +++TS    
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKMKNLQEKCSGDDDLFSVENGHNFSSSNSTSRGQW  149

Query  167  ---------------HHHLVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAssss  301
                           H+ L  +NS     Q   +  S YASS ENI+RLL+GWMR+SSS+
Sbjct  150  ERTLQTDINMAKKALHNALSLENSTPYIKQETPAKVSTYASSTENIARLLQGWMRSSSST  209

Query  302  sssKGLTTATSHGGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFG  481
            ++S+   T++++     +    D    P A + GG+        G++   E L  + TF 
Sbjct  210  NNSENSKTSSNNIAATTDSSSCD--GTPSAESKGGV--------GIMEAFESLFGLETFE  259

Query  482  SLMNGM-------ESGNNKQNVQEGNDNDNPPPLSFLEKWLL  586
            S  +         E+   +  +++  +N   P    LE WL 
Sbjct  260  SSSSDQLSQTASPEASKFQVEIKKEENNSQVPLSVMLENWLF  301



>ref|XP_003520923.1| PREDICTED: myb-related protein 306-like [Glycine max]
 gb|KHN42174.1| Myb-related protein 306 [Glycine soja]
Length=360

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 88/259 (34%), Positives = 120/259 (46%), Gaps = 70/259 (27%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS---PGSENNAQMGSENSPTSATSYHHHH  172
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK Q+   P S +++    +  P S +      
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQAALDPHSASDSTASGQFLPKSFSDRRSTL  149

Query  173  HLVSKNSFTDRPQIa-------tsssslyassaenisRLLEGWMRAsssssssKGLTT--  325
             + S N+      I        +SS++ YASS ENISRLLEGWMR+S    +   + +  
Sbjct  150  DISSNNNNNHGSSIRLSHHQSQSSSTTTYASSTENISRLLEGWMRSSPKQLNKGSIISQY  209

Query  326  ---------------------ATSHGGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVI  442
                                 +T+         +   +N+     GGG+     DNN V 
Sbjct  210  DEDHQLQGINDDDDNNNNNFVSTTKLVNLHHLHQHKIRNKDHEQEGGGV-----DNNMVS  264

Query  443  PKEEYLDSILTF---------GSLMNGMESGNN---------------------KQNVQE  532
              EE+ DSIL+F          S  + M   ++                     + NV++
Sbjct  265  HHEEF-DSILSFENQNNAAWDKSTCDSMPEKSSEASAAADHHHHHHHDIAAAHERNNVRQ  323

Query  533  GNDNDN-PPPLSFLEKWLL  586
             ++N +  PPLSFLEKWLL
Sbjct  324  KSENSSGAPPLSFLEKWLL  342



>ref|XP_004144357.1| PREDICTED: myb-related protein 306-like [Cucumis sativus]
Length=306

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 102/199 (51%), Gaps = 27/199 (14%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKLK   S   +NN      NSP ++ S +H     
Sbjct  114  AAIASYLPQRTDNDIKNYWNTHLKKKLK---SAFEDNN------NSPHTSKSSNH-----  159

Query  182  SKNSFTDRPQIatsssslyassaen-isRLLEGWMRAsssssssKGLTTATSHGGGReee  358
              +  +DR   A+SSSS    S+   ISRLLEGWMR+S   +          H      E
Sbjct  160  --SPTSDRSSTASSSSSSTYYSSAENISRLLEGWMRSSPKKTDDNENILIHFH------E  211

Query  359  eeeDDQNRPEAAAGGGLAGSNDDNNG---VIPKEEYLDSILTFGSLMNGMESGNNKQNVQ  529
            ++  D       +  GL    +++ G   V+ KE     +++  +L N   +        
Sbjct  212  KQNHDNGDSSMVSIQGLEPKTEEDGGDRLVLGKEIESSMVVSPENLNNDDHNVGVCWEKS  271

Query  530  EGNDNDNPPPLSFLEKWLL  586
               D DNPP LSFLEKWLL
Sbjct  272  SNFDVDNPP-LSFLEKWLL  289



>ref|XP_002892473.1| hypothetical protein ARALYDRAFT_888116 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68732.1| hypothetical protein ARALYDRAFT_888116 [Arabidopsis lyrata subsp. 
lyrata]
Length=279

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 88/200 (44%), Gaps = 38/200 (19%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            A+IASYLPQRTDNDIKNYWNTHLKKKL K +S     +  M  + S T  T  H   +  
Sbjct  90   ASIASYLPQRTDNDIKNYWNTHLKKKLNKSESDERSRSENMVLQTSATRNTVNHRSTYAS  149

Query  182  SKNSFTDRPQIatsssslyassaenisRLLEGWMRAs-ssssssKGLTTATSHGGGReee  358
            S  + +                     RLLEGWMRAS  +S+++                
Sbjct  150  STENIS---------------------RLLEGWMRASPKTSTTTTTFLEQKMQNRTNNFI  188

Query  359  eeeDDQNRPEAAAG----GGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNV  526
            +   DQ   E   G    G   G N D+ GV   E             NG +  +   + 
Sbjct  189  DHHTDQFPYEQLQGSWEEGHSKGINGDDQGVKNSESN-----------NGDDVHHEDGDD  237

Query  527  QEGNDNDNPPPLSFLEKWLL  586
             + + N   PPL+F+EKWLL
Sbjct  238  DDDHHNAT-PPLTFIEKWLL  256



>ref|XP_008792495.1| PREDICTED: myb-related protein 306 [Phoenix dactylifera]
Length=338

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 109/234 (47%), Gaps = 47/234 (20%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLP+RTDNDIKNYWNTHLKKK+KK Q+        +GS  +P+ +T   H     
Sbjct  90   AAIASYLPRRTDNDIKNYWNTHLKKKIKKDQT-------TIGSYMAPSDSTITCHELIAK  142

Query  182  SKNSFTDRPQIat---------sssslyassaenisRLLEGWMRAssss----------s  304
              NS T    I+T          SSS YASSAENISRLLEGWMR+   +           
Sbjct  143  GYNSETRNSDISTIHFPLPRSSHSSSTYASSAENISRLLEGWMRSCPKANFKPAQDKQHQ  202

Query  305  ssKGLTTATSHG-------GGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLD  463
            S    ++++ +        G   E   E     P+A   GG    +      IP EE ++
Sbjct  203  SINAFSSSSCNAFNQAHPEGAHAESGRECGDPIPQAYIEGGQVMDDQGYCDRIPHEE-VE  261

Query  464  SILTF-------------GSLMNGMESGNNKQNVQEGNDNDNPPPLSFLEKWLL  586
              L+F              S   G +S       ++  D+    PLS LEKWLL
Sbjct  262  LFLSFENSSGNPWEKSCVDSTFYGPQSPVADAEARQTLDSGQHAPLSLLEKWLL  315



>ref|XP_011079260.1| PREDICTED: myb-related protein 306-like [Sesamum indicum]
Length=309

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 90/225 (40%), Gaps = 82/225 (36%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS-------PGSENNAQMGSENSPTSATSY  160
            AAIA+YLPQRTDNDIKNYWNTHLKKKLKK QS       P S++ + +   N    + +Y
Sbjct  116  AAIATYLPQRTDNDIKNYWNTHLKKKLKKFQSPLDNPQMPVSDHISTVPYNNHQFMSKTY  175

Query  161  HHHHHLVSKNSFTDRPQIatsssslyassaen--------------------isRLLEGW  280
              HHH   +NS  D   I   SSS     +                      ISRLLE W
Sbjct  176  TTHHH--EQNSTNDEINIKNQSSSSSGLFSRQLSHEQNPSSSSSSYASSAENISRLLETW  233

Query  281  MRAsssssssKGLTTATSHGGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYL  460
            M+                                           S++  NG  P E   
Sbjct  234  MK-------------------------------------------SSNRENGEFPTEFSE  250

Query  461  DSILTFGS---LMNGMESGNNKQNVQEGNDNDNPPPLSFLEKWLL  586
            + I  F +   L  G E G       E    D+ PPL FLEKWL+
Sbjct  251  NGISRFSTDQELKGGFEHG-------ERMKMDSIPPLLFLEKWLM  288



>ref|XP_002866494.1| hypothetical protein ARALYDRAFT_496423 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42753.1| hypothetical protein ARALYDRAFT_496423 [Arabidopsis lyrata subsp. 
lyrata]
Length=349

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 5/70 (7%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+   G E+N  + S N     TS   +H   
Sbjct  89   AAIASYLPERTDNDIKNYWNTHLKKKLKKINESGEEDNDGVSSSN-----TSSQKNHQST  143

Query  182  SKNSFTDRPQ  211
            +K  +  R Q
Sbjct  144  NKGQWERRLQ  153



>ref|NP_851248.1| Myb transcription factor  [Arabidopsis thaliana]
 gb|AAD53106.1|AF176001_1 putative transcription factor [Arabidopsis thaliana]
 dbj|BAB11497.1| MYB96 transcription factor-like protein [Arabidopsis thaliana]
 gb|AED97610.1| Myb transcription factor [Arabidopsis thaliana]
Length=351

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 5/70 (7%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+   G E+N  + S N     TS   +H   
Sbjct  89   AAIASYLPERTDNDIKNYWNTHLKKKLKKINESGEEDNDGVSSSN-----TSSQKNHQST  143

Query  182  SKNSFTDRPQ  211
            +K  +  R Q
Sbjct  144  NKGQWERRLQ  153



>ref|NP_201053.2| Myb transcription factor  [Arabidopsis thaliana]
 gb|ABD85159.1| At5g62470 [Arabidopsis thaliana]
 dbj|BAF00865.1| MYB96 transcription factor-like protein [Arabidopsis thaliana]
 gb|AED97611.1| Myb transcription factor [Arabidopsis thaliana]
Length=352

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 5/70 (7%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+   G E+N  + S N     TS   +H   
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKINESGEEDNDGVSSSN-----TSSQKNHQST  144

Query  182  SKNSFTDRPQ  211
            +K  +  R Q
Sbjct  145  NKGQWERRLQ  154



>gb|AAS10115.1| MYB transcription factor [Arabidopsis thaliana]
Length=352

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 5/70 (7%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+   G E+N  + S N     TS   +H   
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKINESGEEDNDGVSSSN-----TSSQKNHQST  144

Query  182  SKNSFTDRPQ  211
            +K  +  R Q
Sbjct  145  NKGQWERRLQ  154



>gb|KHG14344.1| Myb-related protein [Gossypium arboreum]
Length=285

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 94/222 (42%), Gaps = 74/222 (33%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSE--NNAQMGSENSPTSATSYHHHHH  175
            AAIASYLPQRTDND+KNYWNTHLKKKLKK Q P  E    AQ     +  + +S     +
Sbjct  90   AAIASYLPQRTDNDVKNYWNTHLKKKLKKFQ-PAMELPQMAQACLNKTLATGSSSTIATY  148

Query  176  LVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGRee  355
              S  + +                     RLL+GWMRAS +  S++              
Sbjct  149  ASSTENIS---------------------RLLQGWMRASPNICSNQSAIIL---------  178

Query  356  eeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMN--------------  493
                  Q + +  +GGG   SN          E+ +SIL F ++ N              
Sbjct  179  ------QTQSKDESGGGDLMSN----------EHFESILWFENMNNVAWEKSACGSTTSK  222

Query  494  --GMESGNNKQNVQE---------GNDNDNPPPLSFLEKWLL  586
                +SGN+ Q   E         GN++   P  S LEKWLL
Sbjct  223  GGFQDSGNDDQFSVEITQEMKQKTGNNSKFYPSFSSLEKWLL  264



>ref|XP_010458949.1| PREDICTED: myb-related protein 306-like [Camelina sativa]
Length=356

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 45/70 (64%), Gaps = 5/70 (7%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+   G E+N    S N     TS   H+   
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKINESGEEDNDGFSSSN-----TSSQKHNQST  144

Query  182  SKNSFTDRPQ  211
            +K  +  R Q
Sbjct  145  NKGQWERRLQ  154



>ref|XP_003599668.1| R2R3-MYB transcription factor [Medicago truncatula]
Length=310

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 96/213 (45%), Gaps = 38/213 (18%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNA------QMGSENSPTSATSYH  163
            AAIASYLP+RTDNDIKNYWNTHL+KKLKK+   G EN        Q+  +      T  H
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLRKKLKKINQTGDENEVEENSIPQVKGQWERRLQTDIH  149

Query  164  HHHHLVSKNSFTDRPQ--IatsssslyassaenisRLLEGWMRAsssssssKGLTTATSH  337
                 + +    D+P   +A + +S YAS+ ENI+RLLE WM+   +       +  T++
Sbjct  150  MAKQALCEALSLDKPTPILAENQTSPYASNTENIARLLEKWMKKPEN-------SVETTN  202

Query  338  GGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSL----------  487
             G           N      G G      +      K++  DS+++F SL          
Sbjct  203  SG-----------NSIMVVTGSGSREGGQNTIACKQKDQAFDSLVSFNSLNSDCSQSVSV  251

Query  488  --MNGMESGNNKQNVQEGNDNDNPPPLSFLEKW  580
               N +   +     Q   + +   PL F+E W
Sbjct  252  EEKNFLAMDSCFFQYQSKPNQETQDPLMFMENW  284



>ref|XP_010483959.1| PREDICTED: myb-related protein 306-like [Camelina sativa]
Length=356

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 45/70 (64%), Gaps = 5/70 (7%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+   G E+N    S N     TS   H+   
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKINESGEEDNDGFSSSN-----TSSQKHNQST  144

Query  182  SKNSFTDRPQ  211
            +K  +  R Q
Sbjct  145  NKGQWERRLQ  154



>gb|AES69919.2| R2R3-myb transcription factor [Medicago truncatula]
Length=311

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 96/213 (45%), Gaps = 38/213 (18%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNA------QMGSENSPTSATSYH  163
            AAIASYLP+RTDNDIKNYWNTHL+KKLKK+   G EN        Q+  +      T  H
Sbjct  91   AAIASYLPERTDNDIKNYWNTHLRKKLKKINQTGDENEVEENSIPQVKGQWERRLQTDIH  150

Query  164  HHHHLVSKNSFTDRPQ--IatsssslyassaenisRLLEGWMRAsssssssKGLTTATSH  337
                 + +    D+P   +A + +S YAS+ ENI+RLLE WM+   +       +  T++
Sbjct  151  MAKQALCEALSLDKPTPILAENQTSPYASNTENIARLLEKWMKKPEN-------SVETTN  203

Query  338  GGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSL----------  487
             G           N      G G      +      K++  DS+++F SL          
Sbjct  204  SG-----------NSIMVVTGSGSREGGQNTIACKQKDQAFDSLVSFNSLNSDCSQSVSV  252

Query  488  --MNGMESGNNKQNVQEGNDNDNPPPLSFLEKW  580
               N +   +     Q   + +   PL F+E W
Sbjct  253  EEKNFLAMDSCFFQYQSKPNQETQDPLMFMENW  285



>ref|XP_009417866.1| PREDICTED: myb-related protein 306-like [Musa acuminata subsp. 
malaccensis]
Length=310

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 75/216 (35%), Positives = 99/216 (46%), Gaps = 39/216 (18%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKK+KK  S  + +   M S  SP+       H ++ 
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKIKK--SHTATDGYNMSSGTSPSC------HDYMP  141

Query  182  SKNSFTDRPQIatssss----------lyassaenisRLLEGWMRAsssssssKGLTTAT  331
                   R Q  T  +           +YA S  NISRLLEGW R+S  ++  K    A 
Sbjct  142  EGYDMETRKQDITVLTFPLPSMRLTPPIYACSTGNISRLLEGWTRSSKKNTQGKLQERAI  201

Query  332  ---SHGGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSL-----  487
               SH    +       + +  AA   G + +           E L ++L+F  +     
Sbjct  202  ADDSHSSNNDATAAASVREKSRAAGDQGCSTAM--------THEDLGTLLSFEKVSGGSW  253

Query  488  ---MNGMESGNNKQNVQEGNDNDNPPPLSFLEKWLL  586
                 G  S  + +  Q G ++   PPLS LEKWL 
Sbjct  254  EKTAAGKASFGDAEATQGGENHQ--PPLSLLEKWLF  287



>ref|XP_009151368.1| PREDICTED: myb-related protein 306 [Brassica rapa]
Length=350

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENS  139
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+   G E+N    S N+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKINESGREDNDDFSSSNT  135



>emb|CDY69264.1| BnaCnng62710D, partial [Brassica napus]
Length=332

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENS  139
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+   G E+N    S N+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKINESGGEDNDDFSSSNT  135



>dbj|BAJ87308.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLP+RTDNDIKNYWNTHLKKKL+K Q+ G+       S  +      + HHH ++
Sbjct  90   AAIASYLPRRTDNDIKNYWNTHLKKKLRKQQAMGAIFAPPASSPGTAGDNFDHRHHHDMI  149

Query  182  SK  187
            S+
Sbjct  150  SR  151



>ref|NP_001170619.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACR34234.1| unknown [Zea mays]
 gb|AFW65553.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB05102.1| MYB transcription factor, partial [Zea mays]
Length=289

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSEN  112
            AAIASYLPQRTDNDIKNYWNTHLKKK+K+LQ P +++
Sbjct  91   AAIASYLPQRTDNDIKNYWNTHLKKKVKRLQQPAADS  127



>gb|AAZ83352.1| myb transcription factor MYB30 [Gossypium hirsutum]
Length=307

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 5/54 (9%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYH  163
            AAIASYLP+RTDNDIKNYWNTHLK+KLKKLQ  G+E++++ G    P+S++SY 
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKRKLKKLQ--GNESSSRYG---FPSSSSSYQ  138



>emb|CDX87250.1| BnaC09g05650D [Brassica napus]
Length=335

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 44/70 (63%), Gaps = 5/70 (7%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+   G E+N    S     S T     HH  
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKINESGEEDNDGFTS-----SHTISQKQHHSS  144

Query  182  SKNSFTDRPQ  211
            +K  +  R Q
Sbjct  145  NKGQWERRLQ  154



>ref|XP_010475698.1| PREDICTED: myb-related protein 306-like [Camelina sativa]
Length=283

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 104/203 (51%), Gaps = 39/203 (19%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMG-SENSPTSATSYHHHHHL  178
            A+IASYLPQRTDNDIKNYWNTHLKKKL K     SE +A+   S  + T  TS       
Sbjct  90   ASIASYLPQRTDNDIKNYWNTHLKKKLNK-----SECDAERSRSSENITLQTS-------  137

Query  179  VSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReee  358
             S+N+   R        S YASS ENISRLLEGWMRAS  S      T+A +H    +  
Sbjct  138  ASRNTINQR--------STYASSTENISRLLEGWMRASPKS------TSAANH----QTN  179

Query  359  eeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFG-----SLMNGMESGNNKQN  523
               D QN  ++     L GS ++ +    +    D    FG     S  N +   +    
Sbjct  180  SLIDHQNH-QSPYEQQLQGSWEEGHHSKIRSNGDDDHQDFGVGPKISTENNIGGDHEDGG  238

Query  524  VQEGNDNDNP--PPLSFLEKWLL  586
              +  D++N   PPL+F+EKWLL
Sbjct  239  DDDEEDHNNAATPPLTFIEKWLL  261



>emb|CBI15225.3| unnamed protein product [Vitis vinifera]
Length=269

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 50/101 (50%), Gaps = 32/101 (32%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSEN------SPTSATSYH  163
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK  +  S +   + S N       P  A++Y 
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFPTDTSSSLPDLKSSNGYNPNTRPVQASTYA  149

Query  164  HHHHLVSKNSFTDRPQIatsssslyassaenisRLLEGWMR  286
                 ++K                          LLEGWMR
Sbjct  150  SSAENIAK--------------------------LLEGWMR  164



>ref|XP_007138187.1| hypothetical protein PHAVU_009G187700g [Phaseolus vulgaris]
 gb|ESW10181.1| hypothetical protein PHAVU_009G187700g [Phaseolus vulgaris]
Length=315

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 101/237 (43%), Gaps = 77/237 (32%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSE--NNAQMGSENS------------  139
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK+Q+ G +  NN + G+  S            
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKMQTEGDDEGNNYEKGNSCSQLKGQWERRLQT  149

Query  140  ----------------------------PTSATSYHHHHHLVSKNSFTDRPQIatssssl  235
                                         TS+  +H HHH  S N  +           L
Sbjct  150  DIHTAKQALCEALSLDKPTQIFPETKLPSTSSKCFHDHHHPTSPNQTS-----------L  198

Query  236  yassaenisRLLEGWMRAsssssssKGLTTATSHGGGReeeeeeDDQNRPEAAAGGGLAG  415
            YASS ENI+RLL+ WM+ S          T T++                      G + 
Sbjct  199  YASSTENIARLLDNWMKKSPKK-------TETNYSISN--------------MVTTGSSS  237

Query  416  SNDDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNVQEGNDNDNPPPLSFLEKWLL  586
            S    + V   +++LDS+ +F S  +  E+ N    V+   + +   PL  LE WL 
Sbjct  238  SEGTQSTVTCTQDHLDSLWSFKSERSPEENTN---LVESKPNLETQVPLMLLENWLF  291



>ref|XP_009112022.1| PREDICTED: myb-related protein 306-like [Brassica rapa]
Length=335

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 41/55 (75%), Gaps = 2/55 (4%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHH  166
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+   G E+N   G  +S T +   HH
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKINESGEEDND--GFTSSHTISQKQHH  142



>ref|XP_006394392.1| hypothetical protein EUTSA_v10004487mg [Eutrema salsugineum]
 dbj|BAJ34253.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31678.1| hypothetical protein EUTSA_v10004487mg [Eutrema salsugineum]
Length=355

 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 44/70 (63%), Gaps = 5/70 (7%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+   G E+N    S N     TS    H   
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKINEFGEEDNDGFSSSN-----TSSQKQHQSS  144

Query  182  SKNSFTDRPQ  211
            +K  +  R Q
Sbjct  145  NKGQWERRLQ  154



>ref|XP_009410470.1| PREDICTED: myb-related protein 306-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=285

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 92/195 (47%), Gaps = 17/195 (9%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKK++K Q   +       S N      +   H++  
Sbjct  86   AAIASYLPQRTDNDIKNYWNTHLKKKIEKHQLATTGCTTSSDSNNGCPEIMTSRCHNNNA  145

Query  182  SKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReeee  361
            S NS       +  SSS YASS  NISRLL+GW R S     +      T HG       
Sbjct  146  SGNSCHSNLPSSDLSSSSYASSTHNISRLLQGWTRCSPKVKPTAPDQDLTCHG-------  198

Query  362  eeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNVQEGND  541
                Q + +  +   L   N++   ++P  E   +  +F    +     + K+     N 
Sbjct  199  ---IQMKVDQESCHPLF--NEELKQLLPAWEEPSAEASFYGSQSTPACADGKKRFDAQN-  252

Query  542  NDNPPPLSFLEKWLL  586
                PPL+ LE WLL
Sbjct  253  ----PPLAALENWLL  263



>ref|XP_009410469.1| PREDICTED: myb-related protein 306-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=289

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 92/195 (47%), Gaps = 17/195 (9%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKK++K Q   +       S N      +   H++  
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKIEKHQLATTGCTTSSDSNNGCPEIMTSRCHNNNA  149

Query  182  SKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReeee  361
            S NS       +  SSS YASS  NISRLL+GW R S     +      T HG       
Sbjct  150  SGNSCHSNLPSSDLSSSSYASSTHNISRLLQGWTRCSPKVKPTAPDQDLTCHG-------  202

Query  362  eeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNVQEGND  541
                Q + +  +   L   N++   ++P  E   +  +F    +     + K+     N 
Sbjct  203  ---IQMKVDQESCHPLF--NEELKQLLPAWEEPSAEASFYGSQSTPACADGKKRFDAQN-  256

Query  542  NDNPPPLSFLEKWLL  586
                PPL+ LE WLL
Sbjct  257  ----PPLAALENWLL  267



>ref|XP_004299363.1| PREDICTED: myb-related protein 306-like [Fragaria vesca subsp. 
vesca]
Length=358

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTS  148
            AAIASYLPQRTDNDIKNYWNTHLKKKL+KLQ+ GS  +   G+   P S
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLRKLQT-GSAEDGISGTSQQPIS  137



>ref|XP_008790474.1| PREDICTED: myb-related protein 306-like isoform X2 [Phoenix dactylifera]
Length=272

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 99/211 (47%), Gaps = 25/211 (12%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHH--  175
            AAIASYLPQRTDNDIKNYWNTHLKKK KK Q+    +     S  S     S  +     
Sbjct  48   AAIASYLPQRTDNDIKNYWNTHLKKKFKKYQTAIDSSMISSDSGASCHEQMSKGYSMEGR  107

Query  176  -----LVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAs-ssssssKGLTTATSH  337
                 L + +S T R      S S Y S+ ENISRLLEGWM +   S+      +T    
Sbjct  108  IRIPGLTASHSPTSR---FYQSPSTYTSNTENISRLLEGWMWSLPKSAQDMHQQSTIIDS  164

Query  338  GGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSI-------LTFGSLMNG  496
             G    +  +   +R   A     A + DD++ ++  E  L SI        +  S++ G
Sbjct  165  DGNESLQGSQAKGDRWSCA-----AIAKDDHDSLLSFEN-LSSIAWEKSSSSSLHSVLQG  218

Query  497  MESGNNKQNVQEG-NDNDNPPPLSFLEKWLL  586
             +        + G  D    PPLS LEKWLL
Sbjct  219  TQLAPADAEAKRGVADGAQQPPLSLLEKWLL  249



>gb|EYU20889.1| hypothetical protein MIMGU_mgv1a011578mg [Erythranthe guttata]
Length=277

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 106/227 (47%), Gaps = 46/227 (20%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK+Q+        +  +    S    +H    +
Sbjct  91   AAIASYLPQRTDNDIKNYWNTHLKKKLKKIQAQSPPLTPHVAYD----STKPRNHSDLKI  146

Query  182  SKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReeee  361
            ++NS            S+YASS++NIS LL+ W   S++    + +        G+   E
Sbjct  147  TENS------------SVYASSSQNISSLLQEWNNTSTTCDLDRNI-----RNIGKIPTE  189

Query  362  eeDDQN------RPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQN  523
              DD +      RP+         S D          +++   +  S   G +  +    
Sbjct  190  FSDDYSTLLQYYRPQQQQFDCSILSKD--------RSFIEEKSSCDSSQKGSDQSSGPIT  241

Query  524  VQEGNDNDNPPPLSFLEKWLLdesaaqveeeedgedqvavMELPTIF  664
             QE  D DNP PLSFL++WLL          +    QV  ME+P +F
Sbjct  242  DQEKID-DNPAPLSFLDEWLL----------DASASQVEDMEIPQMF  277



>ref|XP_010458145.1| PREDICTED: myb-related protein 306-like [Camelina sativa]
Length=280

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 101/208 (49%), Gaps = 52/208 (25%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMG-SENSPTSATSYHHHHHL  178
            A+IASYLPQRTDNDIKNYWNTHLKKKL K     SE +A+   S  + T  TS       
Sbjct  90   ASIASYLPQRTDNDIKNYWNTHLKKKLNK-----SECDAERSRSSENITLQTS-------  137

Query  179  VSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReee  358
             S+N+   R        S YASS ENISRLLEGWMRA           +  S     +  
Sbjct  138  ASRNTIKHR--------STYASSTENISRLLEGWMRA-----------SPKSSAANHQTN  178

Query  359  eeeDDQNRP---EAAAGGGLAG------SNDDNN---GVIPKEEYLDSILTFGSLMNGME  502
               D QN     E   G    G      SN D++   GV PK    ++I        G +
Sbjct  179  SLIDHQNHQSPYEQLQGSWEQGHHSKIRSNGDDHQDFGVGPKISAENNI--------GGD  230

Query  503  SGNNKQNVQEGNDNDNPPPLSFLEKWLL  586
              +   +  E ++N   PPL+F+EKWLL
Sbjct  231  HEDGGDDDDEDHNNAATPPLTFIEKWLL  258



>gb|AGN96216.1| transcription factor MYBJ2 [Glycine max]
Length=319

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPG  103
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK+QS G
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKMQSGG  123



>ref|XP_010444096.1| PREDICTED: myb-related protein 306-like [Camelina sativa]
Length=356

 Score = 70.1 bits (170),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 44/70 (63%), Gaps = 5/70 (7%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+   G E+     S N     TS   H+   
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKINESGEEDKDGFSSSN-----TSSQKHNQST  144

Query  182  SKNSFTDRPQ  211
            +K  +  R Q
Sbjct  145  NKGQWERRLQ  154



>gb|KFK27973.1| hypothetical protein AALP_AA8G455500 [Arabis alpina]
Length=348

 Score = 70.1 bits (170),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 43/70 (61%), Gaps = 5/70 (7%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+   G E N    S     S T+    H   
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKINESGEEENDGFSS-----SKTTSQKQHQSS  144

Query  182  SKNSFTDRPQ  211
            +K  +  R Q
Sbjct  145  NKGQWERRLQ  154



>ref|XP_008790473.1| PREDICTED: myb-related protein 306-like isoform X1 [Phoenix dactylifera]
Length=314

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 99/211 (47%), Gaps = 25/211 (12%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHH--  175
            AAIASYLPQRTDNDIKNYWNTHLKKK KK Q+    +     S  S     S  +     
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKFKKYQTAIDSSMISSDSGASCHEQMSKGYSMEGR  149

Query  176  -----LVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAs-ssssssKGLTTATSH  337
                 L + +S T R      S S Y S+ ENISRLLEGWM +   S+      +T    
Sbjct  150  IRIPGLTASHSPTSR---FYQSPSTYTSNTENISRLLEGWMWSLPKSAQDMHQQSTIIDS  206

Query  338  GGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSI-------LTFGSLMNG  496
             G    +  +   +R   A     A + DD++ ++  E  L SI        +  S++ G
Sbjct  207  DGNESLQGSQAKGDRWSCA-----AIAKDDHDSLLSFEN-LSSIAWEKSSSSSLHSVLQG  260

Query  497  MESGNNKQNVQEG-NDNDNPPPLSFLEKWLL  586
             +        + G  D    PPLS LEKWLL
Sbjct  261  TQLAPADAEAKRGVADGAQQPPLSLLEKWLL  291



>ref|XP_010547821.1| PREDICTED: myb-related protein 306-like [Tarenaya hassleriana]
Length=351

 Score = 70.1 bits (170),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 48/71 (68%), Gaps = 5/71 (7%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMG-SENSPTSATSYHHHHHL  178
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK+   G +++   G S ++P S     +HH  
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKMDGSGDDSDGHEGLSSSNPNS----QNHHQT  145

Query  179  VSKNSFTDRPQ  211
             +K  +  R Q
Sbjct  146  SNKGQWERRLQ  156



>gb|ABH02921.1| MYB transcription factor MYB74 [Glycine max]
Length=140

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
           AAIASYLPQRTDNDIKNYWNTHL+KKLKK+Q+
Sbjct  14  AAIASYLPQRTDNDIKNYWNTHLRKKLKKMQA  45



>ref|XP_004499445.1| PREDICTED: myb-related protein 306-like [Cicer arietinum]
Length=324

 Score = 69.7 bits (169),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 2/42 (5%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMG  127
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK+Q+  S NN + G
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKIQT--SSNNEKEG  129



>emb|CDY32135.1| BnaCnng06440D [Brassica napus]
Length=267

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 86/199 (43%), Gaps = 47/199 (24%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            A+IASYLPQRTDNDIKNYWNTHLKKKL K +S     +  +  + S T     H   +  
Sbjct  90   ASIASYLPQRTDNDIKNYWNTHLKKKLNKSESEERSISENITLQTSATRNAINHRSTYAS  149

Query  182  SKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReeee  361
            S  + +                     RLLEGWMRAS  SS++  L     +      + 
Sbjct  150  STENIS---------------------RLLEGWMRASPKSSTASFLEQKVQNRTNDLMDH  188

Query  362  eeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNVQEGND  541
              D+    +        GS D    V PK+                E+     +VQE  D
Sbjct  189  HNDESPYEQ--------GSWDQGFHVHPKK--------------SEENVKCDHDVQEDGD  226

Query  542  NDN----PPPLSFLEKWLL  586
             D      PPL+F+EKWLL
Sbjct  227  GDGDGDATPPLTFIEKWLL  245



>ref|XP_009772443.1| PREDICTED: myb-related protein 306-like isoform X2 [Nicotiana 
sylvestris]
Length=122

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK Q+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKFQT  121



>gb|AFW55877.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB05799.1| MYB transcription factor, partial [Zea mays]
Length=289

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKL+K Q+ G+       SE +   A    H     
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLRKQQAIGAIFAPPRPSEPTAGHADCRRHDMTRS  149

Query  182  SKNSFTDRP  208
            SK+S    P
Sbjct  150  SKDSHAACP  158



>ref|XP_006364601.1| PREDICTED: myb-related protein 306-like [Solanum tuberosum]
Length=337

 Score = 69.7 bits (169),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGS  130
            AAIASYLPQRTDNDIKNYWNTHL+KKLKKLQ    EN+ Q G+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLRKKLKKLQG-NDENSTQEGT  131



>emb|CAA09728.1| MYB96 protein [Arabidopsis thaliana]
Length=343

 Score = 69.3 bits (168),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENN  115
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+   G E+N
Sbjct  81   AAIASYLPERTDNDIKNYWNTHLKKKLKKINESGEEDN  118



>gb|KHN32523.1| Myb-related protein 306 [Glycine soja]
Length=319

 Score = 69.3 bits (168),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK+QS
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKMQS  121



>ref|XP_006662698.1| PREDICTED: myb-related protein 306-like [Oryza brachyantha]
Length=299

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 96/202 (48%), Gaps = 24/202 (12%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATS-----YHH  166
            AAIASYLPQRTDNDIKNYWNTHLKKKL    S  S  +        P++A S      H 
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLAAASSTSSSRHPIFADATFPSAAGSSSSEVTHQ  149

Query  167  HHHLVSKNS-FTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGG  343
               + ++ S F D P       S YASS +NIS+LL+G+M+ +  S     L    S  G
Sbjct  150  MQAIAARRSPFADCPS------SSYASSMDNISKLLDGFMKTAPPSPPPPPLQHYDS--G  201

Query  344  GReeeeeeDDQNRPEAAAGGGLAGSND-DNNGVIPKEEYLDSILTFGSLMNGMESGNNKQ  520
              + +    D   P   +   ++G++D D   V  +  ++D          G + G    
Sbjct  202  CYDVKPSVVDVGNP-LLSFHCMSGTDDLDCFDVHQQASFMDQY--------GGDVGRGGA  252

Query  521  NVQEGNDNDNPPPLSFLEKWLL  586
              Q       PPPLS +EKWL 
Sbjct  253  QDQTPQGRRPPPPLSSIEKWLF  274



>ref|XP_009130218.1| PREDICTED: myb-related protein 306-like [Brassica rapa]
Length=343

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENN  115
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+   G E+N
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKINESGEEDN  127



>ref|XP_009594207.1| PREDICTED: myb-related protein 306 [Nicotiana tomentosiformis]
Length=349

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATS  157
            AAIASYLPQRTDNDIKNYWNTHL+KKLKKLQ    EN+ Q G  +S  S  S
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLRKKLKKLQG-NDENSNQEGIRSSSQSNVS  140



>ref|XP_006280703.1| hypothetical protein CARUB_v10026666mg [Capsella rubella]
 gb|EOA13601.1| hypothetical protein CARUB_v10026666mg [Capsella rubella]
Length=357

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENN  115
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+   G E+N
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKINESGEEDN  127



>sp|P81392.1|MYB06_ANTMA RecName: Full=Myb-related protein 306 [Antirrhinum majus]
 gb|AAB23528.1| Myb oncoprotein homolog {clone 306} [Antirrhinum majus=snapdragons, 
J1:522, flowers, Peptide, 316 aa]
Length=316

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSP  100
            AAIASYLP RTDNDIKNYWNTHLKKKL+KLQSP
Sbjct  90   AAIASYLPHRTDNDIKNYWNTHLKKKLEKLQSP  122



>gb|EMT05173.1| Myb-related protein 306 [Aegilops tauschii]
Length=145

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPG  103
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+Q  G
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKMQDAG  123



>ref|XP_004236011.1| PREDICTED: myb-related protein 306 [Solanum lycopersicum]
Length=333

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMG  127
            AAIASYLPQRTDNDIKNYWNTHL+KKLKKLQ    EN+ Q G
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLRKKLKKLQG-NDENSTQEG  130



>ref|XP_006431144.1| hypothetical protein CICLE_v10012152mg [Citrus clementina]
 gb|ESR44384.1| hypothetical protein CICLE_v10012152mg [Citrus clementina]
Length=336

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 3/53 (6%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ---SPGSENNAQMGSENSPTSA  151
            AAIASYLPQRTDNDIKNYWNTHLKKK++KLQ   +  SE+N+Q   E +  S+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKVRKLQLAAAGCSEDNSQYRDELASASS  142



>ref|NP_001242312.1| myb-related protein 306-like [Glycine max]
 gb|ACU19959.1| unknown [Glycine max]
Length=319

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPG  103
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK++S G
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKMRSGG  123



>gb|ABH02908.1| MYB transcription factor MYB60 [Glycine max]
Length=193

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLPQRTDNDIKNYWNTHL+KKLKK+Q
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLRKKLKKMQ  120



>ref|XP_009399931.1| PREDICTED: myb-related protein 306-like [Musa acuminata subsp. 
malaccensis]
Length=309

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 79/216 (37%), Positives = 102/216 (47%), Gaps = 42/216 (19%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKL-----KKLQSPGSENNAQ-MGSENSPTSATSYH  163
            AAIASYLPQRTDNDIKNYWNTHLKKK+       + SP +        S+   T A    
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKMIDTAGSYVISPDTSPVCHDYMSKGCNTEAVKQE  149

Query  164  HHHHLVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTAT----  331
                L   + F+  P I       YASS ENISRLLEGW+R+S  +++ K     T    
Sbjct  150  MKFPL---SRFSQTPSI-------YASSTENISRLLEGWVRSSPKAAAKKKEFAITDNNN  199

Query  332  ---SHGGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGME  502
               S            +  + E    G LA +++D          LDS+L+F +  +GM 
Sbjct  200  SSSSSSSNTITAASPKENKQAERNQVGCLAAAHED----------LDSLLSFEN-TSGMI  248

Query  503  SGNN-------KQNVQEGNDNDNP-PPLSFLEKWLL  586
            S          + N +   D +N  PPLS LEKWL 
Sbjct  249  SWGKIHGPQLAQANAEAKQDAENSQPPLSSLEKWLF  284



>ref|XP_006305493.1| hypothetical protein CARUB_v10009957mg [Capsella rubella]
 gb|EOA38391.1| hypothetical protein CARUB_v10009957mg [Capsella rubella]
Length=280

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 92/198 (46%), Gaps = 34/198 (17%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS--PGSENNAQMGSENSPTSATSYHHHHH  175
            A+IASYLPQRTDNDIKNYWNTHLKKKL K +     S ++  M  + S T  T  H   +
Sbjct  90   ASIASYLPQRTDNDIKNYWNTHLKKKLNKSECDQERSRSSENMTLQTSATRNTINHRSTY  149

Query  176  LVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATS-HGGGRe  352
              S  + +                     RLLEGWMRAS  SS++  L      H     
Sbjct  150  ASSTENIS---------------------RLLEGWMRASPKSSTANFLEQKMQNHQTNNL  188

Query  353  eeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNVQE  532
             ++   +Q +      G  +  ++   G  PK       +T  ++    E G +  + +E
Sbjct  189  MDQSPYEQLQGSWEEAGHHSKRSNGGLGDGPK-------ITENNIGGDHEDGGDDYDEEE  241

Query  533  GNDNDNPPPLSFLEKWLL  586
             N     PPL+F+EKWLL
Sbjct  242  HNAT---PPLTFIEKWLL  256



>gb|AIZ97490.1| R2R3-MYB transcription factor subgroup 7 [Fagopyrum tataricum]
Length=291

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSE  109
            AAIASYLPQRTDNDIKNYWNTHLKKKL KLQ  G E
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLSKLQGNGEE  125



>ref|XP_010489412.1| PREDICTED: myb-related protein 306-like [Camelina sativa]
Length=279

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 95/208 (46%), Gaps = 53/208 (25%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMG-SENSPTSATSYHHHHHL  178
            A+IASYLPQRTDNDIKNYWNTHLKKKL K     SE +A+   S  + T  TS       
Sbjct  90   ASIASYLPQRTDNDIKNYWNTHLKKKLNK-----SECDAERSRSSENITLQTS-------  137

Query  179  VSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReee  358
             S+N+   R        S YASS ENISRLLEGWMRA           +  S     +  
Sbjct  138  ASRNTINHR--------STYASSTENISRLLEGWMRA-----------SPKSSAANHQTN  178

Query  359  eeeDDQNRP----------EAAAGGGLAGSNDDNNG--VIPKEEYLDSILTFGSLMNGME  502
               D QN            E      +  + DD+ G  V PK+   ++I          +
Sbjct  179  SLIDHQNHQSPYEQLQGSWEQGHHSKIRSNGDDHQGFSVGPKKSAENNIGGDHEDGGDDD  238

Query  503  SGNNKQNVQEGNDNDNPPPLSFLEKWLL  586
              ++             PPL+F+EKWLL
Sbjct  239  DEDHISAT---------PPLTFIEKWLL  257



>ref|XP_010931466.1| PREDICTED: myb-related protein 306-like isoform X2 [Elaeis guineensis]
Length=318

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 64/105 (61%), Gaps = 16/105 (15%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKK+KK       N   M S  +P+++T   +     
Sbjct  71   AAIASYLPQRTDNDIKNYWNTHLKKKIKK-------NPTTMDSHKTPSNSTITCNELISN  123

Query  182  SKNSFTDRPQIats---------ssslyassaenisRLLEGWMRA  289
              NS T    I+TS         S+S YA S  NISRLLEGWMR+
Sbjct  124  GCNSETRNSDISTSHSPLLKSYHSTSSYAWSTGNISRLLEGWMRS  168



>ref|XP_009765566.1| PREDICTED: myb-related protein 306-like [Nicotiana sylvestris]
Length=323

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 65/115 (57%), Gaps = 20/115 (17%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSEN----SPTSATSYHH-  166
            AAIASYLP+RTDNDIKNYWNTHLKKK+K L+   S ++     EN    S T++TS    
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKMKNLEEKCSGDDDLFSVENGHNLSSTNSTSRGQW  149

Query  167  ---------------HHHLVSKNSFTDRPQIatsssslyassaenisRLLEGWMR  286
                           H  L  +NS     Q   +  S YASS ENI+RLL+GWMR
Sbjct  150  ERTLQADINMAKKALHSALSLENSTPYIKQETPAPVSTYASSTENIARLLQGWMR  204



>ref|XP_006417645.1| hypothetical protein EUTSA_v10008426mg [Eutrema salsugineum]
 gb|ESQ35998.1| hypothetical protein EUTSA_v10008426mg [Eutrema salsugineum]
Length=279

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 62/98 (63%), Gaps = 25/98 (26%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSP--TSATSYHHHHH  175
            A+IASYLPQRTDNDIKNYWNTHLKKKL K     SE+  +  SEN+   TSAT       
Sbjct  90   ASIASYLPQRTDNDIKNYWNTHLKKKLNK-----SESEERTISENNSLQTSAT-------  137

Query  176  LVSKNSFTDRPQIatsssslyassaenisRLLEGWMRA  289
               +N+   R        S YASS ENISRLLEGWM+A
Sbjct  138  ---RNTINHR--------STYASSTENISRLLEGWMKA  164



>ref|NP_001063167.1| Os09g0414300 [Oryza sativa Japonica Group]
 dbj|BAF25081.1| Os09g0414300 [Oryza sativa Japonica Group]
Length=321

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPG  103
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+Q+ G
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKMQAAG  123



>gb|KHN30839.1| Myb-related protein 306 [Glycine soja]
Length=333

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPG  103
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK+Q  G
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKMQIGG  123



>ref|XP_003527079.1| PREDICTED: myb-related protein 306-like [Glycine max]
Length=333

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPG  103
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK+Q  G
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKMQIGG  123



>gb|KHN13621.1| Myb-related protein 306 [Glycine soja]
Length=312

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
           AAIASYLPQRTDNDIKNYWNTHL+KKLKK+Q
Sbjct  68  AAIASYLPQRTDNDIKNYWNTHLRKKLKKMQ  98



>ref|XP_008239949.1| PREDICTED: myb-related protein 306-like [Prunus mume]
Length=363

 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLPQRTDNDIKNYWNTHLKKKL+KLQ+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLRKLQT  121



>ref|XP_009785597.1| PREDICTED: myb-related protein 306-like [Nicotiana sylvestris]
Length=339

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLPQRTDNDIKNYWNTHL+KKLKKLQ
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLRKKLKKLQ  120



>gb|AAL84627.1|AF474137_1 typical P-type R2R3 Myb protein [Oryza sativa Japonica Group]
Length=204

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+Q+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKMQA  121



>ref|XP_007209276.1| hypothetical protein PRUPE_ppa007562mg [Prunus persica]
 gb|EMJ10475.1| hypothetical protein PRUPE_ppa007562mg [Prunus persica]
Length=363

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLPQRTDNDIKNYWNTHLKKKL+KLQ+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLRKLQT  121



>ref|XP_003534453.1| PREDICTED: myb-related protein 306 [Glycine max]
Length=332

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLPQRTDNDIKNYWNTHL+KKLKK+Q+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLRKKLKKMQA  121



>ref|XP_009395129.1| PREDICTED: myb-related protein 306-like [Musa acuminata subsp. 
malaccensis]
Length=295

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 61/117 (52%), Gaps = 22/117 (19%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSP-------------  142
            AAIASYLP+RTDNDIKNYWNTHLKKKL+++Q  G    +  G    P             
Sbjct  89   AAIASYLPERTDNDIKNYWNTHLKKKLRRIQGSGDGATSNGGLSRCPPVSKDQWERRVQA  148

Query  143  ---------TSATSYHHHHHLVSKNSFTDRPQIatsssslyassaenisRLLEGWMR  286
                     T A S      L  +N  +    +    ++ YASS ENISRLL+GWM+
Sbjct  149  DIRMAKQALTEALSLQKPSCLGDRNPQSSGFSLTAPITTTYASSTENISRLLQGWMK  205



>gb|KHN11601.1| Myb-related protein 306 [Glycine soja]
Length=332

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLPQRTDNDIKNYWNTHL+KKLKK+Q+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLRKKLKKMQA  121



>ref|XP_004157466.1| PREDICTED: myb-related protein 306-like [Cucumis sativus]
Length=214

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLPQRTDNDIKNYWNTHLKKKL+K+Q
Sbjct  91   AAIASYLPQRTDNDIKNYWNTHLKKKLRKMQ  121



>ref|XP_010931465.1| PREDICTED: myb-related protein 306-like isoform X1 [Elaeis guineensis]
Length=337

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 64/105 (61%), Gaps = 16/105 (15%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKK+KK       N   M S  +P+++T   +     
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKIKK-------NPTTMDSHKTPSNSTITCNELISN  142

Query  182  SKNSFTDRPQIats---------ssslyassaenisRLLEGWMRA  289
              NS T    I+TS         S+S YA S  NISRLLEGWMR+
Sbjct  143  GCNSETRNSDISTSHSPLLKSYHSTSSYAWSTGNISRLLEGWMRS  187



>ref|XP_010532312.1| PREDICTED: myb-related protein 306-like [Tarenaya hassleriana]
Length=289

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSE  109
            AAIASYLPQRTDND+KN+WNTHLKKKL+KLQS   E
Sbjct  90   AAIASYLPQRTDNDVKNFWNTHLKKKLQKLQSDTEE  125



>ref|XP_003577454.1| PREDICTED: myb-related protein 306-like [Brachypodium distachyon]
Length=280

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLPQRTDNDIKNYWNTHLKKK+K+LQ
Sbjct  92   AAIASYLPQRTDNDIKNYWNTHLKKKVKRLQ  122



>gb|ACW84412.1| transcription factor MYB392 [Glycine max]
Length=334

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLPQRTDNDIKNYWNTHL+KKLKK+Q
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLRKKLKKMQ  120



>ref|NP_001240154.1| MYB transcription factor MYB60 [Glycine max]
 gb|ACU18135.1| unknown [Glycine max]
Length=334

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLPQRTDNDIKNYWNTHL+KKLKK+Q
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLRKKLKKMQ  120



>ref|XP_007214856.1| hypothetical protein PRUPE_ppa008366mg [Prunus persica]
 gb|EMJ16055.1| hypothetical protein PRUPE_ppa008366mg [Prunus persica]
Length=335

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENS  139
            AAIASYLPQRTDNDIKNYWNTHLKKKL KLQ+    ++   GS  S
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNKLQAGTEGHSKDQGSSTS  135



>ref|XP_008230764.1| PREDICTED: myb-related protein 306 [Prunus mume]
Length=335

 Score = 67.4 bits (163),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENS  139
            AAIASYLPQRTDNDIKNYWNTHLKKKL KLQ+    ++   GS  S
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNKLQAGTEGHSKDQGSSTS  135



>gb|AEV91154.1| R2R3-MYB protein [Aegilops tauschii]
Length=318

 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPG  103
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+Q  G
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKMQDAG  123



>ref|XP_008365400.1| PREDICTED: myb-related protein 306-like [Malus domestica]
Length=342

 Score = 67.4 bits (163),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPG  103
            AAIASYLPQRTDNDIKNYWNTHL+KKL KLQ+ G
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLRKKLSKLQAAG  123



>ref|NP_001280966.1| myb-related protein 306 [Malus domestica]
 gb|ADL36761.1| MYB domain class transcription factor [Malus domestica]
Length=342

 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPG  103
            AAIASYLPQRTDNDIKNYWNTHL+KKL KLQ+ G
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLRKKLSKLQAAG  123



>ref|XP_011008114.1| PREDICTED: myb-related protein 306-like [Populus euphratica]
Length=322

 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMG  127
            AAIASYLPQRTDNDIKN+WNTHLKKKL+KLQ+ G E  ++ G
Sbjct  90   AAIASYLPQRTDNDIKNFWNTHLKKKLRKLQA-GQEGQSRDG  130



>ref|XP_002323853.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEF03986.1| myb family transcription factor family protein [Populus trichocarpa]
Length=322

 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMG  127
            AAIASYLPQRTDNDIKN+WNTHLKKKL+KLQ+ G E  ++ G
Sbjct  90   AAIASYLPQRTDNDIKNFWNTHLKKKLRKLQA-GQEGQSRDG  130



>ref|XP_011071639.1| PREDICTED: myb-related protein 306-like [Sesamum indicum]
Length=325

 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 2/43 (5%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGS  130
            AAIASYLPQRTDNDIKNYWNTHLKKKL KLQ  G +   Q GS
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLAKLQ--GHDEKGQNGS  130



>ref|XP_008455771.1| PREDICTED: myb-related protein 306 [Cucumis melo]
 ref|XP_008455772.1| PREDICTED: myb-related protein 306 [Cucumis melo]
Length=350

 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 96/247 (39%), Positives = 116/247 (47%), Gaps = 55/247 (22%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENN----AQMGSENSPTS-ATSYHH  166
            AAIASYLPQRTDNDIKNYWNTHLKKKLK   S   +NN        S +SPTS   S   
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLK---SAFEDNNHSPYTSKSSNHSPTSDFFSKGF  146

Query  167  HHHLVSKNSFT---------------DRPQIatsssslyassaenisRLLEGWMRAssss  301
              +  SK +F                +R   A+SSSS Y SSAENISRLLEGWMR+S   
Sbjct  147  FSNDSSKRTFDFDSASSSSAASCFGPNRSSTASSSSSTYYSSAENISRLLEGWMRSSPKR  206

Query  302  sssKGLTTATSH------GGGReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLD  463
            +          H       G       +  + + E  AG  LA   +  + ++   E L+
Sbjct  207  NDDNENILIHFHEKQNHDNGDSSMVSIQGLEPKTEEDAGDRLALGKEIESSMVVSPENLN  266

Query  464  -------------SILTFGSLM----NGMESGNN----KQNVQE-----GNDNDNPPPLS  565
                         S    G +M    N  E+  N    KQN  E      N+N+N PPLS
Sbjct  267  NDDHNVGGCWEKSSNFDVGKMMKIKKNSFENCENDNIIKQNRSENNINNNNNNNNNPPLS  326

Query  566  FLEKWLL  586
            FLEKWLL
Sbjct  327  FLEKWLL  333



>ref|XP_008341573.1| PREDICTED: myb-related protein 306-like [Malus domestica]
Length=342

 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPG  103
            AAIASYLPQRTDNDIKNYWNTHL+KKL KLQ+ G
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLRKKLIKLQAAG  123



>gb|EEE69698.1| hypothetical protein OsJ_29353 [Oryza sativa Japonica Group]
Length=320

 Score = 66.6 bits (161),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPG  103
            AAIASYLP RTDNDIKNYWNTHLKKKLKK+Q+ G
Sbjct  90   AAIASYLPDRTDNDIKNYWNTHLKKKLKKMQAAG  123



>ref|XP_004148709.1| PREDICTED: myb-related protein 306-like [Cucumis sativus]
 ref|XP_004173580.1| PREDICTED: myb-related protein 306-like [Cucumis sativus]
Length=293

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLPQRTDNDIKNYWNTHLKKKL+K+Q
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLRKVQ  120



>ref|XP_002460209.1| hypothetical protein SORBIDRAFT_02g024640 [Sorghum bicolor]
 gb|EER96730.1| hypothetical protein SORBIDRAFT_02g024640 [Sorghum bicolor]
Length=306

 Score = 66.6 bits (161),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+Q+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKMQA  121



>ref|XP_007139579.1| hypothetical protein PHAVU_008G041500g [Phaseolus vulgaris]
 gb|ESW11573.1| hypothetical protein PHAVU_008G041500g [Phaseolus vulgaris]
Length=324

 Score = 66.6 bits (161),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSE  109
            AAIASYLPQRTDNDIKNYWNTHL+KK+KKL   G+E
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLRKKVKKLFQTGNE  125



>ref|XP_009341011.1| PREDICTED: myb-related protein 306-like [Pyrus x bretschneideri]
Length=343

 Score = 66.6 bits (161),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPG  103
            AAIASYLPQRTDNDIKNYWNTHL+KKL KLQ+ G
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLRKKLIKLQAAG  123



>ref|XP_003621186.1| MYB family transcription factor-like protein [Medicago truncatula]
 gb|KEH21615.1| R2R3-myb transcription factor [Medicago truncatula]
Length=271

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK Q+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKSQT  121



>gb|EYU24375.1| hypothetical protein MIMGU_mgv1a009382mg [Erythranthe guttata]
Length=344

 Score = 66.6 bits (161),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSAT  154
            AAIASYLP+RTDNDIKNYWNTHLKKKL K+    SEN +   SE  P + +
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLSKINRQNSENGS--SSETEPKTVS  138



>gb|EMT12411.1| Myb-related protein 306 [Aegilops tauschii]
Length=358

 Score = 66.6 bits (161),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLPQRTDNDIKNYWNTHLKKK+K+LQ
Sbjct  168  AAIASYLPQRTDNDIKNYWNTHLKKKVKRLQ  198



>gb|AEL12216.1| putative MYB domain protein 94 [Beta vulgaris]
Length=268

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLPQRTDNDIKNYWNTHLKKKL+K QS
Sbjct  88   AAIASYLPQRTDNDIKNYWNTHLKKKLRKSQS  119



>gb|ABD32205.1| Homeodomain-related [Medicago truncatula]
 gb|ABN08925.1| Homeodomain-related [Medicago truncatula]
 gb|AES77404.2| R2R3-myb transcription factor [Medicago truncatula]
Length=325

 Score = 66.6 bits (161),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK Q+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKSQT  121



>ref|XP_008459311.1| PREDICTED: myb-related protein 306-like [Cucumis melo]
Length=315

 Score = 66.2 bits (160),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLPQRTDNDIKNYWNTHLKKKL+K+Q
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLRKVQ  120



>ref|XP_006660623.1| PREDICTED: myb-related protein 306-like, partial [Oryza brachyantha]
Length=158

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLP+RTDNDIKNYWNTHLKKKLK++Q
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKRMQ  120



>ref|XP_004137409.1| PREDICTED: myb-related protein 306-like [Cucumis sativus]
Length=326

 Score = 66.2 bits (160),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLPQRTDNDIKNYWNTHLKKKL+K+Q
Sbjct  91   AAIASYLPQRTDNDIKNYWNTHLKKKLRKMQ  121



>ref|XP_010546059.1| PREDICTED: myb-related protein 306-like [Tarenaya hassleriana]
Length=356

 Score = 66.6 bits (161),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSE  109
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK+   G +
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKMSGSGDD  125



>gb|AGN52053.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52163.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=295

 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 2/42 (5%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMG  127
            AAIASYLPQRTDNDIKNYWNTHLKKKL K+Q  G E N   G
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLGKIQ--GQEENGGKG  129



>ref|XP_003624757.1| MYB transcription factor [Medicago truncatula]
 ref|XP_003624777.1| MYB transcription factor [Medicago truncatula]
 gb|AES80975.1| myb transcription factor [Medicago truncatula]
Length=338

 Score = 66.6 bits (161),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 62/99 (63%), Gaps = 7/99 (7%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS---PGSENNAQMGSENSPTSATSYHHHH  172
            AAIASYLPQRTDNDIKNYWNTHLKKKL K  +   P +   A +    S  S    ++H 
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNKFHAALDPSNSTTAYLSKSFSDRSLDVSNNHT  149

Query  173  HLVSKNSFTDRPQIatsssslyassaenisRLLEGWMRA  289
              +  N+         SSSS YASS ENISRLLEGWMR+
Sbjct  150  SSLKINTQNSH----QSSSSTYASSTENISRLLEGWMRS  184



>gb|KFK43192.1| hypothetical protein AALP_AA1G091800 [Arabis alpina]
Length=277

 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 90/201 (45%), Gaps = 42/201 (21%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            A+IASYLPQRTDNDIKNYWNTHLKKKL K +S     +     + S T  T  H   +  
Sbjct  90   ASIASYLPQRTDNDIKNYWNTHLKKKLNKSESEEKSKSENTTLQTSVTRNTINHRSTYAS  149

Query  182  SKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssss-----ssKGLTTATSHGGG  346
            S  + +                     RLLEGWMRAS  SS       K    A++    
Sbjct  150  STENIS---------------------RLLEGWMRASPKSSIGSFFEQKKQNPASNLIDV  188

Query  347  ReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESGN-NKQN  523
            + +   E  Q   E      + G +D   GV PK                +E+ N +   
Sbjct  189  QNQFPYEQLQGSWEEGQSKIVNGDDDQGFGVGPKI---------------LENNNGDHHE  233

Query  524  VQEGNDNDNPPPLSFLEKWLL  586
              + +D+ + PPL+F+EKWLL
Sbjct  234  DGDDDDDHDHPPLTFIEKWLL  254



>ref|XP_007151227.1| hypothetical protein PHAVU_004G028500g [Phaseolus vulgaris]
 gb|ESW23221.1| hypothetical protein PHAVU_004G028500g [Phaseolus vulgaris]
Length=317

 Score = 66.2 bits (160),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSE  109
            AAIA+YLPQRTDNDIKN+WNT+LKKKL KL++ GSE
Sbjct  89   AAIAAYLPQRTDNDIKNFWNTYLKKKLNKLEASGSE  124



>ref|XP_008442096.1| PREDICTED: myb-related protein 306-like [Cucumis melo]
Length=328

 Score = 66.2 bits (160),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLPQRTDNDIKNYWNTHLKKKL+K+Q
Sbjct  91   AAIASYLPQRTDNDIKNYWNTHLKKKLRKMQ  121



>ref|XP_002441752.1| hypothetical protein SORBIDRAFT_08g001800 [Sorghum bicolor]
 gb|EES15590.1| hypothetical protein SORBIDRAFT_08g001800 [Sorghum bicolor]
Length=315

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGS  106
            AAIASYLPQRTDNDIKNYWNTHLKKKL+K Q+ G+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLQKQQAIGA  124



>ref|XP_010939500.1| PREDICTED: myb-related protein 306 [Elaeis guineensis]
Length=300

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLP+RTDNDIKNYWNTH+KKK+KKLQ+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHMKKKIKKLQA  121



>ref|XP_004232220.1| PREDICTED: myb-related protein 306-like [Solanum lycopersicum]
Length=292

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLP+RTDNDIKNYWNTHLKKKL+KL++
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLRKLET  121



>ref|XP_011098622.1| PREDICTED: myb-related protein 306-like [Sesamum indicum]
Length=331

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 6/70 (9%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLP+RTDNDIKNYWNTHL KKLKKLQ+  S ++ + G+++  +S +      H +
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLMKKLKKLQNGSSGSDHKSGNDHGFSSTS------HSI  143

Query  182  SKNSFTDRPQ  211
            S+  +  R Q
Sbjct  144  SRGQWERRLQ  153



>gb|KHG13336.1| Myb-related protein [Gossypium arboreum]
Length=335

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLPQRTDNDIKNYWNTHLKKKL K QS
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNKFQS  121



>ref|XP_010693237.1| PREDICTED: myb-related protein 306-like [Beta vulgaris subsp. 
vulgaris]
Length=344

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLPQRTDNDIKNYWNTHLKKKL+K QS
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLRKSQS  121



>gb|EEC84571.1| hypothetical protein OsI_31358 [Oryza sativa Indica Group]
Length=320

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+Q
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKMQ  120



>ref|XP_004956812.1| PREDICTED: myb-related protein 306-like [Setaria italica]
Length=322

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+Q
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKMQ  120



>ref|XP_008670193.1| PREDICTED: myb-related protein 306 [Zea mays]
 tpg|DAA40079.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=326

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+Q
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKMQ  120



>ref|XP_004304297.1| PREDICTED: myb-related protein 306-like [Fragaria vesca subsp. 
vesca]
Length=360

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSAT  154
            AAIASYLPQRTDNDIKNYWNTHLKKKL KL   G  +  +  + N    AT
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNKLTQIGGHSRDEGFTSNCSQQAT  140



>ref|XP_010036271.1| PREDICTED: myb-related protein 306 [Eucalyptus grandis]
 gb|KCW47805.1| hypothetical protein EUGRSUZ_K01545 [Eucalyptus grandis]
Length=353

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 93/291 (32%), Positives = 129/291 (44%), Gaps = 97/291 (33%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQ---MGSENSPTSATSYHHHH  172
            AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSP S +      M S ++ T + S    H
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPSSSSAMDPHNMASSDTTTPSRSIDESH  149

Query  173  HLVSKNSFTDRPQIat-----------sssslyassaenisRLLEGWMRAsssssssKGL  319
            H    +S  D    ++           S +S YASS ENISRLLEGWMR+          
Sbjct  150  HQRRASSCLDLIATSSPSSSSSTLNKLSHTSTYASSTENISRLLEGWMRS----------  199

Query  320  TTATSHGGGReeeeeeDDQNRPEAAAGGGLAGSNDDNN-------GVIPKEEY-------  457
             +  ++G          + +RP+   G G AG  ++            PK E+       
Sbjct  200  -SPKTNGNT--------ENDRPKFLDGKGFAGHENNGGGGGGGGICYRPKAEHQEPGDPL  250

Query  458  -----LDSILTFGSLMNGM------ESGNN------------------------------  514
                  +SIL+F ++ N         +GN+                              
Sbjct  251  ISHDEFESILSFENMNNKCNVSWDKSNGNSTHHPHHHKGDCSDDRPSDANEDEKVHGMMM  310

Query  515  -KQNVQEGNDNDNPPPLSFLEKWLLdesaaqveeeedgedqvavMELPTIF  664
             ++N  +   +++ PPL+FLEKWLL        +E        +M+LP++F
Sbjct  311  LERNYNKAKPSEHAPPLTFLEKWLL--------DETASGQVEDMMDLPSMF  353



>ref|XP_009376268.1| PREDICTED: myb-related protein 306 [Pyrus x bretschneideri]
Length=341

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPG  103
            AAIASYLPQRTDNDIKNYWNTHL+KKL K Q+ G
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLRKKLSKFQAEG  123



>ref|XP_006660161.1| PREDICTED: myb-related protein 306-like [Oryza brachyantha]
Length=192

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKM  119



>gb|AGN52085.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52195.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=302

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSEN  112
            AAIASYLPQRTDNDIKNYWNTHL+KKL K+Q   SE+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLRKKLGKIQGHNSES  126



>gb|KGN54653.1| hypothetical protein Csa_4G416980 [Cucumis sativus]
Length=267

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 40/55 (73%), Gaps = 9/55 (16%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHH  166
            AAIASYLPQRTDNDIKNYWNTHLKKKLK   S   +NN      NSP ++ S +H
Sbjct  4    AAIASYLPQRTDNDIKNYWNTHLKKKLK---SAFEDNN------NSPHTSKSSNH  49



>gb|KGN64000.1| hypothetical protein Csa_1G033200 [Cucumis sativus]
Length=279

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AIASYLPQRTDNDIKNYWNTHLKKKL+K+Q
Sbjct  44  TAIASYLPQRTDNDIKNYWNTHLKKKLRKMQ  74



>ref|XP_009385639.1| PREDICTED: myb-related protein 306-like [Musa acuminata subsp. 
malaccensis]
Length=260

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPG  103
            AAIASYLPQRTDNDIKN+WNTHLKKKL+K+++ G
Sbjct  90   AAIASYLPQRTDNDIKNHWNTHLKKKLRKVEADG  123



>ref|XP_003577718.1| PREDICTED: myb-related protein 306-like [Brachypodium distachyon]
Length=258

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGS  106
            AAIASYLP RTDNDIKNYWNTHL+K+LKKL++ G+
Sbjct  90   AAIASYLPNRTDNDIKNYWNTHLRKRLKKLEAMGA  124



>ref|XP_009618496.1| PREDICTED: myb-related protein 306-like [Nicotiana tomentosiformis]
Length=305

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK ++
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKFEA  121



>ref|NP_001267946.1| R2R3 Myb30 transcription factor [Vitis vinifera]
 gb|ABK59040.1| R2R3 Myb30 transcription factor [Vitis vinifera]
Length=307

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK 
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKF  119



>ref|XP_010937134.1| PREDICTED: myb-related protein 306-like [Elaeis guineensis]
Length=327

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            +AIASYLP+RTDNDIKNYWNTHL+KKLKKLQ+
Sbjct  90   SAIASYLPERTDNDIKNYWNTHLRKKLKKLQA  121



>emb|CDY30719.1| BnaA02g33410D [Brassica napus]
Length=268

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKI  119



>emb|CDY00289.1| BnaA06g21900D [Brassica napus]
Length=277

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKI  119



>ref|NP_001068096.1| Os11g0558200 [Oryza sativa Japonica Group]
 gb|ABA94293.1| Myb-like DNA-binding domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28459.1| Os11g0558200 [Oryza sativa Japonica Group]
 gb|EAY81310.1| hypothetical protein OsI_36486 [Oryza sativa Indica Group]
 gb|EAZ18740.1| hypothetical protein OsJ_34262 [Oryza sativa Japonica Group]
 dbj|BAG99055.1| unnamed protein product [Oryza sativa Japonica Group]
Length=330

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLPQRTDNDIKNYWNTHLKKK+K+L
Sbjct  91   AAIASYLPQRTDNDIKNYWNTHLKKKVKRL  120



>emb|CDY16773.1| BnaA09g06090D [Brassica napus]
Length=295

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKI  119



>gb|EAZ07112.1| hypothetical protein OsI_29359 [Oryza sativa Indica Group]
Length=309

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+ +
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKMSA  121



>ref|NP_001175597.1| Os08g0437200 [Oryza sativa Japonica Group]
 dbj|BAD10148.1| putative typical P-type R2R3 Myb protein [Oryza sativa Japonica 
Group]
 dbj|BAH94325.1| Os08g0437200 [Oryza sativa Japonica Group]
Length=310

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+ +
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKMSA  121



>ref|XP_009410391.1| PREDICTED: myb-related protein 306-like [Musa acuminata subsp. 
malaccensis]
Length=301

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLP+RTDNDIKN+WNTHLKKKL+K+Q
Sbjct  90   AAIASYLPERTDNDIKNFWNTHLKKKLRKIQ  120



>gb|KHG11637.1| Myb-related protein [Gossypium arboreum]
Length=290

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLPQRTDNDIKNYWNTHLKKKLKK Q
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKGQ  120



>ref|XP_009410003.1| PREDICTED: myb-related protein 306-like [Musa acuminata subsp. 
malaccensis]
Length=319

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLP+RTDNDIKN+WNTHLKKKLKK+Q
Sbjct  90   AAIASYLPERTDNDIKNFWNTHLKKKLKKMQ  120



>gb|ABH02904.1| MYB transcription factor MYB53 [Glycine max]
Length=162

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMG-SENSPTSATSYHHH  169
            AAIA+YLPQRTDNDIKNYWNT+LKKKL KL++ GS+    +G S + P S   +   
Sbjct  90   AAIAAYLPQRTDNDIKNYWNTYLKKKLNKLEA-GSDQGHNIGVSVSQPMSRGQWERR  145



>ref|XP_009390302.1| PREDICTED: myb-related protein 306-like [Musa acuminata subsp. 
malaccensis]
Length=289

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSEN  112
            AAIASYLP+RTDNDIKNYWNT+LKKKL+KL+  G+++
Sbjct  90   AAIASYLPERTDNDIKNYWNTYLKKKLRKLEIGGTDS  126



>ref|XP_009419868.1| PREDICTED: myb-related protein 306-like [Musa acuminata subsp. 
malaccensis]
Length=318

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSP  142
            A+IASYLPQRTDNDIKNYWNTHLKKK+ K+Q     +  +  S+  P
Sbjct  90   ASIASYLPQRTDNDIKNYWNTHLKKKINKIQGAADADGKKPSSDARP  136



>emb|CDP12307.1| unnamed protein product [Coffea canephora]
Length=296

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 106/219 (48%), Gaps = 62/219 (28%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ    +++ Q G      S+TS+     ++
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQG-HDDHSCQDGH-----SSTSHESISKVL  143

Query  182  SKN-SFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGReee  358
            + N SFT+ P       S YASS ENI+RLL+ WM+      S K L   +         
Sbjct  144  TLNPSFTNPP----LKPSGYASSTENIARLLQNWMK-----KSPKSLAVVS---------  185

Query  359  eeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQNVQE--  532
                     E      L+  +D+N         LDS+L+F S  N   S     +V+E  
Sbjct  186  ---------ETCTAQSLSCYSDNN-----PSGGLDSLLSFNSTTNSDVSQGQSVSVEEVA  231

Query  533  ------------GNDNDNP---------PPLSFLEKWLL  586
                         +D + P         PPLSFLEKWLL
Sbjct  232  NFRPENTVGGLFQDDENKPNLVVGSHQMPPLSFLEKWLL  270



>ref|XP_006662979.1| PREDICTED: myb-related protein 306-like [Oryza brachyantha]
Length=310

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLPQRTDNDIKNYWNTHLKKK+K+L
Sbjct  92   AAIASYLPQRTDNDIKNYWNTHLKKKVKRL  121



>ref|XP_003549675.2| PREDICTED: myb-related protein 306-like isoform X1 [Glycine max]
Length=325

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSE  109
            AAIASYLPQRTDNDIKNYWNTHLKKKLK+    GS+
Sbjct  93   AAIASYLPQRTDNDIKNYWNTHLKKKLKQSDQSGSD  128



>ref|XP_008652703.1| PREDICTED: myb-related protein 306-like [Zea mays]
 tpg|DAA61435.1| TPA: putative MYB DNA-binding domain superfamily protein isoform 
1 [Zea mays]
 tpg|DAA61436.1| TPA: putative MYB DNA-binding domain superfamily protein isoform 
2 [Zea mays]
Length=302

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLP+RTDNDIKNYWNTHLKKKLK +Q
Sbjct  90   AAIASYLPKRTDNDIKNYWNTHLKKKLKNMQ  120



>ref|XP_009419866.1| PREDICTED: myb-related protein 306-like [Musa acuminata subsp. 
malaccensis]
Length=319

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 62/98 (63%), Gaps = 3/98 (3%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHLV  181
            A+IAS+LP+RTDNDIKNYWNTHLKKK+ K+Q     +  +  S+  P         + ++
Sbjct  90   ASIASHLPRRTDNDIKNYWNTHLKKKINKIQGAADADGKKPSSDARPVCHDYVSQSYDMM  149

Query  182  S--KNSFTDRPQIatsssslyassaenisRLLEGWMRA  289
               K   TD   +    +S YASS+ENISRLL+GWM++
Sbjct  150  ESRKQDLTDALPM-YHQNSRYASSSENISRLLQGWMQS  186



>dbj|BAJ61426.1| R2R3-MYB transcription factor [Lupinus albus]
Length=275

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQ  121
            AAIASYLPQRTDNDIKNYWNTHL+K   KLQ+ G+++N +
Sbjct  33   AAIASYLPQRTDNDIKNYWNTHLRKNHNKLQNGGNDHNQE  72



>emb|CDX85848.1| BnaC06g22860D [Brassica napus]
Length=324

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENN  115
            AAIASYLPQRTDNDIKNYWNTHLKKKL   Q    +NN
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNLQQMSSCDNN  127



>ref|XP_010426206.1| PREDICTED: myb-related protein 306-like [Camelina sativa]
Length=332

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKM  119



>ref|XP_006404360.1| hypothetical protein EUTSA_v10010525mg [Eutrema salsugineum]
 dbj|BAJ34602.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45813.1| hypothetical protein EUTSA_v10010525mg [Eutrema salsugineum]
Length=335

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKM  119



>ref|XP_002877569.1| hypothetical protein ARALYDRAFT_905992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53828.1| hypothetical protein ARALYDRAFT_905992 [Arabidopsis lyrata subsp. 
lyrata]
Length=332

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKM  119



>ref|XP_006291477.1| hypothetical protein CARUB_v10017612mg [Capsella rubella]
 gb|EOA24375.1| hypothetical protein CARUB_v10017612mg [Capsella rubella]
Length=331

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKM  119



>ref|XP_010503364.1| PREDICTED: myb-related protein 306-like [Camelina sativa]
Length=334

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKM  119



>ref|XP_003576343.1| PREDICTED: myb-related protein 306-like [Brachypodium distachyon]
Length=263

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGS  106
            AAIA+YLP+RTDNDIKNYWNTHLKK+L+K Q+ G+
Sbjct  90   AAIATYLPKRTDNDIKNYWNTHLKKRLQKQQAVGA  124



>gb|ACU20420.1| unknown [Glycine max]
Length=213

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMG-SENSPTS  148
            AAIA+YLPQRTDNDIKNYWNT+LKKKL KL++ GS+    +G S + P S
Sbjct  90   AAIAAYLPQRTDNDIKNYWNTYLKKKLNKLEA-GSDQGHNIGVSVSQPMS  138



>ref|NP_190344.1| putative transcription factor MYB94 [Arabidopsis thaliana]
 emb|CAB61986.1| putative transcription factor MYB94 [Arabidopsis thaliana]
 gb|AAO22626.1| putative transcription factor MYB94 [Arabidopsis thaliana]
 gb|AAO42355.1| putative transcription factor MYB94 [Arabidopsis thaliana]
 gb|AAS10065.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE78306.1| putative transcription factor MYB94 [Arabidopsis thaliana]
Length=333

 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKM  119



>gb|AAC83640.1| putative transcription factor [Arabidopsis thaliana]
Length=335

 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKM  119



>gb|KFK34064.1| hypothetical protein AALP_AA5G097400 [Arabis alpina]
Length=330

 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLP+RTDNDIKNYWNTHLKKKLKK+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKLKKM  119



>ref|XP_010528337.1| PREDICTED: myb-related protein 306 [Tarenaya hassleriana]
Length=316

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 1/34 (3%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL-QSP  100
            AAIASYLPQRTDNDIKNYWNTHLKKKL K+ Q+P
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNKIRQTP  123



>gb|KFK33762.1| hypothetical protein AALP_AA5G057000 [Arabis alpina]
Length=335

 Score = 63.5 bits (153),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLPQRTDNDIKNYWNTHLKKKL KL
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNKL  119



>ref|XP_003574549.1| PREDICTED: myb-related protein 306-like [Brachypodium distachyon]
Length=303

 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLP+RTDNDIKNYWNTHLK+KLKK+
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKRKLKKM  119



>ref|NP_001234294.1| transcription factor [Solanum lycopersicum]
 emb|CAA67575.1| transcription factor [Solanum lycopersicum]
Length=347

 Score = 63.5 bits (153),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 1/36 (3%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL-QSPGS  106
            AAIASYLP+RTDNDIKNYWNTHLKKK+K+L Q  GS
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKMKRLDQCHGS  125



>ref|XP_010315878.1| PREDICTED: transcription factor isoform X1 [Solanum lycopersicum]
Length=335

 Score = 63.5 bits (153),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 1/36 (3%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL-QSPGS  106
            AAIASYLP+RTDNDIKNYWNTHLKKK+K+L Q  GS
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKMKRLDQCHGS  125



>ref|XP_003524812.1| PREDICTED: myb-related protein 306-like [Glycine max]
 gb|KHN48687.1| Myb-related protein 306 [Glycine soja]
Length=319

 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKK  88
            AAIASYLPQRTDNDIKNYWNTHLKKKLK+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKQ  118



>ref|XP_007155313.1| hypothetical protein PHAVU_003G190400g [Phaseolus vulgaris]
 gb|ESW27307.1| hypothetical protein PHAVU_003G190400g [Phaseolus vulgaris]
Length=310

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQ  121
            AAIASYLP+RTDNDIKNYWNTHLKKKLK     G+E   +
Sbjct  93   AAIASYLPERTDNDIKNYWNTHLKKKLKLSDQSGNEEGVE  132



>ref|XP_002514763.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF47869.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=332

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ  94
            AAIASYLPQRTDNDIKNYWNTHLKKKL +L+
Sbjct  92   AAIASYLPQRTDNDIKNYWNTHLKKKLTELK  122



>ref|NP_189533.1| myb domain protein 30 [Arabidopsis thaliana]
 gb|AAG10145.1|AF250339_1 Myb30 [Arabidopsis thaliana]
 emb|CAA07433.1| myb-like protein [Arabidopsis thaliana]
 dbj|BAB02134.1| MYB family transcription factor-like protein [Arabidopsis thaliana]
 gb|AAL91167.1| MYB family transcription factor, putative [Arabidopsis thaliana]
 gb|AAM47879.1| MYB family transcription factor [Arabidopsis thaliana]
 gb|AAS10062.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE77505.1| myb domain protein 30 [Arabidopsis thaliana]
Length=323

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLPQRTDNDIKNYWNTHLKKKL K+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNKV  119



>gb|KEH15858.1| R2R3-myb transcription factor [Medicago truncatula]
 gb|KEH16584.1| R2R3-myb transcription factor [Medicago truncatula]
Length=334

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSE  109
            AAIASYLPQRTDNDIKNYWNTHLK+K+ K QS   E
Sbjct  91   AAIASYLPQRTDNDIKNYWNTHLKRKMNKDQSSTDE  126



>ref|XP_002875478.1| hypothetical protein ARALYDRAFT_484660 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51737.1| hypothetical protein ARALYDRAFT_484660 [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLPQRTDNDIKNYWNTHLKKKL K+
Sbjct  91   AAIASYLPQRTDNDIKNYWNTHLKKKLNKV  120



>gb|AAM64792.1| MYB family transcription factor (hsr1), putative [Arabidopsis 
thaliana]
Length=323

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLPQRTDNDIKNYWNTHLKKKL K+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNKV  119



>ref|XP_010502890.1| PREDICTED: myb-related protein 306-like [Camelina sativa]
 ref|XP_010502891.1| PREDICTED: myb-related protein 306-like [Camelina sativa]
Length=323

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLPQRTDNDIKNYWNTHLKKKL K+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNKV  119



>ref|XP_003609059.1| MYB transcription factor [Medicago truncatula]
 ref|XP_003629808.1| MYB transcription factor [Medicago truncatula]
Length=333

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSE  109
            AAIASYLPQRTDNDIKNYWNTHLK+K+ K QS   E
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKRKMNKDQSSTDE  125



>ref|XP_010514606.1| PREDICTED: myb-related protein 306-like [Camelina sativa]
Length=323

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLPQRTDNDIKNYWNTHLKKKL K+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNKV  119



>gb|AAC83595.1| putative transcription factor [Arabidopsis thaliana]
Length=323

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLPQRTDNDIKNYWNTHLKKKL K+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNKV  119



>gb|AFK37503.1| unknown [Lotus japonicus]
Length=312

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIA+YLPQRTDNDIKNYWNT+LKK+L KLQ+
Sbjct  90   AAIAAYLPQRTDNDIKNYWNTYLKKRLNKLQT  121



>ref|XP_010425680.1| PREDICTED: myb-related protein 306-like [Camelina sativa]
Length=323

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLPQRTDNDIKNYWNTHLKKKL K+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNKV  119



>ref|XP_006291492.1| hypothetical protein CARUB_v10017640mg [Capsella rubella]
 gb|EOA24390.1| hypothetical protein CARUB_v10017640mg [Capsella rubella]
Length=325

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKL  91
            AAIASYLPQRTDNDIKNYWNTHLKKKL K+
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNKV  119



>gb|EYU35835.1| hypothetical protein MIMGU_mgv1a012184mg [Erythranthe guttata]
Length=259

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   AAIASYLPQRTDNDIKNYWNTHLKKKLKK  88
           AAIASYLP+RTDNDIKNYWNTHLKKKL+K
Sbjct  14  AAIASYLPERTDNDIKNYWNTHLKKKLEK  42



>ref|XP_006390404.1| hypothetical protein EUTSA_v10019477mg, partial [Eutrema salsugineum]
 gb|ESQ27690.1| hypothetical protein EUTSA_v10019477mg, partial [Eutrema salsugineum]
Length=327

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/28 (100%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLK  85
            AAIASYLPQRTDNDIKNYWNTHLKKKLK
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLK  117



>ref|XP_003543783.1| PREDICTED: myb-related protein 306 [Glycine max]
Length=333

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMG  127
            AAIA+YLPQRTDNDIKNYWNT+LKKKL KL++ GS+    +G
Sbjct  90   AAIAAYLPQRTDNDIKNYWNTYLKKKLNKLEA-GSDQGHNIG  130



>ref|XP_002306049.2| hypothetical protein POPTR_0004s12530g [Populus trichocarpa]
 gb|EEE86560.2| hypothetical protein POPTR_0004s12530g [Populus trichocarpa]
Length=354

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 1/32 (3%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            AAIASYLPQRTDNDIKNYWNTHL KKLKKLQ+
Sbjct  134  AAIASYLPQRTDNDIKNYWNTHL-KKLKKLQA  164



>gb|KHN13225.1| Myb-related protein 306 [Glycine soja]
Length=333

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMG  127
            AAIA+YLPQRTDNDIKNYWNT+LKKKL KL++ GS+    +G
Sbjct  90   AAIAAYLPQRTDNDIKNYWNTYLKKKLNKLEA-GSDQGHNIG  130



>gb|AFH03056.1| R2R3-MYB transcription factor MYB4 [Epimedium sagittatum]
Length=355

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS  97
            A+IASYLPQRTDNDIKN+WNTHLKKK+ K QS
Sbjct  106  ASIASYLPQRTDNDIKNHWNTHLKKKINKFQS  137



>ref|XP_010550057.1| PREDICTED: myb-related protein 306-like [Tarenaya hassleriana]
Length=273

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 2/37 (5%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSEN  112
            AAIASYLPQRTDND+KNYWNTHLKKKL  ++  GSE+
Sbjct  89   AAIASYLPQRTDNDVKNYWNTHLKKKL--MKRVGSES  123



>emb|CBI22219.3| unnamed protein product [Vitis vinifera]
Length=307

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 100/207 (48%), Gaps = 24/207 (12%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSPGSENNAQMGSENSPTSATSYHHHHHL-  178
            AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQ+  S +        +  S +       L 
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQTGSSSDGHSRDVSLASQSISRGQWERRLQ  149

Query  179  ----VSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGG  346
                ++K +  +   +    +S YASS ENI+RLLEGWMR S   + +   TT  S    
Sbjct  150  TDIHMAKQALHEALSLEKPHTSSYASSTENIARLLEGWMRNSPKQARASSATTQNSFINT  209

Query  347  ReeeeeeDDQNRPEAAAGGGLAGSNDDNNGVIPKEEYLDSILTFGSLMNGMESGNNKQN-  523
                +    +  P AA           NN  I   E  + +  F SL +     +  ++ 
Sbjct  210  -AGTDSTSSEGTPSAA-----------NNEDIELTEAYEMLFGFDSLDSSNSEISQSKSP  257

Query  524  ----VQEGNDND--NPPPLSFLEKWLL  586
                 QE +  D  +  PLSFLEKWL 
Sbjct  258  EASFFQEESKPDLSDQVPLSFLEKWLF  284



>ref|XP_009405155.1| PREDICTED: myb-related protein 306-like [Musa acuminata subsp. 
malaccensis]
Length=279

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKK  88
            AAIASYLP+RTDNDIKNYWNTHLKKK++K
Sbjct  90   AAIASYLPERTDNDIKNYWNTHLKKKVRK  118



>gb|AHN60123.1| MYB transcription factor 30 [Brassica napus]
Length=328

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKK  88
            AAIASYLPQRTDNDIKNYWNTHLKKKL K
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNK  118



>emb|CDY04044.1| BnaC02g37590D [Brassica napus]
Length=314

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKK  88
            AAIASYLPQRTDNDIKNYWNTHLKKKL K
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNK  118



>ref|XP_011015034.1| PREDICTED: myb-related protein 306-like [Populus euphratica]
Length=325

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 85/226 (38%), Positives = 115/226 (51%), Gaps = 39/226 (17%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS---PGSENNAQMGSENSPTSATSYHHHH  172
            AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQS   P ++++ +  S+    S        
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLKKLQSAWDPMAQDSTR--SQFISKSFNDRKSLD  147

Query  173  HLVSKNSFTDRPQIatsssslyassaenisRLLEGWMRAsssssssKGLTTATSHGGGRe  352
            +  + +S   RP      +S YASS ENISRLLEGWMR+S   +SS  L           
Sbjct  148  NFTTNSSSALRPN----PASTYASSTENISRLLEGWMRSSPKPNSSNFLLKENRE--QEN  201

Query  353  eeeeeDDQNRPEAAAGGGLAG---SNDDNNGVIPKEEYLDSILTFGSL------MNGMES  505
              +E +D +   + A   L       +  +G +   E  +SIL+  SL       +  +S
Sbjct  202  NSQENNDHDITNSVAINYLQSYKEKREQESGDLISHEEFESILSLESLHYVAWDKSCCDS  261

Query  506  G----------------NNKQN---VQEGNDNDNPPPLSFLEKWLL  586
            G                + K+N   ++    +++ PPLSFLEKWLL
Sbjct  262  GTVTTTTTTKGFQNSASDEKENMTMIERKQKSESTPPLSFLEKWLL  307



>emb|CDX86405.1| BnaA06g31220D [Brassica napus]
Length=333

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKK  88
            AAIASYLPQRTDNDIKNYWNTHLKKKL K
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNK  118



>ref|XP_006395328.1| hypothetical protein EUTSA_v10004538mg [Eutrema salsugineum]
 dbj|BAJ34042.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ32614.1| hypothetical protein EUTSA_v10004538mg [Eutrema salsugineum]
Length=337

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKK  88
            AAIASYLPQRTDNDIKNYWNTHLKKKL K
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNK  118



>emb|CDX86406.1| BnaA06g31230D [Brassica napus]
Length=333

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  2    AAIASYLPQRTDNDIKNYWNTHLKKKLKK  88
            AAIASYLPQRTDNDIKNYWNTHLKKKL K
Sbjct  90   AAIASYLPQRTDNDIKNYWNTHLKKKLNK  118



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2689904046432